2H8PC

Structure of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB heavy chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2h8pC00
3ASOC 3ABLC 4G27B 1JVMA 2WLKA 1BL8A 4LP8A 4MTFA 4XDKA 3SPGA 4LCUC 2DWEC 3K04A 1M56C 1G4YB 2WLMA 2EINC 4MVSA 3OR7C 3OUFA 2X6BA 4QE7A 3SPIA 2AHYA 3SYOA 4GX1A 3E8FA 4GX5A 5EBLC 4F4LA 4MVQA 4XDLA 4R8CA 2DYSC 3ABMC 3IFXA 3R65A 4ZBMA 3SPHA 3OGCC 4X88A 3FB5C 4HZ3A 3T1CA 3F5WC 4RUEA 5EBWC 3TETA 1OCRC 2WLNA 2IH1C 3K0GA 3LDEA 2HVJC 3T2MA 2Y69C 4XDJA 2BOCC 3K06A 1ORQC 2WLHA 4MS2A 1M57C 4EKWA 2P7TC 1OCZC 1J95A 2Q69A 1OCOC 1QLEC 2OCCC 3SYCA 2WLIB 4MTGA 4MW3A 4TWKA 4PDMA 3RW0A 2X6AA 2R9RB 3HPLC 3ZJZA 2A79B 2A0LA 2DWDC 3E8GA 5EC2C 2EIMC 4MSWC 4MVOA 1R3LC 4DXWA 3TCUA 2HFEC 2QKSA 4MVMA 4P9PA 2EIKC 4PDRA 4MW8A 3K03A 3SPCA 2JK5C 2KB1A 2QTOA 2WLIA 3E8HA 4LBEC 5E1AC 1OCCC 5KUMA 3E86A 3FB6C 3JYCA 4WFHA 3SPJA 3PJSK 1ZWIC 1XL6A 5B1BC 2HVKC 3AG2C 4MVZA 2X6CA 3KG2A 3FB7C 3LUTB 4PA9A 1KKDA 4R6ZA 4PA6A 3SJQC 4CBCA 2Q6AA 1XL4A 4X89A 1K4CC 2K1EA 1V54C 4UUJC 2Q68A 4HYOA 5IY5C 4P2ZA 3AG1C 3LDDA 1K4DC 4MTOA 4BW5A 3STZC 1LNQA 4PA4A 2EILC 5EK0A 5B3SC 2A9HA 4JTCB 1R3KC 4X8AA 3K0DA 2AHZA 2H8PC 3STLC 3ZRSA 4MVRA 4KFMA 2ITDC 4J9YB 3RVYA 4P9OA 5J9PC 4PDVA 3E83A 2IH3C 2WLLB 3IGAC 4I9WA 3K08A 3BEHA 4JTDB 2HG5C 4G28B 3AG3C 4MVUA 3OUSA 4QE9A 4WFGA 3VOUA 4PA7A 4RUFA 2BOBC 4JTAB 3ASNC 3LDCA 5EC1C 5B1AC 3AG4C 2ATKC 5CBHA 3E8BA 5KUKA 3E89A 2WLLA 4J9ZB 4RAIA 4WFEA 3SYAA 2ZD9A 3OR6C 4H37A 3SYPA 5CBFA 4GX0A 1S5HC 3T4DA 3UKMA 2WLJA 3UM7A 1R3IC 3T4ZA 2W0FC 2DYRC 3SYQA 4R50A 1R3JC 2YEVA 1V55C 3GB7C 3WG7C 2EIJC 5EBMC 4PA3A 3RBZA 2ZXWC 4GX2A 4QNHB 1P7BA 4OXSA 4WFFA 5BZBA 2ITCC 3FB8C 2HJFC 4P30A 3F7VC 4RO2A 5CBGA 3RVZA 3F7YC 3LNMB 3X2QC 3EFFK 4PDLA 2Q67A 4R7CA 4H33A 3ABKC 2NLJC
chains in the Genus database with same CATH superfamily
1MG1A 4MTFA 2UUCO 5CB4A 3U10A 1O9GA 4UB6Z 1I5XA 5LHHA 1GTOA 2K9PA 1KU9A 1VQPV 2Y4UA 2EIMB 2CH7A 3UCSC 4JF3A 5B1OA 4B3TB 1YDXA 2QM7A 3K0GA 3G67A 3L71H 3CE2A 2Q69A 5FNVB 3CCRV 2PTMA 1LUVA 2ZINA 5J2TA 4W4KA 1R3LC 1SZTA 1RFYA 5BR8B 3SPCA 4MW8A 2OCHA 1KBHA 3JD0A 2UXBB 4YJ2A 1NU1H 2GUZB 4JI5B 3SPJA 3PJSK 2LP7A 2ZNJA 4GLXA 2YIBD 3G80A 4F6EA 1MA1A 5K1XA 1QQCA 1QU7A 1WB7A 1VQ6V 4ZI7A 5EK0A 5IDJA 1MMMA 1SQQH 1ZAUA 2OYQA 1WP8A 2EINB 4MVRA 4KFMA 4YHHO 2DE0X 2ZR3A 4CS3A 4CS2A 3CB2A 1P4RA 1XHZA 5EIBC 4DUZB 1JFFA 3ZS8C 4O4LB 1NBMG 4I5SA 3QNEA 4Q6GA 1OCZB 2JVDA 3CXCU 5KA5A 2QM8A 3OEEG 1R3JC 4DV4B 2ZKOA 1K5QA 1L0NH 4GX2A 2XT9A 3AK2A 3SJAC 4UCTA 3BFRA 4WBNA 3ZMTA 2UU9B 2Q67A 2Y4TA 1XREA 1P49A 2GBOA 1QLEB 1KQSU 3SJCC 1K3EA 1D5AA 2WAMA 4DV7O 3B4SA 4J7JA 1ZTEA 4ZBMA 4Z1VA 1SQVH 1AJQA 5GONB 4NXNO 4GKKO 1PNMA 1M57C 1N32B 1AI5A 2Z5UA 3HKBA 3AG7A 1J5EB 3BA9A 3HKEB 5L3BA 4NVPA 2EIKC 4B3RO 2YI8A 3FB6C 4PI0A 1BGYH 1ZWIC 1KKDA 4W4LA 2QM4A 1K33A 4I55B 5BY1A 1NH2D 3RN4A 3RYFB 2RDCA 2RN9A 4HYOA 5CA1A 1I94B 1E1RG 2V7QG 4D7TA 4MT8A 1IBLB 1Q6IA 4UCOA 5IE9A 2VWJA 2FKXA 4I50A 1DTOA 4ZOLA 2WA4A 3E83A 1GN4A 3H1IH 1CPYA 1B6QA 3OUSA 2XAFA 3QF7A 1XI1A 3CX5F 2GV9A 2A3QA 3ASNC 5KUKA 3AG4C 5H9CA 2GUZA 2WLLA 3SYAA 2Y0PA 1SA0A 1R73A 4QIWF 1Q90D 1DGSA 4B3MO 1THZA 3K57A 3N2KB 2B9ZA 1ZL8B 1WJZA 4N23A 1EM1A 1YITV 1NS1A 1Q82W 5B1BB 5JCOC 5KHHA 1QVGU 1YTFD 1VF6C 1X4TA 2JGUA 2F95B 1I0HA 3B8NA 3FKSG 2VQEB 2UUAB 4TV9A 3D3QA 1PPJH 3K04A 3FYEB 1O9HA 4H0LB 3T1HB 5LP6B 4LF7B 1AP5A 5IYBO 5LL6Y 1QR8A 3CC7V 4LFBO 1AI6A 4IYIA 5KX5A 3BRCA 2E5LB 2PI5A 2BE3A 1XNRB 1K7DA 1FPOA 4X64O 4UFZA 1OCOC 1NZ6A 1Q8IA 1AILA 4OGQB 1TGOA 3DTUB 4PV1B 4DUYO 4YY3O 3TCUA 2EILB 2ZM6O 1JX9A 1SQFA 3D36C 2QTOA 2WLIA 2WPDG 1TVKB 4XBFA 4NXMB 2C2AA 1GM7A 1DK1A 2GSMB 4PA9A 4AHCA 4R6ZA 4GT1A 2UXNA 4NR1A 1XL4A 3OM3B 1FXKB 1K4CC 1PNKA 1BZKA 3AG1C 5IYZA 5D5PA 5GONA 4K0KO 4JTCB 4WF9V 4DK1A 4TOIA 1AP6A 2GTAA 2VQFB 3M8AA 1N33B 1VQLV 1N34O 5H2FZ 2YXLA 3HKEA 2FL4A 4PA7A 2DQ0A 4JTAB 1U97A 3ETGA 4DRXB 4BIOA 2BTOA 3CRMA 2P06A 4DV5B 2A7WA 4LF6B 1IURA 4JASA 2OCCB 1V9PA 4OPHA 1WPXA 4EB6A 3KZIZ 1P7BA 3RYIA 3DXRA 3I56V 1VQ5V 4DR1B 2DJVA 5CA0A 2FB5A 3FAVA 3WB2A 1KC8W 3G4SV 1JVMA 4LCUC 1FFXA 1VF5B 4LF9O 3SPIA 4GX1A 2LFSA 4F4LA 4AILC 3LSUA 3GWOA 4FVMA 2IJKA 1K97A 1SKVA 2Q0AA 3CCEV 4QGPA 1K73W 1PNLA 4D6TH 4O4IA 3CCJV 4MS2A 3N2GB 3D3IA 4LFCO 1NTZH 3HKDB 1Q3EA 3BY6A 5HFLA 2YXYA 4CC5A 5LGTA 4AQYB 2JK5C 4GYCB 3E8HA 2XNDG 3IAYA 2LFRA 5CN0A 4B7KA 4FLTA 3M99B 5C93A 2Z0AA 4UV8A 5F2VO 3ML0A 5B5EZ 2Z3YA 4JV5O 4JYAB 4H44B 4X89A 2K1EA 1JA8A 2Q8VA 1K5SA 2UXDO 1K4DC 3IJ4A 4K35A 3ZIAG 1Y74B 2ITDC 3QG5A 2Y0IA 1M9NA 1GMGA 2H94A 4DR2O 2YXHA 2F93B 4G28B 2YS8A 1NT2B 3ETDA 4KHPO 3LDCA 1YIJV 2N04A 2XAQA 3OTOO 3ABUA 3ZN0A 1G6UA 4PHZA 3K5MA 3UM7A 5LMUO 3BCCH 1DF4A 4X1IB 2JGDB 1FXKA 1P84F 1HWYA 3JARB 1VIBA 2XASA 1A32A 1Q6HA 2UUCB 4FLYA 2P4KA 4DR7B 4RO2A 3AG2B 2ZE8A 3CRQA 4GZRB 4WCEV 4DV2O 4FK5C 1GRJA 1X59A 1N0JA 3ABKC 1MNGA 3T1YB 2CH7B 5KMGA 2DWEC 2IW5A 5A9GA 1WP7A 2B5UA 3CCMV 4U7OA 4GX5A 4FPPA 4R8CA 3FX7A 4BW9A 1P7GA 1DLBA 3OEHG 1YXBA 4LFAO 4RUEA 5EBWC 1YSCA 3GVMA 1K8AW 3Q4HA 2CGNA 5J2TB 3NXSA 2P7TC 2P22C 1YHQV 4YJ2B 2BTQA 2XHBA 2EIMC 4MSWC 2AW9A 2OT5A 4TQDA 3K03A 4UCSA 3O65A 2E74B 1SETA 4TV8A 3K9SA 4ZI7B 5JH7A 2ODMA 1NKDA 2PGGA 3LNNA 5B1AB 4YHHB 1KB9F 2JEXA 4DR6O 4BW5A 2EBOA 5L3FA 3ICXA 1JFFB 1AVMA 1VF6A 1XQ8A 2G38A 4AI8A 3EVKA 3HKDA 4LH6A 5IWAO 1R6NA 5JQGA 3E22B 1NR7A 4QE9A 1K9MW 5IJ9A 4DYLA 1XMOO 1VQMV 4J41A 2PYLA 1YI2V 2H3OA 2YEVA 4JI6O 4WBNB 2D3OW 1Y76A 4PA3A 4ASUG 1Q6UA 4JYYA 1VQOV 4QNHB 3C3TA 3ABMB 1HR0O 1HP8A 2CUGA 4D7SA 5BZBA 1ZLZA 4GKJO 5CBGA 4JI8O 4DV6O 1BHBA 2Q73A 1SF9A 4DV7B 1FJGO 3BVOA 5CA3A 1KD1W 1BSMA 2QKCA 4JPRA 3ZRWA 3E8FA 4NXNB 1TUEB 2DQ3A 5FL7G 1Q7YW 5GTIZ 5KHJA 1G8MA 1VMGA 3AG3B 2R72A 1CP9A 1FS0G 1YJWV 4B3RB 1QLEC 3LSSA 3DC6A 1M90W 3ZRVA 2AZ0A 5B3SB 2OTJV 4LH7A 5DN6G 1LUWA 5CA1B 3LUTB 3KG2A 1EN6A 5LHIA 2ADPA 2VWKA 4O4JB 4I50B 4B7EA 4ZOLB 4CZZA 2DMXA 2LJ2A 3I55V 1EFRG 3QO5A 1IBKO 1M4UA 5EYPB 3ZRSA 3RVYA 4P9OA 4PDVA 3CPWU 4TSFG 1IXBA 2WLLB 3IGAC 4NKGB 3HB3B 2M6YA 4JZGA 1SA0B 2ZXWB 4B3MB 4TUYA 2ATKC 4ZHQB 3E8BA 2XUMA 1XMQO 4RAIA 3ASOB 4GX0A 1Y67A 4TT3G 3CXHF 4R50A 4UVAA 2N74A 1V55C 2EIJC 2CE4A 2YUAA 3VQWA 4TV9B 4WFFA 3F7VC 2JEUA 2YIDA 3AK3A 3TK1A 5LXTA 1OCRB 2BSKA 1JPXA 2NLJC 3E22A 3P30A 5DECA 4LFBB 5KX5B 3C90A 4MVSA 1JQ0A 3P3NA 2UXCO 4LF5B 3IFXA 2ZNIA 5C8YB 4X64B 1MOFA 3OT7A 4X88A 1GK9A 1WNSA 1E79G 2CTPA 3W7TA 4RWUA 4DUYB 4FZ1A 3A0RA 2Q7HA 2ZM6B 3M7MX 3ZHSA 2WLIB 4MTGA 1R1BA 2A0LA 3BPZA 1GKFA 2RJZA 3EHBB 4DR5O 2KB1A 1KMIZ 3HKCB 2F4VO 1Z2GA 3G6BA 3RWRD 5L3GA 1S77D 5IYZB 5FPRA 4LC1A 3FYIB 3QVNA 3ZHRA 1Q43A 1H8EG 1W0JG 4JI2O 2EILC 1N34B 2VRZA 1B3QA 1YF2A 3ZHTA 2YSUB 2P90A 3L70H 1HNZO 2RCVA 3JATA 3CRCA 3B2EE 2ZD9A 5EZYA 4EB6B 1IX9A 2WA3A 3H1JH 1S5HC 3T4DA 1S5LZ 2OIGA 1W0KG 5LMNO 1PL4A 3RYIB 4DV0B 3DXRB 1HDJA 1TA8A 5CA0B 4O4JA 4BIUA 3FAVB 2DYSB 3CCSV 4NTWA 2HJFC 3L72H 4UV9A 3D8CA 5EYPA 1HNWB 3F7YC 1Q81W 1FFXB 4H33A 2LGQA 3L74H 1TUBA 4LF4O 1FAFA 1L8DA 4XDKA 1G4YB 3ZBHA 2ADQB 4ZHQA 2QKAA 4JI7B 2PZSA 4O4IB 3K3WA 3SPHA 3OGCC 3RYCA 2IBZH 2JJ1G 1OCCB 4HZ3A 3F5WC 1EBOA 3B77A 2IH1C 3BABA 4JI0O 2UXBO 2F66C 4EFEA 3JASA 4E2LA 3JD3A 4YIOA 1NVPB 1EZJA 2DWDC 5EC2C 4DV3O 4DV1O 3K5OA 4DXWA 4JV5B 4P9PA 1H2LA 5IY5C 5KUMA 3U0ZA 1CEZA 3JYCA 4FLVA 2UXDB 4LF8B 3WB1A 2QR4A 3C3SA 2CDYA 1CXZB 5C8YA 2XAJA 1XUQA 1SRYA 3L9DA 3RYHA 3G6EV 2QTSA 3A0BZ 2XAGA 4JI1B 1WN7A 5JVDA 1JJOA 3CWBH 3WG7B 3OE7G 2UXXA 1GN2A 4RUFA 5LMUB 1GN6A 3E89A 3HKCA 4Z1MG 2P5OA 1YVWA 1BE3H 3T4ZA 5LOVA 2AGAA 5K1PA 2EIKB 4DV2B 4WFBV 3K9AA 5KHGA 5KMGB 1R6KA 3LNMB 4U3FH 2LGWA 4UB8Z 4IIJA 2ILMA 5JJEB 3CC2V 2HLDG 1W59A 4LFAB 3BHPA 3OUFA 4U3JA 1KUQA 3Q4HB 3ZMVA 3R65A 5FLXN 3SDLA 2F43G 2RNBA 2LO1A 3LDEA 2OIEA 2HEPA 2Y69C 2BTQB 1ORQC 2Q5ZA 3ASNB 1ROPA 3NR7A 3THOA 3S3WA 1UJWB 3RW0A 4JGSA 1R6TA 1FXHA 2QKSA 5LYJA 4TV8B 2JDIG 1I94O 5E1AC 5JH7B 3ZHUA 1IBLO 4HNAA 3MHHC 1YCIA 1N36O 2QEXV 4FM2A 1SC5B 4DR6B 2X6CA 3W7XA 4I0XA 4JI4O 1EZVH 1IVSA 2HHHO 5IWAB 2EJRA 5L3CA 1B04A 5JQGB 1VF7A 1HNXB 2ZT9B 3RGBA 4UVBA 2HR3A 5FPOA 4BAYA 5IJ9B 2EX3A 1F4NA 4O2AA 1XMOB 3K08A 3BEHA 5IYCO 3E35A 3L73H 4FJCC 5B1AC 1SQGA 5BMVB 3JCZA 3CCQV 2NNUA 4ICGA 2QWOB 2YEVB 4HBNA 1Y76B 1QLNA 1AR4A 3ABLB 2WSSG 1HR0B 2DYRC 3SYQA 1M56B 1XOUA 2ETNA 2HJDA 2UUAO 4JI8B 4DV6B 4LWSA 2IJHA 1FJGB 4NTXA 1NI8A 3DSQA 1GN3A 4LF7O 1AR1B 3A8TA 5ITZA 4FLUA 1Z5VA 3ZRWB 4I4TA 1PV0A 3SPGA 3AG1B 1JR9A 3HR0A 3SYOA 4QE7A 4XDLA 3ABMC 1Z5WA 1VQKV 3OTFA 2QGNA 4ABMA 4NXMO 4JZ2A 4EKWA 3JAKA 1J95A 2Q4PA 1V54B 2X6AA 5CMUA 4Z2WA 4B3SO 2BCCH 2EULA 5KHKA 3F5TA 1MSWD 1SS3A 3BA8A 1F23A 4B08A 3CD6V 3E86A 2HKOA 4PELA 4WFAV 3JALB 4MVZA 3FB7C 1WA8A 4O4HA 3K79A 3CYOA 1IBMO 1GM8A 2XOKG 2YIBA 1MZEA 1IBKB 4IHJA 4CBCA 2M7WA 5LA6A 3H1LH 5LBQA 2KG7B 5H5NA 1H2GA 2W6JG 4FIPC 3ZEDA 2JRIA 5B3SC 4RQFA 1ZX3A 5JJNB 2KQXA 1VQ8V 3STLC 4DV5O 3R66A 4TUYB 2PI4A 1AI4A 3UO2A 1XMQB 3S3XA 2XTAA 1SESA 4UVCA 4PD4F 5CBHA 3B09A 1FKAO 1AR5A 1YZBA 4H37A 5CBFA 1RP3B 5JCOA 3WFVA 3FD9A 1IXMA 1XHXA 3UQ8A 5LXTB 4X1YA 2BSKB 2ZXWC 4J11A 3CJHA 1L0LH 3RVZA 1US6A 2UXCB 4JI3O 3ASOC 4G27B 2IJIA 3ZHVA 1EN5A 1VP7A 2R9AA 2Y48A 1FYJA 4CH3A 2EINC 5BMVA 3A0HZ 3CP1A 2W6IG 4I9QA 5DEDA 1T5EA 2Q7EA 2FTKA 1KP3A 3T1CA 1H2SB 3TETA 1OCRC 1DF5A 2JJ2G 4BR6A 2WLHA 3D36A 3AK1A 3OD4A 1OCZC 5DM6V 4TWKA 1TAEA 4PDMA 2R9IA 2F4VB 4JYAO 2R9RB 1BCCH 4N21A 4O2BA 1RM1B 4UXNA 2GDSA 1F7YA 4J7KA 4GKKB 2QE7G 1WB8A 1NVPD 4X1KA 5IJ0B 1JMKC 4DW1A 4JI2B 2CTRA 3UT5B 2Q6AA 3BAAA 4FFKA 4CH5A 1XILA 4G2KA 3VQYA 1LNQA 4PA4A 1COWG 2A9HA 4X8AA 5H6RA 1SERA 1XNQO 3JATB 1GAXA 4DK0A 2V1DA 1AJNA 2IH3C 1MZFA 2W0XA 3ZMZA 5EZYB 4MVUA 4ZIBA 5LMNB 1G1XB 1WLEA 3X2QB 1QVFU 2EZPA 3OR6C 3JALA 4DR7O 2E76B 3VQXA 2RMKB 3T1YO 2FYUH 5L3DA 2KG7A 1NR1A 3U11A 2ZCEA 4LF4B 4X62O 1TUBB 4P30A 5KLVH 2NN4A 2P4VA 1H2NA 4UCRA 4GCZA 1BQ0A 4DR4O 3I5DA 1OHHG 2WLKA 3JAWA 1Y4MA 4OX9O 3RYCB 2X6BA 1IZ3A 4E4EA 2AHYA 4JI0B 4MVQA 2DYSC 4EEQA 5LHGA 3CCVV 3JASB 1AJPA 2QWQB 1AROP 2WLNA 4F6RB 2LW1A 4XDJA 4DV3B 2BOCC 4DV1B 1M1KW 1I5YA 2ZDIC 4X65O 1OZ0A 3DGEA 3ZRXA 5GW7A 2PYJA 1H8HG 4FFBA 3MAQA 2O57A 4LBEC 4IL6Z 1OCCC 4ZKIA 4NB5A 4X66O 2XAHA 5B1BC 4A5UB 3TXSA 3OMAB 1AI7A 2DOSA 4OPAA 1GO3F 3RYHB 4DR3O 3ETEA 3K5LA 1JJ2U 4YY3B 2EJ7A 4UUJC 4UCUA 4P2ZA 5JVDB 3STZC 2UUBO 4BIZA 3K0DA 5LP6C 3CMAV 1FXVA 3N27A 1KYOF 1VQ7V 3P32A 4FLXA 1PKXA 1NJIW 4X20A 1L1FA 4I9WA 5TISZ 3WU2Z 4JTDB 4EFBA 3SJBC 3VOUA 1LR1A 3PN1A 4K0KB 3JSLA 3K5NA 5LOVB 4WFEA 2ZE7A 5IJ0A 1UPGA 4NTYA 3CC4V 2A06H 3OGIB 3UT5A 3K59A 4FM0A 3B40A 3MDSA 1BQZA 1IDSA 3GB7C 3WG7C 5EBMC 4IIJB 3OMNB 1S72V 2IU3A 1SQBH 2YICA 2ZE5A 3RFRA 1FXKC 2B1IA 1H2KA 1NQTA 4U3JB 3CCLV 4J7ZA 5BXZA 4LNUA 1AB3A 1YJ9V 5KHIA 2CK3G 2Q9LA 3ZX6A 4QJFB 1N4CA 2ZIOA 3JD2A 4FMTA 1S76D 4Q20A 2KKWA 1KECA 3OMIB 1UFIA 4YXWG 4LF9B 1PD3A 5LYJB 2FMLA 4B3TO 2OCCC 3OAAG 3HPLC 2A79B 4HNAB 1N36B 1JCHA 3RT3C 4JI4B 4I0XB 4MVMA 5FNVA 3E2EA 3JD1A 2CAZC 1V55B 2HHHB 2EIJB 4I7ZB 1MABG 4LFCB 3W7UA 1B06A 1VQ9V 4J42A 5BR8O 1H38A 1H2MA 3CRRA 4C7UA 1XBLA 4JI5O 3ZMUA 1BHAA 1RPOA 4MTOA 3VBBA 2DW4A 4DO2A 4F6RA 5IT9N 4O2AB 1R3KC 5A2QN 2H8PC 4J9YB 5J9PC 1Y66A 5JJJB 1WPBA 4U7NA 4WFGA 2IJJA 4GUNA 2P67A 1SZXA 2PY5A 4J80A 5HFMA 3H1HH 4O4LA 4DUZO 4LWSB 4DR2B 3JD4A 5ITZB 3WB0A 4KHPB 3OTOB 1PP9H 4OXSA 4I4TB 3H1KH 4DV4O 4LF5O 2ZIMA 3ABLC 5KAFZ 1RPRA 1M57B 2GTSA 1M56C 1F4MA 5LGUA 2UU9O 1BMFG 5B1NA 1Y6XA 2PUSA 4CS4A 5EBLC 3J81N 4JAUA 4JAAA 2OWOA 1BS3A 1OJHA 1I08A 3JAKB 2YDEA 1NTMH 2E75B 4QPJA 3ZMSA 4B3SB 2HVJC 3T2MA 3K06A 1W2BU 4K3AA 1VQNV 3UO3A 3OFNG 3MHSC 3IC7A 4MW3A 1S3JA 1VEWA 4MVOA 1WA8B 4O4HB 5L3EA 1IBMB 4PDRA 1N32O 2ZQMA 4IHJB 5LA6B 4WFHA 4NYKA 1J5EO 2HVKC 3AG2C 2NR5A 3JCUZ 1VARA 3KCXA 1QCEA 3O9OA 1V54C 2L6LA 1D5NA 1SQPH 2V4DA 3AG4B 4I55A 3LDDA 2E3CA 4X9QA 1YEWA 2IM9A 2AHZA 2EZOA 2N05A 2VS0A 3RYFA 1N8RW 1JOYA 5LGNA 1ZUQA 3APOA 2MW2B 2ZR2A 1N0NA 1BT8A 4UCVA 1I7FA 3CS5A 4DV0O 4FLZA 4HAMA 4L87A 4CH4A 5EC1C 1U96A 4FM1A 5KA6A 4IYHA 1HNWO 4MTXA 4X1YB 3UKMA 3CEIA 1R3IC 2Q7GA 2JS5A 4H13B 2W0FC 3JAMN 2F1MA 2ARHA 3CJHB 1Q86W 2ZDIA 1QBZA 2QJ1A 5IY5B 4JI3B 1URFA 2AZ2A 3FB8C 4JI7O 3J7AU 3N2KA 1ZL8A 3EFFK 1QHTA 4J10A 4JI6B 1ZSPA 2LW7A 1BL8A 4LP8A 1OCOB 2WLMA 3ZN1A 3G71V 4GKJB 2VQEO 2Q0OC 1FD9A 2DN9A 1OV9A 2JS3A 5LP6A 3T1HO 2D2CB 4KXRA 4O2BB 3A2FA 5KAIZ 4LF8O 5J2UB 2E5LO 4X1KB 3SGIA 3DC5A 3GWKC 3W7WA 1XNRO 3FFQA 3W7SA 1NH2B 1S5JA 1VQ4V 4JI1O 5E79Z 1XL6A 3CRAA 3SJQC 3OW2U 1TVKA 2B1GA 1XNQB 3H01A 3K58A 2F23A 5JWPA 1RM1C 5IYDO 3QO8A 4YIPA 4YJ3B 1SQXH 2YC0A 3TXQA 1RSOB 1KKCA 3H9VA 2L35A 1MSDA 5CB4B 2HG5C 4IT5A 3AG3C 2BOBC 4JYBA 3J80N 3ABTA 2Y69B 4KUMA 2VQFO 1F51A 1N33O 1XDCA 3KCYA 3SYPA 4RQEA 2QA4V 2YIAA 4X62B 2CGOA 2WLJA 4DRXA 4IGGA 4LF6O 3RBZA 3L75H 1YTFB 1Q5OA 5AG2A 4TQFA 4DR4B 3KKYA 2ZE6A 2ITCC 2MK3A 3JAWB 3CMEV 1QR9A 3TGUH 4OX9B 3X2QC 1K34A 2YI9A 4R7CA 2OTLV 2P6JA 2IU0A 2JIZG 3CCUV 1PM9A 3MD0A 4DR1O 2LQTA 3OR7C 4JAVA 2X7RB 1K92A 4K8ZA 3FB5C 4X65B 2QWPB 3APQA 1HW7A 1YJNV 2QWRB 4PI2A 4CH6A 4FFBB 4CC6A 3SYCA 3CHXA 3CSXA 4X66B 3ZJZA 3E8GA 4KP4A 1D2DA 2RQ6A 3N2GA 2HFEC 1PL0A 4DR3B 1WAZA 2DYRB 3QO7A 4FLWA 3QTCA 4DW0A 3ETQA 1HNXO 3IC9A 1QNMA 2QWNB 2UUBB 4PA6A 4AQYO 3ZCCA 2X0LA 2QDOA 2Q68A 2R70A 3B8MA 4DR5B 4JYCA 5EIBD 4X20B 4QPKA 2QSAA 4PJ0Z 3ZHQA 5B66Z 5GTHZ 3EXAA 5H6QA 1E1QG 5J2UA 1M5IA 2HP8A 1Y74A 2AXTZ 1S0VA 3SR2C 4BWAA 2PF4E 4J9ZB 4L8JA 3VQVA 1NTKH 3P3PA 3ABKB 4KL1A 4LR3A 2KSDA 3TJTA 1HNZB 3LSQA 2CTWA 4FZ0A 1GH6A 1M93A 1EN4A 2CTQA 1KP2A 1ENVA 2GHYA 2WWWA 4K8XA 1FFTB 4X1IA 2JGDA 5D5QA 4LNUB 1GM9A 3HKBB 1XEQA 4YJ3A 4PDLA 3JARA 3JSNA 3AEIA 1RSOA
chains in the Genus database with same CATH topology
1MG1A 4MTFA 3CC2V 2HLDG 2DWEC 1YJ9V 2IW5A 1I5XA 2CK3G 5LHHA 1GTOA 2B5UA 3OUFA 4QJFB 3CCMV 1VQPV 4U7OA 4GX5A 2EIMB 3JD2A 4FPPA 4R8CA 3ZMVA 3R65A 4FMTA 4JF3A 1S76D 5B1OA 4Q20A 1DLBA 3OEHG 2F43G 4RUEA 5EBWC 1KECA 2QM7A 1YSCA 3K0GA 3OMIB 3LDEA 1K8AW 2Y69C 1ORQC 3NXSA 3ASNB 4YXWG 2P7TC 1PD3A 1ROPA 2Q69A 2OCCC 1UJWB 3OAAG 3RW0A 4JGSA 3CCRV 1YHQV 3HPLC 2A79B 1JCHA 2EIMC 1FXHA 4MSWC 1R3LC 1SZTA 2QKSA 4MVMA 2OT5A 2JDIG 4MW8A 3K03A 3SPCA 5E1AC 3E2EA 3JD1A 3JD0A 1V55B 2EIJB 3SPJA 1MABG 3MHHC 3PJSK 2QEXV 2LP7A 3W7UA 2X6CA 3W7XA 1VQ9V 1SETA 1H38A 1NKDA 5B1AB 3ZMUA 1BHAA 2JEXA 1RPOA 4MTOA 4BW5A 2EJRA 5L3CA 2EBOA 5L3FA 1VQ6V 3VBBA 2DW4A 4DO2A 5EK0A 1R3KC 5IDJA 2H8PC 2EINB 4MVRA 4KFMA 4J9YB 4UVBA 2HR3A 2ZR3A 4BAYA 5J9PC 1F4NA 1R6NA 1Y66A 1P4RA 3K08A 3BEHA 4U7NA 1NR7A 4QE9A 2IJJA 1NBMG 3E35A 4WFGA 5IYCO 4FJCC 1K9MW 2P67A 5B1AC 3JCZA 3CCQV 4I5SA 2NNUA 3QNEA 2YEVB 5HFMA 1OCZB 1QLNA 1VQMV 3ABLB 3CXCU 5KA5A 2WSSG 2QM8A 3OEEG 2DYRC 3SYQA 1YI2V 1M56B 1R3JC 2YEVA 2D3OW 1K5QA 3JD4A 4PA3A 4ASUG 1VQOV 4GX2A 4QNHB 4OXSA 3ABMB 2IJHA 5BZBA 5CBGA 3ZMTA 1AR1B 2Q67A 1BHBA 3ZRWB 3ABLC 1RPRA 1M57B 3SPGA 5CA3A 1KD1W 3AG1B 1QLEB 1M56C 1KQSU 1F4MA 5LGUA 1BMFG 4JPRA 5B1NA 3SYOA 4QE7A 3ZRWA 1K3EA 3E8FA 5EBLC 2WAMA 1TUEB 4JAUA 2DQ3A 4XDLA 3ABMC 5FL7G 1Q7YW 4ZBMA 1VQKV 1AJQA 4QPJA 1G8MA 3ZMSA 2HVJC 3T2MA 3AG3B 1PNMA 3K06A 1CP9A 1FS0G 1M57C 1W2BU 4EKWA 1VQNV 1YJWV 3OFNG 1J95A 1AI5A 1QLEC 3MHSC 3IC7A 4MW3A 1V54B 3LSSA 2X6AA 5CMUA 2Z5UA 1M90W 1S3JA 1MSWD 4MVOA 5L3BA 3ZRVA 5L3EA 5B3SB 4PDRA 1F23A 2EIKC 2ZQMA 2OTJV 3CD6V 3E86A 3FB6C 4WFHA 2HKOA 4PELA 1ZWIC 4WFAV 5DN6G 2HVKC 3AG2C 4MVZA 1K33A 3KG2A 3FB7C 3LUTB 1KKDA 3K79A 3CYOA 1NH2D 1GM8A 2XOKG 4CBCA 5LHIA 2M7WA 1QCEA 1V54C 5LBQA 3AG4B 4HYOA 1E1RG 1H2GA 2V7QG 2W6JG 3LDDA 4CZZA 4FIPC 3I55V 1EFRG 4MT8A 3QO5A 5B3SC 4RQFA 2AHZA 2EZOA 1VQ8V 1N8RW 3STLC 3ZRSA 5LGNA 1JOYA 1DTOA 2ZR2A 4P9OA 3RVYA 4PDVA 3CPWU 3E83A 2PI4A 1AI4A 4TSFG 2WLLB 3IGAC 3HB3B 1CPYA 2ZXWB 1B6QA 1SESA 3OUSA 2XAFA 4HAMA 4UVCA 4L87A 3ASNC 5EC1C 5CBHA 5KUKA 3AG4C 2ATKC 5H9CA 3E8BA 2WLLA 5KA6A 4RAIA 3SYAA 4H37A 5CBFA 1R73A 4QIWF 3ASOB 4GX0A 4MTXA 4TT3G 3UKMA 1R3IC 3WFVA 2W0FC 1IXMA 4R50A 4UVAA 1THZA 1V55C 1Q86W 2EIJC 2ZDIA 1QBZA 4N23A 5IY5B 2ZXWC 1YITV 4WFFA 1Q82W 3FB8C 5B1BB 3F7VC 2JEUA 3RVZA 3TK1A 1QVGU 1OCRB 3EFFK 1YTFD 1JPXA 2NLJC 3B8NA 3ASOC 3FKSG 4G27B 2IJIA 1BL8A 4LP8A 1OCOB 3P30A 3K04A 2WLMA 2Y48A 3FYEB 3ZN1A 2EINC 4MVSA 1JQ0A 3G71V 3CP1A 2W6IG 3IFXA 5IYBO 2FTKA 1MOFA 4X88A 1KP3A 1QR8A 1GK9A 3CC7V 1AI6A 3T1CA 1E79G 3TETA 1OCRC 2PI5A 1DF5A 3W7TA 2JJ2G 1K7DA 2WLHA 3D36A 3A0RA 1OCZC 5DM6V 1OCOC 2WLIB 4MTGA 4TWKA 4PDMA 2R9IA 2R9RB 2A0LA 3DTUB 4N21A 1GKFA 3W7WA 1RM1B 4UXNA 3TCUA 2EILB 3EHBB 1JX9A 3W7SA 2KB1A 1NH2B 2QTOA 2WLIA 2WPDG 2QE7G 1NVPD 4XBFA 1VQ4V 2C2AA 1GM7A 1XL6A 2GSMB 4PA9A 5L3GA 4R6ZA 1S77D 4GT1A 3SJQC 3OW2U 4LC1A 2UXNA 2Q6AA 1XL4A 3OM3B 1FXKB 1K4CC 1PNKA 2B1GA 3FYIB 4G2KA 3H01A 3AG1C 1H8EG 1LNQA 1W0JG 1RM1C 5IYDO 4PA4A 2EILC 1COWG 2A9HA 4JTCB 4X8AA 5H6RA 4WF9V 3QO8A 1SERA 2V1DA 2YSUB 1AJNA 2IH3C 2P90A 3ZMZA 1VQLV 2HG5C 3AG3C 4MVUA 4PA7A 2DQ0A 2BOBC 4JYBA 4JTAB 3ABTA 3ETGA 2Y69B 1WLEA 4KUMA 1F51A 3X2QB 1QVFU 2EZPA 3SYPA 2ZD9A 3OR6C 4RQEA 2QA4V 4JASA 2OCCB 1S5HC 3T4DA 2WLJA 1W0KG 1WPXA 5L3DA 1NR1A 3RBZA 1YTFB 4BIUA 1P7BA 2DYSB 3CCSV 2ITCC 2MK3A 2HJFC 4P30A 1QR9A 4UV9A 3CMEV 3I56V 3F7YC 1VQ5V 3X2QC 4GCZA 1Q81W 1K34A 4R7CA 4H33A 2OTLV 2P6JA 2IU0A 1KC8W 1OHHG 2JIZG 3G4SV 3CCUV 1JVMA 2WLKA 4XDKA 1Y4MA 4LCUC 1G4YB 3MD0A 3OR7C 2X6BA 4JAVA 3SPIA 2AHYA 4GX1A 2LFSA 4F4LA 4MVQA 2DYSC 3K3WA 2X7RB 1K92A 3GWOA 3SPHA 5LHGA 3OGCC 3CCVV 2JJ1G 2IJKA 1K97A 1OCCB 3FB5C 4HZ3A 3F5WC 1AJPA 1EBOA 1AROP 3B77A 2WLNA 2IH1C 3CCEV 1K73W 1PNLA 4XDJA 2BOCC 1YJNV 3CCJV 4MS2A 1M1KW 1I5YA 3D3IA 2ZDIC 4E2LA 3SYCA 3JD3A 1OZ0A 3DGEA 3BY6A 5HFLA 3ZRXA 5GW7A 3ZJZA 1NVPB 1EZJA 2DWDC 3E8GA 4KP4A 5EC2C 5LGTA 1H8HG 4DXWA 2HFEC 1PL0A 4P9PA 2DYRB 5IY5C 2JK5C 5KUMA 4LBEC 3E8HA 2XNDG 3QO7A 1OCCC 1CEZA 4ZKIA 3JYCA 2LFRA 5CN0A 2XAHA 5B1BC 3M99B 5C93A 4UV8A 3OMAB 1AI7A 1GO3F 3ML0A 2Z3YA 4PA6A 3ETEA 4X89A 1JJ2U 3ZCCA 2K1EA 2X0LA 4UUJC 2XAJA 2Q68A 1K5SA 3B8MA 4P2ZA 1SRYA 4JYCA 1K4DC 3STZC 3G6EV 2XAGA 4BIZA 3ZIAG 4QPKA 3K0DA 3CMAV 1FXVA 2ITDC 5H6QA 1VQ7V 1M9NA 1GMGA 2H94A 3P32A 1E1QG 1PKXA 1NJIW 3WG7B 1L1FA 4I9WA 3OE7G 4JTDB 4G28B 1S0VA 2UXXA 3VOUA 3ETDA 4RUFA 3LDCA 1YIJV 2XAQA 3E89A 4J9ZB 3ABUA 4WFEA 3ZN0A 3ABKB 4Z1MG 3UM7A 3CC4V 3T4ZA 1DF4A 1FXKA 3LSQA 1HWYA 3GB7C 3WG7C 2EIKB 5EBMC 1KP2A 3OMNB 1ENVA 2GHYA 2WWWA 4WFBV 3K9AA 2XASA 1FFTB 1S72V 2IU3A 1GM9A 3AG2B 4RO2A 1R6KA 3LNMB 1FXKC 4PDLA 2B1IA 4WCEV 4FK5C 1NQTA 3ABKC 3AEIA 3CCLV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO C;  3ABL C;  4G27 B;  1JVM A;  2WLK A;  1BL8 A;  4LP8 A;  4MTF A;  4XDK A;  3SPG A;  4LCU C;  2DWE C;  3K04 A;  1M56 C;  1G4Y B;  2WLM A;  2EIN C;  4MVS A;  3OR7 C;  3OUF A;  2X6B A;  4QE7 A;  3SPI A;  2AHY A;  3SYO A;  4GX1 A;  3E8F A;  4GX5 A;  5EBL C;  4F4L A;  4MVQ A;  4XDL A;  4R8C A;  2DYS C;  3ABM C;  3IFX A;  3R65 A;  4ZBM A;  3SPH A;  3OGC C;  4X88 A;  3FB5 C;  4HZ3 A;  3T1C A;  3F5W C;  4RUE A;  5EBW C;  3TET A;  1OCR C;  2WLN A;  2IH1 C;  3K0G A;  3LDE A;  2HVJ C;  3T2M A;  2Y69 C;  4XDJ A;  2BOC C;  3K06 A;  1ORQ C;  2WLH A;  4MS2 A;  1M57 C;  4EKW A;  2P7T C;  1OCZ C;  1J95 A;  2Q69 A;  1OCO C;  1QLE C;  2OCC C;  3SYC A;  2WLI B;  4MTG A;  4MW3 A;  4TWK A;  4PDM A;  3RW0 A;  2X6A A;  2R9R B;  3HPL C;  3ZJZ A;  2A79 B;  2A0L A;  2DWD C;  3E8G A;  5EC2 C;  2EIM C;  4MSW C;  4MVO A;  1R3L C;  4DXW A;  3TCU A;  2HFE C;  2QKS A;  4MVM A;  4P9P A;  2EIK C;  4PDR A;  4MW8 A;  3K03 A;  3SPC A;  2JK5 C;  2KB1 A;  2QTO A;  2WLI A;  3E8H A;  4LBE C;  5E1A C;  1OCC C;  5KUM A;  3E86 A;  3FB6 C;  3JYC A;  4WFH A;  3SPJ A;  3PJS K;  1ZWI C;  1XL6 A;  5B1B C;  2HVK C;  3AG2 C;  4MVZ A;  2X6C A;  3KG2 A;  3FB7 C;  3LUT B;  4PA9 A;  1KKD A;  4R6Z A;  4PA6 A;  3SJQ C;  4CBC A;  2Q6A A;  1XL4 A;  4X89 A;  1K4C C;  2K1E A;  1V54 C;  4UUJ C;  2Q68 A;  4HYO A;  5IY5 C;  4P2Z A;  3AG1 C;  3LDD A;  1K4D C;  4MTO A;  4BW5 A;  3STZ C;  1LNQ A;  4PA4 A;  2EIL C;  5EK0 A;  5B3S C;  2A9H A;  4JTC B;  1R3K C;  4X8A A;  3K0D A;  2AHZ A;  2H8P C;  3STL C;  3ZRS A;  4MVR A;  4KFM A;  2ITD C;  4J9Y B;  3RVY A;  4P9O A;  5J9P C;  4PDV A;  3E83 A;  2IH3 C;  2WLL B;  3IGA C;  4I9W A;  3K08 A;  3BEH A;  4JTD B;  2HG5 C;  4G28 B;  3AG3 C;  4MVU A;  3OUS A;  4QE9 A;  4WFG A;  3VOU A;  4PA7 A;  4RUF A;  2BOB C;  4JTA B;  3ASN C;  3LDC A;  5EC1 C;  5B1A C;  3AG4 C;  2ATK C;  5CBH A;  3E8B A;  5KUK A;  3E89 A;  2WLL A;  4J9Z B;  4RAI A;  4WFE A;  3SYA A;  2ZD9 A;  3OR6 C;  4H37 A;  3SYP A;  5CBF A;  4GX0 A;  1S5H C;  3T4D A;  3UKM A;  2WLJ A;  3UM7 A;  1R3I C;  3T4Z A;  2W0F C;  2DYR C;  3SYQ A;  4R50 A;  1R3J C;  2YEV A;  1V55 C;  3GB7 C;  3WG7 C;  2EIJ C;  5EBM C;  4PA3 A;  3RBZ A;  2ZXW C;  4GX2 A;  4QNH B;  1P7B A;  4OXS A;  4WFF A;  5BZB A;  2ITC C;  3FB8 C;  2HJF C;  4P30 A;  3F7V C;  4RO2 A;  5CBG A;  3RVZ A;  3F7Y C;  3LNM B;  3X2Q C;  3EFF K;  4PDL A;  2Q67 A;  4R7C A;  4H33 A;  3ABK C;  2NLJ C; 
#chains in the Genus database with same CATH topology
 1MG1 A;  4MTF A;  2UUC O;  5CB4 A;  3U10 A;  1O9G A;  4UB6 Z;  1I5X A;  5LHH A;  1GTO A;  2K9P A;  1KU9 A;  1VQP V;  2Y4U A;  2EIM B;  2CH7 A;  3UCS C;  4JF3 A;  5B1O A;  4B3T B;  1YDX A;  2QM7 A;  3K0G A;  3G67 A;  3L71 H;  3CE2 A;  2Q69 A;  5FNV B;  3CCR V;  2PTM A;  1LUV A;  2ZIN A;  5J2T A;  4W4K A;  1R3L C;  1SZT A;  1RFY A;  5BR8 B;  3SPC A;  4MW8 A;  2OCH A;  1KBH A;  3JD0 A;  2UXB B;  4YJ2 A;  1NU1 H;  2GUZ B;  4JI5 B;  3SPJ A;  3PJS K;  2LP7 A;  2ZNJ A;  4GLX A;  2YIB D;  3G80 A;  4F6E A;  1MA1 A;  5K1X A;  1QQC A;  1QU7 A;  1WB7 A;  1VQ6 V;  4ZI7 A;  5EK0 A;  5IDJ A;  1MMM A;  1SQQ H;  1ZAU A;  2OYQ A;  1WP8 A;  2EIN B;  4MVR A;  4KFM A;  4YHH O;  2DE0 X;  2ZR3 A;  4CS3 A;  4CS2 A;  3CB2 A;  1P4R A;  1XHZ A;  5EIB C;  4DUZ B;  1JFF A;  3ZS8 C;  4O4L B;  1NBM G;  4I5S A;  3QNE A;  4Q6G A;  1OCZ B;  2JVD A;  3CXC U;  5KA5 A;  2QM8 A;  3OEE G;  1R3J C;  4DV4 B;  2ZKO A;  1K5Q A;  1L0N H;  4GX2 A;  2XT9 A;  3AK2 A;  3SJA C;  4UCT A;  3BFR A;  4WBN A;  3ZMT A;  2UU9 B;  2Q67 A;  2Y4T A;  1XRE A;  1P49 A;  2GBO A;  1QLE B;  1KQS U;  3SJC C;  1K3E A;  1D5A A;  2WAM A;  4DV7 O;  3B4S A;  4J7J A;  1ZTE A;  4ZBM A;  4Z1V A;  1SQV H;  1AJQ A;  5GON B;  4NXN O;  4GKK O;  1PNM A;  1M57 C;  1N32 B;  1AI5 A;  2Z5U A;  3HKB A;  3AG7 A;  1J5E B;  3BA9 A;  3HKE B;  5L3B A;  4NVP A;  2EIK C;  4B3R O;  2YI8 A;  3FB6 C;  4PI0 A;  1BGY H;  1ZWI C;  1KKD A;  4W4L A;  2QM4 A;  1K33 A;  4I55 B;  5BY1 A;  1NH2 D;  3RN4 A;  3RYF B;  2RDC A;  2RN9 A;  4HYO A;  5CA1 A;  1I94 B;  1E1R G;  2V7Q G;  4D7T A;  4MT8 A;  1IBL B;  1Q6I A;  4UCO A;  5IE9 A;  2VWJ A;  2FKX A;  4I50 A;  1DTO A;  4ZOL A;  2WA4 A;  3E83 A;  1GN4 A;  3H1I H;  1CPY A;  1B6Q A;  3OUS A;  2XAF A;  3QF7 A;  1XI1 A;  3CX5 F;  2GV9 A;  2A3Q A;  3ASN C;  5KUK A;  3AG4 C;  5H9C A;  2GUZ A;  2WLL A;  3SYA A;  2Y0P A;  1SA0 A;  1R73 A;  4QIW F;  1Q90 D;  1DGS A;  4B3M O;  1THZ A;  3K57 A;  3N2K B;  2B9Z A;  1ZL8 B;  1WJZ A;  4N23 A;  1EM1 A;  1YIT V;  1NS1 A;  1Q82 W;  5B1B B;  5JCO C;  5KHH A;  1QVG U;  1YTF D;  1VF6 C;  1X4T A;  2JGU A;  2F95 B;  1I0H A;  3B8N A;  3FKS G;  2VQE B;  2UUA B;  4TV9 A;  3D3Q A;  1PPJ H;  3K04 A;  3FYE B;  1O9H A;  4H0L B;  3T1H B;  5LP6 B;  4LF7 B;  1AP5 A;  5IYB O;  5LL6 Y;  1QR8 A;  3CC7 V;  4LFB O;  1AI6 A;  4IYI A;  5KX5 A;  3BRC A;  2E5L B;  2PI5 A;  2BE3 A;  1XNR B;  1K7D A;  1FPO A;  4X64 O;  4UFZ A;  1OCO C;  1NZ6 A;  1Q8I A;  1AIL A;  4OGQ B;  1TGO A;  3DTU B;  4PV1 B;  4DUY O;  4YY3 O;  3TCU A;  2EIL B;  2ZM6 O;  1JX9 A;  1SQF A;  3D36 C;  2QTO A;  2WLI A;  2WPD G;  1TVK B;  4XBF A;  4NXM B;  2C2A A;  1GM7 A;  1DK1 A;  2GSM B;  4PA9 A;  4AHC A;  4R6Z A;  4GT1 A;  2UXN A;  4NR1 A;  1XL4 A;  3OM3 B;  1FXK B;  1K4C C;  1PNK A;  1BZK A;  3AG1 C;  5IYZ A;  5D5P A;  5GON A;  4K0K O;  4JTC B;  4WF9 V;  4DK1 A;  4TOI A;  1AP6 A;  2GTA A;  2VQF B;  3M8A A;  1N33 B;  1VQL V;  1N34 O;  5H2F Z;  2YXL A;  3HKE A;  2FL4 A;  4PA7 A;  2DQ0 A;  4JTA B;  1U97 A;  3ETG A;  4DRX B;  4BIO A;  2BTO A;  3CRM A;  2P06 A;  4DV5 B;  2A7W A;  4LF6 B;  1IUR A;  4JAS A;  2OCC B;  1V9P A;  4OPH A;  1WPX A;  4EB6 A;  3KZI Z;  1P7B A;  3RYI A;  3DXR A;  3I56 V;  1VQ5 V;  4DR1 B;  2DJV A;  5CA0 A;  2FB5 A;  3FAV A;  3WB2 A;  1KC8 W;  3G4S V;  1JVM A;  4LCU C;  1FFX A;  1VF5 B;  4LF9 O;  3SPI A;  4GX1 A;  2LFS A;  4F4L A;  4AIL C;  3LSU A;  3GWO A;  4FVM A;  2IJK A;  1K97 A;  1SKV A;  2Q0A A;  3CCE V;  4QGP A;  1K73 W;  1PNL A;  4D6T H;  4O4I A;  3CCJ V;  4MS2 A;  3N2G B;  3D3I A;  4LFC O;  1NTZ H;  3HKD B;  1Q3E A;  3BY6 A;  5HFL A;  2YXY A;  4CC5 A;  5LGT A;  4AQY B;  2JK5 C;  4GYC B;  3E8H A;  2XND G;  3IAY A;  2LFR A;  5CN0 A;  4B7K A;  4FLT A;  3M99 B;  5C93 A;  2Z0A A;  4UV8 A;  5F2V O;  3ML0 A;  5B5E Z;  2Z3Y A;  4JV5 O;  4JYA B;  4H44 B;  4X89 A;  2K1E A;  1JA8 A;  2Q8V A;  1K5S A;  2UXD O;  1K4D C;  3IJ4 A;  4K35 A;  3ZIA G;  1Y74 B;  2ITD C;  3QG5 A;  2Y0I A;  1M9N A;  1GMG A;  2H94 A;  4DR2 O;  2YXH A;  2F93 B;  4G28 B;  2YS8 A;  1NT2 B;  3ETD A;  4KHP O;  3LDC A;  1YIJ V;  2N04 A;  2XAQ A;  3OTO O;  3ABU A;  3ZN0 A;  1G6U A;  4PHZ A;  3K5M A;  3UM7 A;  5LMU O;  3BCC H;  1DF4 A;  4X1I B;  2JGD B;  1FXK A;  1P84 F;  1HWY A;  3JAR B;  1VIB A;  2XAS A;  1A32 A;  1Q6H A;  2UUC B;  4FLY A;  2P4K A;  4DR7 B;  4RO2 A;  3AG2 B;  2ZE8 A;  3CRQ A;  4GZR B;  4WCE V;  4DV2 O;  4FK5 C;  1GRJ A;  1X59 A;  1N0J A;  3ABK C;  1MNG A;  3T1Y B;  2CH7 B;  5KMG A;  2DWE C;  2IW5 A;  5A9G A;  1WP7 A;  2B5U A;  3CCM V;  4U7O A;  4GX5 A;  4FPP A;  4R8C A;  3FX7 A;  4BW9 A;  1P7G A;  1DLB A;  3OEH G;  1YXB A;  4LFA O;  4RUE A;  5EBW C;  1YSC A;  3GVM A;  1K8A W;  3Q4H A;  2CGN A;  5J2T B;  3NXS A;  2P7T C;  2P22 C;  1YHQ V;  4YJ2 B;  2BTQ A;  2XHB A;  2EIM C;  4MSW C;  2AW9 A;  2OT5 A;  4TQD A;  3K03 A;  4UCS A;  3O65 A;  2E74 B;  1SET A;  4TV8 A;  3K9S A;  4ZI7 B;  5JH7 A;  2ODM A;  1NKD A;  2PGG A;  3LNN A;  5B1A B;  4YHH B;  1KB9 F;  2JEX A;  4DR6 O;  4BW5 A;  2EBO A;  5L3F A;  3ICX A;  1JFF B;  1AVM A;  1VF6 A;  1XQ8 A;  2G38 A;  4AI8 A;  3EVK A;  3HKD A;  4LH6 A;  5IWA O;  1R6N A;  5JQG A;  3E22 B;  1NR7 A;  4QE9 A;  1K9M W;  5IJ9 A;  4DYL A;  1XMO O;  1VQM V;  4J41 A;  2PYL A;  1YI2 V;  2H3O A;  2YEV A;  4JI6 O;  4WBN B;  2D3O W;  1Y76 A;  4PA3 A;  4ASU G;  1Q6U A;  4JYY A;  1VQO V;  4QNH B;  3C3T A;  3ABM B;  1HR0 O;  1HP8 A;  2CUG A;  4D7S A;  5BZB A;  1ZLZ A;  4GKJ O;  5CBG A;  4JI8 O;  4DV6 O;  1BHB A;  2Q73 A;  1SF9 A;  4DV7 B;  1FJG O;  3BVO A;  5CA3 A;  1KD1 W;  1BSM A;  2QKC A;  4JPR A;  3ZRW A;  3E8F A;  4NXN B;  1TUE B;  2DQ3 A;  5FL7 G;  1Q7Y W;  5GTI Z;  5KHJ A;  1G8M A;  1VMG A;  3AG3 B;  2R72 A;  1CP9 A;  1FS0 G;  1YJW V;  4B3R B;  1QLE C;  3LSS A;  3DC6 A;  1M90 W;  3ZRV A;  2AZ0 A;  5B3S B;  2OTJ V;  4LH7 A;  5DN6 G;  1LUW A;  5CA1 B;  3LUT B;  3KG2 A;  1EN6 A;  5LHI A;  2ADP A;  2VWK A;  4O4J B;  4I50 B;  4B7E A;  4ZOL B;  4CZZ A;  2DMX A;  2LJ2 A;  3I55 V;  1EFR G;  3QO5 A;  1IBK O;  1M4U A;  5EYP B;  3ZRS A;  3RVY A;  4P9O A;  4PDV A;  3CPW U;  4TSF G;  1IXB A;  2WLL B;  3IGA C;  4NKG B;  3HB3 B;  2M6Y A;  4JZG A;  1SA0 B;  2ZXW B;  4B3M B;  4TUY A;  2ATK C;  4ZHQ B;  3E8B A;  2XUM A;  1XMQ O;  4RAI A;  3ASO B;  4GX0 A;  1Y67 A;  4TT3 G;  3CXH F;  4R50 A;  4UVA A;  2N74 A;  1V55 C;  2EIJ C;  2CE4 A;  2YUA A;  3VQW A;  4TV9 B;  4WFF A;  3F7V C;  2JEU A;  2YID A;  3AK3 A;  3TK1 A;  5LXT A;  1OCR B;  2BSK A;  1JPX A;  2NLJ C;  3E22 A;  3P30 A;  5DEC A;  4LFB B;  5KX5 B;  3C90 A;  4MVS A;  1JQ0 A;  3P3N A;  2UXC O;  4LF5 B;  3IFX A;  2ZNI A;  5C8Y B;  4X64 B;  1MOF A;  3OT7 A;  4X88 A;  1GK9 A;  1WNS A;  1E79 G;  2CTP A;  3W7T A;  4RWU A;  4DUY B;  4FZ1 A;  3A0R A;  2Q7H A;  2ZM6 B;  3M7M X;  3ZHS A;  2WLI B;  4MTG A;  1R1B A;  2A0L A;  3BPZ A;  1GKF A;  2RJZ A;  3EHB B;  4DR5 O;  2KB1 A;  1KMI Z;  3HKC B;  2F4V O;  1Z2G A;  3G6B A;  3RWR D;  5L3G A;  1S77 D;  5IYZ B;  5FPR A;  4LC1 A;  3FYI B;  3QVN A;  3ZHR A;  1Q43 A;  1H8E G;  1W0J G;  4JI2 O;  2EIL C;  1N34 B;  2VRZ A;  1B3Q A;  1YF2 A;  3ZHT A;  2YSU B;  2P90 A;  3L70 H;  1HNZ O;  2RCV A;  3JAT A;  3CRC A;  3B2E E;  2ZD9 A;  5EZY A;  4EB6 B;  1IX9 A;  2WA3 A;  3H1J H;  1S5H C;  3T4D A;  1S5L Z;  2OIG A;  1W0K G;  5LMN O;  1PL4 A;  3RYI B;  4DV0 B;  3DXR B;  1HDJ A;  1TA8 A;  5CA0 B;  4O4J A;  4BIU A;  3FAV B;  2DYS B;  3CCS V;  4NTW A;  2HJF C;  3L72 H;  4UV9 A;  3D8C A;  5EYP A;  1HNW B;  3F7Y C;  1Q81 W;  1FFX B;  4H33 A;  2LGQ A;  3L74 H;  1TUB A;  4LF4 O;  1FAF A;  1L8D A;  4XDK A;  1G4Y B;  3ZBH A;  2ADQ B;  4ZHQ A;  2QKA A;  4JI7 B;  2PZS A;  4O4I B;  3K3W A;  3SPH A;  3OGC C;  3RYC A;  2IBZ H;  2JJ1 G;  1OCC B;  4HZ3 A;  3F5W C;  1EBO A;  3B77 A;  2IH1 C;  3BAB A;  4JI0 O;  2UXB O;  2F66 C;  4EFE A;  3JAS A;  4E2L A;  3JD3 A;  4YIO A;  1NVP B;  1EZJ A;  2DWD C;  5EC2 C;  4DV3 O;  4DV1 O;  3K5O A;  4DXW A;  4JV5 B;  4P9P A;  1H2L A;  5IY5 C;  5KUM A;  3U0Z A;  1CEZ A;  3JYC A;  4FLV A;  2UXD B;  4LF8 B;  3WB1 A;  2QR4 A;  3C3S A;  2CDY A;  1CXZ B;  5C8Y A;  2XAJ A;  1XUQ A;  1SRY A;  3L9D A;  3RYH A;  3G6E V;  2QTS A;  3A0B Z;  2XAG A;  4JI1 B;  1WN7 A;  5JVD A;  1JJO A;  3CWB H;  3WG7 B;  3OE7 G;  2UXX A;  1GN2 A;  4RUF A;  5LMU B;  1GN6 A;  3E89 A;  3HKC A;  4Z1M G;  2P5O A;  1YVW A;  1BE3 H;  3T4Z A;  5LOV A;  2AGA A;  5K1P A;  2EIK B;  4DV2 B;  4WFB V;  3K9A A;  5KHG A;  5KMG B;  1R6K A;  3LNM B;  4U3F H;  2LGW A;  4UB8 Z;  4IIJ A;  2ILM A;  5JJE B;  3CC2 V;  2HLD G;  1W59 A;  4LFA B;  3BHP A;  3OUF A;  4U3J A;  1KUQ A;  3Q4H B;  3ZMV A;  3R65 A;  5FLX N;  3SDL A;  2F43 G;  2RNB A;  2LO1 A;  3LDE A;  2OIE A;  2HEP A;  2Y69 C;  2BTQ B;  1ORQ C;  2Q5Z A;  3ASN B;  1ROP A;  3NR7 A;  3THO A;  3S3W A;  1UJW B;  3RW0 A;  4JGS A;  1R6T A;  1FXH A;  2QKS A;  5LYJ A;  4TV8 B;  2JDI G;  1I94 O;  5E1A C;  5JH7 B;  3ZHU A;  1IBL O;  4HNA A;  3MHH C;  1YCI A;  1N36 O;  2QEX V;  4FM2 A;  1SC5 B;  4DR6 B;  2X6C A;  3W7X A;  4I0X A;  4JI4 O;  1EZV H;  1IVS A;  2HHH O;  5IWA B;  2EJR A;  5L3C A;  1B04 A;  5JQG B;  1VF7 A;  1HNX B;  2ZT9 B;  3RGB A;  4UVB A;  2HR3 A;  5FPO A;  4BAY A;  5IJ9 B;  2EX3 A;  1F4N A;  4O2A A;  1XMO B;  3K08 A;  3BEH A;  5IYC O;  3E35 A;  3L73 H;  4FJC C;  5B1A C;  1SQG A;  5BMV B;  3JCZ A;  3CCQ V;  2NNU A;  4ICG A;  2QWO B;  2YEV B;  4HBN A;  1Y76 B;  1QLN A;  1AR4 A;  3ABL B;  2WSS G;  1HR0 B;  2DYR C;  3SYQ A;  1M56 B;  1XOU A;  2ETN A;  2HJD A;  2UUA O;  4JI8 B;  4DV6 B;  4LWS A;  2IJH A;  1FJG B;  4NTX A;  1NI8 A;  3DSQ A;  1GN3 A;  4LF7 O;  1AR1 B;  3A8T A;  5ITZ A;  4FLU A;  1Z5V A;  3ZRW B;  4I4T A;  1PV0 A;  3SPG A;  3AG1 B;  1JR9 A;  3HR0 A;  3SYO A;  4QE7 A;  4XDL A;  3ABM C;  1Z5W A;  1VQK V;  3OTF A;  2QGN A;  4ABM A;  4NXM O;  4JZ2 A;  4EKW A;  3JAK A;  1J95 A;  2Q4P A;  1V54 B;  2X6A A;  5CMU A;  4Z2W A;  4B3S O;  2BCC H;  2EUL A;  5KHK A;  3F5T A;  1MSW D;  1SS3 A;  3BA8 A;  1F23 A;  4B08 A;  3CD6 V;  3E86 A;  2HKO A;  4PEL A;  4WFA V;  3JAL B;  4MVZ A;  3FB7 C;  1WA8 A;  4O4H A;  3K79 A;  3CYO A;  1IBM O;  1GM8 A;  2XOK G;  2YIB A;  1MZE A;  1IBK B;  4IHJ A;  4CBC A;  2M7W A;  5LA6 A;  3H1L H;  5LBQ A;  2KG7 B;  5H5N A;  1H2G A;  2W6J G;  4FIP C;  3ZED A;  2JRI A;  5B3S C;  4RQF A;  1ZX3 A;  5JJN B;  2KQX A;  1VQ8 V;  3STL C;  4DV5 O;  3R66 A;  4TUY B;  2PI4 A;  1AI4 A;  3UO2 A;  1XMQ B;  3S3X A;  2XTA A;  1SES A;  4UVC A;  4PD4 F;  5CBH A;  3B09 A;  1FKA O;  1AR5 A;  1YZB A;  4H37 A;  5CBF A;  1RP3 B;  5JCO A;  3WFV A;  3FD9 A;  1IXM A;  1XHX A;  3UQ8 A;  5LXT B;  4X1Y A;  2BSK B;  2ZXW C;  4J11 A;  3CJH A;  1L0L H;  3RVZ A;  1US6 A;  2UXC B;  4JI3 O;  3ASO C;  4G27 B;  2IJI A;  3ZHV A;  1EN5 A;  1VP7 A;  2R9A A;  2Y48 A;  1FYJ A;  4CH3 A;  2EIN C;  5BMV A;  3A0H Z;  3CP1 A;  2W6I G;  4I9Q A;  5DED A;  1T5E A;  2Q7E A;  2FTK A;  1KP3 A;  3T1C A;  1H2S B;  3TET A;  1OCR C;  1DF5 A;  2JJ2 G;  4BR6 A;  2WLH A;  3D36 A;  3AK1 A;  3OD4 A;  1OCZ C;  5DM6 V;  4TWK A;  1TAE A;  4PDM A;  2R9I A;  2F4V B;  4JYA O;  2R9R B;  1BCC H;  4N21 A;  4O2B A;  1RM1 B;  4UXN A;  2GDS A;  1F7Y A;  4J7K A;  4GKK B;  2QE7 G;  1WB8 A;  1NVP D;  4X1K A;  5IJ0 B;  1JMK C;  4DW1 A;  4JI2 B;  2CTR A;  3UT5 B;  2Q6A A;  3BAA A;  4FFK A;  4CH5 A;  1XIL A;  4G2K A;  3VQY A;  1LNQ A;  4PA4 A;  1COW G;  2A9H A;  4X8A A;  5H6R A;  1SER A;  1XNQ O;  3JAT B;  1GAX A;  4DK0 A;  2V1D A;  1AJN A;  2IH3 C;  1MZF A;  2W0X A;  3ZMZ A;  5EZY B;  4MVU A;  4ZIB A;  5LMN B;  1G1X B;  1WLE A;  3X2Q B;  1QVF U;  2EZP A;  3OR6 C;  3JAL A;  4DR7 O;  2E76 B;  3VQX A;  2RMK B;  3T1Y O;  2FYU H;  5L3D A;  2KG7 A;  1NR1 A;  3U11 A;  2ZCE A;  4LF4 B;  4X62 O;  1TUB B;  4P30 A;  5KLV H;  2NN4 A;  2P4V A;  1H2N A;  4UCR A;  4GCZ A;  1BQ0 A;  4DR4 O;  3I5D A;  1OHH G;  2WLK A;  3JAW A;  1Y4M A;  4OX9 O;  3RYC B;  2X6B A;  1IZ3 A;  4E4E A;  2AHY A;  4JI0 B;  4MVQ A;  2DYS C;  4EEQ A;  5LHG A;  3CCV V;  3JAS B;  1AJP A;  2QWQ B;  1ARO P;  2WLN A;  4F6R B;  2LW1 A;  4XDJ A;  4DV3 B;  2BOC C;  4DV1 B;  1M1K W;  1I5Y A;  2ZDI C;  4X65 O;  1OZ0 A;  3DGE A;  3ZRX A;  5GW7 A;  2PYJ A;  1H8H G;  4FFB A;  3MAQ A;  2O57 A;  4LBE C;  4IL6 Z;  1OCC C;  4ZKI A;  4NB5 A;  4X66 O;  2XAH A;  5B1B C;  4A5U B;  3TXS A;  3OMA B;  1AI7 A;  2DOS A;  4OPA A;  1GO3 F;  3RYH B;  4DR3 O;  3ETE A;  3K5L A;  1JJ2 U;  4YY3 B;  2EJ7 A;  4UUJ C;  4UCU A;  4P2Z A;  5JVD B;  3STZ C;  2UUB O;  4BIZ A;  3K0D A;  5LP6 C;  3CMA V;  1FXV A;  3N27 A;  1KYO F;  1VQ7 V;  3P32 A;  4FLX A;  1PKX A;  1NJI W;  4X20 A;  1L1F A;  4I9W A;  5TIS Z;  3WU2 Z;  4JTD B;  4EFB A;  3SJB C;  3VOU A;  1LR1 A;  3PN1 A;  4K0K B;  3JSL A;  3K5N A;  5LOV B;  4WFE A;  2ZE7 A;  5IJ0 A;  1UPG A;  4NTY A;  3CC4 V;  2A06 H;  3OGI B;  3UT5 A;  3K59 A;  4FM0 A;  3B40 A;  3MDS A;  1BQZ A;  1IDS A;  3GB7 C;  3WG7 C;  5EBM C;  4IIJ B;  3OMN B;  1S72 V;  2IU3 A;  1SQB H;  2YIC A;  2ZE5 A;  3RFR A;  1FXK C;  2B1I A;  1H2K A;  1NQT A;  4U3J B;  3CCL V;  4J7Z A;  5BXZ A;  4LNU A;  1AB3 A;  1YJ9 V;  5KHI A;  2CK3 G;  2Q9L A;  3ZX6 A;  4QJF B;  1N4C A;  2ZIO A;  3JD2 A;  4FMT A;  1S76 D;  4Q20 A;  2KKW A;  1KEC A;  3OMI B;  1UFI A;  4YXW G;  4LF9 B;  1PD3 A;  5LYJ B;  2FML A;  4B3T O;  2OCC C;  3OAA G;  3HPL C;  2A79 B;  4HNA B;  1N36 B;  1JCH A;  3RT3 C;  4JI4 B;  4I0X B;  4MVM A;  5FNV A;  3E2E A;  3JD1 A;  2CAZ C;  1V55 B;  2HHH B;  2EIJ B;  4I7Z B;  1MAB G;  4LFC B;  3W7U A;  1B06 A;  1VQ9 V;  4J42 A;  5BR8 O;  1H38 A;  1H2M A;  3CRR A;  4C7U A;  1XBL A;  4JI5 O;  3ZMU A;  1BHA A;  1RPO A;  4MTO A;  3VBB A;  2DW4 A;  4DO2 A;  4F6R A;  5IT9 N;  4O2A B;  1R3K C;  5A2Q N;  2H8P C;  4J9Y B;  5J9P C;  1Y66 A;  5JJJ B;  1WPB A;  4U7N A;  4WFG A;  2IJJ A;  4GUN A;  2P67 A;  1SZX A;  2PY5 A;  4J80 A;  5HFM A;  3H1H H;  4O4L A;  4DUZ O;  4LWS B;  4DR2 B;  3JD4 A;  5ITZ B;  3WB0 A;  4KHP B;  3OTO B;  1PP9 H;  4OXS A;  4I4T B;  3H1K H;  4DV4 O;  4LF5 O;  2ZIM A;  3ABL C;  5KAF Z;  1RPR A;  1M57 B;  2GTS A;  1M56 C;  1F4M A;  5LGU A;  2UU9 O;  1BMF G;  5B1N A;  1Y6X A;  2PUS A;  4CS4 A;  5EBL C;  3J81 N;  4JAU A;  4JAA A;  2OWO A;  1BS3 A;  1OJH A;  1I08 A;  3JAK B;  2YDE A;  1NTM H;  2E75 B;  4QPJ A;  3ZMS A;  4B3S B;  2HVJ C;  3T2M A;  3K06 A;  1W2B U;  4K3A A;  1VQN V;  3UO3 A;  3OFN G;  3MHS C;  3IC7 A;  4MW3 A;  1S3J A;  1VEW A;  4MVO A;  1WA8 B;  4O4H B;  5L3E A;  1IBM B;  4PDR A;  1N32 O;  2ZQM A;  4IHJ B;  5LA6 B;  4WFH A;  4NYK A;  1J5E O;  2HVK C;  3AG2 C;  2NR5 A;  3JCU Z;  1VAR A;  3KCX A;  1QCE A;  3O9O A;  1V54 C;  2L6L A;  1D5N A;  1SQP H;  2V4D A;  3AG4 B;  4I55 A;  3LDD A;  2E3C A;  4X9Q A;  1YEW A;  2IM9 A;  2AHZ A;  2EZO A;  2N05 A;  2VS0 A;  3RYF A;  1N8R W;  1JOY A;  5LGN A;  1ZUQ A;  3APO A;  2MW2 B;  2ZR2 A;  1N0N A;  1BT8 A;  4UCV A;  1I7F A;  3CS5 A;  4DV0 O;  4FLZ A;  4HAM A;  4L87 A;  4CH4 A;  5EC1 C;  1U96 A;  4FM1 A;  5KA6 A;  4IYH A;  1HNW O;  4MTX A;  4X1Y B;  3UKM A;  3CEI A;  1R3I C;  2Q7G A;  2JS5 A;  4H13 B;  2W0F C;  3JAM N;  2F1M A;  2ARH A;  3CJH B;  1Q86 W;  2ZDI A;  1QBZ A;  2QJ1 A;  5IY5 B;  4JI3 B;  1URF A;  2AZ2 A;  3FB8 C;  4JI7 O;  3J7A U;  3N2K A;  1ZL8 A;  3EFF K;  1QHT A;  4J10 A;  4JI6 B;  1ZSP A;  2LW7 A;  1BL8 A;  4LP8 A;  1OCO B;  2WLM A;  3ZN1 A;  3G71 V;  4GKJ B;  2VQE O;  2Q0O C;  1FD9 A;  2DN9 A;  1OV9 A;  2JS3 A;  5LP6 A;  3T1H O;  2D2C B;  4KXR A;  4O2B B;  3A2F A;  5KAI Z;  4LF8 O;  5J2U B;  2E5L O;  4X1K B;  3SGI A;  3DC5 A;  3GWK C;  3W7W A;  1XNR O;  3FFQ A;  3W7S A;  1NH2 B;  1S5J A;  1VQ4 V;  4JI1 O;  5E79 Z;  1XL6 A;  3CRA A;  3SJQ C;  3OW2 U;  1TVK A;  2B1G A;  1XNQ B;  3H01 A;  3K58 A;  2F23 A;  5JWP A;  1RM1 C;  5IYD O;  3QO8 A;  4YIP A;  4YJ3 B;  1SQX H;  2YC0 A;  3TXQ A;  1RSO B;  1KKC A;  3H9V A;  2L35 A;  1MSD A;  5CB4 B;  2HG5 C;  4IT5 A;  3AG3 C;  2BOB C;  4JYB A;  3J80 N;  3ABT A;  2Y69 B;  4KUM A;  2VQF O;  1F51 A;  1N33 O;  1XDC A;  3KCY A;  3SYP A;  4RQE A;  2QA4 V;  2YIA A;  4X62 B;  2CGO A;  2WLJ A;  4DRX A;  4IGG A;  4LF6 O;  3RBZ A;  3L75 H;  1YTF B;  1Q5O A;  5AG2 A;  4TQF A;  4DR4 B;  3KKY A;  2ZE6 A;  2ITC C;  2MK3 A;  3JAW B;  3CME V;  1QR9 A;  3TGU H;  4OX9 B;  3X2Q C;  1K34 A;  2YI9 A;  4R7C A;  2OTL V;  2P6J A;  2IU0 A;  2JIZ G;  3CCU V;  1PM9 A;  3MD0 A;  4DR1 O;  2LQT A;  3OR7 C;  4JAV A;  2X7R B;  1K92 A;  4K8Z A;  3FB5 C;  4X65 B;  2QWP B;  3APQ A;  1HW7 A;  1YJN V;  2QWR B;  4PI2 A;  4CH6 A;  4FFB B;  4CC6 A;  3SYC A;  3CHX A;  3CSX A;  4X66 B;  3ZJZ A;  3E8G A;  4KP4 A;  1D2D A;  2RQ6 A;  3N2G A;  2HFE C;  1PL0 A;  4DR3 B;  1WAZ A;  2DYR B;  3QO7 A;  4FLW A;  3QTC A;  4DW0 A;  3ETQ A;  1HNX O;  3IC9 A;  1QNM A;  2QWN B;  2UUB B;  4PA6 A;  4AQY O;  3ZCC A;  2X0L A;  2QDO A;  2Q68 A;  2R70 A;  3B8M A;  4DR5 B;  4JYC A;  5EIB D;  4X20 B;  4QPK A;  2QSA A;  4PJ0 Z;  3ZHQ A;  5B66 Z;  5GTH Z;  3EXA A;  5H6Q A;  1E1Q G;  5J2U A;  1M5I A;  2HP8 A;  1Y74 A;  2AXT Z;  1S0V A;  3SR2 C;  4BWA A;  2PF4 E;  4J9Z B;  4L8J A;  3VQV A;  1NTK H;  3P3P A;  3ABK B;  4KL1 A;  4LR3 A;  2KSD A;  3TJT A;  1HNZ B;  3LSQ A;  2CTW A;  4FZ0 A;  1GH6 A;  1M93 A;  1EN4 A;  2CTQ A;  1KP2 A;  1ENV A;  2GHY A;  2WWW A;  4K8X A;  1FFT B;  4X1I A;  2JGD A;  5D5Q A;  4LNU B;  1GM9 A;  3HKB B;  1XEQ A;  4YJ3 A;  4PDL A;  3JAR A;  3JSN A;  3AEI A;  1RSO A; 
#chains in the Genus database with same CATH homology
 1MG1 A;  4MTF A;  3CC2 V;  2HLD G;  2DWE C;  1YJ9 V;  2IW5 A;  1I5X A;  2CK3 G;  5LHH A;  1GTO A;  2B5U A;  3OUF A;  4QJF B;  3CCM V;  1VQP V;  4U7O A;  4GX5 A;  2EIM B;  3JD2 A;  4FPP A;  4R8C A;  3ZMV A;  3R65 A;  4FMT A;  4JF3 A;  1S76 D;  5B1O A;  4Q20 A;  1DLB A;  3OEH G;  2F43 G;  4RUE A;  5EBW C;  1KEC A;  2QM7 A;  1YSC A;  3K0G A;  3OMI B;  3LDE A;  1K8A W;  2Y69 C;  1ORQ C;  3NXS A;  3ASN B;  4YXW G;  2P7T C;  1PD3 A;  1ROP A;  2Q69 A;  2OCC C;  1UJW B;  3OAA G;  3RW0 A;  4JGS A;  3CCR V;  1YHQ V;  3HPL C;  2A79 B;  1JCH A;  2EIM C;  1FXH A;  4MSW C;  1R3L C;  1SZT A;  2QKS A;  4MVM A;  2OT5 A;  2JDI G;  4MW8 A;  3K03 A;  3SPC A;  5E1A C;  3E2E A;  3JD1 A;  3JD0 A;  1V55 B;  2EIJ B;  3SPJ A;  1MAB G;  3MHH C;  3PJS K;  2QEX V;  2LP7 A;  3W7U A;  2X6C A;  3W7X A;  1VQ9 V;  1SET A;  1H38 A;  1NKD A;  5B1A B;  3ZMU A;  1BHA A;  2JEX A;  1RPO A;  4MTO A;  4BW5 A;  2EJR A;  5L3C A;  2EBO A;  5L3F A;  1VQ6 V;  3VBB A;  2DW4 A;  4DO2 A;  5EK0 A;  1R3K C;  5IDJ A;  2H8P C;  2EIN B;  4MVR A;  4KFM A;  4J9Y B;  4UVB A;  2HR3 A;  2ZR3 A;  4BAY A;  5J9P C;  1F4N A;  1R6N A;  1Y66 A;  1P4R A;  3K08 A;  3BEH A;  4U7N A;  1NR7 A;  4QE9 A;  2IJJ A;  1NBM G;  3E35 A;  4WFG A;  5IYC O;  4FJC C;  1K9M W;  2P67 A;  5B1A C;  3JCZ A;  3CCQ V;  4I5S A;  2NNU A;  3QNE A;  2YEV B;  5HFM A;  1OCZ B;  1QLN A;  1VQM V;  3ABL B;  3CXC U;  5KA5 A;  2WSS G;  2QM8 A;  3OEE G;  2DYR C;  3SYQ A;  1YI2 V;  1M56 B;  1R3J C;  2YEV A;  2D3O W;  1K5Q A;  3JD4 A;  4PA3 A;  4ASU G;  1VQO V;  4GX2 A;  4QNH B;  4OXS A;  3ABM B;  2IJH A;  5BZB A;  5CBG A;  3ZMT A;  1AR1 B;  2Q67 A;  1BHB A;  3ZRW B;  3ABL C;  1RPR A;  1M57 B;  3SPG A;  5CA3 A;  1KD1 W;  3AG1 B;  1QLE B;  1M56 C;  1KQS U;  1F4M A;  5LGU A;  1BMF G;  4JPR A;  5B1N A;  3SYO A;  4QE7 A;  3ZRW A;  1K3E A;  3E8F A;  5EBL C;  2WAM A;  1TUE B;  4JAU A;  2DQ3 A;  4XDL A;  3ABM C;  5FL7 G;  1Q7Y W;  4ZBM A;  1VQK V;  1AJQ A;  4QPJ A;  1G8M A;  3ZMS A;  2HVJ C;  3T2M A;  3AG3 B;  1PNM A;  3K06 A;  1CP9 A;  1FS0 G;  1M57 C;  1W2B U;  4EKW A;  1VQN V;  1YJW V;  3OFN G;  1J95 A;  1AI5 A;  1QLE C;  3MHS C;  3IC7 A;  4MW3 A;  1V54 B;  3LSS A;  2X6A A;  5CMU A;  2Z5U A;  1M90 W;  1S3J A;  1MSW D;  4MVO A;  5L3B A;  3ZRV A;  5L3E A;  5B3S B;  4PDR A;  1F23 A;  2EIK C;  2ZQM A;  2OTJ V;  3CD6 V;  3E86 A;  3FB6 C;  4WFH A;  2HKO A;  4PEL A;  1ZWI C;  4WFA V;  5DN6 G;  2HVK C;  3AG2 C;  4MVZ A;  1K33 A;  3KG2 A;  3FB7 C;  3LUT B;  1KKD A;  3K79 A;  3CYO A;  1NH2 D;  1GM8 A;  2XOK G;  4CBC A;  5LHI A;  2M7W A;  1QCE A;  1V54 C;  5LBQ A;  3AG4 B;  4HYO A;  1E1R G;  1H2G A;  2V7Q G;  2W6J G;  3LDD A;  4CZZ A;  4FIP C;  3I55 V;  1EFR G;  4MT8 A;  3QO5 A;  5B3S C;  4RQF A;  2AHZ A;  2EZO A;  1VQ8 V;  1N8R W;  3STL C;  3ZRS A;  5LGN A;  1JOY A;  1DTO A;  2ZR2 A;  4P9O A;  3RVY A;  4PDV A;  3CPW U;  3E83 A;  2PI4 A;  1AI4 A;  4TSF G;  2WLL B;  3IGA C;  3HB3 B;  1CPY A;  2ZXW B;  1B6Q A;  1SES A;  3OUS A;  2XAF A;  4HAM A;  4UVC A;  4L87 A;  3ASN C;  5EC1 C;  5CBH A;  5KUK A;  3AG4 C;  2ATK C;  5H9C A;  3E8B A;  2WLL A;  5KA6 A;  4RAI A;  3SYA A;  4H37 A;  5CBF A;  1R73 A;  4QIW F;  3ASO B;  4GX0 A;  4MTX A;  4TT3 G;  3UKM A;  1R3I C;  3WFV A;  2W0F C;  1IXM A;  4R50 A;  4UVA A;  1THZ A;  1V55 C;  1Q86 W;  2EIJ C;  2ZDI A;  1QBZ A;  4N23 A;  5IY5 B;  2ZXW C;  1YIT V;  4WFF A;  1Q82 W;  3FB8 C;  5B1B B;  3F7V C;  2JEU A;  3RVZ A;  3TK1 A;  1QVG U;  1OCR B;  3EFF K;  1YTF D;  1JPX A;  2NLJ C;  3B8N A;  3ASO C;  3FKS G;  4G27 B;  2IJI A;  1BL8 A;  4LP8 A;  1OCO B;  3P30 A;  3K04 A;  2WLM A;  2Y48 A;  3FYE B;  3ZN1 A;  2EIN C;  4MVS A;  1JQ0 A;  3G71 V;  3CP1 A;  2W6I G;  3IFX A;  5IYB O;  2FTK A;  1MOF A;  4X88 A;  1KP3 A;  1QR8 A;  1GK9 A;  3CC7 V;  1AI6 A;  3T1C A;  1E79 G;  3TET A;  1OCR C;  2PI5 A;  1DF5 A;  3W7T A;  2JJ2 G;  1K7D A;  2WLH A;  3D36 A;  3A0R A;  1OCZ C;  5DM6 V;  1OCO C;  2WLI B;  4MTG A;  4TWK A;  4PDM A;  2R9I A;  2R9R B;  2A0L A;  3DTU B;  4N21 A;  1GKF A;  3W7W A;  1RM1 B;  4UXN A;  3TCU A;  2EIL B;  3EHB B;  1JX9 A;  3W7S A;  2KB1 A;  1NH2 B;  2QTO A;  2WLI A;  2WPD G;  2QE7 G;  1NVP D;  4XBF A;  1VQ4 V;  2C2A A;  1GM7 A;  1XL6 A;  2GSM B;  4PA9 A;  5L3G A;  4R6Z A;  1S77 D;  4GT1 A;  3SJQ C;  3OW2 U;  4LC1 A;  2UXN A;  2Q6A A;  1XL4 A;  3OM3 B;  1FXK B;  1K4C C;  1PNK A;  2B1G A;  3FYI B;  4G2K A;  3H01 A;  3AG1 C;  1H8E G;  1LNQ A;  1W0J G;  1RM1 C;  5IYD O;  4PA4 A;  2EIL C;  1COW G;  2A9H A;  4JTC B;  4X8A A;  5H6R A;  4WF9 V;  3QO8 A;  1SER A;  2V1D A;  2YSU B;  1AJN A;  2IH3 C;  2P90 A;  3ZMZ A;  1VQL V;  2HG5 C;  3AG3 C;  4MVU A;  4PA7 A;  2DQ0 A;  2BOB C;  4JYB A;  4JTA B;  3ABT A;  3ETG A;  2Y69 B;  1WLE A;  4KUM A;  1F51 A;  3X2Q B;  1QVF U;  2EZP A;  3SYP A;  2ZD9 A;  3OR6 C;  4RQE A;  2QA4 V;  4JAS A;  2OCC B;  1S5H C;  3T4D A;  2WLJ A;  1W0K G;  1WPX A;  5L3D A;  1NR1 A;  3RBZ A;  1YTF B;  4BIU A;  1P7B A;  2DYS B;  3CCS V;  2ITC C;  2MK3 A;  2HJF C;  4P30 A;  1QR9 A;  4UV9 A;  3CME V;  3I56 V;  3F7Y C;  1VQ5 V;  3X2Q C;  4GCZ A;  1Q81 W;  1K34 A;  4R7C A;  4H33 A;  2OTL V;  2P6J A;  2IU0 A;  1KC8 W;  1OHH G;  2JIZ G;  3G4S V;  3CCU V;  1JVM A;  2WLK A;  4XDK A;  1Y4M A;  4LCU C;  1G4Y B;  3MD0 A;  3OR7 C;  2X6B A;  4JAV A;  3SPI A;  2AHY A;  4GX1 A;  2LFS A;  4F4L A;  4MVQ A;  2DYS C;  3K3W A;  2X7R B;  1K92 A;  3GWO A;  3SPH A;  5LHG A;  3OGC C;  3CCV V;  2JJ1 G;  2IJK A;  1K97 A;  1OCC B;  3FB5 C;  4HZ3 A;  3F5W C;  1AJP A;  1EBO A;  1ARO P;  3B77 A;  2WLN A;  2IH1 C;  3CCE V;  1K73 W;  1PNL A;  4XDJ A;  2BOC C;  1YJN V;  3CCJ V;  4MS2 A;  1M1K W;  1I5Y A;  3D3I A;  2ZDI C;  4E2L A;  3SYC A;  3JD3 A;  1OZ0 A;  3DGE A;  3BY6 A;  5HFL A;  3ZRX A;  5GW7 A;  3ZJZ A;  1NVP B;  1EZJ A;  2DWD C;  3E8G A;  4KP4 A;  5EC2 C;  5LGT A;  1H8H G;  4DXW A;  2HFE C;  1PL0 A;  4P9P A;  2DYR B;  5IY5 C;  2JK5 C;  5KUM A;  4LBE C;  3E8H A;  2XND G;  3QO7 A;  1OCC C;  1CEZ A;  4ZKI A;  3JYC A;  2LFR A;  5CN0 A;  2XAH A;  5B1B C;  3M99 B;  5C93 A;  4UV8 A;  3OMA B;  1AI7 A;  1GO3 F;  3ML0 A;  2Z3Y A;  4PA6 A;  3ETE A;  4X89 A;  1JJ2 U;  3ZCC A;  2K1E A;  2X0L A;  4UUJ C;  2XAJ A;  2Q68 A;  1K5S A;  3B8M A;  4P2Z A;  1SRY A;  4JYC A;  1K4D C;  3STZ C;  3G6E V;  2XAG A;  4BIZ A;  3ZIA G;  4QPK A;  3K0D A;  3CMA V;  1FXV A;  2ITD C;  5H6Q A;  1VQ7 V;  1M9N A;  1GMG A;  2H94 A;  3P32 A;  1E1Q G;  1PKX A;  1NJI W;  3WG7 B;  1L1F A;  4I9W A;  3OE7 G;  4JTD B;  4G28 B;  1S0V A;  2UXX A;  3VOU A;  3ETD A;  4RUF A;  3LDC A;  1YIJ V;  2XAQ A;  3E89 A;  4J9Z B;  3ABU A;  4WFE A;  3ZN0 A;  3ABK B;  4Z1M G;  3UM7 A;  3CC4 V;  3T4Z A;  1DF4 A;  1FXK A;  3LSQ A;  1HWY A;  3GB7 C;  3WG7 C;  2EIK B;  5EBM C;  1KP2 A;  3OMN B;  1ENV A;  2GHY A;  2WWW A;  4WFB V;  3K9A A;  2XAS A;  1FFT B;  1S72 V;  2IU3 A;  1GM9 A;  3AG2 B;  4RO2 A;  1R6K A;  3LNM B;  1FXK C;  4PDL A;  2B1I A;  4WCE V;  4FK5 C;  1NQT A;  3ABK C;  3AEI A;  3CCL V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...