2H8PC

Structure of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords FAB heavy chain
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2h8pC00
4MW8A 4GX5A 4PA3A 1S5HC 3IGAC 4ZBMA 4MS2A 1BL8A 1ZWIC 3ASOC 3SYQA 4R8CA 3SPGA 1M56C 2Q67A 4XDJA 2EILC 2Q69A 3OGCC 2HJFC 3AG4C 4QE9A 2X6CA 1LNQA 3OUSA 3SPCA 4MW3A 3X2QC 4MTFA 4P30A 3K08A 2A0LA 4R6ZA 3K03A 1R3JC 4H37A 4F4LA 1R3KC 1M57C 1G4YB 2ZXWC 4RAIA 3R65A 3WG7C 3E8HA 3OR7C 3SPIA 3SPJA 2QTOA 4JTDB 2HFEC 3KG2A 3AG2C 2EINC 3IFXA 1V55C 5CBHA 2WLIB 3LDCA 5CBGA 2QKSA 1JVMA 3E86A 1J95A 4RO2A 2KB1A 4MVOA 4EKWA 2K1EA 4JTCB 2Y69C 3F5WC 4WFGA 4MVUA 3E8BA 4GX0A 3SYCA 3T4ZA 4BW5A 2WLNA 5EBWC 2WLIA 2JK5C 4PA4A 4JTAB 3RVZA 3SYOA 3K06A 4RUEA 1XL6A 2DYRC 5KUMA 4J9YB 4KFMA 2ZD9A 2IH1C 2AHYA 2OCCC 3FB5C 3FB7C 3K0GA 3T2MA 2WLLA 1OCRC 3K04A 3LNMB 4GX1A 1K4DC 2EIMC 4MTOA 4MVRA 2DWEC 2HG5C 4P2ZA 5EC1C 2AHZA 5B1BC 3STLC 3ZRSA 2WLLB 3K0DA 1R3LC 2DWDC 5KUKA 3HPLC 5B3SC 3SYPA 1V54C 4GX2A 1OCCC 5BZBA 2BOBC 3ASNC 2WLKA 2P7TC 3RW0A 1QLEC 3EFFK 2WLJA 4QNHB 4PDLA 3FB6C 4WFEA 3RBZA 3AG3C 1ORQC 4MVSA 3TETA 3OUFA 1R3IC 1OCZC 5EC2C 4LBEC 4HYOA 2DYSC 4X8AA 2HVJC 3E83A 3F7YC 4J9ZB 4R50A 4G27B 4MVMA 4R7CA 5EBLC 2HVKC 4DXWA 4H33A 3UKMA 2EIJC 1KKDA 2X6AA 2YEVA 3LDDA 4P9PA 3AG1C 3E8FA 3ABKC 1K4CC 2ITCC 4I9WA 5J9PC 3E8GA 4RUFA 3FB8C 2BOCC 4P9OA 2EIKC 2ATKC 4MVQA 2W0FC 1P7BA 3SPHA 2A79B 2H8PC 3GB7C 4MSWC 3JYCA 4G28B 3TCUA 4UUJC 3F7VC 4QE7A 2X6BA 5E1AC 4X89A 4XDLA 4MVZA 2ITDC 3STZC 3SJQC 3UM7A 4WFHA 3PJSK 4PA7A 3SYAA 3E89A 3ZJZA 3LUTB 4HZ3A 5EK0A 4XDKA 2WLMA 2R9RB 4TWKA 3BEHA 3T1CA 3OR6C 5IY5C 4PDVA 4LCUC 2Q6AA 3LDEA 4MTGA 5B1AC 4PDMA 3ABLC 5CBFA 1XL4A 2IH3C 4PA6A 4PA9A 4WFFA 4CBCA 4OXSA 2A9HA 1OCOC 2NLJC 3T4DA 3VOUA 2WLHA 3ABMC 4X88A 4LP8A 4PDRA 3RVYA 2Q68A 5EBMC
chains in the Genus database with same CATH superfamily
4HAMA 3KZIZ 1VF7A 1ZL8A 4UB8Z 4BW9A 4OPHA 1P49A 2FB5A 3DSQA 5LP6C 1VEWA 1SQBH 5L3DA 2YI8A 2W6IG 3PN1A 3FKSG 1XMOO 5D5QA 1AB3A 4X1KA 1NH2D 2ZE7A 3KCXA 2A06H 3E86A 2YXLA 4H13B 2ARHA 3F5WC 4JYCA 2PF4E 5EYPA 1US6A 2Z3YA 4GKKB 4JTAB 5KA6A 4KFMA 2ZXWB 3CRAA 4J7KA 3JARB 1ZX3A 3CPWU 4P2ZA 2R72A 2HLDG 4JI1O 2EINB 3JARA 3KKYA 5BZBA 4GX2A 1XHXA 2QKAA 4WFAV 2Y69B 5EYPB 2ADPA 2DQ3A 4DV0O 1FXKA 2XNDG 5CA0A 1L0NH 2P5OA 2HVKC 4H33A 3TGUH 1W59A 4TSFG 4CS2A 4JI0B 3CCUV 2ITCC 1V55B 1HR0B 4JYBA 3N2KB 2OTLV 4XDLA 1K3EA 2Q8VA 1TUBB 4JI3B 3E89A 2V4DA 4HZ3A 4O4HB 3IC9A 4CC5A 2WLMA 3DC5A 4DO2A 3APOA 1XNRB 1NKDA 2YS8A 1K33A 5A9GA 4FLUA 1Y74A 4X66O 5KX5A 1JMKC 2VQEO 5AG2A 4MW8A 3ZCCA 4KUMA 2VQFO 1AI5A 1LR1A 5B1AB 1M90W 1I94O 4LF8O 1XI1A 2A0LA 2N74A 1IVSA 4X66B 2VWKA 4DR4O 2D2CB 2UUBO 1DF5A 2QWQB 4PELA 2UXCO 5LMUO 3RYIB 1PM9A 2FKXA 1SC5B 4C7UA 1AJQA 2K1EA 3MDSA 1N8RW 1VF6C 2DE0X 3SYCA 1K34A 4DUZB 4MT8A 3T2MA 4WF9V 2RCVA 1E1QG 1JJOA 1S72V 3S3XA 3ZMVA 4N23A 1MOFA 2P4VA 1QLEC 2Q5ZA 2OIEA 3U11A 4CH3A 1UJWB 3UQ8A 1NS1A 4DV0B 3RN4A 2V7QG 4NTXA 3ABKB 3HB3B 4I50B 2Z5UA 1U96A 2FTKA 3MD0A 2EIKC 4FFKA 3G6BA 3JYCA 3LNNA 3E22A 4MVZA 4JF3A 3W7TA 1N33O 1MNGA 1W0JG 3STZC 4LF5O 3PJSK 1IBLB 4DR6O 1GM7A 4QGPA 3BVOA 2BE3A 3CCSV 2W0XA 3BEHA 5GONB 5JJJB 2M6YA 3ABMB 3WB0A 2A9HA 2NLJC 4GKJO 1I94B 2WLHA 3ABUA 4LP8A 2Q0AA 5B5EZ 2JVDA 1PD3A 5A2QN 2VQFB 4U7OA 3CSXA 4R8CA 2E76B 2LW7A 1SQVH 1YEWA 2YXYA 3JAMN 2ZDIA 3AG4C 1HNZB 3K08A 1R3JC 3KCYA 5KAIZ 4I50A 2KSDA 3ZEDA 4WBNA 4JTDB 2Q4PA 2QKCA 3OTFA 1NI8A 1Z5VA 4ZHQB 3WU2Z 2JRIA 4X64B 5IYCO 5H5NA 4D6TH 3BAAA 1PPJH 2ZR3A 2AGAA 2ZD9A 2ZKOA 2AHYA 2EJRA 5B66Z 3FFQA 2F93B 5IWAB 2DWEC 3OEHG 3ZRSA 4F6EA 4AILC 2XAHA 1J5EB 3ASNC 3AG1B 4EFBA 2P7TC 3ABLB 4HNAB 3RW0A 4JI8O 2ZE8A 3JASA 1DGSA 1SZXA 1N0JA 3RT3C 4NR1A 2PGGA 4DV2O 4TT3G 1FFXB 4LBEC 1YVWA 3RYCA 2HVJC 1NVPB 1WPXA 1TGOA 4MVMA 5H2FZ 1KKDA 2Z0AA 3CE2A 4P9PA 1Y67A 2B1GA 4PI2A 1LUWA 5GONA 2CUGA 3GB7C 1KB9F 4K8ZA 1YI2V 3OFNG 3ZS8C 4EFEA 4B3TB 4B3TO 4MTXA 4DR2O 1R73A 3SYAA 2QWPB 1Y74B 3CHXA 1KKCA 3FAVA 1M56B 3U10A 1Z5WA 2UU9B 1KBHA 2IJJA 4PDVA 3X2QB 1NJIW 5DEDA 4NTWA 3W7SA 1N34O 1PNMA 4OPAA 4GKKO 1YHQV 2UXDB 5C93A 4B3SB 2AZ2A 1L1FA 2F4VB 1JFFA 1M4UA 1TUBA 4DYLA 2Q67A 4H0LB 5IYDO 5EIBC 4Q6GA 2N05A 5HFLA 4FK5C 1AI6A 5LHHA 4DR4B 4JV5B 5C8YA 3CP1A 1AR4A 2JS5A 1VQKV 4GZRB 4IIJB 3AG2B 4JZ2A 2P4KA 3F5TA 2IU0A 4DR3B 4FFBA 4OX9O 1TVKA 1NQTA 3I55V 3IC7A 2ETNA 4U3JB 5IJ9B 2UUCO 4MVRA 4K8XA 5B1BC 4JGSA 1BZKA 4LNUA 2F23A 3K79A 5LHIA 3DXRB 3TETA 4NXNO 1XREA 2BTQA 4DV4O 1O9HA 2GHYA 5DN6G 2Q9LA 2X6AA 3BCCH 4AQYO 4NXMO 1YJNV 4JZGA 1XNRO 1IZ3A 3AG3B 5LGUA 5DECA 5LXTA 4JI5O 1QCEA 4W4KA 3B8NA 2OCHA 3JALA 4X20B 3ZJZA 3LUTB 3JATB 1G1XB 1Q86W 1Q43A 2ZNIA 1AROP 1XNQB 4PDMA 2PUSA 2XAQA 3ZN1A 3G4SV 1B06A 3FX7A 2HP8A 5CA0B 1DLBA 1FXKB 4PHZA 4GCZA 4LF4O 1S0VA 3G67A 1M56C 1NH2B 5KHGA 4FJCC 2F1MA 3JD4A 4QNHB 5LOVA 3OUSA 3GWOA 3X2QC 5J2UB 5JVDB 1OHHG 2PTMA 3H1JH 4B7KA 4UCUA 1KECA 5FNVB 1FYJA 3HKDB 4ZOLB 3ML0A 2JDIG 5CBGA 4YJ3B 3D8CA 4HBNA 3K9AA 1RPRA 5K1XA 1VQ9V 4LR3A 1WB7A 4UVCA 1XDCA 1RPOA 4J9YB 3JD0A 4I7ZB 3K04A 5EC1C 4XBFA 3BHPA 5B3SC 4GYCB 3SYPA 5K1PA 3OEEG 3DGEA 1KD1W 2E5LB 3BA8A 5H6RA 2H94A 5FLXN 4ZI7A 5BR8O 4FLZA 1H8HG 1Q81W 1VQPV 4YY3B 3E83A 2QA4V 1WA8B 4DXWA 1H2SB 3EVKA 1KYOF 5FNVA 4LH7A 4ASUG 5JQGB 1B3QA 3APQA 1EN4A 4GT1A 5E79Z 5J2UA 3P30A 3VQYA 1S76D 1GN4A 2OCCB 2QTSA 1HW7A 5IDJA 1JCHA 2ZINA 1HR0O 1Z2GA 2QEXV 2VQEB 2K9PA 4ABMA 3LDEA 4MTGA 3ASNB 4FLXA 1WN7A 2IH3C 4PA6A 1IURA 5CB4A 4F6RB 3AG7A 4DV6O 3C3TA 3M99B 4LF7O 1Y66A 1SERA 3JALB 3LSSA 3K59A 4I4TB 4J80A 1NVPD 2OT5A 3SYQA 3CRRA 1M9NA 2Y0PA 4JI3O 1VQ5V 3RYFB 3ZIAG 3AEIA 1GM9A 3A0HZ 2Q7GA 2QWRB 1LNQA 1RSOA 4W4LA 1HNZO 1AJNA 3AK1A 3JD1A 3K03A 4TV8A 1JJ2U 5CA1A 3QTCA 3CRQA 3TXQA 4IGGA 5CN0A 3AG2C 4YIOA 4DV7B 1GO3F 2WAMA 4B7EA 4EKWA 4JTCB 4TOIA 3FD9A 5ITZA 4JI1B 1N36B 1K5QA 4LFAO 4WCEV 1MSWD 3QNEA 2DYRC 3H1LH 2QM7A 3JCUZ 4NVPA 2IH1C 3FB5C 1BCCH 4DV5B 3L70H 3CXCU 3CMAV 4DR2B 1GTOA 3L75H 1GKFA 5JVDA 5GTIZ 1SZTA 4B3MB 1COWG 1R3IC 2EULA 1WJZA 5KA5A 1WAZA 2JIZG 4DR5B 4J42A 1WB8A 4FM1A 2EIJC 2ZT9B 3LDDA 5LP6A 2E74B 2WA4A 4O4IA 3CD6V 2ATKC 1J5EO 1XOUA 3M8AA 3JAKA 4QE7A 4BIUA 3O65A 4DV2B 3OAAG 1QVFU 4GUNA 2HKOA 1KUQA 2JGUA 1DTOA 4TV9B 1VQ7V 3SJCC 4UVBA 3OR6C 3OM3B 2Q6AA 5B1AC 5LYJA 3CS5A 3W7WA 1RP3B 1Q6IA 3FAVB 2BTQB 4JYAO 3C3SA 2OYQA 3ZMUA 2NNUA 4X1IA 1VF5B 4NTYA 5LA6A 1YSCA 5JJNB 1RM1C 3OGCC 4LNUB 5FL7G 1FKAO 4LF8B 5LBQA 2UUAO 1SQQH 1G4YB 1MABG 2F95B 1VQ4V 2QTOA 1EZJA 2IM9A 1TA8A 4BWAA 1YXBA 1IBMO 1ZTEA 4JI4B 2BSKA 1X4TA 4EB6B 3UO3A 4X1YB 4BW5A 1IBKB 3BA9A 2ZNJA 4WFBV 4DR3O 2CTWA 3RFRA 3ZMZA 1JPXA 2R70A 4QPKA 3JD3A 1PNLA 1IXBA 1HNWB 1ZUQA 2FYUH 1R3LC 2XAJA 2X0LA 2CGNA 1URFA 2WLJA 3B4SA 3RBZA 3ZHRA 2QDOA 1P4RA 5H6QA 4UB6Z 3CCVV 4FLTA 2PYJA 3CYOA 3K57A 2LFSA 3IJ4A 2CTPA 1Q7YW 4OGQB 4ZHQA 2IW5A 2ZR2A 4JAUA 3G71V 3K5MA 1XQ8A 1N32O 3HKBA 4K0KB 4JAAA 5CA1B 4TV8B 2A79B 2DQ0A 5LGNA 2GV9A 1BHAA 4DV5O 2LFRA 4TV9A 1KQSU 1QHTA 3QVNA 1YIJV 3FYEB 1P7GA 3EXAA 4Z1VA 5IYBO 1PL0A 1QLNA 1IBMB 4JI4O 3JAKB 4LWSB 5B3SB 3T1CA 3ZMSA 4NKGB 1ROPA 1XNQO 5LP6B 3AG4B 5IJ0B 2LJ2A 4E4EA 4WFFA 3ZRWA 4J41A 2ZCEA 3NXSA 3N27A 2YIDA 1GMGA 5EBMC 1S3JA 1EBOA 1FFXA 4GX5A 3RYCB 4MS2A 3TK1A 4DRXB 3ZRXA 1K9MW 2EILC 2ADQB 2WWWA 4MW3A 4YIPA 2P6JA 1OJHA 4IYHA 2QR4A 2ZXWC 4RAIA 3E8HA 4NXNB 2ILMA 1Q82W 1WA8A 5J2TB 4JYAB 3HKCA 4BIOA 5CBHA 2CK3G 2DW4A 3UT5B 5IWAO 3A0BZ 3R66A 4E2LA 5ITZB 2Q0OC 3WB1A 3A8TA 1FXVA 3QO8A 4WBNB 3FB7C 4ZKIA 5D5PA 2UUCB 2WLLA 2YXHA 1FD9A 2QM8A 3STLC 3JAWB 1WLEA 2DWDC 3HPLC 1XILA 1RSOB 1QVGU 3CCMV 4QIWF 4PV1B 4PDLA 4X62B 2KG7A 1THZA 4JV5O 2CE4A 3CWBH 3P3NA 1JR9A 5L3EA 1HNXB 3HKDA 1FS0G 4IL6Z 2F4VO 4G2KA 2E5LO 3CC7V 3OTOO 3E8FA 5L3FA 3ABKC 2RQ6A 4JI0O 3VQWA 1N34B 1QQCA 1P7BA 2RMKB 4CZZA 3SJBC 3BFRA 5JCOC 3JCZA 2ZM6B 3U0ZA 2UXDO 1GM8A 1P84F 5JCOA 5EK0A 3CJHB 2UXNA 2PY5A 1RFYA 3ZHVA 2IJHA 1SESA 4EEQA 4CS3A 1AJPA 3T4DA 3VOUA 4JI5B 3JATA 3RVYA 2D3OW 4X20A 1QBZA 2YC0A 2DMXA 2L35A 1M93A 1H2MA 5JWPA 4XDJA 1VF6A 3E2EA 1EFRG 2JGDA 3L72H 2JEXA 1I08A 2BCCH 3CMEV 1YZBA 1PL4A 4B3RO 4LF7B 3MHSC 2WLIB 1X59A 4JI2O 4JI2B 2WLNA 3NR7A 5KUMA 1CP9A 3WG7B 2KKWA 3H1HH 4ZOLA 4DUYB 1OCOB 3TJTA 4LF9B 1Q90D 1OV9A 2PI4A 1JA8A 2WLKA 2IJKA 1Q3EA 4FFBB 5LOVB 4DV3O 3FB6C 1DF4A 2EBOA 3AG3C 1ORQC 4K3AA 1AI7A 1OCZC 1Q8IA 2YIAA 5KX5B 2O57A 2HEPA 2Y0IA 3UKMA 4BAYA 1SQFA 3ETQA 3CCLV 1MZEA 5CA3A 3S3WA 4G28B 5E1AC 1K7DA 1ZL8B 3M7MX 2B5UA 1M5IA 2RJZA 4UCTA 4I0XB 5GTHZ 3N2KA 1YDXA 3OE7G 3FYIB 1F4MA 3AK3A 4LCUC 5CBFA 1XL4A 3W7UA 2YEVB 4K35A 4Z2WA 1XBLA 5FPRA 4IYIA 1UPGA 3CEIA 5LL6Y 2EILB 1SF9A 3B40A 1AP5A 2YDEA 3DXRA 1UFIA 4LFAB 1VQ6V 1FPOA 3BY6A 4P30A 1IXMA 5EZYA 3JD2A 1QR9A 5F2VO 3OR7C 3BPZA 5IJ9A 1L0LH 3SPIA 3ZMTA 5B1OA 4LF6O 1TVKB 2XAGA 4LFCB 4DK1A 1TUEB 1Q5OA 4YJ2B 1FFTB 1N36O 4JI6O 4IIJA 3K9SA 2HJDA 5JJEB 5EBWC 3ABTA 2ZIMA 4HNAA 4X1KB 4UVAA 4FIPC 5C8YB 1YTFD 5LMUB 3JAWA 2Q7EA 1FJGB 2UXBO 1OCCB 4J7JA 2P06A 4TUYA 1I0HA 1HNWO 2OTJV 5KUKA 1OCRB 3CXHF 1NTMH 1QR8A 1HP8A 3OUFA 2AXTZ 2XUMA 3L9DA 3UT5A 1WPBA 2UUBB 4I55A 3H9VA 4O2AB 3ETDA 4ICGA 2EX3A 3D3IA 4JI8B 1S5JA 3B09A 2E75B 1GK9A 3B8MA 3CC4V 1M57B 3OGIB 1R1BA 4UCVA 2GSMB 2X6BA 2CH7A 5GW7A 2CDYA 4PI0A 1S77D 4BIZA 2IBZH 3EHBB 2YIBA 2R9AA 1VARA 1YCIA 2YUAA 3Q4HA 5IJ0A 2ZDIC 1IX9A 3WFVA 4DR5O 3J7AU 3K58A 3A2FA 1H2LA 4Z1MG 1Y4MA 5KLVH 1N32B 1H2KA 3D36C 1T5EA 3G80A 4QE9A 3SPCA 2X6CA 4F4LA 2AZ0A 5L3GA 1R3KC 4B3MO 2W6JG 3ZHUA 4O2BA 1AR5A 5LMNO 3OMAB 5BMVB 3ETEA 3MAQA 4CH5A 3P32A 4LFBB 4FVMA 1K92A 4D7SA 4WFGA 3CB2A 4GX0A 2GUZA 1EM1A 4MVUA 1VMGA 4FLVA 3SYOA 1R6NA 4DUZO 5BMVA 2OCCC 2QGNA 1AR1B 2EIMC 5KAFZ 1A32A 1MMMA 3SJAC 2HR3A 3H01A 2UUAB 4X1YA 2LGWA 4WFEA 1E79G 2HHHO 3K3WA 4DR1O 1H8EG 5BY1A 4EB6A 1QU7A 3SR2C 4DV6B 5LMNB 4J9ZB 4DV4B 1YJ9V 1AVMA 4BR6A 4DV7O 1NU1H 3E35A 3ZRWB 2YIBD 3OTOB 1MSDA 1Q6HA 1QLEB 2WPDG 1MG1A 3ETGA 4MVQA 3SPHA 1IBKO 3Q4HB 1KP2A 1VP7A 4LH6A 4FMTA 2ITDC 2ODMA 3UM7A 2CH7B 4PA7A 1SS3A 3E22B 4X64O 4TQDA 3G6EV 1B04A 1I5YA 4NB5A 4J7ZA 4PA9A 2F43G 3ZHTA 1I5XA 3T1YO 1VQ8V 2XTAA 4O4HA 4PDRA 4CH4A 2ZQMA 1H38A 1R6KA 1K73W 2BTOA 3T1HB 1ZWIC 4X9QA 1KMIZ 3CCQV 1JOYA 1DK1A 2OIGA 4FZ0A 4MTFA 4O4IB 1B6QA 4TUYB 3R65A 1NZ6A 2X7RB 1WP8A 3ZHSA 4DK0A 4B3SO 1VQMV 4DV1B 3DTUB 4CC6A 1GN2A 2FMLA 4LC1A 4D7TA 1JX9A 3E8BA 5IYZB 2WSSG 3T4ZA 1BE3H 4PA4A 3RYIA 3RVZA 1XL6A 4UXNA 3CCEV 2N04A 2LP7A 4X65O 1OCRC 4GX1A 1Q6UA 1SQGA 4AI8A 5EZYB 3JSNA 2LW1A 2IJIA 3ZBHA 2L6LA 1SA0A 1K8AW 4L87A 5HFMA 1W2BU 1W0KG 2CTRA 5KHKA 3F7YC 4DV1O 4R7CA 2EIMB 2YEVA 1RM1B 4LF4B 1I7FA 3E8GA 2W0FC 3D36A 2R9IA 3F7VC 4I0XA 2B9ZA 1EN6A 3T1HO 3VQXA 1CPYA 3K5OA 4GLXA 4TWKA 5CMUA 3SGIA 5JH7A 2QSAA 4DR7B 1VQLV 4JYYA 1SKVA 3N2GB 4U7NA 3THOA 4DUYO 2Q68A 1SQXH 2XASA 3MHHC 2XT9A 1FXHA 2P67A 3SPGA 2XAFA 4PJ0Z 1GAXA 5IT9N 1HDJA 5KHJA 3JSLA 4FZ1A 1EZVH 4FM0A 1Y6XA 1KP3A 1M57C 2Q73A 4JI7B 2Y4TA 4L8JA 3KG2A 3CRCA 5LGTA 2QKSA 4DV3B 4UCOA 1CXZB 4ZI7B 1BQ0A 2WLIA 4OX9B 3K06A 2DYSB 3K0GA 2H3OA 5DM6V 3BRCA 3ZX6A 1K4DC 2JGDB 4KL1A 1SETA 2Q7HA 1F51A 3I5DA 3ICXA 2WLLB 4JI6B 3CRMA 3J81N 4O4LA 2MK3A 5BR8B 4PD4F 4FM2A 3OW2U 2JJ1G 1FAFA 3OMNB 2ZM6O 3BABA 4HYOA 3HKCB 4JASA 3L71H 5EBLC 2XHBA 4O4JB 5B1BB 4LFCO 2ZIOA 4F6RA 4K0KO 2M7WA 2YSUB 4KP4A 3RYHA 3SDLA 1K4CC 3VQVA 5IY5B 3RGBA 2VRZA 2H8PC 4MSWC 4QPJA 3CJHA 2QE7G 4UUJC 4U3FH 4IHJB 2AW9A 3CC2V 1AILA 4WFHA 4LF5B 3W7XA 1YITV 1BHBA 5TISZ 4XDKA 1IDSA 2OWOA 1JQ0A 2G38A 3H1IH 3ABLC 2LQTA 3RYHB 2A7WA 3C90A 3ZN0A 5KMGA 1YF2A 2UXCB 1MA1A 4X88A 4IT5A 2ZE5A 4PA3A 2GTSA 2KG7B 4I9QA 1R6TA 4FLYA 5KHIA 3ZRVA 5LXTB 2HJFC 2VWJA 2KQXA 3AK2A 1TAEA 4H37A 2Y4UA 1F4NA 1BS3A 1KU9A 3I56V 4RO2A 4NYKA 3RWRD 1LUVA 2Y69C 4N21A 4YJ3A 2JK5C 1ENVA 4RUEA 1F7YA 5J2TA 3T1YB 1EN5A 1KC8W 1NBMG 1VQNV 3LNMB 1E1RG 4JAVA 2UXBB 2HG5C 3DC6A 3L73H 2AHZA 2ZE6A 4U3JA 1XHZA 3J80N 1AI4A 3EFFK 3CX5F 1V54B 5IYZA 2EZPA 4MVSA 4DRXA 1Y76A 1H2NA 4YY3O 1YJWV 4X8AA 2DYSC 3K5NA 4GKJB 1H2GA 1WNSA 5FPOA 4LF6B 5L3CA 4KXRA 1NTKH 3AG1C 5L3BA 4LWSA 3TCUA 3B77A 1D2DA 1QNMA 2PYLA 4X1IB 2P90A 2QJ1A 3UO2A 3HKEB 1N0NA 3ASOB 4RWUA 2R9RB 1F23A 5IY5C 1ZAUA 4CH6A 5IE9A 1N33B 4AHCA 1SRYA 4CBCA 3HKBB 1OCOC 2QM4A 2EZOA 4DW0A 2V1DA 2CAZC 1S5HC 1GN6A 3IGAC 4ZBMA 4LFBO 2IU3A 1SA0B 1IBLO 4DR6B 1N4CA 2Q69A 4UCRA 1OCZB 3K5LA 1MZFA 1XMOB 2GTAA 3SPJA 2HFEC 2JS3A 2MW2B 2YI9A 1V55C 1K97A 3QG5A 1J95A 1OZ0A 5H9CA 1G8MA 1PKXA 5LHGA 3JASB 2BSKB 1BSMA 1NTZH 1CEZA 2VS0A 4MTOA 3L74H 4UV9A 1U97A 1FXKC 1SQPH 1NT2B 4RQFA 4I5SA 1XMQB 2F66C 5LA6B 4FLWA 2B1IA 2DYRB 1JFFB 1NR7A 4UFZA 4YHHO 1XMQO 1BMFG 2XOKG 1O9GA 3CCRV 4NXMB 5LYJB 2BOCC 4YXWG 2FL4A 3UCSC 2LGQA 3HKEA 1VIBA 2RDCA 1FJGO 1M1KW 4I4TA 4LF9O 2EIJB 3QF7A 3WB2A 1S5LZ 2QWOB 5CB4B 2DN9A 4DR7O 5BXZA 4B08A 4KHPB 1K5SA 1ZSPA 2GDSA 2WA3A 2CGOA 2YICA 4B3RB 3P3PA 2PZSA 1Y76B 1BL8A 2EJ7A 3ASOC 4IHJA 3VBBA 3OMIB 3GVMA 4TQFA 4R6ZA 5JQGA 4DR1B 2HHHB 4FPPA 3WG7C 3LSUA 3OD4A 2UXXA 1V9PA 4J10A 4ZIBA 3B2EE 4CS4A 3A0RA 4O4JA 4O2AA 2EINC 3IFXA 4I55B 1XUQA 5KHHA 3LDCA 4UCSA 4J11A 2C2AA 1JVMA 2UU9O 2GUZB 2EIKB 2KB1A 4MVOA 3ZHQA 3O9OA 2DJVA 4O4LB 2QWNB 4X65B 3OT7A 4O2BB 1L8DA 4A5UB 3K0DA 2JJ2G 1V54C 1OCCC 2BOBC 1WP7A 1GN3A 2GBOA 3CCJV 4H44B 1D5AA 5B1NA 3RYFA 4X62O 1YTFB 2E3CA 1GH6A 1XEQA 3H1KH 3QO5A 2PI5A 4YJ2A 3D3QA 5EC2C 1G6UA 4YHHB 4DW1A 4R50A 1VQOV 4G27B 1HNXO 2DOSA 4AQYB 3QO7A 2RN9A 1ZLZA 5KMGB 4I9WA 4UV8A 5J9PC 4KHPO 4RUFA 1BQZA 3FB8C 4P9OA 3TXSA 4Q20A 1BT8A 4RQEA 1AP6A 1PV0A 1D5NA 1PNKA 3LSQA 4X89A 4QJFB 2P22C 1NR1A 3SJQC 2NR5A 2A3QA 1PP9H 3GWKC 2JEUA 5EIBD 4JPRA 3N2GA 3IAYA 1HWYA 2RNBA 2CTQA 3HR0A 4JI7O 2LO1A 5JH7B 4OXSA 1GRJA 3ABMC 1BGYH 2NN4A 2Y48A
chains in the Genus database with same CATH topology
2XASA 1QBZA 3MHHC 4GCZA 1FXHA 2P67A 4HAMA 1S0VA 3SPGA 1NH2B 1M56C 2XAFA 4XDJA 4FJCC 3JD4A 4QNHB 3OUSA 3GWOA 3X2QC 3E2EA 5L3DA 1EFRG 1OHHG 2W6IG 1KP3A 1M57C 1KECA 3FKSG 2JEXA 3CMEV 1NH2D 3KG2A 3ML0A 5LGTA 3MHSC 2WLIB 2JDIG 5CBGA 3E86A 2QKSA 3K9AA 1RPRA 1VQ9V 3F5WC 4JYCA 2Z3YA 2WLNA 4UVCA 2WLIA 4JTAB 3K06A 1RPOA 5KUMA 1CP9A 4J9YB 2ZXWB 4KFMA 3WG7B 5KA6A 2DYSB 3K0GA 5DM6V 3JD0A 1OCOB 3K04A 5EC1C 3CPWU 1K4DC 4XBFA 4P2ZA 1SETA 1F51A 2HLDG 2WLLB 2EINB 5B3SC 3SYPA 4GX2A 5BZBA 4WFAV 2PI4A 2WLKA 2Y69B 2IJKA 3OEEG 3DGEA 1KD1W 2MK3A 5H6RA 2H94A 3FB6C 1DF4A 2EBOA 3AG3C 1ORQC 3OW2U 2JJ1G 3OMNB 1AI7A 1OCZC 2DQ3A 1H8HG 1Q81W 1VQPV 4HYOA 1FXKA 2XNDG 3E83A 4JASA 5EBLC 5B1BB 2QA4V 2HVKC 4DXWA 4H33A 3UKMA 4TSFG 4BAYA 2M7WA 2YSUB 4KP4A 3CCUV 1K4CC 2ITCC 3CCLV 1V55B 4ASUG 5IY5B 4GT1A 2H8PC 4MSWC 3P30A 5CA3A 4JYBA 4QPJA 4G28B 2QE7G 2OTLV 4UUJC 5E1AC 4XDLA 1K7DA 1K3EA 3CC2V 2B5UA 1S76D 4WFHA 2OCCB 3W7XA 1YITV 1BHBA 5IDJA 1JCHA 3E89A 4HZ3A 4XDKA 2QEXV 2WLMA 1JQ0A 4DO2A 3OE7G 3FYIB 1F4MA 3LDEA 4LCUC 4MTGA 3ASNB 3ABLC 5CBFA 1XL4A 2IH3C 4PA6A 3ZN0A 3W7UA 2YEVB 1NKDA 1K33A 4X88A 3M99B 1Y66A 1SERA 3LSSA 4MW8A 4PA3A 3ZCCA 1NVPD 4KUMA 2EILB 2OT5A 1AI5A 3SYQA 1M9NA 1VQ5V 3ZIAG 3AEIA 5B1AB 1GM9A 1M90W 1VQ6V 3ZRVA 2HJFC 3BY6A 1LNQA 4P30A 1AJNA 1IXMA 2A0LA 3JD1A 3K03A 4H37A 1JJ2U 3JD2A 1QR9A 3OR7C 3SPIA 1DF5A 4PELA 3ZMTA 1F4NA 5B1OA 5CN0A 3AG2C 2XAGA 1GO3F 1TUEB 2WAMA 3I56V 4RO2A 1AJQA 4EKWA 2K1EA 4JTCB 1FFTB 1K5QA 2Y69C 1N8RW 3SYCA 4N21A 5EBWC 3ABTA 4WCEV 2JK5C 1MSWD 3QNEA 1ENVA 4RUEA 2DYRC 4UVAA 1K34A 2QM7A 4FIPC 1KC8W 2IH1C 4MT8A 3FB5C 1NBMG 3T2MA 4WF9V 1YTFD 1VQNV 1E1QG 3CXCU 1S72V 3LNMB 3CMAV 1E1RG 4JAVA 1OCCB 2HG5C 1GTOA 2AHZA 1GKFA 3ZMVA 2OTJV 4N23A 1OCRB 5KUKA 1MOFA 1AI4A 1QLEC 3EFFK 1V54B 1QR8A 1SZTA 2EZPA 1UJWB 1COWG 4MVSA 3OUFA 1R3IC 1YJWV 5KA5A 4X8AA 2DYSC 2JIZG 2V7QG 1H2GA 3ABKB 3ETDA 3HB3B 2EIJC 3D3IA 3LDDA 5L3CA 3AG1C 2Z5UA 2FTKA 1GK9A 3MD0A 3B8MA 2EIKC 3CD6V 3CC4V 2ATKC 5L3BA 1M57B 3JYCA 3TCUA 4QE7A 2GSMB 2X6BA 3B77A 4BIUA 4MVZA 5GW7A 4JF3A 3W7TA 1W0JG 2P90A 3OAAG 3STZC 1QVFU 2HKOA 3PJSK 1S77D 4BIZA 1DTOA 3EHBB 1VQ7V 1GM7A 3ASOB 4UVBA 3CCSV 2R9RB 1F23A 3BEHA 3OR6C 5IY5C 3OM3B 2Q6AA 5B1AC 2ZDIC 3W7WA 1SRYA 3ABMB 4CBCA 3WFVA 2A9HA 1OCOC 2NLJC 2WLHA 4Z1MG 3ABUA 1Y4MA 4LP8A 2EZOA 2V1DA 1PD3A 1S5HC 3IGAC 4ZBMA 3ZMUA 2NNUA 4U7OA 2IU3A 4R8CA 1YSCA 1RM1C 2Q69A 3OGCC 4QE9A 2ZDIA 3AG4C 5FL7G 2X6CA 3SPCA 3K08A 5LBQA 1OCZB 1R3JC 4F4LA 5L3GA 1R3KC 2W6JG 1G4YB 1MABG 3OMAB 2D3OW 3SPJA 2QTOA 3ETEA 1EZJA 2HFEC 4JTDB 1VQ4V 1V55C 5IYCO 3P32A 1K97A 1J95A 1OZ0A 1K92A 5H9CA 1G8MA 4WFGA 4MVUA 1PKXA 4GX0A 5LHGA 4BW5A 3SYOA 1CEZA 4WFBV 1R6NA 2ZR3A 2ZD9A 3ZMZA 1JPXA 2AHYA 2EJRA 2OCCC 4QPKA 3JD3A 1AR1B 1PNLA 4MTOA 2EIMC 4UV9A 2DWEC 3OEHG 3ZRSA 1FXKC 4RQFA 1R3LC 2XAJA 2X0LA 2HR3A 2XAHA 4I5SA 3ASNC 3AG1B 2P7TC 3ABLB 3H01A 3RW0A 2WLJA 2B1IA 4WFEA 1E79G 3RBZA 1P4RA 3K3WA 5H6QA 1H8EG 2DYRB 4TT3G 3CCVV 3CYOA 4LBEC 2LFSA 1NR7A 2HVJC 1Q7YW 1NVPB 1WPXA 4J9ZB 4MVMA 2IW5A 2ZR2A 4JAUA 1YJ9V 3G71V 1KKDA 1BMFG 2XOKG 3E35A 3ZRWB 4P9PA 3CCRV 2B1GA 1QLEB 2BOCC 1MG1A 2WPDG 4YXWG 3ETGA 4MVQA 3SPHA 2A79B 2DQ0A 3GB7C 1KP2A 5LGNA 1BHAA 2LFRA 3OFNG 1YI2V 4FMTA 2ITDC 1KQSU 4MTXA 1YIJV 3UM7A 1R73A 3FYEB 1M1KW 4PA7A 1PL0A 5IYBO 3SYAA 2EIJB 1QLNA 1M56B 5B3SB 3T1CA 3ZMSA 3G6EV 2IJJA 4PDVA 1ROPA 3X2QB 1I5YA 1NJIW 3AG4B 1K5SA 4PA9A 2F43G 4WFFA 3ZRWA 3W7SA 1PNMA 1I5XA 1YHQV 1VQ8V 5C93A 3NXSA 1GMGA 4PDRA 2ZQMA 1L1FA 5EBMC 1S3JA 1EBOA 4GX5A 1R6KA 1H38A 1K73W 4MS2A 1BL8A 3TK1A 1ZWIC 3ASOC 3ZRXA 1K9MW 3CCQV 1JOYA 2Q67A 2EILC 3OMIB 3VBBA 5IYDO 2WWWA 4MW3A 4MTFA 4R6ZA 2P6JA 1B6QA 2ZXWC 4FPPA 3R65A 4RAIA 3E8HA 3WG7C 5HFLA 4FK5C 1AI6A 2UXXA 2X7RB 5LHHA 1VQMV 3CP1A 1Q82W 3A0RA 1VQKV 2EINC 3IFXA 5CBHA 2CK3G 3LDCA 3DTUB 2C2AA 1JVMA 2DW4A 2EIKB 2KB1A 4MVOA 3AG2B 4E2LA 4LC1A 1JX9A 3E8BA 2WSSG 3T4ZA 4PA4A 2IU0A 3RVZA 1XL6A 4UXNA 1FXVA 1NQTA 3I55V 3QO8A 3CCEV 2LP7A 3FB7C 3IC7A 4ZKIA 2WLLA 1OCRC 4GX1A 4MVRA 5B1BC 2QM8A 3STLC 3K0DA 1WLEA 2DWDC 3HPLC 2JJ2G 1V54C 1OCCC 2BOBC 4JGSA 1QVGU 3CCJV 3CCMV 4QIWF 2IJIA 3K79A 5LHIA 5B1NA 4PDLA 1YTFB 3TETA 3QO5A 1K8AW 2PI5A 4L87A 5EC2C 5HFMA 1THZA 1W2BU 1W0KG 3F7YC 2GHYA 4R50A 1VQOV 4G27B 4R7CA 5DN6G 2EIMB 5L3EA 1FS0G 4G2KA 2X6AA 2YEVA 3QO7A 3CC7V 1RM1B 3E8FA 1YJNV 5L3FA 3ABKC 4I9WA 4UV8A 5J9PC 3E8GA 4RUFA 3FB8C 4P9OA 4Q20A 3AG3B 5LGUA 2W0FC 1P7BA 3D36A 2R9IA 4RQEA 3F7VC 4CZZA 4X89A 1PNKA 3LSQA 4QJFB 1QCEA 1NR1A 3SJQC 3B8NA 1CPYA 3JCZA 1GM8A 3ZJZA 3LUTB 5EK0A 1Q86W 2UXNA 2JEUA 4TWKA 5CMUA 1AROP 4JPRA 4PDMA 1VQLV 1HWYA 2IJHA 1SESA 2XAQA 3ZN1A 1AJPA 4U7NA 3G4SV 4OXSA 3T4DA 3VOUA 1DLBA 3ABMC 1FXKB 3RVYA 2Q68A 2Y48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW8 A;  4GX5 A;  4PA3 A;  1S5H C;  3IGA C;  4ZBM A;  4MS2 A;  1BL8 A;  1ZWI C;  3ASO C;  3SYQ A;  4R8C A;  3SPG A;  1M56 C;  2Q67 A;  4XDJ A;  2EIL C;  2Q69 A;  3OGC C;  2HJF C;  3AG4 C;  4QE9 A;  2X6C A;  1LNQ A;  3OUS A;  3SPC A;  4MW3 A;  3X2Q C;  4MTF A;  4P30 A;  3K08 A;  2A0L A;  4R6Z A;  3K03 A;  1R3J C;  4H37 A;  4F4L A;  1R3K C;  1M57 C;  1G4Y B;  2ZXW C;  4RAI A;  3R65 A;  3WG7 C;  3E8H A;  3OR7 C;  3SPI A;  3SPJ A;  2QTO A;  4JTD B;  2HFE C;  3KG2 A;  3AG2 C;  2EIN C;  3IFX A;  1V55 C;  5CBH A;  2WLI B;  3LDC A;  5CBG A;  2QKS A;  1JVM A;  3E86 A;  1J95 A;  4RO2 A;  2KB1 A;  4MVO A;  4EKW A;  2K1E A;  4JTC B;  2Y69 C;  3F5W C;  4WFG A;  4MVU A;  3E8B A;  4GX0 A;  3SYC A;  3T4Z A;  4BW5 A;  2WLN A;  5EBW C;  2WLI A;  2JK5 C;  4PA4 A;  4JTA B;  3RVZ A;  3SYO A;  3K06 A;  4RUE A;  1XL6 A;  2DYR C;  5KUM A;  4J9Y B;  4KFM A;  2ZD9 A;  2IH1 C;  2AHY A;  2OCC C;  3FB5 C;  3FB7 C;  3K0G A;  3T2M A;  2WLL A;  1OCR C;  3K04 A;  3LNM B;  4GX1 A;  1K4D C;  2EIM C;  4MTO A;  4MVR A;  2DWE C;  2HG5 C;  4P2Z A;  5EC1 C;  2AHZ A;  5B1B C;  3STL C;  3ZRS A;  2WLL B;  3K0D A;  1R3L C;  2DWD C;  5KUK A;  3HPL C;  5B3S C;  3SYP A;  1V54 C;  4GX2 A;  1OCC C;  5BZB A;  2BOB C;  3ASN C;  2WLK A;  2P7T C;  3RW0 A;  1QLE C;  3EFF K;  2WLJ A;  4QNH B;  4PDL A;  3FB6 C;  4WFE A;  3RBZ A;  3AG3 C;  1ORQ C;  4MVS A;  3TET A;  3OUF A;  1R3I C;  1OCZ C;  5EC2 C;  4LBE C;  4HYO A;  2DYS C;  4X8A A;  2HVJ C;  3E83 A;  3F7Y C;  4J9Z B;  4R50 A;  4G27 B;  4MVM A;  4R7C A;  5EBL C;  2HVK C;  4DXW A;  4H33 A;  3UKM A;  2EIJ C;  1KKD A;  2X6A A;  2YEV A;  3LDD A;  4P9P A;  3AG1 C;  3E8F A;  3ABK C;  1K4C C;  2ITC C;  4I9W A;  5J9P C;  3E8G A;  4RUF A;  3FB8 C;  2BOC C;  4P9O A;  2EIK C;  2ATK C;  4MVQ A;  2W0F C;  1P7B A;  3SPH A;  2A79 B;  2H8P C;  3GB7 C;  4MSW C;  3JYC A;  4G28 B;  3TCU A;  4UUJ C;  3F7V C;  4QE7 A;  2X6B A;  5E1A C;  4X89 A;  4XDL A;  4MVZ A;  2ITD C;  3STZ C;  3SJQ C;  3UM7 A;  4WFH A;  3PJS K;  4PA7 A;  3SYA A;  3E89 A;  3ZJZ A;  3LUT B;  4HZ3 A;  5EK0 A;  4XDK A;  2WLM A;  2R9R B;  4TWK A;  3BEH A;  3T1C A;  3OR6 C;  5IY5 C;  4PDV A;  4LCU C;  2Q6A A;  3LDE A;  4MTG A;  5B1A C;  4PDM A;  3ABL C;  5CBF A;  1XL4 A;  2IH3 C;  4PA6 A;  4PA9 A;  4WFF A;  4CBC A;  4OXS A;  2A9H A;  1OCO C;  2NLJ C;  3T4D A;  3VOU A;  2WLH A;  3ABM C;  4X88 A;  4LP8 A;  4PDR A;  3RVY A;  2Q68 A;  5EBM C; 
#chains in the Genus database with same CATH topology
 4HAM A;  3KZI Z;  1VF7 A;  1ZL8 A;  4UB8 Z;  4BW9 A;  4OPH A;  1P49 A;  2FB5 A;  3DSQ A;  5LP6 C;  1VEW A;  1SQB H;  5L3D A;  2YI8 A;  2W6I G;  3PN1 A;  3FKS G;  1XMO O;  5D5Q A;  1AB3 A;  4X1K A;  1NH2 D;  2ZE7 A;  3KCX A;  2A06 H;  3E86 A;  2YXL A;  4H13 B;  2ARH A;  3F5W C;  4JYC A;  2PF4 E;  5EYP A;  1US6 A;  2Z3Y A;  4GKK B;  4JTA B;  5KA6 A;  4KFM A;  2ZXW B;  3CRA A;  4J7K A;  3JAR B;  1ZX3 A;  3CPW U;  4P2Z A;  2R72 A;  2HLD G;  4JI1 O;  2EIN B;  3JAR A;  3KKY A;  5BZB A;  4GX2 A;  1XHX A;  2QKA A;  4WFA V;  2Y69 B;  5EYP B;  2ADP A;  2DQ3 A;  4DV0 O;  1FXK A;  2XND G;  5CA0 A;  1L0N H;  2P5O A;  2HVK C;  4H33 A;  3TGU H;  1W59 A;  4TSF G;  4CS2 A;  4JI0 B;  3CCU V;  2ITC C;  1V55 B;  1HR0 B;  4JYB A;  3N2K B;  2OTL V;  4XDL A;  1K3E A;  2Q8V A;  1TUB B;  4JI3 B;  3E89 A;  2V4D A;  4HZ3 A;  4O4H B;  3IC9 A;  4CC5 A;  2WLM A;  3DC5 A;  4DO2 A;  3APO A;  1XNR B;  1NKD A;  2YS8 A;  1K33 A;  5A9G A;  4FLU A;  1Y74 A;  4X66 O;  5KX5 A;  1JMK C;  2VQE O;  5AG2 A;  4MW8 A;  3ZCC A;  4KUM A;  2VQF O;  1AI5 A;  1LR1 A;  5B1A B;  1M90 W;  1I94 O;  4LF8 O;  1XI1 A;  2A0L A;  2N74 A;  1IVS A;  4X66 B;  2VWK A;  4DR4 O;  2D2C B;  2UUB O;  1DF5 A;  2QWQ B;  4PEL A;  2UXC O;  5LMU O;  3RYI B;  1PM9 A;  2FKX A;  1SC5 B;  4C7U A;  1AJQ A;  2K1E A;  3MDS A;  1N8R W;  1VF6 C;  2DE0 X;  3SYC A;  1K34 A;  4DUZ B;  4MT8 A;  3T2M A;  4WF9 V;  2RCV A;  1E1Q G;  1JJO A;  1S72 V;  3S3X A;  3ZMV A;  4N23 A;  1MOF A;  2P4V A;  1QLE C;  2Q5Z A;  2OIE A;  3U11 A;  4CH3 A;  1UJW B;  3UQ8 A;  1NS1 A;  4DV0 B;  3RN4 A;  2V7Q G;  4NTX A;  3ABK B;  3HB3 B;  4I50 B;  2Z5U A;  1U96 A;  2FTK A;  3MD0 A;  2EIK C;  4FFK A;  3G6B A;  3JYC A;  3LNN A;  3E22 A;  4MVZ A;  4JF3 A;  3W7T A;  1N33 O;  1MNG A;  1W0J G;  3STZ C;  4LF5 O;  3PJS K;  1IBL B;  4DR6 O;  1GM7 A;  4QGP A;  3BVO A;  2BE3 A;  3CCS V;  2W0X A;  3BEH A;  5GON B;  5JJJ B;  2M6Y A;  3ABM B;  3WB0 A;  2A9H A;  2NLJ C;  4GKJ O;  1I94 B;  2WLH A;  3ABU A;  4LP8 A;  2Q0A A;  5B5E Z;  2JVD A;  1PD3 A;  5A2Q N;  2VQF B;  4U7O A;  3CSX A;  4R8C A;  2E76 B;  2LW7 A;  1SQV H;  1YEW A;  2YXY A;  3JAM N;  2ZDI A;  3AG4 C;  1HNZ B;  3K08 A;  1R3J C;  3KCY A;  5KAI Z;  4I50 A;  2KSD A;  3ZED A;  4WBN A;  4JTD B;  2Q4P A;  2QKC A;  3OTF A;  1NI8 A;  1Z5V A;  4ZHQ B;  3WU2 Z;  2JRI A;  4X64 B;  5IYC O;  5H5N A;  4D6T H;  3BAA A;  1PPJ H;  2ZR3 A;  2AGA A;  2ZD9 A;  2ZKO A;  2AHY A;  2EJR A;  5B66 Z;  3FFQ A;  2F93 B;  5IWA B;  2DWE C;  3OEH G;  3ZRS A;  4F6E A;  4AIL C;  2XAH A;  1J5E B;  3ASN C;  3AG1 B;  4EFB A;  2P7T C;  3ABL B;  4HNA B;  3RW0 A;  4JI8 O;  2ZE8 A;  3JAS A;  1DGS A;  1SZX A;  1N0J A;  3RT3 C;  4NR1 A;  2PGG A;  4DV2 O;  4TT3 G;  1FFX B;  4LBE C;  1YVW A;  3RYC A;  2HVJ C;  1NVP B;  1WPX A;  1TGO A;  4MVM A;  5H2F Z;  1KKD A;  2Z0A A;  3CE2 A;  4P9P A;  1Y67 A;  2B1G A;  4PI2 A;  1LUW A;  5GON A;  2CUG A;  3GB7 C;  1KB9 F;  4K8Z A;  1YI2 V;  3OFN G;  3ZS8 C;  4EFE A;  4B3T B;  4B3T O;  4MTX A;  4DR2 O;  1R73 A;  3SYA A;  2QWP B;  1Y74 B;  3CHX A;  1KKC A;  3FAV A;  1M56 B;  3U10 A;  1Z5W A;  2UU9 B;  1KBH A;  2IJJ A;  4PDV A;  3X2Q B;  1NJI W;  5DED A;  4NTW A;  3W7S A;  1N34 O;  1PNM A;  4OPA A;  4GKK O;  1YHQ V;  2UXD B;  5C93 A;  4B3S B;  2AZ2 A;  1L1F A;  2F4V B;  1JFF A;  1M4U A;  1TUB A;  4DYL A;  2Q67 A;  4H0L B;  5IYD O;  5EIB C;  4Q6G A;  2N05 A;  5HFL A;  4FK5 C;  1AI6 A;  5LHH A;  4DR4 B;  4JV5 B;  5C8Y A;  3CP1 A;  1AR4 A;  2JS5 A;  1VQK V;  4GZR B;  4IIJ B;  3AG2 B;  4JZ2 A;  2P4K A;  3F5T A;  2IU0 A;  4DR3 B;  4FFB A;  4OX9 O;  1TVK A;  1NQT A;  3I55 V;  3IC7 A;  2ETN A;  4U3J B;  5IJ9 B;  2UUC O;  4MVR A;  4K8X A;  5B1B C;  4JGS A;  1BZK A;  4LNU A;  2F23 A;  3K79 A;  5LHI A;  3DXR B;  3TET A;  4NXN O;  1XRE A;  2BTQ A;  4DV4 O;  1O9H A;  2GHY A;  5DN6 G;  2Q9L A;  2X6A A;  3BCC H;  4AQY O;  4NXM O;  1YJN V;  4JZG A;  1XNR O;  1IZ3 A;  3AG3 B;  5LGU A;  5DEC A;  5LXT A;  4JI5 O;  1QCE A;  4W4K A;  3B8N A;  2OCH A;  3JAL A;  4X20 B;  3ZJZ A;  3LUT B;  3JAT B;  1G1X B;  1Q86 W;  1Q43 A;  2ZNI A;  1ARO P;  1XNQ B;  4PDM A;  2PUS A;  2XAQ A;  3ZN1 A;  3G4S V;  1B06 A;  3FX7 A;  2HP8 A;  5CA0 B;  1DLB A;  1FXK B;  4PHZ A;  4GCZ A;  4LF4 O;  1S0V A;  3G67 A;  1M56 C;  1NH2 B;  5KHG A;  4FJC C;  2F1M A;  3JD4 A;  4QNH B;  5LOV A;  3OUS A;  3GWO A;  3X2Q C;  5J2U B;  5JVD B;  1OHH G;  2PTM A;  3H1J H;  4B7K A;  4UCU A;  1KEC A;  5FNV B;  1FYJ A;  3HKD B;  4ZOL B;  3ML0 A;  2JDI G;  5CBG A;  4YJ3 B;  3D8C A;  4HBN A;  3K9A A;  1RPR A;  5K1X A;  1VQ9 V;  4LR3 A;  1WB7 A;  4UVC A;  1XDC A;  1RPO A;  4J9Y B;  3JD0 A;  4I7Z B;  3K04 A;  5EC1 C;  4XBF A;  3BHP A;  5B3S C;  4GYC B;  3SYP A;  5K1P A;  3OEE G;  3DGE A;  1KD1 W;  2E5L B;  3BA8 A;  5H6R A;  2H94 A;  5FLX N;  4ZI7 A;  5BR8 O;  4FLZ A;  1H8H G;  1Q81 W;  1VQP V;  4YY3 B;  3E83 A;  2QA4 V;  1WA8 B;  4DXW A;  1H2S B;  3EVK A;  1KYO F;  5FNV A;  4LH7 A;  4ASU G;  5JQG B;  1B3Q A;  3APQ A;  1EN4 A;  4GT1 A;  5E79 Z;  5J2U A;  3P30 A;  3VQY A;  1S76 D;  1GN4 A;  2OCC B;  2QTS A;  1HW7 A;  5IDJ A;  1JCH A;  2ZIN A;  1HR0 O;  1Z2G A;  2QEX V;  2VQE B;  2K9P A;  4ABM A;  3LDE A;  4MTG A;  3ASN B;  4FLX A;  1WN7 A;  2IH3 C;  4PA6 A;  1IUR A;  5CB4 A;  4F6R B;  3AG7 A;  4DV6 O;  3C3T A;  3M99 B;  4LF7 O;  1Y66 A;  1SER A;  3JAL B;  3LSS A;  3K59 A;  4I4T B;  4J80 A;  1NVP D;  2OT5 A;  3SYQ A;  3CRR A;  1M9N A;  2Y0P A;  4JI3 O;  1VQ5 V;  3RYF B;  3ZIA G;  3AEI A;  1GM9 A;  3A0H Z;  2Q7G A;  2QWR B;  1LNQ A;  1RSO A;  4W4L A;  1HNZ O;  1AJN A;  3AK1 A;  3JD1 A;  3K03 A;  4TV8 A;  1JJ2 U;  5CA1 A;  3QTC A;  3CRQ A;  3TXQ A;  4IGG A;  5CN0 A;  3AG2 C;  4YIO A;  4DV7 B;  1GO3 F;  2WAM A;  4B7E A;  4EKW A;  4JTC B;  4TOI A;  3FD9 A;  5ITZ A;  4JI1 B;  1N36 B;  1K5Q A;  4LFA O;  4WCE V;  1MSW D;  3QNE A;  2DYR C;  3H1L H;  2QM7 A;  3JCU Z;  4NVP A;  2IH1 C;  3FB5 C;  1BCC H;  4DV5 B;  3L70 H;  3CXC U;  3CMA V;  4DR2 B;  1GTO A;  3L75 H;  1GKF A;  5JVD A;  5GTI Z;  1SZT A;  4B3M B;  1COW G;  1R3I C;  2EUL A;  1WJZ A;  5KA5 A;  1WAZ A;  2JIZ G;  4DR5 B;  4J42 A;  1WB8 A;  4FM1 A;  2EIJ C;  2ZT9 B;  3LDD A;  5LP6 A;  2E74 B;  2WA4 A;  4O4I A;  3CD6 V;  2ATK C;  1J5E O;  1XOU A;  3M8A A;  3JAK A;  4QE7 A;  4BIU A;  3O65 A;  4DV2 B;  3OAA G;  1QVF U;  4GUN A;  2HKO A;  1KUQ A;  2JGU A;  1DTO A;  4TV9 B;  1VQ7 V;  3SJC C;  4UVB A;  3OR6 C;  3OM3 B;  2Q6A A;  5B1A C;  5LYJ A;  3CS5 A;  3W7W A;  1RP3 B;  1Q6I A;  3FAV B;  2BTQ B;  4JYA O;  3C3S A;  2OYQ A;  3ZMU A;  2NNU A;  4X1I A;  1VF5 B;  4NTY A;  5LA6 A;  1YSC A;  5JJN B;  1RM1 C;  3OGC C;  4LNU B;  5FL7 G;  1FKA O;  4LF8 B;  5LBQ A;  2UUA O;  1SQQ H;  1G4Y B;  1MAB G;  2F95 B;  1VQ4 V;  2QTO A;  1EZJ A;  2IM9 A;  1TA8 A;  4BWA A;  1YXB A;  1IBM O;  1ZTE A;  4JI4 B;  2BSK A;  1X4T A;  4EB6 B;  3UO3 A;  4X1Y B;  4BW5 A;  1IBK B;  3BA9 A;  2ZNJ A;  4WFB V;  4DR3 O;  2CTW A;  3RFR A;  3ZMZ A;  1JPX A;  2R70 A;  4QPK A;  3JD3 A;  1PNL A;  1IXB A;  1HNW B;  1ZUQ A;  2FYU H;  1R3L C;  2XAJ A;  2X0L A;  2CGN A;  1URF A;  2WLJ A;  3B4S A;  3RBZ A;  3ZHR A;  2QDO A;  1P4R A;  5H6Q A;  4UB6 Z;  3CCV V;  4FLT A;  2PYJ A;  3CYO A;  3K57 A;  2LFS A;  3IJ4 A;  2CTP A;  1Q7Y W;  4OGQ B;  4ZHQ A;  2IW5 A;  2ZR2 A;  4JAU A;  3G71 V;  3K5M A;  1XQ8 A;  1N32 O;  3HKB A;  4K0K B;  4JAA A;  5CA1 B;  4TV8 B;  2A79 B;  2DQ0 A;  5LGN A;  2GV9 A;  1BHA A;  4DV5 O;  2LFR A;  4TV9 A;  1KQS U;  1QHT A;  3QVN A;  1YIJ V;  3FYE B;  1P7G A;  3EXA A;  4Z1V A;  5IYB O;  1PL0 A;  1QLN A;  1IBM B;  4JI4 O;  3JAK B;  4LWS B;  5B3S B;  3T1C A;  3ZMS A;  4NKG B;  1ROP A;  1XNQ O;  5LP6 B;  3AG4 B;  5IJ0 B;  2LJ2 A;  4E4E A;  4WFF A;  3ZRW A;  4J41 A;  2ZCE A;  3NXS A;  3N27 A;  2YID A;  1GMG A;  5EBM C;  1S3J A;  1EBO A;  1FFX A;  4GX5 A;  3RYC B;  4MS2 A;  3TK1 A;  4DRX B;  3ZRX A;  1K9M W;  2EIL C;  2ADQ B;  2WWW A;  4MW3 A;  4YIP A;  2P6J A;  1OJH A;  4IYH A;  2QR4 A;  2ZXW C;  4RAI A;  3E8H A;  4NXN B;  2ILM A;  1Q82 W;  1WA8 A;  5J2T B;  4JYA B;  3HKC A;  4BIO A;  5CBH A;  2CK3 G;  2DW4 A;  3UT5 B;  5IWA O;  3A0B Z;  3R66 A;  4E2L A;  5ITZ B;  2Q0O C;  3WB1 A;  3A8T A;  1FXV A;  3QO8 A;  4WBN B;  3FB7 C;  4ZKI A;  5D5P A;  2UUC B;  2WLL A;  2YXH A;  1FD9 A;  2QM8 A;  3STL C;  3JAW B;  1WLE A;  2DWD C;  3HPL C;  1XIL A;  1RSO B;  1QVG U;  3CCM V;  4QIW F;  4PV1 B;  4PDL A;  4X62 B;  2KG7 A;  1THZ A;  4JV5 O;  2CE4 A;  3CWB H;  3P3N A;  1JR9 A;  5L3E A;  1HNX B;  3HKD A;  1FS0 G;  4IL6 Z;  2F4V O;  4G2K A;  2E5L O;  3CC7 V;  3OTO O;  3E8F A;  5L3F A;  3ABK C;  2RQ6 A;  4JI0 O;  3VQW A;  1N34 B;  1QQC A;  1P7B A;  2RMK B;  4CZZ A;  3SJB C;  3BFR A;  5JCO C;  3JCZ A;  2ZM6 B;  3U0Z A;  2UXD O;  1GM8 A;  1P84 F;  5JCO A;  5EK0 A;  3CJH B;  2UXN A;  2PY5 A;  1RFY A;  3ZHV A;  2IJH A;  1SES A;  4EEQ A;  4CS3 A;  1AJP A;  3T4D A;  3VOU A;  4JI5 B;  3JAT A;  3RVY A;  2D3O W;  4X20 A;  1QBZ A;  2YC0 A;  2DMX A;  2L35 A;  1M93 A;  1H2M A;  5JWP A;  4XDJ A;  1VF6 A;  3E2E A;  1EFR G;  2JGD A;  3L72 H;  2JEX A;  1I08 A;  2BCC H;  3CME V;  1YZB A;  1PL4 A;  4B3R O;  4LF7 B;  3MHS C;  2WLI B;  1X59 A;  4JI2 O;  4JI2 B;  2WLN A;  3NR7 A;  5KUM A;  1CP9 A;  3WG7 B;  2KKW A;  3H1H H;  4ZOL A;  4DUY B;  1OCO B;  3TJT A;  4LF9 B;  1Q90 D;  1OV9 A;  2PI4 A;  1JA8 A;  2WLK A;  2IJK A;  1Q3E A;  4FFB B;  5LOV B;  4DV3 O;  3FB6 C;  1DF4 A;  2EBO A;  3AG3 C;  1ORQ C;  4K3A A;  1AI7 A;  1OCZ C;  1Q8I A;  2YIA A;  5KX5 B;  2O57 A;  2HEP A;  2Y0I A;  3UKM A;  4BAY A;  1SQF A;  3ETQ A;  3CCL V;  1MZE A;  5CA3 A;  3S3W A;  4G28 B;  5E1A C;  1K7D A;  1ZL8 B;  3M7M X;  2B5U A;  1M5I A;  2RJZ A;  4UCT A;  4I0X B;  5GTH Z;  3N2K A;  1YDX A;  3OE7 G;  3FYI B;  1F4M A;  3AK3 A;  4LCU C;  5CBF A;  1XL4 A;  3W7U A;  2YEV B;  4K35 A;  4Z2W A;  1XBL A;  5FPR A;  4IYI A;  1UPG A;  3CEI A;  5LL6 Y;  2EIL B;  1SF9 A;  3B40 A;  1AP5 A;  2YDE A;  3DXR A;  1UFI A;  4LFA B;  1VQ6 V;  1FPO A;  3BY6 A;  4P30 A;  1IXM A;  5EZY A;  3JD2 A;  1QR9 A;  5F2V O;  3OR7 C;  3BPZ A;  5IJ9 A;  1L0L H;  3SPI A;  3ZMT A;  5B1O A;  4LF6 O;  1TVK B;  2XAG A;  4LFC B;  4DK1 A;  1TUE B;  1Q5O A;  4YJ2 B;  1FFT B;  1N36 O;  4JI6 O;  4IIJ A;  3K9S A;  2HJD A;  5JJE B;  5EBW C;  3ABT A;  2ZIM A;  4HNA A;  4X1K B;  4UVA A;  4FIP C;  5C8Y B;  1YTF D;  5LMU B;  3JAW A;  2Q7E A;  1FJG B;  2UXB O;  1OCC B;  4J7J A;  2P06 A;  4TUY A;  1I0H A;  1HNW O;  2OTJ V;  5KUK A;  1OCR B;  3CXH F;  1NTM H;  1QR8 A;  1HP8 A;  3OUF A;  2AXT Z;  2XUM A;  3L9D A;  3UT5 A;  1WPB A;  2UUB B;  4I55 A;  3H9V A;  4O2A B;  3ETD A;  4ICG A;  2EX3 A;  3D3I A;  4JI8 B;  1S5J A;  3B09 A;  2E75 B;  1GK9 A;  3B8M A;  3CC4 V;  1M57 B;  3OGI B;  1R1B A;  4UCV A;  2GSM B;  2X6B A;  2CH7 A;  5GW7 A;  2CDY A;  4PI0 A;  1S77 D;  4BIZ A;  2IBZ H;  3EHB B;  2YIB A;  2R9A A;  1VAR A;  1YCI A;  2YUA A;  3Q4H A;  5IJ0 A;  2ZDI C;  1IX9 A;  3WFV A;  4DR5 O;  3J7A U;  3K58 A;  3A2F A;  1H2L A;  4Z1M G;  1Y4M A;  5KLV H;  1N32 B;  1H2K A;  3D36 C;  1T5E A;  3G80 A;  4QE9 A;  3SPC A;  2X6C A;  4F4L A;  2AZ0 A;  5L3G A;  1R3K C;  4B3M O;  2W6J G;  3ZHU A;  4O2B A;  1AR5 A;  5LMN O;  3OMA B;  5BMV B;  3ETE A;  3MAQ A;  4CH5 A;  3P32 A;  4LFB B;  4FVM A;  1K92 A;  4D7S A;  4WFG A;  3CB2 A;  4GX0 A;  2GUZ A;  1EM1 A;  4MVU A;  1VMG A;  4FLV A;  3SYO A;  1R6N A;  4DUZ O;  5BMV A;  2OCC C;  2QGN A;  1AR1 B;  2EIM C;  5KAF Z;  1A32 A;  1MMM A;  3SJA C;  2HR3 A;  3H01 A;  2UUA B;  4X1Y A;  2LGW A;  4WFE A;  1E79 G;  2HHH O;  3K3W A;  4DR1 O;  1H8E G;  5BY1 A;  4EB6 A;  1QU7 A;  3SR2 C;  4DV6 B;  5LMN B;  4J9Z B;  4DV4 B;  1YJ9 V;  1AVM A;  4BR6 A;  4DV7 O;  1NU1 H;  3E35 A;  3ZRW B;  2YIB D;  3OTO B;  1MSD A;  1Q6H A;  1QLE B;  2WPD G;  1MG1 A;  3ETG A;  4MVQ A;  3SPH A;  1IBK O;  3Q4H B;  1KP2 A;  1VP7 A;  4LH6 A;  4FMT A;  2ITD C;  2ODM A;  3UM7 A;  2CH7 B;  4PA7 A;  1SS3 A;  3E22 B;  4X64 O;  4TQD A;  3G6E V;  1B04 A;  1I5Y A;  4NB5 A;  4J7Z A;  4PA9 A;  2F43 G;  3ZHT A;  1I5X A;  3T1Y O;  1VQ8 V;  2XTA A;  4O4H A;  4PDR A;  4CH4 A;  2ZQM A;  1H38 A;  1R6K A;  1K73 W;  2BTO A;  3T1H B;  1ZWI C;  4X9Q A;  1KMI Z;  3CCQ V;  1JOY A;  1DK1 A;  2OIG A;  4FZ0 A;  4MTF A;  4O4I B;  1B6Q A;  4TUY B;  3R65 A;  1NZ6 A;  2X7R B;  1WP8 A;  3ZHS A;  4DK0 A;  4B3S O;  1VQM V;  4DV1 B;  3DTU B;  4CC6 A;  1GN2 A;  2FML A;  4LC1 A;  4D7T A;  1JX9 A;  3E8B A;  5IYZ B;  2WSS G;  3T4Z A;  1BE3 H;  4PA4 A;  3RYI A;  3RVZ A;  1XL6 A;  4UXN A;  3CCE V;  2N04 A;  2LP7 A;  4X65 O;  1OCR C;  4GX1 A;  1Q6U A;  1SQG A;  4AI8 A;  5EZY B;  3JSN A;  2LW1 A;  2IJI A;  3ZBH A;  2L6L A;  1SA0 A;  1K8A W;  4L87 A;  5HFM A;  1W2B U;  1W0K G;  2CTR A;  5KHK A;  3F7Y C;  4DV1 O;  4R7C A;  2EIM B;  2YEV A;  1RM1 B;  4LF4 B;  1I7F A;  3E8G A;  2W0F C;  3D36 A;  2R9I A;  3F7V C;  4I0X A;  2B9Z A;  1EN6 A;  3T1H O;  3VQX A;  1CPY A;  3K5O A;  4GLX A;  4TWK A;  5CMU A;  3SGI A;  5JH7 A;  2QSA A;  4DR7 B;  1VQL V;  4JYY A;  1SKV A;  3N2G B;  4U7N A;  3THO A;  4DUY O;  2Q68 A;  1SQX H;  2XAS A;  3MHH C;  2XT9 A;  1FXH A;  2P67 A;  3SPG A;  2XAF A;  4PJ0 Z;  1GAX A;  5IT9 N;  1HDJ A;  5KHJ A;  3JSL A;  4FZ1 A;  1EZV H;  4FM0 A;  1Y6X A;  1KP3 A;  1M57 C;  2Q73 A;  4JI7 B;  2Y4T A;  4L8J A;  3KG2 A;  3CRC A;  5LGT A;  2QKS A;  4DV3 B;  4UCO A;  1CXZ B;  4ZI7 B;  1BQ0 A;  2WLI A;  4OX9 B;  3K06 A;  2DYS B;  3K0G A;  2H3O A;  5DM6 V;  3BRC A;  3ZX6 A;  1K4D C;  2JGD B;  4KL1 A;  1SET A;  2Q7H A;  1F51 A;  3I5D A;  3ICX A;  2WLL B;  4JI6 B;  3CRM A;  3J81 N;  4O4L A;  2MK3 A;  5BR8 B;  4PD4 F;  4FM2 A;  3OW2 U;  2JJ1 G;  1FAF A;  3OMN B;  2ZM6 O;  3BAB A;  4HYO A;  3HKC B;  4JAS A;  3L71 H;  5EBL C;  2XHB A;  4O4J B;  5B1B B;  4LFC O;  2ZIO A;  4F6R A;  4K0K O;  2M7W A;  2YSU B;  4KP4 A;  3RYH A;  3SDL A;  1K4C C;  3VQV A;  5IY5 B;  3RGB A;  2VRZ A;  2H8P C;  4MSW C;  4QPJ A;  3CJH A;  2QE7 G;  4UUJ C;  4U3F H;  4IHJ B;  2AW9 A;  3CC2 V;  1AIL A;  4WFH A;  4LF5 B;  3W7X A;  1YIT V;  1BHB A;  5TIS Z;  4XDK A;  1IDS A;  2OWO A;  1JQ0 A;  2G38 A;  3H1I H;  3ABL C;  2LQT A;  3RYH B;  2A7W A;  3C90 A;  3ZN0 A;  5KMG A;  1YF2 A;  2UXC B;  1MA1 A;  4X88 A;  4IT5 A;  2ZE5 A;  4PA3 A;  2GTS A;  2KG7 B;  4I9Q A;  1R6T A;  4FLY A;  5KHI A;  3ZRV A;  5LXT B;  2HJF C;  2VWJ A;  2KQX A;  3AK2 A;  1TAE A;  4H37 A;  2Y4U A;  1F4N A;  1BS3 A;  1KU9 A;  3I56 V;  4RO2 A;  4NYK A;  3RWR D;  1LUV A;  2Y69 C;  4N21 A;  4YJ3 A;  2JK5 C;  1ENV A;  4RUE A;  1F7Y A;  5J2T A;  3T1Y B;  1EN5 A;  1KC8 W;  1NBM G;  1VQN V;  3LNM B;  1E1R G;  4JAV A;  2UXB B;  2HG5 C;  3DC6 A;  3L73 H;  2AHZ A;  2ZE6 A;  4U3J A;  1XHZ A;  3J80 N;  1AI4 A;  3EFF K;  3CX5 F;  1V54 B;  5IYZ A;  2EZP A;  4MVS A;  4DRX A;  1Y76 A;  1H2N A;  4YY3 O;  1YJW V;  4X8A A;  2DYS C;  3K5N A;  4GKJ B;  1H2G A;  1WNS A;  5FPO A;  4LF6 B;  5L3C A;  4KXR A;  1NTK H;  3AG1 C;  5L3B A;  4LWS A;  3TCU A;  3B77 A;  1D2D A;  1QNM A;  2PYL A;  4X1I B;  2P90 A;  2QJ1 A;  3UO2 A;  3HKE B;  1N0N A;  3ASO B;  4RWU A;  2R9R B;  1F23 A;  5IY5 C;  1ZAU A;  4CH6 A;  5IE9 A;  1N33 B;  4AHC A;  1SRY A;  4CBC A;  3HKB B;  1OCO C;  2QM4 A;  2EZO A;  4DW0 A;  2V1D A;  2CAZ C;  1S5H C;  1GN6 A;  3IGA C;  4ZBM A;  4LFB O;  2IU3 A;  1SA0 B;  1IBL O;  4DR6 B;  1N4C A;  2Q69 A;  4UCR A;  1OCZ B;  3K5L A;  1MZF A;  1XMO B;  2GTA A;  3SPJ A;  2HFE C;  2JS3 A;  2MW2 B;  2YI9 A;  1V55 C;  1K97 A;  3QG5 A;  1J95 A;  1OZ0 A;  5H9C A;  1G8M A;  1PKX A;  5LHG A;  3JAS B;  2BSK B;  1BSM A;  1NTZ H;  1CEZ A;  2VS0 A;  4MTO A;  3L74 H;  4UV9 A;  1U97 A;  1FXK C;  1SQP H;  1NT2 B;  4RQF A;  4I5S A;  1XMQ B;  2F66 C;  5LA6 B;  4FLW A;  2B1I A;  2DYR B;  1JFF B;  1NR7 A;  4UFZ A;  4YHH O;  1XMQ O;  1BMF G;  2XOK G;  1O9G A;  3CCR V;  4NXM B;  5LYJ B;  2BOC C;  4YXW G;  2FL4 A;  3UCS C;  2LGQ A;  3HKE A;  1VIB A;  2RDC A;  1FJG O;  1M1K W;  4I4T A;  4LF9 O;  2EIJ B;  3QF7 A;  3WB2 A;  1S5L Z;  2QWO B;  5CB4 B;  2DN9 A;  4DR7 O;  5BXZ A;  4B08 A;  4KHP B;  1K5S A;  1ZSP A;  2GDS A;  2WA3 A;  2CGO A;  2YIC A;  4B3R B;  3P3P A;  2PZS A;  1Y76 B;  1BL8 A;  2EJ7 A;  3ASO C;  4IHJ A;  3VBB A;  3OMI B;  3GVM A;  4TQF A;  4R6Z A;  5JQG A;  4DR1 B;  2HHH B;  4FPP A;  3WG7 C;  3LSU A;  3OD4 A;  2UXX A;  1V9P A;  4J10 A;  4ZIB A;  3B2E E;  4CS4 A;  3A0R A;  4O4J A;  4O2A A;  2EIN C;  3IFX A;  4I55 B;  1XUQ A;  5KHH A;  3LDC A;  4UCS A;  4J11 A;  2C2A A;  1JVM A;  2UU9 O;  2GUZ B;  2EIK B;  2KB1 A;  4MVO A;  3ZHQ A;  3O9O A;  2DJV A;  4O4L B;  2QWN B;  4X65 B;  3OT7 A;  4O2B B;  1L8D A;  4A5U B;  3K0D A;  2JJ2 G;  1V54 C;  1OCC C;  2BOB C;  1WP7 A;  1GN3 A;  2GBO A;  3CCJ V;  4H44 B;  1D5A A;  5B1N A;  3RYF A;  4X62 O;  1YTF B;  2E3C A;  1GH6 A;  1XEQ A;  3H1K H;  3QO5 A;  2PI5 A;  4YJ2 A;  3D3Q A;  5EC2 C;  1G6U A;  4YHH B;  4DW1 A;  4R50 A;  1VQO V;  4G27 B;  1HNX O;  2DOS A;  4AQY B;  3QO7 A;  2RN9 A;  1ZLZ A;  5KMG B;  4I9W A;  4UV8 A;  5J9P C;  4KHP O;  4RUF A;  1BQZ A;  3FB8 C;  4P9O A;  3TXS A;  4Q20 A;  1BT8 A;  4RQE A;  1AP6 A;  1PV0 A;  1D5N A;  1PNK A;  3LSQ A;  4X89 A;  4QJF B;  2P22 C;  1NR1 A;  3SJQ C;  2NR5 A;  2A3Q A;  1PP9 H;  3GWK C;  2JEU A;  5EIB D;  4JPR A;  3N2G A;  3IAY A;  1HWY A;  2RNB A;  2CTQ A;  3HR0 A;  4JI7 O;  2LO1 A;  5JH7 B;  4OXS A;  1GRJ A;  3ABM C;  1BGY H;  2NN4 A;  2Y48 A; 
#chains in the Genus database with same CATH homology
 2XAS A;  1QBZ A;  3MHH C;  4GCZ A;  1FXH A;  2P67 A;  4HAM A;  1S0V A;  3SPG A;  1NH2 B;  1M56 C;  2XAF A;  4XDJ A;  4FJC C;  3JD4 A;  4QNH B;  3OUS A;  3GWO A;  3X2Q C;  3E2E A;  5L3D A;  1EFR G;  1OHH G;  2W6I G;  1KP3 A;  1M57 C;  1KEC A;  3FKS G;  2JEX A;  3CME V;  1NH2 D;  3KG2 A;  3ML0 A;  5LGT A;  3MHS C;  2WLI B;  2JDI G;  5CBG A;  3E86 A;  2QKS A;  3K9A A;  1RPR A;  1VQ9 V;  3F5W C;  4JYC A;  2Z3Y A;  2WLN A;  4UVC A;  2WLI A;  4JTA B;  3K06 A;  1RPO A;  5KUM A;  1CP9 A;  4J9Y B;  2ZXW B;  4KFM A;  3WG7 B;  5KA6 A;  2DYS B;  3K0G A;  5DM6 V;  3JD0 A;  1OCO B;  3K04 A;  5EC1 C;  3CPW U;  1K4D C;  4XBF A;  4P2Z A;  1SET A;  1F51 A;  2HLD G;  2WLL B;  2EIN B;  5B3S C;  3SYP A;  4GX2 A;  5BZB A;  4WFA V;  2PI4 A;  2WLK A;  2Y69 B;  2IJK A;  3OEE G;  3DGE A;  1KD1 W;  2MK3 A;  5H6R A;  2H94 A;  3FB6 C;  1DF4 A;  2EBO A;  3AG3 C;  1ORQ C;  3OW2 U;  2JJ1 G;  3OMN B;  1AI7 A;  1OCZ C;  2DQ3 A;  1H8H G;  1Q81 W;  1VQP V;  4HYO A;  1FXK A;  2XND G;  3E83 A;  4JAS A;  5EBL C;  5B1B B;  2QA4 V;  2HVK C;  4DXW A;  4H33 A;  3UKM A;  4TSF G;  4BAY A;  2M7W A;  2YSU B;  4KP4 A;  3CCU V;  1K4C C;  2ITC C;  3CCL V;  1V55 B;  4ASU G;  5IY5 B;  4GT1 A;  2H8P C;  4MSW C;  3P30 A;  5CA3 A;  4JYB A;  4QPJ A;  4G28 B;  2QE7 G;  2OTL V;  4UUJ C;  5E1A C;  4XDL A;  1K7D A;  1K3E A;  3CC2 V;  2B5U A;  1S76 D;  4WFH A;  2OCC B;  3W7X A;  1YIT V;  1BHB A;  5IDJ A;  1JCH A;  3E89 A;  4HZ3 A;  4XDK A;  2QEX V;  2WLM A;  1JQ0 A;  4DO2 A;  3OE7 G;  3FYI B;  1F4M A;  3LDE A;  4LCU C;  4MTG A;  3ASN B;  3ABL C;  5CBF A;  1XL4 A;  2IH3 C;  4PA6 A;  3ZN0 A;  3W7U A;  2YEV B;  1NKD A;  1K33 A;  4X88 A;  3M99 B;  1Y66 A;  1SER A;  3LSS A;  4MW8 A;  4PA3 A;  3ZCC A;  1NVP D;  4KUM A;  2EIL B;  2OT5 A;  1AI5 A;  3SYQ A;  1M9N A;  1VQ5 V;  3ZIA G;  3AEI A;  5B1A B;  1GM9 A;  1M90 W;  1VQ6 V;  3ZRV A;  2HJF C;  3BY6 A;  1LNQ A;  4P30 A;  1AJN A;  1IXM A;  2A0L A;  3JD1 A;  3K03 A;  4H37 A;  1JJ2 U;  3JD2 A;  1QR9 A;  3OR7 C;  3SPI A;  1DF5 A;  4PEL A;  3ZMT A;  1F4N A;  5B1O A;  5CN0 A;  3AG2 C;  2XAG A;  1GO3 F;  1TUE B;  2WAM A;  3I56 V;  4RO2 A;  1AJQ A;  4EKW A;  2K1E A;  4JTC B;  1FFT B;  1K5Q A;  2Y69 C;  1N8R W;  3SYC A;  4N21 A;  5EBW C;  3ABT A;  4WCE V;  2JK5 C;  1MSW D;  3QNE A;  1ENV A;  4RUE A;  2DYR C;  4UVA A;  1K34 A;  2QM7 A;  4FIP C;  1KC8 W;  2IH1 C;  4MT8 A;  3FB5 C;  1NBM G;  3T2M A;  4WF9 V;  1YTF D;  1VQN V;  1E1Q G;  3CXC U;  1S72 V;  3LNM B;  3CMA V;  1E1R G;  4JAV A;  1OCC B;  2HG5 C;  1GTO A;  2AHZ A;  1GKF A;  3ZMV A;  2OTJ V;  4N23 A;  1OCR B;  5KUK A;  1MOF A;  1AI4 A;  1QLE C;  3EFF K;  1V54 B;  1QR8 A;  1SZT A;  2EZP A;  1UJW B;  1COW G;  4MVS A;  3OUF A;  1R3I C;  1YJW V;  5KA5 A;  4X8A A;  2DYS C;  2JIZ G;  2V7Q G;  1H2G A;  3ABK B;  3ETD A;  3HB3 B;  2EIJ C;  3D3I A;  3LDD A;  5L3C A;  3AG1 C;  2Z5U A;  2FTK A;  1GK9 A;  3MD0 A;  3B8M A;  2EIK C;  3CD6 V;  3CC4 V;  2ATK C;  5L3B A;  1M57 B;  3JYC A;  3TCU A;  4QE7 A;  2GSM B;  2X6B A;  3B77 A;  4BIU A;  4MVZ A;  5GW7 A;  4JF3 A;  3W7T A;  1W0J G;  2P90 A;  3OAA G;  3STZ C;  1QVF U;  2HKO A;  3PJS K;  1S77 D;  4BIZ A;  1DTO A;  3EHB B;  1VQ7 V;  1GM7 A;  3ASO B;  4UVB A;  3CCS V;  2R9R B;  1F23 A;  3BEH A;  3OR6 C;  5IY5 C;  3OM3 B;  2Q6A A;  5B1A C;  2ZDI C;  3W7W A;  1SRY A;  3ABM B;  4CBC A;  3WFV A;  2A9H A;  1OCO C;  2NLJ C;  2WLH A;  4Z1M G;  3ABU A;  1Y4M A;  4LP8 A;  2EZO A;  2V1D A;  1PD3 A;  1S5H C;  3IGA C;  4ZBM A;  3ZMU A;  2NNU A;  4U7O A;  2IU3 A;  4R8C A;  1YSC A;  1RM1 C;  2Q69 A;  3OGC C;  4QE9 A;  2ZDI A;  3AG4 C;  5FL7 G;  2X6C A;  3SPC A;  3K08 A;  5LBQ A;  1OCZ B;  1R3J C;  4F4L A;  5L3G A;  1R3K C;  2W6J G;  1G4Y B;  1MAB G;  3OMA B;  2D3O W;  3SPJ A;  2QTO A;  3ETE A;  1EZJ A;  2HFE C;  4JTD B;  1VQ4 V;  1V55 C;  5IYC O;  3P32 A;  1K97 A;  1J95 A;  1OZ0 A;  1K92 A;  5H9C A;  1G8M A;  4WFG A;  4MVU A;  1PKX A;  4GX0 A;  5LHG A;  4BW5 A;  3SYO A;  1CEZ A;  4WFB V;  1R6N A;  2ZR3 A;  2ZD9 A;  3ZMZ A;  1JPX A;  2AHY A;  2EJR A;  2OCC C;  4QPK A;  3JD3 A;  1AR1 B;  1PNL A;  4MTO A;  2EIM C;  4UV9 A;  2DWE C;  3OEH G;  3ZRS A;  1FXK C;  4RQF A;  1R3L C;  2XAJ A;  2X0L A;  2HR3 A;  2XAH A;  4I5S A;  3ASN C;  3AG1 B;  2P7T C;  3ABL B;  3H01 A;  3RW0 A;  2WLJ A;  2B1I A;  4WFE A;  1E79 G;  3RBZ A;  1P4R A;  3K3W A;  5H6Q A;  1H8E G;  2DYR B;  4TT3 G;  3CCV V;  3CYO A;  4LBE C;  2LFS A;  1NR7 A;  2HVJ C;  1Q7Y W;  1NVP B;  1WPX A;  4J9Z B;  4MVM A;  2IW5 A;  2ZR2 A;  4JAU A;  1YJ9 V;  3G71 V;  1KKD A;  1BMF G;  2XOK G;  3E35 A;  3ZRW B;  4P9P A;  3CCR V;  2B1G A;  1QLE B;  2BOC C;  1MG1 A;  2WPD G;  4YXW G;  3ETG A;  4MVQ A;  3SPH A;  2A79 B;  2DQ0 A;  3GB7 C;  1KP2 A;  5LGN A;  1BHA A;  2LFR A;  3OFN G;  1YI2 V;  4FMT A;  2ITD C;  1KQS U;  4MTX A;  1YIJ V;  3UM7 A;  1R73 A;  3FYE B;  1M1K W;  4PA7 A;  1PL0 A;  5IYB O;  3SYA A;  2EIJ B;  1QLN A;  1M56 B;  5B3S B;  3T1C A;  3ZMS A;  3G6E V;  2IJJ A;  4PDV A;  1ROP A;  3X2Q B;  1I5Y A;  1NJI W;  3AG4 B;  1K5S A;  4PA9 A;  2F43 G;  4WFF A;  3ZRW A;  3W7S A;  1PNM A;  1I5X A;  1YHQ V;  1VQ8 V;  5C93 A;  3NXS A;  1GMG A;  4PDR A;  2ZQM A;  1L1F A;  5EBM C;  1S3J A;  1EBO A;  4GX5 A;  1R6K A;  1H38 A;  1K73 W;  4MS2 A;  1BL8 A;  3TK1 A;  1ZWI C;  3ASO C;  3ZRX A;  1K9M W;  3CCQ V;  1JOY A;  2Q67 A;  2EIL C;  3OMI B;  3VBB A;  5IYD O;  2WWW A;  4MW3 A;  4MTF A;  4R6Z A;  2P6J A;  1B6Q A;  2ZXW C;  4FPP A;  3R65 A;  4RAI A;  3E8H A;  3WG7 C;  5HFL A;  4FK5 C;  1AI6 A;  2UXX A;  2X7R B;  5LHH A;  1VQM V;  3CP1 A;  1Q82 W;  3A0R A;  1VQK V;  2EIN C;  3IFX A;  5CBH A;  2CK3 G;  3LDC A;  3DTU B;  2C2A A;  1JVM A;  2DW4 A;  2EIK B;  2KB1 A;  4MVO A;  3AG2 B;  4E2L A;  4LC1 A;  1JX9 A;  3E8B A;  2WSS G;  3T4Z A;  4PA4 A;  2IU0 A;  3RVZ A;  1XL6 A;  4UXN A;  1FXV A;  1NQT A;  3I55 V;  3QO8 A;  3CCE V;  2LP7 A;  3FB7 C;  3IC7 A;  4ZKI A;  2WLL A;  1OCR C;  4GX1 A;  4MVR A;  5B1B C;  2QM8 A;  3STL C;  3K0D A;  1WLE A;  2DWD C;  3HPL C;  2JJ2 G;  1V54 C;  1OCC C;  2BOB C;  4JGS A;  1QVG U;  3CCJ V;  3CCM V;  4QIW F;  2IJI A;  3K79 A;  5LHI A;  5B1N A;  4PDL A;  1YTF B;  3TET A;  3QO5 A;  1K8A W;  2PI5 A;  4L87 A;  5EC2 C;  5HFM A;  1THZ A;  1W2B U;  1W0K G;  3F7Y C;  2GHY A;  4R50 A;  1VQO V;  4G27 B;  4R7C A;  5DN6 G;  2EIM B;  5L3E A;  1FS0 G;  4G2K A;  2X6A A;  2YEV A;  3QO7 A;  3CC7 V;  1RM1 B;  3E8F A;  1YJN V;  5L3F A;  3ABK C;  4I9W A;  4UV8 A;  5J9P C;  3E8G A;  4RUF A;  3FB8 C;  4P9O A;  4Q20 A;  3AG3 B;  5LGU A;  2W0F C;  1P7B A;  3D36 A;  2R9I A;  4RQE A;  3F7V C;  4CZZ A;  4X89 A;  1PNK A;  3LSQ A;  4QJF B;  1QCE A;  1NR1 A;  3SJQ C;  3B8N A;  1CPY A;  3JCZ A;  1GM8 A;  3ZJZ A;  3LUT B;  5EK0 A;  1Q86 W;  2UXN A;  2JEU A;  4TWK A;  5CMU A;  1ARO P;  4JPR A;  4PDM A;  1VQL V;  1HWY A;  2IJH A;  1SES A;  2XAQ A;  3ZN1 A;  1AJP A;  4U7N A;  3G4S V;  4OXS A;  3T4D A;  3VOU A;  1DLB A;  3ABM C;  1FXK B;  3RVY A;  2Q68 A;  2Y48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...