2H8PC

Structure of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB heavy chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2h8pC00
3T1CA 4X88A 4GX2A 3SPJA 4MVMA 3LNMB 4XDKA 1R3LC 2DYSC 2HVJC 3LUTB 4GX0A 4R7CA 3K08A 3SPCA 4JTCB 3SYCA 3F5WC 3OR7C 4J9YB 5EK0A 3K04A 3K0GA 2AHZA 4MVUA 4JTDB 4R6ZA 4OXSA 3F7YC 3AG4C 3K06A 2ZXWC 4PA3A 3E83A 3KG2A 4MTFA 1LNQA 2QKSA 5BZBA 2EIKC 2AHYA 4MVZA 4RO2A 4P9PA 3IGAC 3OUFA 3T2MA 3FB5C 4PDVA 4X89A 4PDLA 4I9WA 1OCRC 2IH3C 2WLJA 4CBCA 2HJFC 3SYAA 5EC2C 2WLIA 3OGCC 3RVZA 4QE7A 3EFFK 3RBZA 4WFHA 4MVSA 4MS2A 3FB8C 2Q68A 4R50A 2A79B 1QLEC 3LDDA 4BW5A 3LDEA 1V54C 4LBEC 4MVOA 2OCCC 2X6BA 3AG3C 3X2QC 2KB1A 2WLHA 2X6AA 4WFEA 3AG2C 4PA7A 2Q69A 2WLLA 3OR6C 2ITCC 2IH1C 5EBLC 4DXWA 2QTOA 2HFEC 1V55C 4QE9A 2EIMC 4MTGA 1K4DC 2Y69C 5E1AC 2X6CA 1R3JC 4P2ZA 5B1AC 2P7TC 4J9ZB 4X8AA 3JYCA 4LCUC 3E8HA 3ASNC 1S5HC 2R9RB 3E8FA 5B1BC 4PA9A 4ZBMA 1P7BA 1OCCC 3UM7A 4R8CA 2BOCC 2WLIB 1OCOC 3WG7C 4QNHB 4XDLA 4UUJC 2ATKC 4H33A 2HVKC 3E8GA 3SYQA 1OCZC 3R65A 2YEVA 3HPLC 3E8BA 4JTAB 1XL4A 4HYOA 1G4YB 3FB6C 2K1EA 4XDJA 2DWDC 3E89A 3K03A 2Q67A 3K0DA 2WLLB 5KUMA 2NLJC 3ASOC 4MTOA 4PA6A 3F7VC 4MW8A 3TETA 4G28B 4H37A 1JVMA 3SPIA 4PDMA 4GX1A 4P9OA 4MSWC 3TCUA 3ZRSA 2EINC 3PJSK 3UKMA 4LP8A 3STZC 5KUKA 1K4CC 3E86A 4WFFA 3SYOA 5IY5C 2EILC 4GX5A 3SPHA 2WLKA 4MW3A 3T4ZA 3T4DA 2Q6AA 3VOUA 3ZJZA 3SPGA 2HG5C 4KFMA 2WLNA 3LDCA 4HZ3A 3STLC 4RUEA 4F4LA 5J9PC 1XL6A 2A9HA 3ABMC 1R3KC 3FB7C 3IFXA 5EC1C 1KKDA 2DYRC 1ORQC 3AG1C 1M56C 2DWEC 3GB7C 5CBHA 1J95A 5CBFA 2ITDC 4RUFA 4TWKA 1ZWIC 2BOBC 4MVQA 3SYPA 2H8PC 5EBMC 2A0LA 2EIJC 3ABLC 3BEHA 4WFGA 5EBWC 1M57C 5CBGA 4PA4A 4RAIA 1BL8A 3SJQC 4P30A 3ABKC 3OUSA 2JK5C 1R3IC 2W0FC 4G27B 4MVRA 4PDRA 4EKWA 2WLMA 5B3SC 3RVYA 2ZD9A 3RW0A
chains in the Genus database with same CATH superfamily
3T1CA 3SPJA 1AVMA 4NR1A 1OZ0A 4K8XA 3K08A 2AZ2A 5LYJB 4GCZA 1N0NA 1K5SA 1R6NA 2V4DA 4OXSA 3JD3A 4O2BA 3RYCB 3HKDA 2LFSA 3ZMZA 3CCMV 3QNEA 2ARHA 1N36O 3SJCC 1Q6UA 4E4EA 3BRCA 2IJHA 1ZLZA 3I5DA 5IJ9B 2XAGA 4B3RO 2UXDO 1J5EB 3BHPA 2UUBB 3DTUB 4H44B 3OR6C 2X7RB 3U11A 4MTGA 3QTCA 2X6CA 4P2ZA 5IT9N 4KHPB 1BMFG 4FMTA 5LA6A 3I55V 4U7NA 3IAYA 2XAFA 2JGDA 1MABG 4PJ0Z 1XNQB 4H13B 1QR9A 1Y66A 2YEVA 4BW9A 1KU9A 2M6YA 4XDJA 2UXCB 3VQXA 2GV9A 1XQ8A 3PJSK 2WPDG 1O9HA 5JH7A 1SETA 4GX5A 3OFNG 2B5UA 2WLNA 3N27A 4F4LA 1FJGB 2R72A 4IYHA 1K33A 4FM0A 2QM7A 5JJJB 4J7ZA 1XEQA 4WCEV 5LGNA 3SYPA 2ZDIC 3CC7V 4DV0O 1COWG 3BEHA 1H38A 1LUWA 1FFXA 3J81N 5LXTB 3OUSA 2Q7EA 2MK3A 5B66Z 4J41A 3OMAB 1VF6C 3CPWU 3LDEA 4Z2WA 1HNZO 3UT5B 4U3JA 4JF3A 3VBBA 3B77A 2F95B 4DV7O 2X0LA 4HBNA 3OR7C 4GZRB 4NYKA 1I94B 4ZI7A 2FL4A 3ZHQA 1XBLA 1GH6A 3OGIB 2LFRA 5IWAO 3JALA 1Y76A 1IBLB 4CBCA 1WP8A 1DF5A 5H5NA 2QTSA 3T1HB 4FM2A 3WG7B 3L72H 4B3SO 4DR3B 1GM7A 2H94A 1V54C 3A2FA 1TUBB 2UUCO 2R9IA 4FPPA 1BT8A 4WFEA 4DUYO 2WLLA 3E22A 1NI8A 1S0VA 2LP7A 3ASNC 4DV3B 1S5HC 3ZBHA 4BR6A 4LF9O 1AR4A 2QSAA 4LF7O 5BMVA 1OJHA 2EILB 4GLXA 3UM7A 4R8CA 2BOCC 3Q4HA 1D5AA 2QDOA 4BWAA 4CH3A 3AG7A 4X1KA 2DMXA 2A06H 1G4YB 2DYRB 2K1EA 2DWDC 3E89A 2UUAO 2YXLA 1K34A 2XUMA 1JCHA 1K4CC 4YY3O 1AI6A 2YICA 4UCUA 4X1YB 5LP6B 2Q7HA 3AK2A 1R3KC 3IFXA 3K9SA 4LH7A 1KP3A 1QU7A 1HR0B 1SC5B 4D7SA 2DQ3A 2L35A 2EZPA 2JJ1G 3KKYA 2D2CB 2IJIA 5KLVH 4DV4O 1YXBA 2Q0AA 1FPOA 2PF4E 3H1JH 2JGUA 4G2KA 2YXHA 4X1IB 2KKWA 2DYSC 1NZ6A 1TVKB 4DV6O 3DXRA 1FD9A 5BZBA 3RGBA 2Q73A 4ZKIA 3RYIB 1OCRC 2RDCA 4X64O 4UCVA 3S3WA 1KBHA 4JI2B 2WAMA 2V7QG 1D2DA 3FKSG 2YIBA 2JEXA 4IGGA 4BW5A 1YIJV 1R1BA 4I0XA 4JYYA 2HFEC 4ABMA 1XUQA 3K58A 3CYOA 4FFKA 2JJ2G 2Q8VA 3RYFB 3ASNB 3JATB 5B1BC 4O4JB 4JI4B 1P7BA 5IY5B 1OCCC 1XMQB 3WB0A 3FFQA 5JWPA 1OCZC 2GUZB 2UXNA 1F23A 2PI4A 3A0HZ 1M56B 2Q67A 4EFEA 2YDEA 1ZSPA 1GN2A 1Q3EA 1JVMA 1JMKC 4Z1VA 1SQQH 5D5QA 2R70A 4LP8A 3MHHC 2QKAA 4WFFA 1YTFB 4LFBO 4IIJA 3OW2U 2GHYA 2WLKA 3FAVA 3ZJZA 3F5TA 2ODMA 4FLUA 2ZR3A 4K8ZA 4UCOA 1XL6A 2A7WA 2YIDA 5EIBC 1W2BU 3D8CA 3ICXA 2H8PC 2PUSA 1AP6A 1PP9H 3QO8A 4GKJB 1HP8A 5JVDA 3G67A 1X4TA 3RW0A 1CP9A 1VQ9V 1AJNA 1H2LA 3ABTA 2CTPA 4KL1A 4DR5O 1M9NA 2OCCB 1VF7A 5L3CA 4J10A 4MTFA 2EIMB 2EIKC 4UFZA 2JIZG 4X89A 5KA6A 1QVFU 4ZHQB 3CCUV 4YHHO 2E3CA 1AB3A 3HKBB 5EC2C 4LF6B 3CD6V 4LR3A 1J5EO 4DRXA 3ZHVA 2JVDA 4PELA 2QA4V 4JYAB 1KMIZ 3ZEDA 1W0KG 4DXWA 4DR2B 4K35A 4KHPO 5E1AC 4JI1B 2KQXA 1SQXH 2QWNB 1H2MA 5CB4A 2R9RB 4LFCB 1JJOA 2CAZC 5IJ0A 1GK9A 5ITZB 2A3QA 4JTAB 2UXCO 2RQ6A 1H2GA 5L3GA 1WPXA 1Y74B 1SQPH 4X66B 1E1RG 4JI3B 3TCUA 1HDJA 3K3WA 4WBNB 2CH7B 3SYOA 5F2VO 2KG7A 2P5OA 5GW7A 3JAMN 2H3OA 4U7OA 2GSMB 1GRJA 1FJGO 4AI8A 2ILMA 3STLC 3CCJV 4JI8B 2DWEC 3GVMA 2P22C 3JD1A 2FTKA 1VQKV 5EBWC 4YIPA 2AW9A 4PDRA 4X62B 1IDSA 1D5NA 3DGEA 3RT3C 2HP8A 4J9YB 1I94O 2GDSA 2Z3YA 4CS4A 1G8MA 2AXTZ 4DV1O 4DW0A 4L87A 1V55B 2HLDG 3CXHF 3VQYA 3IGAC 3OUFA 4FLXA 4IHJA 1IBLO 4OPAA 4NTWA 3O9OA 1ZL8A 5LGTA 2IH3C 2WLJA 1N32B 4FZ1A 4QPKA 3RVZA 5L3DA 2F1MA 5IYDO 4TOIA 4DR3O 4FFBA 1DK1A 1QHTA 2MW2B 4NXMO 5E79Z 4LNUA 2CGOA 3ZIAG 1PL0A 3CCRV 4DR6B 1SQFA 4CH6A 4QE9A 2QR4A 3CE2A 2CE4A 2EINB 4PA9A 2LW7A 3JASA 1PL4A 3UCSC 1SA0B 5A9GA 1F4MA 1JR9A 1MG1A 1TGOA 1EZVH 2LGWA 4G28B 3SJAC 3ABLB 4K3AA 1VQMV 2RN9A 2UXBB 2B1GA 1SF9A 3RN4A 1E1QG 2A9HA 1GM8A 5LYJA 4YXWG 4AQYB 4DR4B 4UCTA 1J95A 4RUFA 1Z5WA 2BOBC 3CP1A 4FVMA 3RYCA 1P49A 1KQSU 3T1YO 3ETEA 1FXKA 3RVYA 3OD4A 3BCCH 1THZA 3ZRXA 4YJ2A 3L70H 1I0HA 3JD0A 1UJWB 3SYCA 1QLEB 2EBOA 1Q6IA 3L75H 5EK0A 5DECA 2JS5A 2ZNIA 3K04A 1KD1W 1H8HG 4JTDB 1VQ7V 1KUQA 1MSDA 2ZIMA 3FB5C 5L3EA 2ZINA 1BQ0A 4ZOLB 3E35A 1ZX3A 4JGSA 1XMOO 1HNWO 2A79B 3JD4A 5JQGB 2FB5A 2WA4A 3ETGA 2Q69A 4WFBV 2OTJV 1MSWD 1CEZA 1PM9A 2JS3A 4FLTA 2CK3G 2ADQB 2Q4PA 4JI4O 1IBKO 5EIBD 3NXSA 1XMQO 3H1LH 1YJNV 5LBQA 3OMNB 2EX3A 3WG7C 2PTMA 1N34B 4GKKB 3KCYA 5EZYA 1NH2D 5EYPB 2ETNA 2VQFB 3M7MX 3JAWB 1NKDA 1Q81W 3AK3A 3FYEB 1M90W 4Q20A 4YIOA 5C8YB 4I50A 1VP7A 1AR5A 5KUKA 4DK0A 3W7TA 5GONB 1K3EA 2EILC 3UO3A 5JCOA 4W4LA 3UT5A 4CC5A 3LDCA 1QCEA 1Z2GA 2DYRC 4UVCA 1YVWA 3JCZA 4DR7B 5K1XA 1XHZA 4F6EA 1SQVH 5KA5A 3K5NA 1VQPV 4WFGA 4TV9B 1XI1A 3ZRVA 4GKJO 2CDYA 2F4VB 1Q5OA 1JFFB 4EKWA 4O2AB 2ZCEA 3ZCCA 5LP6C 1DLBA 2ZD9A 1KKCA 1YEWA 1VQ5V 4WFAV 3G71V 1R3LC 3CRRA 2B9ZA 1TUBA 1WB7A 3CXCU 4QJFB 3F7YC 4O2BB 1N8RW 1TUEB 2QJ1A 3HKDB 1NR7A 4P9PA 5KAFZ 3IC7A 4PDVA 4LF6O 2VWKA 4MTXA 5FPRA 2N74A 3K5OA 1Y6XA 1TAEA 4WFHA 4R50A 4JYAO 4L8JA 4BAYA 3LDDA 2DW4A 3CCLV 4DR2O 1SRYA 1Q86W 2QWPB 2Y69C 2PZSA 4JAUA 4LFCO 4DW1A 3OTFA 5LA6B 3RYHB 4X65B 3D3IA 2QE7G 4I9QA 1PNLA 4X1YA 2JGDB 3R66A 4XDLA 4H33A 2YEVB 4LF5O 1AR1B 1MNGA 5FNVA 3H1IH 4GYCB 2YI8A 4LWSA 4JI3O 4MW8A 5LMNB 3WB2A 2ZDIA 3A0RA 3B8MA 2YC0A 3UKMA 3DC5A 4JV5B 5JH7B 5IY5C 2BSKB 4Z1MG 1VF6A 1QLNA 5CA1A 4RUEA 2HHHB 4JI8O 1LR1A 3IC9A 5CN0A 1N33B 1TVKA 1M56C 2XNDG 1X59A 2A0LA 5J2UB 1YZBA 1FFXB 1GMGA 2XAHA 5A2QN 2W0XA 5GTIZ 4X62O 5JJEB 2JK5C 3STZC 4B3MB 2ZKOA 5IYZB 2AGAA 2HVJC 4GX0A 3GWOA 4JI7B 2VRZA 4BIUA 1EN5A 2IBZH 2QM8A 2YUAA 4MVUA 1QBZA 1NS1A 2ADPA 1NT2B 1N32O 1OHHG 3JALB 4PDLA 5LMUB 1VIBA 3JATA 1HNXO 4I7ZB 4QE7A 2QWRB 4CH5A 4O4HA 3OEHG 4O4LB 4DR6O 2OCCC 2X6BA 3AG3C 1KB9F 2ITCC 1NU1H 4DR1B 3OM3B 3ASOB 2EIMC 2NNUA 3ZN1A 5BR8B 4UCRA 4DYLA 4PI2A 2Y69B 4LCUC 3U0ZA 2XAJA 5KHIA 2QM4A 1H8EG 4CS3A 4E2LA 2UU9B 2OIGA 3Q4HB 3ZRWB 4B3TB 5KX5A 3W7SA 1QVGU 1FYJA 2Q7GA 1L8DA 4X1KB 1FFTB 3FB6C 3BA9A 4JAVA 1E79G 1BS3A 1GO3F 5KMGB 4NKGB 3JSNA 1WNSA 5B5EZ 3AK1A 2UXBO 2HKOA 5FL7G 2YXYA 3CRCA 1WA8B 4K0KO 3SPHA 2N05A 4KXRA 2Y4TA 1LUVA 1H2SB 4JYCA 4AQYO 4DR4O 3JAKA 1BSMA 3AG1C 2ITDC 4J42A 1VQ6V 2DN9A 4I4TB 1F7YA 4XBFA 4RAIA 1Q90D 4YJ3A 1I5YA 4D6TH 4JI5B 3CCSV 4B3RB 2QWOB 4JTCB 2Y4UA 3FD9A 2XT9A 3DXRB 4FJCC 1NVPB 1EN6A 2DOSA 4TT3G 3KG2A 5DN6G 4LH6A 3JARA 3C3TA 2C2AA 4TQFA 1ENVA 3A8TA 1F51A 1AP5A 3CRAA 3N2KB 4TUYB 1I5XA 1YSCA 2P90A 1S5JA 3SYAA 3CHXA 4F6RA 1Q6HA 5HFLA 1OCOB 4MVSA 4I55B 1ZAUA 2NR5A 2LJ2A 4LBEC 4MVOA 1CPYA 4O4IB 3ML0A 2BE3A 3AG3B 4J11A 4LFAB 3K5MA 1V55C 2HR3A 5B1AC 1M1KW 2PY5A 2E5LB 3CX5F 1QR8A 4JZGA 3CWBH 4ZBMA 5LOVA 1AI7A 1N34O 3H1HH 4GKKO 4FK5C 1EN4A 3L73H 1WPBA 2CGNA 4FM1A 2VQFO 4X20B 2JEUA 2UUBO 3B40A 3APOA 2E75B 3CCVV 3EVKA 1FXVA 5KHGA 3CSXA 4CS2A 2EZOA 4H37A 4KP4A 2EIJB 3HKEB 4GX1A 4DK1A 2EINC 2CTRA 4NTXA 4OGQB 1JX9A 2RMKB 3RWRD 1XNQO 3T4DA 5B3SB 3NR7A 1HNZB 4ICGA 4HNAB 2V1DA 3AG1B 4TWKA 4FLYA 4MVQA 1NQTA 3AG4B 3ABLC 1K97A 1Q43A 1PNMA 3W7UA 3CJHA 3SJQC 4P30A 1JOYA 2F23A 2W0FC 1URFA 1S77D 1VMGA 2ZR2A 4XDKA 1DGSA 4JYBA 2P06A 3BVOA 3E83A 3PN1A 2VQEB 1K92A 3FX7A 1BE3H 4KUMA 1B04A 3DSQA 3P32A 3K79A 4UB6Z 2JRIA 3BAAA 4LF7B 3OGCC 4EEQA 4GUNA 1VQNV 1SA0A 1IBMB 4DRXB 1ZTEA 5CA0B 1WB8A 2IW5A 1K73W 1QLEC 2OIEA 1SZXA 2KB1A 2WLHA 1GN6A 2FYUH 5L3BA 1VQ8V 2UUAB 4X65O 3ZN0A 5B1AB 2P67A 4HAMA 2GTAA 3T1HO 5IJ0B 5J2TA 4QNHB 1DF4A 3EXAA 1XHXA 3ABMB 1GN3A 2ZE6A 4HYOA 1YTFD 1GKFA 5LMNO 4QPJA 1SESA 3K0DA 1XNRB 1H2NA 3F7VC 3N2GB 3HKCA 4DV3O 2Q0OC 3CEIA 2QKCA 3QG5A 2KG7B 5C93A 3H9VA 2WWWA 3VOUA 2HHHO 1SZTA 3SPGA 1IXBA 3OMIB 3CMAV 3LNNA 3O65A 2ZM6B 1YITV 1F4NA 1BQZA 4DV6B 2ZXWB 2PGGA 2UXXA 1FKAO 3H01A 5D5PA 3WFVA 5GTHZ 1R3IC 3KZIZ 1FXHA 2DJVA 2BTQB 1BZKA 4JI7O 3MDSA 5KAIZ 1NBMG 4LC1A 1US6A 1NJIW 1HR0O 3P3NA 1VF5B 3CS5A 4FZ0A 1EFRG 4LF8B 4JI0B 3D36C 2QKSA 4EB6B 1KP2A 4IHJB 4X9QA 1U96A 1L1FA 4I9WA 3B4SA 2AZ0A 1GM9A 3UQ8A 5B1OA 4FFBB 5IJ9A 2PYJA 1QQCA 1DTOA 3AG2C 1Y4MA 3VQVA 3ZHTA 1RSOB 2QTOA 3MHSC 5L3FA 4TV8B 5K1PA 4PI0A 2DE0X 5GONA 2UU9O 4JI2O 1SS3A 3JASB 3KCXA 3L74H 1IURA 1G6UA 2WLIB 2B1IA 2HVKC 3E8GA 3FYIB 5H6QA 3L71H 4RQFA 3K03A 3AEIA 1N0JA 4MTOA 1PNKA 1EM1A 3LSUA 4DV2B 1AROP 1M57B 1H2KA 2ZIOA 2RCVA 4LF4B 4UV9A 4DO2A 4DR5B 1Q7YW 1SERA 2IM9A 3C3SA 3QO5A 3E2EA 4JI6B 1YF2A 1UFIA 5IYBO 5LXTA 1MA1A 4G27B 4W4KA 3DC6A 4JI5O 2K9PA 1FXKB 2ZE5A 4YHHB 4X88A 5DEDA 1KC8W 4YJ2B 3LNMB 4EFBA 4N21A 4R7CA 3K0GA 3X2QB 1Q82W 1VEWA 3OTOB 4QIWF 1LNQA 4MVZA 1SQGA 3TXQA 3RYHA 1NTKH 1XREA 1PV0A 4BIOA 3GWKC 3EFFK 1GAXA 4MS2A 3P30A 1P84F 4JASA 4LFAO 1TA8A 2F93B 1RM1B 4OX9B 5EBLC 4I5SA 3AG2B 5BXZA 2E5LO 4X8AA 4FLWA 4CH4A 2GTSA 3E8HA 1VQOV 3TJTA 2BSKA 4UUJC 1AJPA 3SYQA 4B08A 3E8BA 3OE7G 2ZQMA 5EZYB 2CTWA 2D3OW 3WU2Z 3ASOC 4JI1O 2ZE7A 2L6LA 1KYOF 2Y0IA 5J2UA 4I50B 2ZNJA 4ZIBA 2HEPA 2LQTA 3ABKB 2IJKA 5LP6A 3M8AA 5IYZA 5J9PC 5LHHA 2RNBA 1ORQC 2O57A 3GB7C 5CBHA 1RPOA 4X66O 2OYQA 3THOA 4QGPA 3ZMVA 4DV1B 1BHAA 5IDJA 1EZJA 4PA4A 2FKXA 3ZHRA 2EULA 1JA8A 1BGYH 3TGUH 1PKXA 1Y67A 5LHGA 4X1IA 4O4LA 1YI2V 4NXMB 1IXMA 4B7EA 1NTZH 2VQEO 3TK1A 2Z5UA 3ZMSA 1WAZA 2XHBA 2BCCH 4MT8A 3T2MA 1AILA 3LSQA 3RYIA 4NXNB 1MOFA 1WLEA 1IBMO 5B1NA 1P4RA 3ZRWA 1AJQA 1S3JA 4U3JB 3FB8C 2OCHA 4DUZB 2OWOA 3B8NA 2X6AA 3TXSA 5KMGA 1M5IA 1ROPA 3ZX6A 2BTOA 4UXNA 3ZMTA 4ZI7B 1NTMH 1R3JC 2M7WA 1W0JG 1SKVA 2VWJA 3RYFA 1WA8A 1Y76B 1VARA 4O4JA 4Q6GA 1OCOC 3CCEV 3R65A 1IX9A 2GUZA 2HJDA 5FNVB 2XTAA 1XNRO 2ZT9B 1GN4A 2WLLB 4LWSB 1UPGA 1XOUA 3E22B 2P6JA 3JSLA 1CXZB 3OEEG 2QGNA 4I4TA 4JZ2A 3G4SV 4PD4F 4DV5B 3E86A 5BMVB 3T4ZA 3T1YB 1U97A 2ZM6O 4NB5A 5CA1B 3FB7C 3VQWA 1FS0G 4CC6A 3K5LA 4UCSA 3ETDA 3ABUA 1YJ9V 2EIJC 1B06A 2QWQB 5CBGA 3K57A 2P4VA 3N2KA 4TUYA 3OT7A 1WJZA 5B3SC 4I55A 2CUGA 1B6QA 4TSFG 3ETQA 1XMOB 1HNWB 4O4IA 1AI5A 1V54B 2AHZA 4LF8O 4JI0O 3K06A 3AG4C 1GTOA 1T5EA 1JQ0A 1O9GA 1MMMA 3K59A 4ZHQA 1JJ2U 1IBKB 1BHBA 2HJFC 3HKBA 1N4CA 3RBZA 1N36B 3OAAG 2Q68A 2WA3A 4X20A 4O4HB 3SDLA 2WSSG 4UVAA 5H9CA 2ZE8A 2UXDB 4PV1B 2IH1C 3CC2V 5CMUA 1L0LH 2IJJA 2R9AA 3HKEA 2P7TC 4FLVA 1V9PA 3CC4V 3CMEV 1K8AW 1S72V 4FLZA 1HWYA 1SQBH 1YJWV 3ZMUA 5KX5B 1S76D 3HPLC 1XL4A 5ITZA 2N04A 4HNAA 4J80A 4I0XB 1Y74A 3UO2A 4DV2O 3QF7A 3TETA 2Q5ZA 1AI4A 3BFRA 4P9OA 1MZEA 3K9AA 4UV8A 1B3QA 4J7JA 3U10A 3D3QA 3S3XA 4WBNA 2Y0PA 2CH7A 3QVNA 2EJRA 4MW3A 4LF4O 1RP3B 2IU3A 4KFMA 4WF9V 1OV9A 3W7WA 3JAKB 3ABMC 2DYSB 5EC1C 3BA8A 5CBFA 1XDCA 5FPOA 4RWUA 4JI6O 4JAAA 2LW1A 4BIZA 4IT5A 1IZ3A 4DV0B 4YJ3B 1OCRB 4IIJB 1Q8IA 5KHHA 4GT1A 2P4KA 5JJNB 5TISZ 3FAVB 4MVMA 4UB8Z 5CA0A 2OT5A 3CB2A 3LUTB 4DR7O 1VQ4V 2VS0A 3OTOO 3QO7A 4DV7B 2ZXWC 3B09A 4PA3A 3J80N 4NTYA 2AHYA 3JARB 2W6JG 2F4VO 4H0LB 1QNMA 2EJ7A 5IWAB 5JVDB 5B1BB 5BY1A 5LL6Y 4F6RB 2OTLV 3W7XA 1OCCB 3C90A 5LHIA 1OCZB 4LF5B 3ZS8C 2YS8A 4B3SB 4OX9O 1YHQV 3H1KH 3A0BZ 2GBOA 4N23A 3CCQV 3N2GA 2UUCB 4DUYB 1K4DC 4J9ZB 3JYCA 3WB1A 5AG2A 4B7KA 4OPHA 2NN4A 2Z0AA 5LOVB 4IL6Z 4LF9B 3SGIA 4UVBA 1A32A 1K7DA 1L0NH 1S5LZ 3B2EE 4AHCA 3MAQA 3JD2A 1NR1A 2YSUB 4PA6A 1W59A 2XAQA 2YIAA 3SPIA 4PDMA 2W6IG 3IJ4A 2JDIG 4RQEA 1NH2B 5CB4B 3JCUZ 1R73A 3ZHUA 2QEXV 4CZZA 2Q9LA 4J7KA 2Q6AA 3LSSA 4YY3B 2BTQA 4IYIA 4A5UB 1Z5VA 4D7TA 3ZHSA 1KKDA 1R6KA 2XASA 3G80A 2LO1A 1ZWIC 5H2FZ 4EB6A 1BCCH 3MD0A 2EIKB 2KSDA 2YI9A 4U3FH 1M57C 3CJHB 4JV5O 3BABA 1XILA 1NVPD 4MVRA 4DV4B 3RFRA 1HNXB 3I56V 4GX2A 1WN7A 3G6EV 5KHJA 1N33O 3SPCA 1YDXA 1I08A 3F5WC 2F66C 1JPXA 4JPRA 1RPRA 4R6ZA 1RSOA 5DM6V 4ASUG 3L9DA 4RO2A 2YIBD 4TV8A 5KHKA 1EBOA 1IVSA 4NXNO 3SR2C 2G38A 1FXKC 1K5QA 5IYCO 1R6TA 2F43G 4ZOLA 3EHBB 2WLIA 2LGQA 2RJZA 2XOKG 4X64B 4B3MO 4DUZO 1FAFA 5HFMA 3G6BA 2Y48A 5JQGA 3X2QC 5FLXN 4PA7A 2CTQA 2IU0A 3CRQA 2PI5A 4AILC 1MZFA 1YCIA 1PPJH 5LMUO 1PD3A 4NVPA 1ZL8B 3E8FA 5J2TB 2DQ0A 2FMLA 4K0KB 5CA3A 2ATKC 4C7UA 4PHZA 1K9MW 4LNUB 5EYPA 1RFYA 3JAWA 4DR1O 1RM1C 5KUMA 2NLJC 3HR0A 1I7FA 3HKCB 2PYLA 1WP7A 5BR8O 5C8YA 3M99B 3ZRSA 4MSWC 4DV5O 2E74B 1P7GA 5H6RA 3BPZA 4B3TO 3HB3B 4TQDA 4LFBB 1ZUQA 2HG5C 4HZ3A 5LGUA 2E76B 1KECA 1M4UA 3BY6A 3CRMA 5EBMC 1G1XB 1VQLV 3SJBC 3P3PA 3J7AU 3APQA 3D36A 1M93A 4TV9A 5IE9A 1BL8A 3ABKC 4FIPC 1JFFA 5JCOC 1HW7A 2WLMA 4O2AA
chains in the Genus database with same CATH topology
3T1CA 3DGEA 3SPJA 1OZ0A 5LHGA 3CCSV 3K08A 1YI2V 1IXMA 4JTCB 4GCZA 4J9YB 1K5SA 1R6NA 2Z3YA 4FJCC 1NVPB 1G8MA 4OXSA 2Z5UA 3TK1A 4TT3G 4L87A 3KG2A 3ZMSA 3JD3A 1V55B 2HLDG 5DN6G 4MT8A 2C2AA 3IGAC 3OUFA 3T2MA 1ENVA 2LFSA 1F51A 3ZMZA 3LSQA 3CCMV 3QNEA 1I5XA 1YSCA 5LGTA 2IH3C 2WLJA 2P90A 1MOFA 1WLEA 3SYAA 4QPKA 1P4RA 5B1NA 1AJQA 5L3DA 2IJHA 5HFLA 3RVZA 3ZRWA 5IYDO 1OCOB 4MVSA 1S3JA 3FB8C 2XAGA 4MVOA 4LBEC 3ZIAG 1CPYA 3B8NA 1PL0A 3DTUB 3ML0A 3CCRV 2X6AA 3AG3B 3OR6C 2X7RB 1ROPA 1V55C 4QE9A 4UXNA 3ZMTA 4MTGA 2HR3A 2X6CA 1R3JC 4P2ZA 5B1AC 2M7WA 1M1KW 1W0JG 1BMFG 2EINB 1QR8A 4FMTA 4PA9A 4ZBMA 3I55V 1AI7A 4U7NA 2XAFA 4FK5C 1OCOC 3CCEV 1MABG 1QR9A 1Y66A 3R65A 2YEVA 2JEUA 1F4MA 1MG1A 4XDJA 3CCVV 1FXVA 2WLLB 4G28B 2P6JA 2EZOA 4H37A 4KP4A 2EIJB 3ABLB 3OEEG 4GX1A 2EINC 3PJSK 2WPDG 3G4SV 3E86A 1VQMV 1JX9A 1SETA 2B1GA 4GX5A 3OFNG 2B5UA 3T4ZA 3T4DA 5B3SB 2WLNA 1E1QG 4F4LA 2A9HA 3FB7C 1GM8A 4YXWG 1FS0G 1K33A 1J95A 2QM7A 3ETDA 3ABUA 2V1DA 3AG1B 4RUFA 4TWKA 1YJ9V 2BOBC 1NQTA 4MVQA 4WCEV 5LGNA 3SYPA 3CP1A 2ZDIC 3AG4B 3CC7V 2EIJC 3ABLC 1COWG 3BEHA 1H38A 1K97A 1PNMA 5CBGA 3W7UA 3SJQC 4P30A 1JOYA 3OUSA 2W0FC 1KQSU 2MK3A 5B3SC 3ETEA 1FXKA 3OMAB 1S77D 3CPWU 3RVYA 3LDEA 2ZR2A 1THZA 3ZRXA 4JF3A 3VBBA 3B77A 1B6QA 4XDKA 3JD0A 4TSFG 1UJWB 2X0LA 3SYCA 1QLEB 2EBOA 3OR7C 5EK0A 1AI5A 1V54B 3K04A 1KD1W 2AHZA 4JYBA 1H8HG 4JTDB 1VQ7V 3K06A 3AG4C 1GTOA 3E83A 1K92A 1JQ0A 4KUMA 2LFRA 3FB5C 5L3EA 3P32A 3K79A 4CBCA 1JJ2U 1BHBA 2HJFC 1DF5A 3OGCC 3E35A 3RBZA 1VQNV 4JGSA 3WG7B 3OAAG 2Q68A 1GM7A 2A79B 1QLEC 2IW5A 2WSSG 3JD4A 4UVAA 2H94A 1K73W 1V54C 5H9CA 3ETGA 2KB1A 2WLHA 2R9IA 4FPPA 4WFEA 2Q69A 2WLLA 4WFBV 2OTJV 2IH1C 3CC2V 5CMUA 1MSWD 1VQ8V 5L3BA 2IJJA 1CEZA 2P7TC 2CK3G 1S0VA 3ZN0A 5B1AB 2LP7A 3ASNC 3CMEV 3CC4V 2P67A 1K8AW 1S5HC 1S72V 4HAMA 3NXSA 1HWYA 1YJNV 1YJWV 5LBQA 2EILB 3OMNB 3UM7A 3ZMUA 4R8CA 2BOCC 3WG7C 4QNHB 1DF4A 1S76D 3HPLC 1XL4A 3ABMB 1NH2D 4HYOA 1YTFD 1G4YB 2DYRB 2K1EA 1GKFA 1NKDA 1Q81W 2DWDC 3E89A 4QPJA 1SESA 3K0DA 3FYEB 1M90W 3F7VC 4Q20A 3TETA 1K34A 1AI4A 4P9OA 3K9AA 4UV8A 1JCHA 5KUKA 3W7TA 1K4CC 1K3EA 2EILC 5C93A 1AI6A 2WWWA 2EJRA 4MW3A 3VOUA 1SZTA 3SPGA 2IU3A 4KFMA 4WF9V 3LDCA 1QCEA 3W7WA 3OMIB 3CMAV 3ABMC 1R3KC 3IFXA 2DYSB 4UVCA 2DYRC 5EC1C 3JCZA 5CBFA 1YITV 1KP3A 1F4NA 2ZXWB 5KA5A 1VQPV 2DQ3A 4WFGA 2UXXA 4BIZA 2EZPA 3H01A 3ZRVA 2JJ1G 2IJIA 3WFVA 1OCRB 1R3IC 4GT1A 4EKWA 1FXHA 3ZCCA 2ZD9A 1DLBA 1VQ5V 4WFAV 4G2KA 4MVMA 2OT5A 3G71V 1NBMG 1R3LC 2DYSC 3LUTB 4LC1A 1VQ4V 3CXCU 4QJFB 3QO7A 1NJIW 3F7YC 2ZXWC 4PA3A 1EFRG 1N8RW 1TUEB 2QKSA 5BZBA 1NR7A 2AHYA 1KP2A 4P9PA 2W6JG 1L1FA 4ZKIA 3IC7A 4PDVA 4I9WA 1OCRC 4MTXA 1GM9A 5B1BB 2OTLV 3W7XA 2WAMA 1OCCB 5B1OA 4WFHA 5LHIA 4R50A 2V7QG 3FKSG 2JEXA 1OCZB 4BAYA 3LDDA 4BW5A 1YIJV 2DW4A 3CCLV 1SRYA 1DTOA 3AG2C 1Y4MA 1YHQV 1Q86W 2QTOA 4N23A 2HFEC 3CCQV 3MHSC 1K4DC 2Y69C 3CYOA 4J9ZB 5L3FA 4JAUA 3JYCA 2JJ2G 3ASNB 3D3IA 2QE7G 5B1BC 1P7BA 5IY5B 1PNLA 1OCCC 2WLIB 4XDLA 2B1IA 4H33A 4UVBA 2HVKC 1K7DA 2YEVB 3E8GA 1OCZC 3FYIB 5H6QA 2UXNA 4RQFA 1F23A 1AR1B 2PI4A 3JD2A 1M56B 1NR1A 3K03A 2Q67A 2YSUB 3AEIA 4MTOA 4PA6A 4MW8A 2XAQA 1PNKA 1JVMA 2ZDIA 3A0RA 3SPIA 4PDMA 2W6IG 3B8MA 2JDIG 3UKMA 4LP8A 1AROP 1M57B 3MHHC 4RQEA 1NH2B 4WFFA 1YTFB 5IY5C 2GHYA 1R73A 3OW2U 2QEXV 4CZZA 4Z1MG 2WLKA 2Q6AA 3LSSA 3ZJZA 1QLNA 4RUEA 2ZR3A 4UV9A 1XL6A 5CN0A 1KKDA 4DO2A 1W2BU 1R6KA 1M56C 2XASA 1Q7YW 1SERA 1ZWIC 2XNDG 2H8PC 2A0LA 3MD0A 3QO5A 2EIKB 3E2EA 1M57C 1GMGA 2XAHA 3QO8A 5IYBO 2JK5C 4G27B 4MVRA 1NVPD 1FXKB 3STZC 3RW0A 3I56V 4X88A 1CP9A 4GX2A 1KC8W 3LNMB 3G6EV 1AJNA 1VQ9V 3SPCA 2HVJC 3ABTA 4GX0A 3GWOA 4N21A 4R7CA 4BIUA 3F5WC 1JPXA 1M9NA 4JPRA 2OCCB 3K0GA 1RPRA 2QM8A 4MVUA 3X2QB 1Q82W 1QBZA 4R6ZA 5L3CA 4MTFA 4QIWF 1LNQA 5DM6V 4ASUG 2EIMB 2EIKC 4RO2A 4MVZA 1EBOA 2JIZG 1OHHG 4X89A 5KA6A 1QVFU 4PDLA 3CCUV 1FXKC 1K5QA 5IYCO 2F43G 5EC2C 3EHBB 2WLIA 4QE7A 3EFFK 3CD6V 2XOKG 4MS2A 5HFMA 3P30A 4PELA 2Y48A 3OEHG 2QA4V 4JASA 2OCCC 2X6BA 3AG3C 3X2QC 4PA7A 1RM1B 1W0KG 2ITCC 4I5SA 5EBLC 2IU0A 4DXWA 3AG2B 3ASOB 2EIMC 3OM3B 2PI5A 2NNUA 5E1AC 4X8AA 3ZN1A 2Y69B 4LCUC 3E8HA 1PD3A 2XAJA 1VQOV 2R9RB 1H8EG 3E8FA 4E2LA 2DQ0A 3ZRWB 3W7SA 1QVGU 5CA3A 4UUJC 2ATKC 1AJPA 3SYQA 1GK9A 3E8BA 1K9MW 4JTAB 3OE7G 2ZQMA 1FFTB 2D3OW 1H2GA 3FB6C 5L3GA 1RM1C 1WPXA 4JAVA 1E79G 1GO3F 2NLJC 3ASOC 5KUMA 1E1RG 3M99B 3ZRSA 3TCUA 4MSWC 2HKOA 5FL7G 3K3WA 5H6RA 3SYOA 3ABKB 5GW7A 4U7OA 3SPHA 3HB3B 2GSMB 2IJKA 2HG5C 4HZ3A 3STLC 5LGUA 4JYCA 1KECA 5J9PC 5LHHA 3CCJV 1ORQC 3AG1C 2DWEC 3GB7C 5CBHA 1RPOA 2ITDC 3BY6A 3ZMVA 5EBMC 1VQLV 3JD1A 1VQ6V 1BHAA 2FTKA 3D36A 5IDJA 1VQKV 5EBWC 1EZJA 4XBFA 4PA4A 4RAIA 1BL8A 3ABKC 4FIPC 4PDRA 2WLMA 1I5YA 1PKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1C A;  4X88 A;  4GX2 A;  3SPJ A;  4MVM A;  3LNM B;  4XDK A;  1R3L C;  2DYS C;  2HVJ C;  3LUT B;  4GX0 A;  4R7C A;  3K08 A;  3SPC A;  4JTC B;  3SYC A;  3F5W C;  3OR7 C;  4J9Y B;  5EK0 A;  3K04 A;  3K0G A;  2AHZ A;  4MVU A;  4JTD B;  4R6Z A;  4OXS A;  3F7Y C;  3AG4 C;  3K06 A;  2ZXW C;  4PA3 A;  3E83 A;  3KG2 A;  4MTF A;  1LNQ A;  2QKS A;  5BZB A;  2EIK C;  2AHY A;  4MVZ A;  4RO2 A;  4P9P A;  3IGA C;  3OUF A;  3T2M A;  3FB5 C;  4PDV A;  4X89 A;  4PDL A;  4I9W A;  1OCR C;  2IH3 C;  2WLJ A;  4CBC A;  2HJF C;  3SYA A;  5EC2 C;  2WLI A;  3OGC C;  3RVZ A;  4QE7 A;  3EFF K;  3RBZ A;  4WFH A;  4MVS A;  4MS2 A;  3FB8 C;  2Q68 A;  4R50 A;  2A79 B;  1QLE C;  3LDD A;  4BW5 A;  3LDE A;  1V54 C;  4LBE C;  4MVO A;  2OCC C;  2X6B A;  3AG3 C;  3X2Q C;  2KB1 A;  2WLH A;  2X6A A;  4WFE A;  3AG2 C;  4PA7 A;  2Q69 A;  2WLL A;  3OR6 C;  2ITC C;  2IH1 C;  5EBL C;  4DXW A;  2QTO A;  2HFE C;  1V55 C;  4QE9 A;  2EIM C;  4MTG A;  1K4D C;  2Y69 C;  5E1A C;  2X6C A;  1R3J C;  4P2Z A;  5B1A C;  2P7T C;  4J9Z B;  4X8A A;  3JYC A;  4LCU C;  3E8H A;  3ASN C;  1S5H C;  2R9R B;  3E8F A;  5B1B C;  4PA9 A;  4ZBM A;  1P7B A;  1OCC C;  3UM7 A;  4R8C A;  2BOC C;  2WLI B;  1OCO C;  3WG7 C;  4QNH B;  4XDL A;  4UUJ C;  2ATK C;  4H33 A;  2HVK C;  3E8G A;  3SYQ A;  1OCZ C;  3R65 A;  2YEV A;  3HPL C;  3E8B A;  4JTA B;  1XL4 A;  4HYO A;  1G4Y B;  3FB6 C;  2K1E A;  4XDJ A;  2DWD C;  3E89 A;  3K03 A;  2Q67 A;  3K0D A;  2WLL B;  5KUM A;  2NLJ C;  3ASO C;  4MTO A;  4PA6 A;  3F7V C;  4MW8 A;  3TET A;  4G28 B;  4H37 A;  1JVM A;  3SPI A;  4PDM A;  4GX1 A;  4P9O A;  4MSW C;  3TCU A;  3ZRS A;  2EIN C;  3PJS K;  3UKM A;  4LP8 A;  3STZ C;  5KUK A;  1K4C C;  3E86 A;  4WFF A;  3SYO A;  5IY5 C;  2EIL C;  4GX5 A;  3SPH A;  2WLK A;  4MW3 A;  3T4Z A;  3T4D A;  2Q6A A;  3VOU A;  3ZJZ A;  3SPG A;  2HG5 C;  4KFM A;  2WLN A;  3LDC A;  4HZ3 A;  3STL C;  4RUE A;  4F4L A;  5J9P C;  1XL6 A;  2A9H A;  3ABM C;  1R3K C;  3FB7 C;  3IFX A;  5EC1 C;  1KKD A;  2DYR C;  1ORQ C;  3AG1 C;  1M56 C;  2DWE C;  3GB7 C;  5CBH A;  1J95 A;  5CBF A;  2ITD C;  4RUF A;  4TWK A;  1ZWI C;  2BOB C;  4MVQ A;  3SYP A;  2H8P C;  5EBM C;  2A0L A;  2EIJ C;  3ABL C;  3BEH A;  4WFG A;  5EBW C;  1M57 C;  5CBG A;  4PA4 A;  4RAI A;  1BL8 A;  3SJQ C;  4P30 A;  3ABK C;  3OUS A;  2JK5 C;  1R3I C;  2W0F C;  4G27 B;  4MVR A;  4PDR A;  4EKW A;  2WLM A;  5B3S C;  3RVY A;  2ZD9 A;  3RW0 A; 
#chains in the Genus database with same CATH topology
 3T1C A;  3SPJ A;  1AVM A;  4NR1 A;  1OZ0 A;  4K8X A;  3K08 A;  2AZ2 A;  5LYJ B;  4GCZ A;  1N0N A;  1K5S A;  1R6N A;  2V4D A;  4OXS A;  3JD3 A;  4O2B A;  3RYC B;  3HKD A;  2LFS A;  3ZMZ A;  3CCM V;  3QNE A;  2ARH A;  1N36 O;  3SJC C;  1Q6U A;  4E4E A;  3BRC A;  2IJH A;  1ZLZ A;  3I5D A;  5IJ9 B;  2XAG A;  4B3R O;  2UXD O;  1J5E B;  3BHP A;  2UUB B;  3DTU B;  4H44 B;  3OR6 C;  2X7R B;  3U11 A;  4MTG A;  3QTC A;  2X6C A;  4P2Z A;  5IT9 N;  4KHP B;  1BMF G;  4FMT A;  5LA6 A;  3I55 V;  4U7N A;  3IAY A;  2XAF A;  2JGD A;  1MAB G;  4PJ0 Z;  1XNQ B;  4H13 B;  1QR9 A;  1Y66 A;  2YEV A;  4BW9 A;  1KU9 A;  2M6Y A;  4XDJ A;  2UXC B;  3VQX A;  2GV9 A;  1XQ8 A;  3PJS K;  2WPD G;  1O9H A;  5JH7 A;  1SET A;  4GX5 A;  3OFN G;  2B5U A;  2WLN A;  3N27 A;  4F4L A;  1FJG B;  2R72 A;  4IYH A;  1K33 A;  4FM0 A;  2QM7 A;  5JJJ B;  4J7Z A;  1XEQ A;  4WCE V;  5LGN A;  3SYP A;  2ZDI C;  3CC7 V;  4DV0 O;  1COW G;  3BEH A;  1H38 A;  1LUW A;  1FFX A;  3J81 N;  5LXT B;  3OUS A;  2Q7E A;  2MK3 A;  5B66 Z;  4J41 A;  3OMA B;  1VF6 C;  3CPW U;  3LDE A;  4Z2W A;  1HNZ O;  3UT5 B;  4U3J A;  4JF3 A;  3VBB A;  3B77 A;  2F95 B;  4DV7 O;  2X0L A;  4HBN A;  3OR7 C;  4GZR B;  4NYK A;  1I94 B;  4ZI7 A;  2FL4 A;  3ZHQ A;  1XBL A;  1GH6 A;  3OGI B;  2LFR A;  5IWA O;  3JAL A;  1Y76 A;  1IBL B;  4CBC A;  1WP8 A;  1DF5 A;  5H5N A;  2QTS A;  3T1H B;  4FM2 A;  3WG7 B;  3L72 H;  4B3S O;  4DR3 B;  1GM7 A;  2H94 A;  1V54 C;  3A2F A;  1TUB B;  2UUC O;  2R9I A;  4FPP A;  1BT8 A;  4WFE A;  4DUY O;  2WLL A;  3E22 A;  1NI8 A;  1S0V A;  2LP7 A;  3ASN C;  4DV3 B;  1S5H C;  3ZBH A;  4BR6 A;  4LF9 O;  1AR4 A;  2QSA A;  4LF7 O;  5BMV A;  1OJH A;  2EIL B;  4GLX A;  3UM7 A;  4R8C A;  2BOC C;  3Q4H A;  1D5A A;  2QDO A;  4BWA A;  4CH3 A;  3AG7 A;  4X1K A;  2DMX A;  2A06 H;  1G4Y B;  2DYR B;  2K1E A;  2DWD C;  3E89 A;  2UUA O;  2YXL A;  1K34 A;  2XUM A;  1JCH A;  1K4C C;  4YY3 O;  1AI6 A;  2YIC A;  4UCU A;  4X1Y B;  5LP6 B;  2Q7H A;  3AK2 A;  1R3K C;  3IFX A;  3K9S A;  4LH7 A;  1KP3 A;  1QU7 A;  1HR0 B;  1SC5 B;  4D7S A;  2DQ3 A;  2L35 A;  2EZP A;  2JJ1 G;  3KKY A;  2D2C B;  2IJI A;  5KLV H;  4DV4 O;  1YXB A;  2Q0A A;  1FPO A;  2PF4 E;  3H1J H;  2JGU A;  4G2K A;  2YXH A;  4X1I B;  2KKW A;  2DYS C;  1NZ6 A;  1TVK B;  4DV6 O;  3DXR A;  1FD9 A;  5BZB A;  3RGB A;  2Q73 A;  4ZKI A;  3RYI B;  1OCR C;  2RDC A;  4X64 O;  4UCV A;  3S3W A;  1KBH A;  4JI2 B;  2WAM A;  2V7Q G;  1D2D A;  3FKS G;  2YIB A;  2JEX A;  4IGG A;  4BW5 A;  1YIJ V;  1R1B A;  4I0X A;  4JYY A;  2HFE C;  4ABM A;  1XUQ A;  3K58 A;  3CYO A;  4FFK A;  2JJ2 G;  2Q8V A;  3RYF B;  3ASN B;  3JAT B;  5B1B C;  4O4J B;  4JI4 B;  1P7B A;  5IY5 B;  1OCC C;  1XMQ B;  3WB0 A;  3FFQ A;  5JWP A;  1OCZ C;  2GUZ B;  2UXN A;  1F23 A;  2PI4 A;  3A0H Z;  1M56 B;  2Q67 A;  4EFE A;  2YDE A;  1ZSP A;  1GN2 A;  1Q3E A;  1JVM A;  1JMK C;  4Z1V A;  1SQQ H;  5D5Q A;  2R70 A;  4LP8 A;  3MHH C;  2QKA A;  4WFF A;  1YTF B;  4LFB O;  4IIJ A;  3OW2 U;  2GHY A;  2WLK A;  3FAV A;  3ZJZ A;  3F5T A;  2ODM A;  4FLU A;  2ZR3 A;  4K8Z A;  4UCO A;  1XL6 A;  2A7W A;  2YID A;  5EIB C;  1W2B U;  3D8C A;  3ICX A;  2H8P C;  2PUS A;  1AP6 A;  1PP9 H;  3QO8 A;  4GKJ B;  1HP8 A;  5JVD A;  3G67 A;  1X4T A;  3RW0 A;  1CP9 A;  1VQ9 V;  1AJN A;  1H2L A;  3ABT A;  2CTP A;  4KL1 A;  4DR5 O;  1M9N A;  2OCC B;  1VF7 A;  5L3C A;  4J10 A;  4MTF A;  2EIM B;  2EIK C;  4UFZ A;  2JIZ G;  4X89 A;  5KA6 A;  1QVF U;  4ZHQ B;  3CCU V;  4YHH O;  2E3C A;  1AB3 A;  3HKB B;  5EC2 C;  4LF6 B;  3CD6 V;  4LR3 A;  1J5E O;  4DRX A;  3ZHV A;  2JVD A;  4PEL A;  2QA4 V;  4JYA B;  1KMI Z;  3ZED A;  1W0K G;  4DXW A;  4DR2 B;  4K35 A;  4KHP O;  5E1A C;  4JI1 B;  2KQX A;  1SQX H;  2QWN B;  1H2M A;  5CB4 A;  2R9R B;  4LFC B;  1JJO A;  2CAZ C;  5IJ0 A;  1GK9 A;  5ITZ B;  2A3Q A;  4JTA B;  2UXC O;  2RQ6 A;  1H2G A;  5L3G A;  1WPX A;  1Y74 B;  1SQP H;  4X66 B;  1E1R G;  4JI3 B;  3TCU A;  1HDJ A;  3K3W A;  4WBN B;  2CH7 B;  3SYO A;  5F2V O;  2KG7 A;  2P5O A;  5GW7 A;  3JAM N;  2H3O A;  4U7O A;  2GSM B;  1GRJ A;  1FJG O;  4AI8 A;  2ILM A;  3STL C;  3CCJ V;  4JI8 B;  2DWE C;  3GVM A;  2P22 C;  3JD1 A;  2FTK A;  1VQK V;  5EBW C;  4YIP A;  2AW9 A;  4PDR A;  4X62 B;  1IDS A;  1D5N A;  3DGE A;  3RT3 C;  2HP8 A;  4J9Y B;  1I94 O;  2GDS A;  2Z3Y A;  4CS4 A;  1G8M A;  2AXT Z;  4DV1 O;  4DW0 A;  4L87 A;  1V55 B;  2HLD G;  3CXH F;  3VQY A;  3IGA C;  3OUF A;  4FLX A;  4IHJ A;  1IBL O;  4OPA A;  4NTW A;  3O9O A;  1ZL8 A;  5LGT A;  2IH3 C;  2WLJ A;  1N32 B;  4FZ1 A;  4QPK A;  3RVZ A;  5L3D A;  2F1M A;  5IYD O;  4TOI A;  4DR3 O;  4FFB A;  1DK1 A;  1QHT A;  2MW2 B;  4NXM O;  5E79 Z;  4LNU A;  2CGO A;  3ZIA G;  1PL0 A;  3CCR V;  4DR6 B;  1SQF A;  4CH6 A;  4QE9 A;  2QR4 A;  3CE2 A;  2CE4 A;  2EIN B;  4PA9 A;  2LW7 A;  3JAS A;  1PL4 A;  3UCS C;  1SA0 B;  5A9G A;  1F4M A;  1JR9 A;  1MG1 A;  1TGO A;  1EZV H;  2LGW A;  4G28 B;  3SJA C;  3ABL B;  4K3A A;  1VQM V;  2RN9 A;  2UXB B;  2B1G A;  1SF9 A;  3RN4 A;  1E1Q G;  2A9H A;  1GM8 A;  5LYJ A;  4YXW G;  4AQY B;  4DR4 B;  4UCT A;  1J95 A;  4RUF A;  1Z5W A;  2BOB C;  3CP1 A;  4FVM A;  3RYC A;  1P49 A;  1KQS U;  3T1Y O;  3ETE A;  1FXK A;  3RVY A;  3OD4 A;  3BCC H;  1THZ A;  3ZRX A;  4YJ2 A;  3L70 H;  1I0H A;  3JD0 A;  1UJW B;  3SYC A;  1QLE B;  2EBO A;  1Q6I A;  3L75 H;  5EK0 A;  5DEC A;  2JS5 A;  2ZNI A;  3K04 A;  1KD1 W;  1H8H G;  4JTD B;  1VQ7 V;  1KUQ A;  1MSD A;  2ZIM A;  3FB5 C;  5L3E A;  2ZIN A;  1BQ0 A;  4ZOL B;  3E35 A;  1ZX3 A;  4JGS A;  1XMO O;  1HNW O;  2A79 B;  3JD4 A;  5JQG B;  2FB5 A;  2WA4 A;  3ETG A;  2Q69 A;  4WFB V;  2OTJ V;  1MSW D;  1CEZ A;  1PM9 A;  2JS3 A;  4FLT A;  2CK3 G;  2ADQ B;  2Q4P A;  4JI4 O;  1IBK O;  5EIB D;  3NXS A;  1XMQ O;  3H1L H;  1YJN V;  5LBQ A;  3OMN B;  2EX3 A;  3WG7 C;  2PTM A;  1N34 B;  4GKK B;  3KCY A;  5EZY A;  1NH2 D;  5EYP B;  2ETN A;  2VQF B;  3M7M X;  3JAW B;  1NKD A;  1Q81 W;  3AK3 A;  3FYE B;  1M90 W;  4Q20 A;  4YIO A;  5C8Y B;  4I50 A;  1VP7 A;  1AR5 A;  5KUK A;  4DK0 A;  3W7T A;  5GON B;  1K3E A;  2EIL C;  3UO3 A;  5JCO A;  4W4L A;  3UT5 A;  4CC5 A;  3LDC A;  1QCE A;  1Z2G A;  2DYR C;  4UVC A;  1YVW A;  3JCZ A;  4DR7 B;  5K1X A;  1XHZ A;  4F6E A;  1SQV H;  5KA5 A;  3K5N A;  1VQP V;  4WFG A;  4TV9 B;  1XI1 A;  3ZRV A;  4GKJ O;  2CDY A;  2F4V B;  1Q5O A;  1JFF B;  4EKW A;  4O2A B;  2ZCE A;  3ZCC A;  5LP6 C;  1DLB A;  2ZD9 A;  1KKC A;  1YEW A;  1VQ5 V;  4WFA V;  3G71 V;  1R3L C;  3CRR A;  2B9Z A;  1TUB A;  1WB7 A;  3CXC U;  4QJF B;  3F7Y C;  4O2B B;  1N8R W;  1TUE B;  2QJ1 A;  3HKD B;  1NR7 A;  4P9P A;  5KAF Z;  3IC7 A;  4PDV A;  4LF6 O;  2VWK A;  4MTX A;  5FPR A;  2N74 A;  3K5O A;  1Y6X A;  1TAE A;  4WFH A;  4R50 A;  4JYA O;  4L8J A;  4BAY A;  3LDD A;  2DW4 A;  3CCL V;  4DR2 O;  1SRY A;  1Q86 W;  2QWP B;  2Y69 C;  2PZS A;  4JAU A;  4LFC O;  4DW1 A;  3OTF A;  5LA6 B;  3RYH B;  4X65 B;  3D3I A;  2QE7 G;  4I9Q A;  1PNL A;  4X1Y A;  2JGD B;  3R66 A;  4XDL A;  4H33 A;  2YEV B;  4LF5 O;  1AR1 B;  1MNG A;  5FNV A;  3H1I H;  4GYC B;  2YI8 A;  4LWS A;  4JI3 O;  4MW8 A;  5LMN B;  3WB2 A;  2ZDI A;  3A0R A;  3B8M A;  2YC0 A;  3UKM A;  3DC5 A;  4JV5 B;  5JH7 B;  5IY5 C;  2BSK B;  4Z1M G;  1VF6 A;  1QLN A;  5CA1 A;  4RUE A;  2HHH B;  4JI8 O;  1LR1 A;  3IC9 A;  5CN0 A;  1N33 B;  1TVK A;  1M56 C;  2XND G;  1X59 A;  2A0L A;  5J2U B;  1YZB A;  1FFX B;  1GMG A;  2XAH A;  5A2Q N;  2W0X A;  5GTI Z;  4X62 O;  5JJE B;  2JK5 C;  3STZ C;  4B3M B;  2ZKO A;  5IYZ B;  2AGA A;  2HVJ C;  4GX0 A;  3GWO A;  4JI7 B;  2VRZ A;  4BIU A;  1EN5 A;  2IBZ H;  2QM8 A;  2YUA A;  4MVU A;  1QBZ A;  1NS1 A;  2ADP A;  1NT2 B;  1N32 O;  1OHH G;  3JAL B;  4PDL A;  5LMU B;  1VIB A;  3JAT A;  1HNX O;  4I7Z B;  4QE7 A;  2QWR B;  4CH5 A;  4O4H A;  3OEH G;  4O4L B;  4DR6 O;  2OCC C;  2X6B A;  3AG3 C;  1KB9 F;  2ITC C;  1NU1 H;  4DR1 B;  3OM3 B;  3ASO B;  2EIM C;  2NNU A;  3ZN1 A;  5BR8 B;  4UCR A;  4DYL A;  4PI2 A;  2Y69 B;  4LCU C;  3U0Z A;  2XAJ A;  5KHI A;  2QM4 A;  1H8E G;  4CS3 A;  4E2L A;  2UU9 B;  2OIG A;  3Q4H B;  3ZRW B;  4B3T B;  5KX5 A;  3W7S A;  1QVG U;  1FYJ A;  2Q7G A;  1L8D A;  4X1K B;  1FFT B;  3FB6 C;  3BA9 A;  4JAV A;  1E79 G;  1BS3 A;  1GO3 F;  5KMG B;  4NKG B;  3JSN A;  1WNS A;  5B5E Z;  3AK1 A;  2UXB O;  2HKO A;  5FL7 G;  2YXY A;  3CRC A;  1WA8 B;  4K0K O;  3SPH A;  2N05 A;  4KXR A;  2Y4T A;  1LUV A;  1H2S B;  4JYC A;  4AQY O;  4DR4 O;  3JAK A;  1BSM A;  3AG1 C;  2ITD C;  4J42 A;  1VQ6 V;  2DN9 A;  4I4T B;  1F7Y A;  4XBF A;  4RAI A;  1Q90 D;  4YJ3 A;  1I5Y A;  4D6T H;  4JI5 B;  3CCS V;  4B3R B;  2QWO B;  4JTC B;  2Y4U A;  3FD9 A;  2XT9 A;  3DXR B;  4FJC C;  1NVP B;  1EN6 A;  2DOS A;  4TT3 G;  3KG2 A;  5DN6 G;  4LH6 A;  3JAR A;  3C3T A;  2C2A A;  4TQF A;  1ENV A;  3A8T A;  1F51 A;  1AP5 A;  3CRA A;  3N2K B;  4TUY B;  1I5X A;  1YSC A;  2P90 A;  1S5J A;  3SYA A;  3CHX A;  4F6R A;  1Q6H A;  5HFL A;  1OCO B;  4MVS A;  4I55 B;  1ZAU A;  2NR5 A;  2LJ2 A;  4LBE C;  4MVO A;  1CPY A;  4O4I B;  3ML0 A;  2BE3 A;  3AG3 B;  4J11 A;  4LFA B;  3K5M A;  1V55 C;  2HR3 A;  5B1A C;  1M1K W;  2PY5 A;  2E5L B;  3CX5 F;  1QR8 A;  4JZG A;  3CWB H;  4ZBM A;  5LOV A;  1AI7 A;  1N34 O;  3H1H H;  4GKK O;  4FK5 C;  1EN4 A;  3L73 H;  1WPB A;  2CGN A;  4FM1 A;  2VQF O;  4X20 B;  2JEU A;  2UUB O;  3B40 A;  3APO A;  2E75 B;  3CCV V;  3EVK A;  1FXV A;  5KHG A;  3CSX A;  4CS2 A;  2EZO A;  4H37 A;  4KP4 A;  2EIJ B;  3HKE B;  4GX1 A;  4DK1 A;  2EIN C;  2CTR A;  4NTX A;  4OGQ B;  1JX9 A;  2RMK B;  3RWR D;  1XNQ O;  3T4D A;  5B3S B;  3NR7 A;  1HNZ B;  4ICG A;  4HNA B;  2V1D A;  3AG1 B;  4TWK A;  4FLY A;  4MVQ A;  1NQT A;  3AG4 B;  3ABL C;  1K97 A;  1Q43 A;  1PNM A;  3W7U A;  3CJH A;  3SJQ C;  4P30 A;  1JOY A;  2F23 A;  2W0F C;  1URF A;  1S77 D;  1VMG A;  2ZR2 A;  4XDK A;  1DGS A;  4JYB A;  2P06 A;  3BVO A;  3E83 A;  3PN1 A;  2VQE B;  1K92 A;  3FX7 A;  1BE3 H;  4KUM A;  1B04 A;  3DSQ A;  3P32 A;  3K79 A;  4UB6 Z;  2JRI A;  3BAA A;  4LF7 B;  3OGC C;  4EEQ A;  4GUN A;  1VQN V;  1SA0 A;  1IBM B;  4DRX B;  1ZTE A;  5CA0 B;  1WB8 A;  2IW5 A;  1K73 W;  1QLE C;  2OIE A;  1SZX A;  2KB1 A;  2WLH A;  1GN6 A;  2FYU H;  5L3B A;  1VQ8 V;  2UUA B;  4X65 O;  3ZN0 A;  5B1A B;  2P67 A;  4HAM A;  2GTA A;  3T1H O;  5IJ0 B;  5J2T A;  4QNH B;  1DF4 A;  3EXA A;  1XHX A;  3ABM B;  1GN3 A;  2ZE6 A;  4HYO A;  1YTF D;  1GKF A;  5LMN O;  4QPJ A;  1SES A;  3K0D A;  1XNR B;  1H2N A;  3F7V C;  3N2G B;  3HKC A;  4DV3 O;  2Q0O C;  3CEI A;  2QKC A;  3QG5 A;  2KG7 B;  5C93 A;  3H9V A;  2WWW A;  3VOU A;  2HHH O;  1SZT A;  3SPG A;  1IXB A;  3OMI B;  3CMA V;  3LNN A;  3O65 A;  2ZM6 B;  1YIT V;  1F4N A;  1BQZ A;  4DV6 B;  2ZXW B;  2PGG A;  2UXX A;  1FKA O;  3H01 A;  5D5P A;  3WFV A;  5GTH Z;  1R3I C;  3KZI Z;  1FXH A;  2DJV A;  2BTQ B;  1BZK A;  4JI7 O;  3MDS A;  5KAI Z;  1NBM G;  4LC1 A;  1US6 A;  1NJI W;  1HR0 O;  3P3N A;  1VF5 B;  3CS5 A;  4FZ0 A;  1EFR G;  4LF8 B;  4JI0 B;  3D36 C;  2QKS A;  4EB6 B;  1KP2 A;  4IHJ B;  4X9Q A;  1U96 A;  1L1F A;  4I9W A;  3B4S A;  2AZ0 A;  1GM9 A;  3UQ8 A;  5B1O A;  4FFB B;  5IJ9 A;  2PYJ A;  1QQC A;  1DTO A;  3AG2 C;  1Y4M A;  3VQV A;  3ZHT A;  1RSO B;  2QTO A;  3MHS C;  5L3F A;  4TV8 B;  5K1P A;  4PI0 A;  2DE0 X;  5GON A;  2UU9 O;  4JI2 O;  1SS3 A;  3JAS B;  3KCX A;  3L74 H;  1IUR A;  1G6U A;  2WLI B;  2B1I A;  2HVK C;  3E8G A;  3FYI B;  5H6Q A;  3L71 H;  4RQF A;  3K03 A;  3AEI A;  1N0J A;  4MTO A;  1PNK A;  1EM1 A;  3LSU A;  4DV2 B;  1ARO P;  1M57 B;  1H2K A;  2ZIO A;  2RCV A;  4LF4 B;  4UV9 A;  4DO2 A;  4DR5 B;  1Q7Y W;  1SER A;  2IM9 A;  3C3S A;  3QO5 A;  3E2E A;  4JI6 B;  1YF2 A;  1UFI A;  5IYB O;  5LXT A;  1MA1 A;  4G27 B;  4W4K A;  3DC6 A;  4JI5 O;  2K9P A;  1FXK B;  2ZE5 A;  4YHH B;  4X88 A;  5DED A;  1KC8 W;  4YJ2 B;  3LNM B;  4EFB A;  4N21 A;  4R7C A;  3K0G A;  3X2Q B;  1Q82 W;  1VEW A;  3OTO B;  4QIW F;  1LNQ A;  4MVZ A;  1SQG A;  3TXQ A;  3RYH A;  1NTK H;  1XRE A;  1PV0 A;  4BIO A;  3GWK C;  3EFF K;  1GAX A;  4MS2 A;  3P30 A;  1P84 F;  4JAS A;  4LFA O;  1TA8 A;  2F93 B;  1RM1 B;  4OX9 B;  5EBL C;  4I5S A;  3AG2 B;  5BXZ A;  2E5L O;  4X8A A;  4FLW A;  4CH4 A;  2GTS A;  3E8H A;  1VQO V;  3TJT A;  2BSK A;  4UUJ C;  1AJP A;  3SYQ A;  4B08 A;  3E8B A;  3OE7 G;  2ZQM A;  5EZY B;  2CTW A;  2D3O W;  3WU2 Z;  3ASO C;  4JI1 O;  2ZE7 A;  2L6L A;  1KYO F;  2Y0I A;  5J2U A;  4I50 B;  2ZNJ A;  4ZIB A;  2HEP A;  2LQT A;  3ABK B;  2IJK A;  5LP6 A;  3M8A A;  5IYZ A;  5J9P C;  5LHH A;  2RNB A;  1ORQ C;  2O57 A;  3GB7 C;  5CBH A;  1RPO A;  4X66 O;  2OYQ A;  3THO A;  4QGP A;  3ZMV A;  4DV1 B;  1BHA A;  5IDJ A;  1EZJ A;  4PA4 A;  2FKX A;  3ZHR A;  2EUL A;  1JA8 A;  1BGY H;  3TGU H;  1PKX A;  1Y67 A;  5LHG A;  4X1I A;  4O4L A;  1YI2 V;  4NXM B;  1IXM A;  4B7E A;  1NTZ H;  2VQE O;  3TK1 A;  2Z5U A;  3ZMS A;  1WAZ A;  2XHB A;  2BCC H;  4MT8 A;  3T2M A;  1AIL A;  3LSQ A;  3RYI A;  4NXN B;  1MOF A;  1WLE A;  1IBM O;  5B1N A;  1P4R A;  3ZRW A;  1AJQ A;  1S3J A;  4U3J B;  3FB8 C;  2OCH A;  4DUZ B;  2OWO A;  3B8N A;  2X6A A;  3TXS A;  5KMG A;  1M5I A;  1ROP A;  3ZX6 A;  2BTO A;  4UXN A;  3ZMT A;  4ZI7 B;  1NTM H;  1R3J C;  2M7W A;  1W0J G;  1SKV A;  2VWJ A;  3RYF A;  1WA8 A;  1Y76 B;  1VAR A;  4O4J A;  4Q6G A;  1OCO C;  3CCE V;  3R65 A;  1IX9 A;  2GUZ A;  2HJD A;  5FNV B;  2XTA A;  1XNR O;  2ZT9 B;  1GN4 A;  2WLL B;  4LWS B;  1UPG A;  1XOU A;  3E22 B;  2P6J A;  3JSL A;  1CXZ B;  3OEE G;  2QGN A;  4I4T A;  4JZ2 A;  3G4S V;  4PD4 F;  4DV5 B;  3E86 A;  5BMV B;  3T4Z A;  3T1Y B;  1U97 A;  2ZM6 O;  4NB5 A;  5CA1 B;  3FB7 C;  3VQW A;  1FS0 G;  4CC6 A;  3K5L A;  4UCS A;  3ETD A;  3ABU A;  1YJ9 V;  2EIJ C;  1B06 A;  2QWQ B;  5CBG A;  3K57 A;  2P4V A;  3N2K A;  4TUY A;  3OT7 A;  1WJZ A;  5B3S C;  4I55 A;  2CUG A;  1B6Q A;  4TSF G;  3ETQ A;  1XMO B;  1HNW B;  4O4I A;  1AI5 A;  1V54 B;  2AHZ A;  4LF8 O;  4JI0 O;  3K06 A;  3AG4 C;  1GTO A;  1T5E A;  1JQ0 A;  1O9G A;  1MMM A;  3K59 A;  4ZHQ A;  1JJ2 U;  1IBK B;  1BHB A;  2HJF C;  3HKB A;  1N4C A;  3RBZ A;  1N36 B;  3OAA G;  2Q68 A;  2WA3 A;  4X20 A;  4O4H B;  3SDL A;  2WSS G;  4UVA A;  5H9C A;  2ZE8 A;  2UXD B;  4PV1 B;  2IH1 C;  3CC2 V;  5CMU A;  1L0L H;  2IJJ A;  2R9A A;  3HKE A;  2P7T C;  4FLV A;  1V9P A;  3CC4 V;  3CME V;  1K8A W;  1S72 V;  4FLZ A;  1HWY A;  1SQB H;  1YJW V;  3ZMU A;  5KX5 B;  1S76 D;  3HPL C;  1XL4 A;  5ITZ A;  2N04 A;  4HNA A;  4J80 A;  4I0X B;  1Y74 A;  3UO2 A;  4DV2 O;  3QF7 A;  3TET A;  2Q5Z A;  1AI4 A;  3BFR A;  4P9O A;  1MZE A;  3K9A A;  4UV8 A;  1B3Q A;  4J7J A;  3U10 A;  3D3Q A;  3S3X A;  4WBN A;  2Y0P A;  2CH7 A;  3QVN A;  2EJR A;  4MW3 A;  4LF4 O;  1RP3 B;  2IU3 A;  4KFM A;  4WF9 V;  1OV9 A;  3W7W A;  3JAK B;  3ABM C;  2DYS B;  5EC1 C;  3BA8 A;  5CBF A;  1XDC A;  5FPO A;  4RWU A;  4JI6 O;  4JAA A;  2LW1 A;  4BIZ A;  4IT5 A;  1IZ3 A;  4DV0 B;  4YJ3 B;  1OCR B;  4IIJ B;  1Q8I A;  5KHH A;  4GT1 A;  2P4K A;  5JJN B;  5TIS Z;  3FAV B;  4MVM A;  4UB8 Z;  5CA0 A;  2OT5 A;  3CB2 A;  3LUT B;  4DR7 O;  1VQ4 V;  2VS0 A;  3OTO O;  3QO7 A;  4DV7 B;  2ZXW C;  3B09 A;  4PA3 A;  3J80 N;  4NTY A;  2AHY A;  3JAR B;  2W6J G;  2F4V O;  4H0L B;  1QNM A;  2EJ7 A;  5IWA B;  5JVD B;  5B1B B;  5BY1 A;  5LL6 Y;  4F6R B;  2OTL V;  3W7X A;  1OCC B;  3C90 A;  5LHI A;  1OCZ B;  4LF5 B;  3ZS8 C;  2YS8 A;  4B3S B;  4OX9 O;  1YHQ V;  3H1K H;  3A0B Z;  2GBO A;  4N23 A;  3CCQ V;  3N2G A;  2UUC B;  4DUY B;  1K4D C;  4J9Z B;  3JYC A;  3WB1 A;  5AG2 A;  4B7K A;  4OPH A;  2NN4 A;  2Z0A A;  5LOV B;  4IL6 Z;  4LF9 B;  3SGI A;  4UVB A;  1A32 A;  1K7D A;  1L0N H;  1S5L Z;  3B2E E;  4AHC A;  3MAQ A;  3JD2 A;  1NR1 A;  2YSU B;  4PA6 A;  1W59 A;  2XAQ A;  2YIA A;  3SPI A;  4PDM A;  2W6I G;  3IJ4 A;  2JDI G;  4RQE A;  1NH2 B;  5CB4 B;  3JCU Z;  1R73 A;  3ZHU A;  2QEX V;  4CZZ A;  2Q9L A;  4J7K A;  2Q6A A;  3LSS A;  4YY3 B;  2BTQ A;  4IYI A;  4A5U B;  1Z5V A;  4D7T A;  3ZHS A;  1KKD A;  1R6K A;  2XAS A;  3G80 A;  2LO1 A;  1ZWI C;  5H2F Z;  4EB6 A;  1BCC H;  3MD0 A;  2EIK B;  2KSD A;  2YI9 A;  4U3F H;  1M57 C;  3CJH B;  4JV5 O;  3BAB A;  1XIL A;  1NVP D;  4MVR A;  4DV4 B;  3RFR A;  1HNX B;  3I56 V;  4GX2 A;  1WN7 A;  3G6E V;  5KHJ A;  1N33 O;  3SPC A;  1YDX A;  1I08 A;  3F5W C;  2F66 C;  1JPX A;  4JPR A;  1RPR A;  4R6Z A;  1RSO A;  5DM6 V;  4ASU G;  3L9D A;  4RO2 A;  2YIB D;  4TV8 A;  5KHK A;  1EBO A;  1IVS A;  4NXN O;  3SR2 C;  2G38 A;  1FXK C;  1K5Q A;  5IYC O;  1R6T A;  2F43 G;  4ZOL A;  3EHB B;  2WLI A;  2LGQ A;  2RJZ A;  2XOK G;  4X64 B;  4B3M O;  4DUZ O;  1FAF A;  5HFM A;  3G6B A;  2Y48 A;  5JQG A;  3X2Q C;  5FLX N;  4PA7 A;  2CTQ A;  2IU0 A;  3CRQ A;  2PI5 A;  4AIL C;  1MZF A;  1YCI A;  1PPJ H;  5LMU O;  1PD3 A;  4NVP A;  1ZL8 B;  3E8F A;  5J2T B;  2DQ0 A;  2FML A;  4K0K B;  5CA3 A;  2ATK C;  4C7U A;  4PHZ A;  1K9M W;  4LNU B;  5EYP A;  1RFY A;  3JAW A;  4DR1 O;  1RM1 C;  5KUM A;  2NLJ C;  3HR0 A;  1I7F A;  3HKC B;  2PYL A;  1WP7 A;  5BR8 O;  5C8Y A;  3M99 B;  3ZRS A;  4MSW C;  4DV5 O;  2E74 B;  1P7G A;  5H6R A;  3BPZ A;  4B3T O;  3HB3 B;  4TQD A;  4LFB B;  1ZUQ A;  2HG5 C;  4HZ3 A;  5LGU A;  2E76 B;  1KEC A;  1M4U A;  3BY6 A;  3CRM A;  5EBM C;  1G1X B;  1VQL V;  3SJB C;  3P3P A;  3J7A U;  3APQ A;  3D36 A;  1M93 A;  4TV9 A;  5IE9 A;  1BL8 A;  3ABK C;  4FIP C;  1JFF A;  5JCO C;  1HW7 A;  2WLM A;  4O2A A; 
#chains in the Genus database with same CATH homology
 3T1C A;  3DGE A;  3SPJ A;  1OZ0 A;  5LHG A;  3CCS V;  3K08 A;  1YI2 V;  1IXM A;  4JTC B;  4GCZ A;  4J9Y B;  1K5S A;  1R6N A;  2Z3Y A;  4FJC C;  1NVP B;  1G8M A;  4OXS A;  2Z5U A;  3TK1 A;  4TT3 G;  4L87 A;  3KG2 A;  3ZMS A;  3JD3 A;  1V55 B;  2HLD G;  5DN6 G;  4MT8 A;  2C2A A;  3IGA C;  3OUF A;  3T2M A;  1ENV A;  2LFS A;  1F51 A;  3ZMZ A;  3LSQ A;  3CCM V;  3QNE A;  1I5X A;  1YSC A;  5LGT A;  2IH3 C;  2WLJ A;  2P90 A;  1MOF A;  1WLE A;  3SYA A;  4QPK A;  1P4R A;  5B1N A;  1AJQ A;  5L3D A;  2IJH A;  5HFL A;  3RVZ A;  3ZRW A;  5IYD O;  1OCO B;  4MVS A;  1S3J A;  3FB8 C;  2XAG A;  4MVO A;  4LBE C;  3ZIA G;  1CPY A;  3B8N A;  1PL0 A;  3DTU B;  3ML0 A;  3CCR V;  2X6A A;  3AG3 B;  3OR6 C;  2X7R B;  1ROP A;  1V55 C;  4QE9 A;  4UXN A;  3ZMT A;  4MTG A;  2HR3 A;  2X6C A;  1R3J C;  4P2Z A;  5B1A C;  2M7W A;  1M1K W;  1W0J G;  1BMF G;  2EIN B;  1QR8 A;  4FMT A;  4PA9 A;  4ZBM A;  3I55 V;  1AI7 A;  4U7N A;  2XAF A;  4FK5 C;  1OCO C;  3CCE V;  1MAB G;  1QR9 A;  1Y66 A;  3R65 A;  2YEV A;  2JEU A;  1F4M A;  1MG1 A;  4XDJ A;  3CCV V;  1FXV A;  2WLL B;  4G28 B;  2P6J A;  2EZO A;  4H37 A;  4KP4 A;  2EIJ B;  3ABL B;  3OEE G;  4GX1 A;  2EIN C;  3PJS K;  2WPD G;  3G4S V;  3E86 A;  1VQM V;  1JX9 A;  1SET A;  2B1G A;  4GX5 A;  3OFN G;  2B5U A;  3T4Z A;  3T4D A;  5B3S B;  2WLN A;  1E1Q G;  4F4L A;  2A9H A;  3FB7 C;  1GM8 A;  4YXW G;  1FS0 G;  1K33 A;  1J95 A;  2QM7 A;  3ETD A;  3ABU A;  2V1D A;  3AG1 B;  4RUF A;  4TWK A;  1YJ9 V;  2BOB C;  1NQT A;  4MVQ A;  4WCE V;  5LGN A;  3SYP A;  3CP1 A;  2ZDI C;  3AG4 B;  3CC7 V;  2EIJ C;  3ABL C;  1COW G;  3BEH A;  1H38 A;  1K97 A;  1PNM A;  5CBG A;  3W7U A;  3SJQ C;  4P30 A;  1JOY A;  3OUS A;  2W0F C;  1KQS U;  2MK3 A;  5B3S C;  3ETE A;  1FXK A;  3OMA B;  1S77 D;  3CPW U;  3RVY A;  3LDE A;  2ZR2 A;  1THZ A;  3ZRX A;  4JF3 A;  3VBB A;  3B77 A;  1B6Q A;  4XDK A;  3JD0 A;  4TSF G;  1UJW B;  2X0L A;  3SYC A;  1QLE B;  2EBO A;  3OR7 C;  5EK0 A;  1AI5 A;  1V54 B;  3K04 A;  1KD1 W;  2AHZ A;  4JYB A;  1H8H G;  4JTD B;  1VQ7 V;  3K06 A;  3AG4 C;  1GTO A;  3E83 A;  1K92 A;  1JQ0 A;  4KUM A;  2LFR A;  3FB5 C;  5L3E A;  3P32 A;  3K79 A;  4CBC A;  1JJ2 U;  1BHB A;  2HJF C;  1DF5 A;  3OGC C;  3E35 A;  3RBZ A;  1VQN V;  4JGS A;  3WG7 B;  3OAA G;  2Q68 A;  1GM7 A;  2A79 B;  1QLE C;  2IW5 A;  2WSS G;  3JD4 A;  4UVA A;  2H94 A;  1K73 W;  1V54 C;  5H9C A;  3ETG A;  2KB1 A;  2WLH A;  2R9I A;  4FPP A;  4WFE A;  2Q69 A;  2WLL A;  4WFB V;  2OTJ V;  2IH1 C;  3CC2 V;  5CMU A;  1MSW D;  1VQ8 V;  5L3B A;  2IJJ A;  1CEZ A;  2P7T C;  2CK3 G;  1S0V A;  3ZN0 A;  5B1A B;  2LP7 A;  3ASN C;  3CME V;  3CC4 V;  2P67 A;  1K8A W;  1S5H C;  1S72 V;  4HAM A;  3NXS A;  1HWY A;  1YJN V;  1YJW V;  5LBQ A;  2EIL B;  3OMN B;  3UM7 A;  3ZMU A;  4R8C A;  2BOC C;  3WG7 C;  4QNH B;  1DF4 A;  1S76 D;  3HPL C;  1XL4 A;  3ABM B;  1NH2 D;  4HYO A;  1YTF D;  1G4Y B;  2DYR B;  2K1E A;  1GKF A;  1NKD A;  1Q81 W;  2DWD C;  3E89 A;  4QPJ A;  1SES A;  3K0D A;  3FYE B;  1M90 W;  3F7V C;  4Q20 A;  3TET A;  1K34 A;  1AI4 A;  4P9O A;  3K9A A;  4UV8 A;  1JCH A;  5KUK A;  3W7T A;  1K4C C;  1K3E A;  2EIL C;  5C93 A;  1AI6 A;  2WWW A;  2EJR A;  4MW3 A;  3VOU A;  1SZT A;  3SPG A;  2IU3 A;  4KFM A;  4WF9 V;  3LDC A;  1QCE A;  3W7W A;  3OMI B;  3CMA V;  3ABM C;  1R3K C;  3IFX A;  2DYS B;  4UVC A;  2DYR C;  5EC1 C;  3JCZ A;  5CBF A;  1YIT V;  1KP3 A;  1F4N A;  2ZXW B;  5KA5 A;  1VQP V;  2DQ3 A;  4WFG A;  2UXX A;  4BIZ A;  2EZP A;  3H01 A;  3ZRV A;  2JJ1 G;  2IJI A;  3WFV A;  1OCR B;  1R3I C;  4GT1 A;  4EKW A;  1FXH A;  3ZCC A;  2ZD9 A;  1DLB A;  1VQ5 V;  4WFA V;  4G2K A;  4MVM A;  2OT5 A;  3G71 V;  1NBM G;  1R3L C;  2DYS C;  3LUT B;  4LC1 A;  1VQ4 V;  3CXC U;  4QJF B;  3QO7 A;  1NJI W;  3F7Y C;  2ZXW C;  4PA3 A;  1EFR G;  1N8R W;  1TUE B;  2QKS A;  5BZB A;  1NR7 A;  2AHY A;  1KP2 A;  4P9P A;  2W6J G;  1L1F A;  4ZKI A;  3IC7 A;  4PDV A;  4I9W A;  1OCR C;  4MTX A;  1GM9 A;  5B1B B;  2OTL V;  3W7X A;  2WAM A;  1OCC B;  5B1O A;  4WFH A;  5LHI A;  4R50 A;  2V7Q G;  3FKS G;  2JEX A;  1OCZ B;  4BAY A;  3LDD A;  4BW5 A;  1YIJ V;  2DW4 A;  3CCL V;  1SRY A;  1DTO A;  3AG2 C;  1Y4M A;  1YHQ V;  1Q86 W;  2QTO A;  4N23 A;  2HFE C;  3CCQ V;  3MHS C;  1K4D C;  2Y69 C;  3CYO A;  4J9Z B;  5L3F A;  4JAU A;  3JYC A;  2JJ2 G;  3ASN B;  3D3I A;  2QE7 G;  5B1B C;  1P7B A;  5IY5 B;  1PNL A;  1OCC C;  2WLI B;  4XDL A;  2B1I A;  4H33 A;  4UVB A;  2HVK C;  1K7D A;  2YEV B;  3E8G A;  1OCZ C;  3FYI B;  5H6Q A;  2UXN A;  4RQF A;  1F23 A;  1AR1 B;  2PI4 A;  3JD2 A;  1M56 B;  1NR1 A;  3K03 A;  2Q67 A;  2YSU B;  3AEI A;  4MTO A;  4PA6 A;  4MW8 A;  2XAQ A;  1PNK A;  1JVM A;  2ZDI A;  3A0R A;  3SPI A;  4PDM A;  2W6I G;  3B8M A;  2JDI G;  3UKM A;  4LP8 A;  1ARO P;  1M57 B;  3MHH C;  4RQE A;  1NH2 B;  4WFF A;  1YTF B;  5IY5 C;  2GHY A;  1R73 A;  3OW2 U;  2QEX V;  4CZZ A;  4Z1M G;  2WLK A;  2Q6A A;  3LSS A;  3ZJZ A;  1QLN A;  4RUE A;  2ZR3 A;  4UV9 A;  1XL6 A;  5CN0 A;  1KKD A;  4DO2 A;  1W2B U;  1R6K A;  1M56 C;  2XAS A;  1Q7Y W;  1SER A;  1ZWI C;  2XND G;  2H8P C;  2A0L A;  3MD0 A;  3QO5 A;  2EIK B;  3E2E A;  1M57 C;  1GMG A;  2XAH A;  3QO8 A;  5IYB O;  2JK5 C;  4G27 B;  4MVR A;  1NVP D;  1FXK B;  3STZ C;  3RW0 A;  3I56 V;  4X88 A;  1CP9 A;  4GX2 A;  1KC8 W;  3LNM B;  3G6E V;  1AJN A;  1VQ9 V;  3SPC A;  2HVJ C;  3ABT A;  4GX0 A;  3GWO A;  4N21 A;  4R7C A;  4BIU A;  3F5W C;  1JPX A;  1M9N A;  4JPR A;  2OCC B;  3K0G A;  1RPR A;  2QM8 A;  4MVU A;  3X2Q B;  1Q82 W;  1QBZ A;  4R6Z A;  5L3C A;  4MTF A;  4QIW F;  1LNQ A;  5DM6 V;  4ASU G;  2EIM B;  2EIK C;  4RO2 A;  4MVZ A;  1EBO A;  2JIZ G;  1OHH G;  4X89 A;  5KA6 A;  1QVF U;  4PDL A;  3CCU V;  1FXK C;  1K5Q A;  5IYC O;  2F43 G;  5EC2 C;  3EHB B;  2WLI A;  4QE7 A;  3EFF K;  3CD6 V;  2XOK G;  4MS2 A;  5HFM A;  3P30 A;  4PEL A;  2Y48 A;  3OEH G;  2QA4 V;  4JAS A;  2OCC C;  2X6B A;  3AG3 C;  3X2Q C;  4PA7 A;  1RM1 B;  1W0K G;  2ITC C;  4I5S A;  5EBL C;  2IU0 A;  4DXW A;  3AG2 B;  3ASO B;  2EIM C;  3OM3 B;  2PI5 A;  2NNU A;  5E1A C;  4X8A A;  3ZN1 A;  2Y69 B;  4LCU C;  3E8H A;  1PD3 A;  2XAJ A;  1VQO V;  2R9R B;  1H8E G;  3E8F A;  4E2L A;  2DQ0 A;  3ZRW B;  3W7S A;  1QVG U;  5CA3 A;  4UUJ C;  2ATK C;  1AJP A;  3SYQ A;  1GK9 A;  3E8B A;  1K9M W;  4JTA B;  3OE7 G;  2ZQM A;  1FFT B;  2D3O W;  1H2G A;  3FB6 C;  5L3G A;  1RM1 C;  1WPX A;  4JAV A;  1E79 G;  1GO3 F;  2NLJ C;  3ASO C;  5KUM A;  1E1R G;  3M99 B;  3ZRS A;  3TCU A;  4MSW C;  2HKO A;  5FL7 G;  3K3W A;  5H6R A;  3SYO A;  3ABK B;  5GW7 A;  4U7O A;  3SPH A;  3HB3 B;  2GSM B;  2IJK A;  2HG5 C;  4HZ3 A;  3STL C;  5LGU A;  4JYC A;  1KEC A;  5J9P C;  5LHH A;  3CCJ V;  1ORQ C;  3AG1 C;  2DWE C;  3GB7 C;  5CBH A;  1RPO A;  2ITD C;  3BY6 A;  3ZMV A;  5EBM C;  1VQL V;  3JD1 A;  1VQ6 V;  1BHA A;  2FTK A;  3D36 A;  5IDJ A;  1VQK V;  5EBW C;  1EZJ A;  4XBF A;  4PA4 A;  4RAI A;  1BL8 A;  3ABK C;  4FIP C;  4PDR A;  2WLM A;  1I5Y A;  1PKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...