2H8PC

Structure of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB heavy chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 20
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2h8pC00
4PDLA 1R3IC 4X88A 1P7BA 4XDJA 4R6ZA 2HG5C 3OUSA 4P9PA 2AHYA 3LDEA 4LBEC 3VOUA 1R3LC 5KUKA 4MW3A 3K08A 3SPIA 1OCZC 2EIKC 3LDCA 5B3SC 4XDLA 3E86A 3FB7C 3SPJA 4EKWA 2X6BA 2A0LA 4I9WA 2DWEC 4RAIA 2AHZA 2H8PC 1R3JC 3RBZA 4JTCB 4H33A 4PDMA 3X2QC 3SPHA 4LCUC 4PDRA 4G27B 3UM7A 4DXWA 5EBLC 3GB7C 2W0FC 4WFHA 2WLIB 5BZBA 3BEHA 4JTDB 3K06A 4MS2A 2DWDC 3OR6C 4PDVA 1ZWIC 4ZBMA 3STLC 4KFMA 3LDDA 4LP8A 2EIMC 4J9YB 4MVUA 2ZXWC 5CBFA 3FB5C 5CBGA 2P7TC 2A9HA 4H37A 1M56C 3K0GA 4JTAB 4WFEA 5EK0A 5CBHA 1LNQA 3ABKC 3IGAC 1V54C 3K03A 2DYRC 3ABMC 3LNMB 2Q69A 1XL6A 2DYSC 3TETA 1JVMA 3STZC 2OCCC 4F4LA 4QE9A 2K1EA 3IFXA 4MW8A 4WFGA 3T2MA 4RO2A 2X6AA 4PA3A 2HFEC 3E8BA 4MSWC 4PA9A 4WFFA 4R8CA 3UKMA 3TCUA 3AG4C 3E8HA 3OGCC 3EFFK 3RVZA 4QNHB 4GX2A 3ASNC 4TWKA 3RVYA 2WLLB 3AG1C 4MTFA 1ORQC 1K4DC 3E8FA 4P30A 3OR7C 4GX1A 4MVQA 2HVJC 1J95A 1OCRC 2WLNA 4MTOA 4X89A 2QKSA 3WG7C 1G4YB 3JYCA 1BL8A 1KKDA 3K04A 3K0DA 3LUTB 3OUFA 3E89A 4RUFA 1K4CC 2EILC 3ZRSA 2WLKA 2ITCC 4GX0A 4XDKA 2Q67A 2BOBC 4MVMA 5EC2C 2HVKC 3AG2C 2R9RB 3SYOA 1M57C 4UUJC 3FB6C 4HZ3A 4OXSA 2WLIA 3SPCA 3T4DA 4G28B 5J9PC 2EIJC 3ZJZA 3HPLC 4X8AA 4CBCA 2WLMA 2WLJA 2WLLA 3T1CA 5EC1C 2KB1A 1V55C 2QTOA 4MVRA 4MTGA 3ABLC 3SJQC 2Q68A 3F7VC 2EINC 2A79B 3SYPA 2HJFC 4MVZA 4R7CA 3E8GA 4QE7A 5KUMA 1XL4A 2YEVA 3AG3C 2ZD9A 3F5WC 3SYAA 2ATKC 2Y69C 4MVSA 5IY5C 1QLEC 3PJSK 5B1BC 2NLJC 3R65A 2X6CA 5EBMC 1OCCC 4RUEA 4J9ZB 2BOCC 3FB8C 5E1AC 2WLHA 3SYCA 3SYQA 4P2ZA 4BW5A 2JK5C 2IH1C 1S5HC 1OCOC 3E83A 5B1AC 3RW0A 3ASOC 2ITDC 3KG2A 1R3KC 3SPGA 5EBWC 4P9OA 4PA6A 4PA7A 4HYOA 4R50A 3T4ZA 4MVOA 3F7YC 4PA4A 2Q6AA 4GX5A 2IH3C
chains in the Genus database with same CATH superfamily
2YI9A 3HKEB 2CH7B 4NB5A 3K08A 3DXRA 2EIKC 3LDCA 5BXZA 4XDLA 3SPJA 4O4HB 3B2EE 1IBLB 4U3JA 1W0KG 3ZIAG 1CEZA 4UVAA 1VQ9V 1Q6IA 2PGGA 1M90W 3AG4B 1Q90D 2G38A 5DECA 1SQQH 3E22B 4FLZA 4ZBMA 3RYCA 5J2TA 3STLC 4GKKO 4WFAV 4DR5B 1SESA 2YIAA 2OIEA 2VQFB 4JTAB 1NQTA 1YTFD 2OCCC 4F4LA 4QE9A 3JASA 3T2MA 3N27A 4IGGA 2DMXA 1H2LA 5KHJA 2UUBB 3BA8A 4PA9A 1FFXA 3GWKC 4TWKA 1JX9A 2ZR2A 3JALB 2VWJA 1K8AW 3D36A 4DW0A 4X9QA 1BS3A 3S3XA 2YXHA 1EM1A 1W59A 4BAYA 1NVPD 4FLYA 2R9AA 2YC0A 4BIZA 2CE4A 5E79Z 5B1AB 1DF5A 1M57C 4HZ3A 3U10A 2WLIA 4FLWA 1ROPA 2EIJC 2WLMA 1Q6HA 4JYAO 5B1NA 4DUYB 5BMVA 2B5UA 1XOUA 3A0HZ 3K5NA 1R6KA 3AG3C 3RYHA 2JGUA 1QVGU 4DV6O 1K73W 1OZ0A 4FM1A 3DSQA 2UU9B 2PTMA 1HNXO 1AJNA 3FB8C 2MW2B 4OX9O 5K1PA 3NXSA 2KQXA 3ZBHA 2VS0A 4E2LA 4LFAB 1QU7A 1TVKA 1FXKA 5FLXN 4JI6B 5K1XA 4YJ3A 4JI5O 4P9PA 2LFRA 1XNQB 1R3LC 4J11A 3I55V 1XNRB 4NXNB 5LYJA 5B3SC 4UFZA 1XHZA 2OCCB 4RAIA 1YSCA 3H01A 1UFIA 4WF9V 1E79G 2NNUA 2IJKA 3J7AU 1KECA 1D5NA 2DE0X 2P06A 4DR2B 1VQLV 1IBKB 1N0NA 1NR1A 5CBGA 3BFRA 2RCVA 4WFEA 3TXQA 1SC5B 1EN6A 1COWG 2Q69A 1VQ4V 1JVMA 3H1KH 3STZC 3M99B 2P4KA 4CH6A 4DK1A 5LP6A 4KP4A 1HNWO 3N2GA 3AG1C 4PELA 2XT9A 4X64B 3E8FA 4NTXA 2PY5A 4TT3G 1PNKA 2WLNA 3D36C 3UT5B 2CTWA 2B1GA 3THOA 4YY3B 4PV1B 2ZQMA 3ZRSA 3KCXA 4JPRA 1F51A 5CA1B 5IJ9B 5L3DA 1FJGB 5KX5A 2Q8VA 3FKSG 4NR1A 4JI1O 2Z3YA 5CN0A 3O9OA 5L3CA 5IYDO 3KZIZ 1V55C 3ABLC 4LWSA 1Z5WA 4EFEA 2GUZA 4MVZA 3L71H 5KHIA 5GONB 4JI2O 1A32A 4LF6B 1P84F 3IJ4A 1XREA 3DXRB 1X4TA 1H2KA 3P32A 2CUGA 3ICXA 4U3JB 1KU9A 2OWOA 1Q6UA 3D3IA 1BHAA 4ZI7A 1FXKC 2YIBD 4CH3A 1TAEA 3RYCB 5J2TB 1AROP 5IWAO 3N2KA 1X59A 1YCIA 1FXVA 1AJQA 1THZA 4ZHQA 2AHZA 5CMUA 4PDMA 1FKAO 2ZINA 3JASB 1IDSA 1FFXB 2QKAA 4FFBA 4PDVA 3AG1B 4IT5A 3CP1A 3FB5C 3JD4A 1GKFA 1SQXH 1MZFA 1NBMG 4C7UA 4GZRB 5IJ0A 3ETDA 1FXHA 1N32O 1AR5A 3ASOB 2X6AA 4PA3A 3WU2Z 3E8BA 4GX2A 3RVYA 4JASA 5LP6C 2WSSG 1V55B 3ABLB 4J7KA 5KHGA 5KMGA 1US6A 2F43G 3B8NA 1AI7A 1GM9A 1NR7A 3L72H 3QF7A 1KKDA 3P3PA 4DK0A 2X0LA 3QNEA 2AXTZ 1R6TA 4UUJC 1VF7A 1ZL8A 4B7EA 4B3SB 1Y66A 2KB1A 3SJQC 2Q68A 1TVKB 1FXKB 2A79B 4LF4B 1XL4A 4BIOA 3F5WC 4O4LA 3ZMTA 4B3TB 1QLEC 1AVMA 3DC5A 4AQYB 3L9DA 5LL6Y 4DV5O 1F23A 1IURA 1I5YA 1WN7A 2RMKB 5H2FZ 3SPGA 3ZN1A 3JD2A 1YI2V 3SGIA 1Q5OA 5LMNB 3OUSA 3A8TA 1H2MA 3FB7C 4LF8B 4LFCB 3T1HO 1H8EG 1E1RG 2Y48A 5DM6V 5EZYA 1JR9A 1MG1A 3SPHA 3UM7A 2ADQB 4DXWA 1FPOA 4WFHA 1KP3A 4W4KA 4XBFA 2XOKG 2QEXV 1KKCA 1S3JA 5L3BA 5IY5B 3IGAC 5GTHZ 1YVWA 2QWOB 3ABMC 4F6EA 4X65O 5F2VO 4LF9B 4RWUA 2HFEC 5KX5B 4FK5C 3JAMN 3K5MA 1O9GA 1N33B 3TCUA 3RVZA 4UCVA 1F4MA 3HKEA 2N04A 4IIJB 2UUAB 2GUZB 4DV2B 2VQEO 1JCHA 2EILC 2QGNA 1Q7YW 1Q86W 2Q67A 3AG2C 1M9NA 1MZEA 3E2EA 3ZMUA 3OMNB 2OTJV 2PYLA 4O2AB 1BGYH 4O4JB 3ZCCA 2ZM6B 1OV9A 1VQOV 3OT7A 5LHHA 4X66B 1V54B 3PJSK 2DYRB 3N2KB 3R65A 5JH7A 2F66C 1WAZA 2BOCC 4HAMA 3SYCA 4EB6A 1AILA 3E83A 2PUSA 1P49A 4W4LA 4I0XA 3APQA 3ETQA 1PNLA 4MVOA 4GX5A 2IH3C 4PDLA 4FFBB 4X88A 1CPYA 1BCCH 1Y6XA 3U11A 2GSMB 1FYJA 3GVMA 1BZKA 5KUKA 4KHPO 3G6BA 3ABMB 1KMIZ 5L3EA 3UO3A 2JS3A 5LHGA 2F93B 3OTFA 1NKDA 3C90A 2DN9A 4GCZA 3FYEB 4GKKB 4DR6O 5GTIZ 2EILB 3U0ZA 2CK3G 1N8RW 3AG2B 3H1LH 3IAYA 3JAKA 1ZL8B 1EN5A 2DOSA 3VQYA 5CA3A 3A0RA 4GX1A 1L1FA 2RDCA 3S3WA 2AZ0A 4JAVA 2ZE5A 4DR4O 3WG7C 1VQNV 1BL8A 1OCZB 3APOA 1QVFU 4O4LB 1K4CC 4GX0A 2BOBC 3KCYA 2AW9A 2ZNIA 3T4DA 2K9PA 3L75H 2QTSA 1DK1A 3OTOO 3NR7A 4JF3A 4JI7O 1GH6A 4ASUG 2HJFC 3G4SV 3TGUH 4R7CA 3ZEDA 4JYAB 2QKCA 2DJVA 4EFBA 3ZX6A 4NTWA 3CPWU 3C3TA 4RUEA 4DV6B 4BW5A 4P2ZA 3RT3C 1HNXB 1Q3EA 4JI4O 2ITDC 1MNGA 1OJHA 5B1OA 4OX9B 3CD6V 2UXBO 1RP3B 4GKJO 3JAWA 1JMKC 3H9VA 4DV4O 1YJNV 1ZAUA 1W2BU 4MW3A 3BCCH 2BSKA 4JI5B 3SJCC 1SQFA 3I56V 4PD4F 5KA6A 3X2QC 4IHJB 3OFNG 1L0LH 3GB7C 5BZBA 4LFBO 3K06A 3OR6C 4X20B 1QQCA 4L87A 3UO2A 5GONA 1BSMA 2Y0IA 4LF7O 2P7TC 1XQ8A 3WG7B 3ZRXA 1PL0A 4QGPA 2Y0PA 1BQ0A 1GRJA 3RYIA 1GK9A 4X1IA 1PL4A 1SKVA 2QR4A 3OGCC 1GN4A 4MVQA 3ETEA 1KD1W 1HNWB 1U97A 3QG5A 2YXYA 2UXCO 1VQKV 3BVOA 2L6LA 3B77A 1JJ2U 1EZJA 3JYCA 1VF5B 5LOVA 3SDLA 1WA8A 2ZIOA 4QPKA 2EBOA 5JH7B 1SERA 3P3NA 1UPGA 2EZPA 4YIPA 4EB6B 3WFVA 1Y74A 3SYOA 3CRRA 2WLJA 4I0XB 1CXZB 2XNDG 1YEWA 1Z5VA 4JI1B 3E8GA 5KUMA 5H9CA 2E74B 3SYAA 5ITZA 1KQSU 4MT8A 3ABKB 3CWBH 5LXTA 1AI6A 5HFLA 4JI2B 4FJCC 3K5OA 4J9ZB 1M93A 2QA4V 3SYQA 2FL4A 1O9HA 2IH1C 3X2QB 1FD9A 1WP7A 5EBWC 1NH2B 1MABG 3RYFA 4CC6A 4D7TA 2ZT9B 1YXBA 3ZMZA 4X1KA 1WPBA 4DV0O 2XUMA 1P7BA 1DLBA 2F1MA 2HG5C 4CC5A 4OPHA 3SPIA 2AGAA 3B8MA 5IWAB 2FKXA 2H8PC 1N34B 3FYIB 4JAUA 2B1IA 4PDRA 4G27B 2YSUB 3VBBA 1WB7A 4I9QA 3L74H 3CJHA 4U3FH 3M8AA 4Z1MG 1SETA 2V4DA 1YJ9V 3JAKB 1AB3A 4Q6GA 1TGOA 4KFMA 3KKYA 4B7KA 2Y4TA 1M56C 4B3MO 2FYUH 4NVPA 5JJJB 5B1BB 5EIBC 3LNMB 5BR8O 4TQFA 4FIPC 3ABUA 2H3OA 2WA3A 3ZS8C 2E76B 1SF9A 5AG2A 4R8CA 2ODMA 1N32B 1HWYA 4MTFA 1ORQC 4P30A 4X89A 1ZSPA 5IE9A 3ZHSA 2H94A 3OUFA 1VF6A 4PHZA 1VIBA 3BHPA 3MHSC 2IU0A 2BCCH 4TV8A 4Z2WA 3SPCA 2ZDIA 4DW1A 5KA5A 2QJ1A 5B5EZ 2P6JA 3LSSA 5H5NA 3A2FA 3CRQA 1S77D 1IXBA 3JAWB 4UCRA 2CTRA 2LGQA 2ZCEA 1XDCA 4MVSA 5KLVH 2D3OW 4JGSA 1K33A 2DYSB 3QTCA 2BSKB 3CHXA 1H2GA 1S5HC 4UB6Z 3JARB 3RW0A 2JJ2G 3ASOC 3CB2A 1PP9H 4DV5B 3RWRD 2GDSA 3HB3B 2F95B 3IC9A 4IIJA 1AR1B 3JCZA 1R3IC 1GM8A 4HBNA 1HR0O 5IYCO 1YITV 1M56B 1YZBA 2JS5A 1S0VA 1YF2A 4J41A 1EZVH 4DR1O 4DR3O 2W6IG 2LW7A 4UCTA 4JTCB 4J7JA 2NN4A 2P4VA 3T1HB 4AI8A 3RYIB 4X1IB 2Q9LA 4JZ2A 3CXCU 2F4VO 1M4UA 4MS2A 2DWDC 4UV8A 1ZUQA 4O2AA 4B3RB 4O4JA 4D7SA 2EJRA 2UXDO 3K3WA 4OGQB 4UVCA 2A9HA 2Y69B 1NS1A 4K35A 3RN4A 1CP9A 1F4NA 2HP8A 3G6EV 2UUCO 5LOVB 1WA8B 4K0KO 4DV1O 1F7YA 4X65B 1Q82W 1QBZA 1Y74B 4UXNA 1SA0B 1B6QA 1NH2D 4FLVA 1VQ5V 3TJTA 1XMOO 4FZ0A 1N0JA 1OCRC 3SJAC 3DC6A 3K0DA 5ITZB 2RNBA 5LXTB 2VQEB 2ITCC 2PZSA 2YIDA 2FTKA 3OE7G 3SJBC 1YDXA 4X62O 3OGIB 2XAFA 3HKDA 3FB6C 2ZDIC 4BWAA 3RYFB 4MVRA 4X1KB 1LR1A 5IY5C 2X6CA 5EBMC 5LA6A 4K8ZA 5DEDA 4RQFA 4FM2A 3JD0A 4JV5O 2GTSA 1EFRG 4QIWF 2R9IA 3CYOA 4N23A 3T4ZA 3CJHB 3LSQA 3L73H 4J42A 3CCEV 2E75B 3CSXA 3H1JH 2CAZC 1VP7A 1M1KW 1GN2A 1RPOA 2O57A 1XBLA 4I9WA 2QSAA 4I7ZB 4KHPB 1KYOF 3RBZA 4UB8Z 2RQ6A 2B9ZA 4LCUC 3ML0A 5KAIZ 4E4EA 2L35A 4CS2A 1H8HG 1K97A 3AK3A 4J9YB 1OCRB 2JGDA 2LW1A 3Q4HA 1V54C 2DYRC 2V1DA 1J5EO 3ZHRA 2QWRB 1R1BA 4WFGA 4DR6B 4CH5A 1OHHG 2QWPB 3FFQA 4JI8O 2XASA 3DTUB 4TV8B 3W7SA 1D5AA 1KC8W 4MTXA 1WLEA 3AK2A 4QNHB 3GWOA 1XUQA 1W0JG 5D5QA 1HW7A 3L70H 1TA8A 3ZRVA 4IL6Z 1GN6A 5CA0A 4CH4A 4GT1A 1AI5A 1G4YB 1E1QG 5JJEB 4DR4B 5EIBD 5DN6G 4IHJA 5EYPB 1GM7A 2RN9A 2WAMA 1SQGA 2R70A 4FFKA 2Z5UA 2ARHA 4X20A 2QTOA 2HLDG 4PJ0Z 1VQPV 2CTPA 2EIMB 3OTOB 2NR5A 3BABA 4JI7B 3ZN0A 4B08A 1H2SB 4LF5O 4FLTA 4WBNA 1OCOC 3OEEG 1GMGA 3ZHTA 4HYOA 1Y4MA 4R50A 5LBQA 2ETNA 4JI4B 5KHKA 1DGSA 2UXBB 4NYKA 4DV7O 1IVSA 4GKJB 4NXMO 4KUMA 1IBMO 4DV4B 1OCZC 4FVMA 4JI0O 1KB9F 4F6RB 5IYZA 3D8CA 3B40A 3P30A 3HKBA 4ZOLA 2JEUA 2BTOA 3M7MX 1Y76A 1HNZO 4LFBB 2P5OA 2KKWA 2C2AA 3UCSC 1Z2GA 1KP2A 4LF7B 1XL6A 3TETA 3WB0A 4MW8A 4B3SO 4RQEA 4MSWC 4EEQA 3UKMA 3HKDB 1RSOA 1K34A 2GV9A 4A5UB 4CS3A 4B3TO 2ZE7A 3CX5F 4H44B 1BMFG 2JRIA 3CMAV 2IJHA 3JD3A 4O2BA 1UJWB 2EJ7A 2UXCB 1R73A 5JWPA 4XDKA 5LA6B 1H38A 2AZ2A 1VQ8V 1OCOB 2A3QA 5IYBO 1QNMA 4CBCA 2FMLA 1N36O 2OYQA 3QVNA 4K3AA 3ZHUA 2F23A 1FFTB 4UVBA 1FAFA 2P22C 2Q7GA 2R72A 3CCUV 4K8XA 1SS3A 3AEIA 1EN4A 2E3CA 3CE2A 3BY6A 1JFFA 5FL7G 2HHHO 4TUYA 3CC7V 4LH7A 5L3FA 4JI3O 1EBOA 3RGBA 4DV0B 2JGDB 5GW7A 2Z0AA 3Q4HB 3AG7A 5JQGA 1WP8A 3I5DA 3BRCA 1WB8A 4PI2A 4LNUB 4O4IA 4DR7O 4DV2O 1K5QA 3O65A 4MVUA 5CBFA 4JAAA 5CA0B 1VQ7V 3ABKC 1VQMV 3K03A 1I94O 1BQZA 5JVDA 3JARA 5BR8B 5JJNB 2YXLA 4WFFA 3ASNC 4YHHO 1AP6A 3MHHC 1K4DC 5LGUA 3ZRWB 2ZIMA 3E89A 3T1YO 2WLKA 5EC2C 4WBNB 2QWQB 2N74A 3OD4A 4G28B 3ZHQA 4DUZO 2ZKOA 4LC1A 3T1CA 2Q73A 2XAJA 4ICGA 4WCEV 2EINC 2YEVA 2QDOA 1URFA 4X1YA 5A2QN 5B1BC 3JSNA 2NLJC 1SZXA 3CCMV 5E1AC 2WLHA 4J10A 3CCLV 4IYIA 4IYHA 5IYZB 2BTQB 1SA0A 3HKBB 4ZOLB 3MD0A 1Y76B 2LFSA 2Q0AA 1DF4A 1L0NH 1KBHA 1VQ6V 3LDEA 2HKOA 3LNNA 3OAAG 5C93A 1I7FA 2CGNA 1HR0B 2Q5ZA 3CC2V 4Q20A 3IC7A 1R3JC 3AK1A 4TV9B 4YIOA 4H33A 1XILA 3OMIB 4BR6A 4DR1B 4DR3B 3BEHA 3CCRV 4JTDB 1QR9A 5LMUO 2XHBA 3ASNB 1RSOB 1JPXA 1NI8A 4FZ1A 4I50A 2F4VB 3OMAB 4GUNA 4NTYA 1AR4A 1JA8A 2UXDB 2DYSC 4O2BB 5FPRA 2QM4A 1G6UA 3HR0A 5A9GA 2UUCB 5L3GA 4K0KB 1DTOA 3E8HA 4OPAA 4DV1B 4CZZA 3EXAA 3OEHG 2EINB 3G80A 2HVJC 1Q8IA 2BE3A 2YDEA 1G1XB 2EIKB 1XMOB 1K3EA 4I4TA 1P4RA 1MA1A 5LHIA 3FAVB 3QO7A 2UXNA 4DO2A 2PI5A 4HNAA 1G8MA 2R9RB 4UV9A 2XAGA 4OXSA 3BA9A 3J81N 1K92A 2WLLA 4DV3O 4Z1VA 4X62B 1JFFB 2JJ1G 1IX9A 5JCOA 3CCSV 4FPPA 3B09A 2QE7G 4TUYB 2Y69C 3HKCA 4YJ2A 4KXRA 2E5LO 2ADPA 3CRCA 3VQWA 2DW4A 1NT2B 4DYLA 3OM3B 1XMQO 1NZ6A 3BAAA 5JQGB 1ZX3A 1ZTEA 1RPRA 2GTAA 4PA7A 2RJZA 2A06H 4KL1A 4JV5B 4O4IB 3CXHF 4ZKIA 1NU1H 3MDSA 1GAXA 2AHYA 1IBLO 4PI0A 3VOUA 4DRXA 2IM9A 4CS4A 2KG7A 1RFYA 1TUEB 4TOIA 2GBOA 1IXMA 4J80A 2N05A 5EYPA 1WNSA 2LJ2A 5H6RA 5JVDB 1M57B 2ZNJA 5EBLC 2EIJB 4GYCB 3JATA 4JYBA 5KAFZ 4H13B 4DR5O 1T5EA 2VQFO 2EX3A 2YUAA 2ZXWC 1ENVA 3AG3B 4UCSA 3J80N 2W6JG 1JQ0A 1BE3H 1U96A 4L8JA 5J2UA 3CCQV 1PV0A 2UUBO 2VWKA 4TSFG 4JYYA 1J5EB 2WA4A 1I0HA 3WB2A 4JI8B 3OR7C 1Y67A 1J95A 2M6YA 3K9SA 1IZ3A 2YEVB 5B3SB 4X1YB 4F6RA 2OT5A 2WWWA 2A7WA 3H1HH 4MVMA 1AP5A 2PYJA 2HVKC 2M7WA 5B66Z 1AI4A 4DUYO 3B4SA 5J9PC 3HPLC 1WJZA 3D3QA 2ZR3A 1TUBA 1V9PA 5JCOC 1YHQV 2UU9O 4LR3A 2CDYA 3JD1A 1N34O 4D6TH 1VF6C 5BY1A 4I55A 1MSWD 2X7RB 4LFAO 1JOYA 1S76D 3DGEA 4LF5B 2PI4A 4N21A 1B06A 5C8YA 4JI6O 2QM7A 4PA4A 4AHCA 2Q6AA 2OCHA 1XNQO 3CS5A 3ABTA 1XNRO 4NXNO 2ZXWB 4I50B 4LBEC 3K9AA 4DV7B 2DQ0A 3E86A 3W7XA 4NXMB 5FNVA 1IBMB 4JI0B 5IT9N 4J7ZA 5KHHA 1K9MW 2WLIB 3CCJV 4DR2O 1IBKO 1HDJA 2EZOA 1S5LZ 5CB4A 5BMVB 4LP8A 2EIMC 3FX7A 3VQXA 1HNZB 1PPJH 3RYHB 5HFMA 3UQ8A 3TXSA 1XI1A 4I4TB 3W7WA 3ETGA 5LGTA 4UCOA 1QLNA 3IFXA 3CRAA 1WPXA 4QJFB 1QHTA 4X64O 4HNAB 1SQPH 3H1IH 2XAQA 2IU3A 2WLLB 3RFRA 1GN3A 4MTOA 4YY3O 2QKSA 4YJ3B 3JSLA 1SQVH 1FJGO 3CMEV 1PD3A 3LUTB 1XHXA 3HKCB 4YJ2B 5LYJB 2GHYA 1MSDA 2OIGA 2LP7A 3JCUZ 4LNUA 1Q81W 1NTMH 3EVKA 1NTZH 2LQTA 3SYPA 4LF6O 1D2DA 1N36B 2ZD9A 3PN1A 4DRXB 1LUVA 1OCCC 2KG7B 1ZLZA 2FB5A 1H2NA 1Q43A 4UCUA 4WFBV 1R3KC 4B3RO 4P9OA 2Q0OC 5LP6B 3JATB 1RM1C 1AJPA 3N2GB 2HEPA 3CEIA 3K5LA 1N4CA 2P67A 3ZRWA 4R6ZA 1YIJV 2ILMA 2HHHB 2HR3A 1K5SA 2JEXA 3BPZA 4U7NA 4JI3B 5J2UB 2DWEC 2IJJA 3QO8A 4JZGA 4ABMA 1VMGA 4BW9A 1MMMA 1MOFA 4FLUA 4BIUA 1LUWA 1ZWIC 2HJDA 1SRYA 2CH7A 1FS0G 2KSDA 4LWSB 3LDDA 4DR7B 2QWNB 1GO3F 3R66A 4H37A 3K0GA 3G67A 1QLEB 4O4HA 4FM0A 2MK3A 5TISZ 1B04A 1YJWV 2K1EA 4LH6A 1I94B 4RO2A 4TQDA 1I08A 2XAHA 4GLXA 2W0XA 2BTQA 4FLXA 3FD9A 1QR8A 1VEWA 3EFFK 3E22A 2QM8A 3ZMSA 1XEQA 3EHBB 3F5TA 4ZI7B 4YHHB 1TUBB 3CRMA 5FPOA 3OW2U 4G2KA 4FMTA 3CCVV 1OCCB 2YI8A 4TV9A 5LGNA 4ZHQB 2VRZA 3W7UA 3T1YB 4I55B 2OTLV 4AILC 1B3QA 1S5JA 2Q7EA 2YIBA 2YICA 4LF4O 3TK1A 3K59A 5EC1C 3JALA 5D5PA 5C8YB 3W7TA 1RM1B 1GTOA 4DUZB 3LSUA 2EULA 3SR2C 3MAQA 4AQYO 5IDJA 2ATKC 2CGOA 1YTFB 1L8DA 1PNMA 3C3SA 5IJ0B 5FNVB 1SQBH 2WPDG 3CC4V 3KG2A 3ZMVA 3VQVA 4PA6A 1QCEA 5LMNO 2UXXA 1PM9A 3K79A 5KMGB 2IW5A 5CB4B 4XDJA 4LF8O 4LFCO 1NVPB 2LO1A 4EKWA 2X6BA 2A0LA 3FAVA 2Y4UA 2IBZH 4QPJA 1VARA 2W0FC 4I5SA 1S72V 5LMUB 2XTAA 5EK0A 5CBHA 1LNQA 4LF9O 3QO5A 1I5XA 1K7DA 1R6NA 4JYCA 1N33O 2ZE6A 2Q7HA 2DQ3A 1BT8A 4YXWG 4ZIBA 1NTKH 3ZHVA 1JJOA 3AG4C 2JDIG 4NKGB 2IJIA 2UUAO 1P7GA 2P90A 2D2CB 2ZE8A 2Q4PA 3K04A 4RUFA 2PF4E 3G71V 3K57A 4B3MB 1M5IA 3E35A 5EZYB 2CTQA 1NJIW 3ZJZA 4X8AA 2ZM6O 1SZTA 1KUQA 4MTGA 3WB1A 3F7VC 3UT5A 4X66O 4DV3B 4QE7A 2LGWA 1PKXA 4U7OA 5CA1A 5IJ9A 2JVDA 2JK5C 2V7QG 2E5LB 5B1AC 2YS8A 2JIZG 1BHBA 3A0BZ 3F7YC 4H0LB 1XMQB 1HP8A 5H6QA 3K58A
chains in the Genus database with same CATH topology
3LSQA 4PDLA 4X88A 4ZKIA 1CPYA 3CCEV 2GSMB 2AHYA 3VOUA 5KUKA 3K08A 2EIKC 3LDCA 4XDLA 1M1KW 1RPOA 3SPJA 3ABMB 1TUEB 1W0KG 3ZIAG 4I9WA 1IXMA 5L3EA 1CEZA 4UVAA 3RBZA 5LHGA 5H6RA 4LCUC 1VQ9V 1M57B 3ML0A 5EBLC 2EIJB 4JYBA 1M90W 3AG4B 1NKDA 4ZBMA 3STLC 1H8HG 4GCZA 4WFAV 1K97A 4J9YB 1SESA 2ZXWC 3FYEB 1ENVA 1OCRB 3AG3B 2W6JG 4JTAB 1JQ0A 1NQTA 1V54C 2DYRC 2V1DA 3CCQV 2EILB 1YTFD 2OCCC 4F4LA 4TSFG 4QE9A 4WFGA 3T2MA 2CK3G 1N8RW 1OHHG 3AG2B 4PA9A 2XASA 3DTUB 3W7SA 1KC8W 4MTXA 1WLEA 4QNHB 3GWOA 1JX9A 4TWKA 1W0JG 2ZR2A 5CA3A 3A0RA 3ZRVA 3OR7C 4GX1A 1L1FA 1K8AW 3D36A 1J95A 4JAVA 3WG7C 4GT1A 1AI5A 1G4YB 2YEVB 1VQNV 1BL8A 1OCZB 4BAYA 5B3SB 1NVPD 1E1QG 1QVFU 1K4CC 4BIZA 2OT5A 4GX0A 2WWWA 5DN6G 2BOBC 4MVMA 1GM7A 2WAMA 2HVKC 5B1AB 2M7WA 1AI4A 1DF5A 1M57C 4HZ3A 3T4DA 2WLIA 5J9PC 1ROPA 2EIJC 3HPLC 2WLMA 2Z5UA 5B1NA 2QTOA 4JF3A 2HLDG 2B5UA 2ZR3A 4ASUG 2HJFC 3G4SV 1VQPV 2EIMB 4R7CA 1YHQV 1R6KA 3AG3C 1QVGU 1K73W 1OZ0A 3JD1A 3ZN0A 1AJNA 3CPWU 4RUEA 4BW5A 3FB8C 4P2ZA 3NXSA 1MSWD 1OCOC 2X7RB 3OEEG 1JOYA 1GMGA 2ITDC 1S76D 3DGEA 2PI4A 4N21A 5B1OA 4HYOA 3CD6V 4E2LA 1Y4MA 4R50A 5LBQA 2QM7A 4PA4A 2Q6AA 1FXKA 3ABTA 1YJNV 2ZXWB 4P9PA 2LFRA 4KUMA 4LBEC 1W2BU 1R3LC 4MW3A 3K9AA 1OCZC 3I55V 5B3SC 2DQ0A 3E86A 3W7XA 3I56V 2OCCB 4RAIA 1YSCA 3H01A 5KA6A 3X2QC 3P30A 3OFNG 1K9MW 3GB7C 4WF9V 2WLIB 2JEUA 1E79G 5BZBA 3CCJV 2NNUA 2IJKA 3K06A 3OR6C 1KECA 2EZOA 4L87A 4LP8A 2EIMC 1VQLV 1NR1A 5CBGA 2C2AA 2P7TC 4WFEA 5HFMA 3WG7B 1KP2A 1COWG 1PL0A 2Q69A 1XL6A 3ZRXA 3TETA 1JVMA 1VQ4V 3STZC 3W7WA 3ETGA 3M99B 5LGTA 1QLNA 3IFXA 4MW8A 4QJFB 1WPXA 1GK9A 4RQEA 4MSWC 3UKMA 3OGCC 4KP4A 1K34A 2XAQA 2IU3A 2WLLB 3AG1C 4PELA 3E8FA 4MVQA 3ETEA 4TT3G 1KD1W 1PNKA 2WLNA 1BMFG 4MTOA 1VQKV 2QKSA 3B77A 1JJ2U 1EZJA 3JYCA 2B1GA 3CMAV 2IJHA 3JD3A 3CMEV 1UJWB 1PD3A 3LUTB 1R73A 2ZQMA 2GHYA 4QPKA 3ZRSA 2EBOA 4JPRA 1F51A 4XDKA 1SERA 5L3DA 1H38A 2EZPA 2LP7A 3WFVA 1VQ8V 1OCOB 3FKSG 3SYOA 5IYBO 2Z3YA 4CBCA 5CN0A 2WLJA 1Q81W 5IYDO 5L3CA 2XNDG 1V55C 3ABLC 3SYPA 4MVZA 3E8GA 5KUMA 5H9CA 2ZD9A 3SYAA 1KQSU 4MT8A 3ABKB 1FFTB 1AI6A 5HFLA 4UVBA 1OCCC 4FJCC 2QA4V 4J9ZB 3P32A 3SYQA 2IH1C 3CCUV 3X2QB 4WFBV 3AEIA 1R3KC 5EBWC 1NH2B 3D3IA 4P9OA 1MABG 3BY6A 5FL7G 1BHAA 1RM1C 1AJPA 1FXKC 3ZMZA 1P7BA 2P67A 3ZRWA 4R6ZA 1DLBA 3CC7V 1YIJV 2HG5C 5L3FA 1AROP 1EBOA 5GW7A 3SPIA 2HR3A 1K5SA 2JEXA 3B8MA 4U7NA 1FXVA 1AJQA 1THZA 2DWEC 2AHZA 2H8PC 2IJJA 3QO8A 5CMUA 4PDMA 3FYIB 4JAUA 2B1IA 4PDRA 4G27B 2YSUB 3VBBA 1MOFA 4Z1MG 1SETA 4PDVA 4BIUA 1K5QA 1ZWIC 3AG1B 1YJ9V 1SRYA 1FS0G 4KFMA 3LDDA 3CP1A 4MVUA 5CBFA 1GO3F 3FB5C 3JD4A 4H37A 1M56C 3K0GA 1GKFA 1QLEB 1VQ7V 3ABKC 5B1BB 2MK3A 1NBMG 3K03A 1VQMV 3LNMB 4FIPC 3ABUA 3ETDA 1FXHA 1YJWV 2K1EA 4RO2A 3ASOB 2XAHA 2X6AA 4PA3A 3E8BA 4WFFA 4R8CA 1QR8A 3EFFK 1HWYA 4GX2A 3ASNC 3RVYA 4JASA 2QM8A 3ZMSA 3MHHC 2WSSG 1V55B 1ORQC 1K4DC 3EHBB 3ABLB 4MTFA 4P30A 5LGUA 2F43G 3B8NA 1AI7A 1GM9A 1NR7A 4X89A 3ZRWB 2H94A 3OW2U 1KKDA 4G2KA 3OUFA 3E89A 4FMTA 2X0LA 3QNEA 3CCVV 1OCCB 3MHSC 2WLKA 2IU0A 5LGNA 5EC2C 3W7UA 4UUJC 2OTLV 3SPCA 2ZDIA 4G28B 5KA5A 3TK1A 4LC1A 5EC1C 3T1CA 1Y66A 2P6JA 2XAJA 2KB1A 3LSSA 3W7TA 1RM1B 3SJQC 2Q68A 1GTOA 4WCEV 2EINC 1FXKB 1S77D 2A79B 1XL4A 2YEVA 3F5WC 3ZMTA 5IDJA 2ATKC 4MVSA 1QLEC 4JGSA 2D3OW 5B1BC 2NLJC 1YTFB 1K33A 2DYSB 3CCMV 1PNMA 5E1AC 2WLHA 3CCLV 1F23A 1H2GA 1S5HC 2WPDG 3RW0A 2JJ2G 3CC4V 3ASOC 3KG2A 1I5YA 3ZMVA 3SPGA 3ZN1A 3JD2A 4PA6A 1YI2V 3MD0A 5H6QA 3HB3B 1QCEA 2LFSA 2UXXA 1DF4A 1AR1B 3JCZA 3K79A 1R3IC 1GM8A 2IW5A 4XDJA 3OUSA 5IYCO 1VQ6V 1NVPB 3LDEA 1YITV 2HKOA 1M56B 3OAAG 5C93A 1S0VA 3FB7C 4EKWA 2X6BA 2A0LA 2W6IG 3CC2V 1H8EG 4Q20A 3IC7A 1E1RG 1R3JC 2Y48A 4JTCB 4H33A 5DM6V 4QPJA 1MG1A 3SPHA 3OMIB 3UM7A 4DXWA 2W0FC 4WFHA 3BEHA 3CCRV 4JTDB 1QR9A 3CXCU 1KP3A 4XBFA 3ASNB 2XOKG 4MS2A 1JPXA 2DWDC 4I5SA 4UV8A 1S72V 2QEXV 1S3JA 2EJRA 5L3BA 3K3WA 4UVCA 2A9HA 3OMAB 2Y69B 5IY5B 5EK0A 5CBHA 1LNQA 3IGAC 3QO5A 3ABMC 1I5XA 1K7DA 1R6NA 2DYSC 1CP9A 1F4NA 3G6EV 4JYCA 2DQ3A 2HFEC 4FK5C 4YXWG 1Q82W 1QBZA 5L3GA 1DTOA 3TCUA 3AG4C 3E8HA 4UXNA 2JDIG 3RVZA 1B6QA 2IJIA 1NH2D 1F4MA 4CZZA 1VQ5V 3OEHG 2EINB 2HVJC 1OCRC 2P90A 2EIKB 1K3EA 3K04A 3K0DA 4RUFA 1JCHA 1P4RA 2EILC 1Q7YW 5LHIA 2ITCC 1Q86W 3G71V 3QO7A 2FTKA 2UXNA 2Q67A 3OE7G 4DO2A 3E35A 2PI5A 3AG2C 1G8MA 2R9RB 2XAFA 4UV9A 2XAGA 3FB6C 4OXSA 1NJIW 1M9NA 3ZJZA 4X8AA 1K92A 2ZDIC 2WLLA 3E2EA 1SZTA 4MTGA 3ZMUA 4MVRA 3OMNB 2JJ1G 3F7VC 2OTJV 3CCSV 3ZCCA 4FPPA 4QE7A 1VQOV 5LHHA 2QE7G 2Y69C 5IY5C 1V54B 3PJSK 1PKXA 2DYRB 4U7OA 3R65A 2X6CA 5EBMC 2BOCC 2DW4A 4HAMA 3SYCA 2JK5C 2V7QG 4RQFA 3E83A 5B1AC 3OM3B 3JD0A 2JIZG 1EFRG 4QIWF 1RPRA 2R9IA 3CYOA 4PA7A 1BHBA 4N23A 1PNLA 3F7YC 4MVOA 3T4ZA 4GX5A 2IH3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDL A;  1R3I C;  4X88 A;  1P7B A;  4XDJ A;  4R6Z A;  2HG5 C;  3OUS A;  4P9P A;  2AHY A;  3LDE A;  4LBE C;  3VOU A;  1R3L C;  5KUK A;  4MW3 A;  3K08 A;  3SPI A;  1OCZ C;  2EIK C;  3LDC A;  5B3S C;  4XDL A;  3E86 A;  3FB7 C;  3SPJ A;  4EKW A;  2X6B A;  2A0L A;  4I9W A;  2DWE C;  4RAI A;  2AHZ A;  2H8P C;  1R3J C;  3RBZ A;  4JTC B;  4H33 A;  4PDM A;  3X2Q C;  3SPH A;  4LCU C;  4PDR A;  4G27 B;  3UM7 A;  4DXW A;  5EBL C;  3GB7 C;  2W0F C;  4WFH A;  2WLI B;  5BZB A;  3BEH A;  4JTD B;  3K06 A;  4MS2 A;  2DWD C;  3OR6 C;  4PDV A;  1ZWI C;  4ZBM A;  3STL C;  4KFM A;  3LDD A;  4LP8 A;  2EIM C;  4J9Y B;  4MVU A;  2ZXW C;  5CBF A;  3FB5 C;  5CBG A;  2P7T C;  2A9H A;  4H37 A;  1M56 C;  3K0G A;  4JTA B;  4WFE A;  5EK0 A;  5CBH A;  1LNQ A;  3ABK C;  3IGA C;  1V54 C;  3K03 A;  2DYR C;  3ABM C;  3LNM B;  2Q69 A;  1XL6 A;  2DYS C;  3TET A;  1JVM A;  3STZ C;  2OCC C;  4F4L A;  4QE9 A;  2K1E A;  3IFX A;  4MW8 A;  4WFG A;  3T2M A;  4RO2 A;  2X6A A;  4PA3 A;  2HFE C;  3E8B A;  4MSW C;  4PA9 A;  4WFF A;  4R8C A;  3UKM A;  3TCU A;  3AG4 C;  3E8H A;  3OGC C;  3EFF K;  3RVZ A;  4QNH B;  4GX2 A;  3ASN C;  4TWK A;  3RVY A;  2WLL B;  3AG1 C;  4MTF A;  1ORQ C;  1K4D C;  3E8F A;  4P30 A;  3OR7 C;  4GX1 A;  4MVQ A;  2HVJ C;  1J95 A;  1OCR C;  2WLN A;  4MTO A;  4X89 A;  2QKS A;  3WG7 C;  1G4Y B;  3JYC A;  1BL8 A;  1KKD A;  3K04 A;  3K0D A;  3LUT B;  3OUF A;  3E89 A;  4RUF A;  1K4C C;  2EIL C;  3ZRS A;  2WLK A;  2ITC C;  4GX0 A;  4XDK A;  2Q67 A;  2BOB C;  4MVM A;  5EC2 C;  2HVK C;  3AG2 C;  2R9R B;  3SYO A;  1M57 C;  4UUJ C;  3FB6 C;  4HZ3 A;  4OXS A;  2WLI A;  3SPC A;  3T4D A;  4G28 B;  5J9P C;  2EIJ C;  3ZJZ A;  3HPL C;  4X8A A;  4CBC A;  2WLM A;  2WLJ A;  2WLL A;  3T1C A;  5EC1 C;  2KB1 A;  1V55 C;  2QTO A;  4MVR A;  4MTG A;  3ABL C;  3SJQ C;  2Q68 A;  3F7V C;  2EIN C;  2A79 B;  3SYP A;  2HJF C;  4MVZ A;  4R7C A;  3E8G A;  4QE7 A;  5KUM A;  1XL4 A;  2YEV A;  3AG3 C;  2ZD9 A;  3F5W C;  3SYA A;  2ATK C;  2Y69 C;  4MVS A;  5IY5 C;  1QLE C;  3PJS K;  5B1B C;  2NLJ C;  3R65 A;  2X6C A;  5EBM C;  1OCC C;  4RUE A;  4J9Z B;  2BOC C;  3FB8 C;  5E1A C;  2WLH A;  3SYC A;  3SYQ A;  4P2Z A;  4BW5 A;  2JK5 C;  2IH1 C;  1S5H C;  1OCO C;  3E83 A;  5B1A C;  3RW0 A;  3ASO C;  2ITD C;  3KG2 A;  1R3K C;  3SPG A;  5EBW C;  4P9O A;  4PA6 A;  4PA7 A;  4HYO A;  4R50 A;  3T4Z A;  4MVO A;  3F7Y C;  4PA4 A;  2Q6A A;  4GX5 A;  2IH3 C; 
#chains in the Genus database with same CATH topology
 2YI9 A;  3HKE B;  2CH7 B;  4NB5 A;  3K08 A;  3DXR A;  2EIK C;  3LDC A;  5BXZ A;  4XDL A;  3SPJ A;  4O4H B;  3B2E E;  1IBL B;  4U3J A;  1W0K G;  3ZIA G;  1CEZ A;  4UVA A;  1VQ9 V;  1Q6I A;  2PGG A;  1M90 W;  3AG4 B;  1Q90 D;  2G38 A;  5DEC A;  1SQQ H;  3E22 B;  4FLZ A;  4ZBM A;  3RYC A;  5J2T A;  3STL C;  4GKK O;  4WFA V;  4DR5 B;  1SES A;  2YIA A;  2OIE A;  2VQF B;  4JTA B;  1NQT A;  1YTF D;  2OCC C;  4F4L A;  4QE9 A;  3JAS A;  3T2M A;  3N27 A;  4IGG A;  2DMX A;  1H2L A;  5KHJ A;  2UUB B;  3BA8 A;  4PA9 A;  1FFX A;  3GWK C;  4TWK A;  1JX9 A;  2ZR2 A;  3JAL B;  2VWJ A;  1K8A W;  3D36 A;  4DW0 A;  4X9Q A;  1BS3 A;  3S3X A;  2YXH A;  1EM1 A;  1W59 A;  4BAY A;  1NVP D;  4FLY A;  2R9A A;  2YC0 A;  4BIZ A;  2CE4 A;  5E79 Z;  5B1A B;  1DF5 A;  1M57 C;  4HZ3 A;  3U10 A;  2WLI A;  4FLW A;  1ROP A;  2EIJ C;  2WLM A;  1Q6H A;  4JYA O;  5B1N A;  4DUY B;  5BMV A;  2B5U A;  1XOU A;  3A0H Z;  3K5N A;  1R6K A;  3AG3 C;  3RYH A;  2JGU A;  1QVG U;  4DV6 O;  1K73 W;  1OZ0 A;  4FM1 A;  3DSQ A;  2UU9 B;  2PTM A;  1HNX O;  1AJN A;  3FB8 C;  2MW2 B;  4OX9 O;  5K1P A;  3NXS A;  2KQX A;  3ZBH A;  2VS0 A;  4E2L A;  4LFA B;  1QU7 A;  1TVK A;  1FXK A;  5FLX N;  4JI6 B;  5K1X A;  4YJ3 A;  4JI5 O;  4P9P A;  2LFR A;  1XNQ B;  1R3L C;  4J11 A;  3I55 V;  1XNR B;  4NXN B;  5LYJ A;  5B3S C;  4UFZ A;  1XHZ A;  2OCC B;  4RAI A;  1YSC A;  3H01 A;  1UFI A;  4WF9 V;  1E79 G;  2NNU A;  2IJK A;  3J7A U;  1KEC A;  1D5N A;  2DE0 X;  2P06 A;  4DR2 B;  1VQL V;  1IBK B;  1N0N A;  1NR1 A;  5CBG A;  3BFR A;  2RCV A;  4WFE A;  3TXQ A;  1SC5 B;  1EN6 A;  1COW G;  2Q69 A;  1VQ4 V;  1JVM A;  3H1K H;  3STZ C;  3M99 B;  2P4K A;  4CH6 A;  4DK1 A;  5LP6 A;  4KP4 A;  1HNW O;  3N2G A;  3AG1 C;  4PEL A;  2XT9 A;  4X64 B;  3E8F A;  4NTX A;  2PY5 A;  4TT3 G;  1PNK A;  2WLN A;  3D36 C;  3UT5 B;  2CTW A;  2B1G A;  3THO A;  4YY3 B;  4PV1 B;  2ZQM A;  3ZRS A;  3KCX A;  4JPR A;  1F51 A;  5CA1 B;  5IJ9 B;  5L3D A;  1FJG B;  5KX5 A;  2Q8V A;  3FKS G;  4NR1 A;  4JI1 O;  2Z3Y A;  5CN0 A;  3O9O A;  5L3C A;  5IYD O;  3KZI Z;  1V55 C;  3ABL C;  4LWS A;  1Z5W A;  4EFE A;  2GUZ A;  4MVZ A;  3L71 H;  5KHI A;  5GON B;  4JI2 O;  1A32 A;  4LF6 B;  1P84 F;  3IJ4 A;  1XRE A;  3DXR B;  1X4T A;  1H2K A;  3P32 A;  2CUG A;  3ICX A;  4U3J B;  1KU9 A;  2OWO A;  1Q6U A;  3D3I A;  1BHA A;  4ZI7 A;  1FXK C;  2YIB D;  4CH3 A;  1TAE A;  3RYC B;  5J2T B;  1ARO P;  5IWA O;  3N2K A;  1X59 A;  1YCI A;  1FXV A;  1AJQ A;  1THZ A;  4ZHQ A;  2AHZ A;  5CMU A;  4PDM A;  1FKA O;  2ZIN A;  3JAS B;  1IDS A;  1FFX B;  2QKA A;  4FFB A;  4PDV A;  3AG1 B;  4IT5 A;  3CP1 A;  3FB5 C;  3JD4 A;  1GKF A;  1SQX H;  1MZF A;  1NBM G;  4C7U A;  4GZR B;  5IJ0 A;  3ETD A;  1FXH A;  1N32 O;  1AR5 A;  3ASO B;  2X6A A;  4PA3 A;  3WU2 Z;  3E8B A;  4GX2 A;  3RVY A;  4JAS A;  5LP6 C;  2WSS G;  1V55 B;  3ABL B;  4J7K A;  5KHG A;  5KMG A;  1US6 A;  2F43 G;  3B8N A;  1AI7 A;  1GM9 A;  1NR7 A;  3L72 H;  3QF7 A;  1KKD A;  3P3P A;  4DK0 A;  2X0L A;  3QNE A;  2AXT Z;  1R6T A;  4UUJ C;  1VF7 A;  1ZL8 A;  4B7E A;  4B3S B;  1Y66 A;  2KB1 A;  3SJQ C;  2Q68 A;  1TVK B;  1FXK B;  2A79 B;  4LF4 B;  1XL4 A;  4BIO A;  3F5W C;  4O4L A;  3ZMT A;  4B3T B;  1QLE C;  1AVM A;  3DC5 A;  4AQY B;  3L9D A;  5LL6 Y;  4DV5 O;  1F23 A;  1IUR A;  1I5Y A;  1WN7 A;  2RMK B;  5H2F Z;  3SPG A;  3ZN1 A;  3JD2 A;  1YI2 V;  3SGI A;  1Q5O A;  5LMN B;  3OUS A;  3A8T A;  1H2M A;  3FB7 C;  4LF8 B;  4LFC B;  3T1H O;  1H8E G;  1E1R G;  2Y48 A;  5DM6 V;  5EZY A;  1JR9 A;  1MG1 A;  3SPH A;  3UM7 A;  2ADQ B;  4DXW A;  1FPO A;  4WFH A;  1KP3 A;  4W4K A;  4XBF A;  2XOK G;  2QEX V;  1KKC A;  1S3J A;  5L3B A;  5IY5 B;  3IGA C;  5GTH Z;  1YVW A;  2QWO B;  3ABM C;  4F6E A;  4X65 O;  5F2V O;  4LF9 B;  4RWU A;  2HFE C;  5KX5 B;  4FK5 C;  3JAM N;  3K5M A;  1O9G A;  1N33 B;  3TCU A;  3RVZ A;  4UCV A;  1F4M A;  3HKE A;  2N04 A;  4IIJ B;  2UUA B;  2GUZ B;  4DV2 B;  2VQE O;  1JCH A;  2EIL C;  2QGN A;  1Q7Y W;  1Q86 W;  2Q67 A;  3AG2 C;  1M9N A;  1MZE A;  3E2E A;  3ZMU A;  3OMN B;  2OTJ V;  2PYL A;  4O2A B;  1BGY H;  4O4J B;  3ZCC A;  2ZM6 B;  1OV9 A;  1VQO V;  3OT7 A;  5LHH A;  4X66 B;  1V54 B;  3PJS K;  2DYR B;  3N2K B;  3R65 A;  5JH7 A;  2F66 C;  1WAZ A;  2BOC C;  4HAM A;  3SYC A;  4EB6 A;  1AIL A;  3E83 A;  2PUS A;  1P49 A;  4W4L A;  4I0X A;  3APQ A;  3ETQ A;  1PNL A;  4MVO A;  4GX5 A;  2IH3 C;  4PDL A;  4FFB B;  4X88 A;  1CPY A;  1BCC H;  1Y6X A;  3U11 A;  2GSM B;  1FYJ A;  3GVM A;  1BZK A;  5KUK A;  4KHP O;  3G6B A;  3ABM B;  1KMI Z;  5L3E A;  3UO3 A;  2JS3 A;  5LHG A;  2F93 B;  3OTF A;  1NKD A;  3C90 A;  2DN9 A;  4GCZ A;  3FYE B;  4GKK B;  4DR6 O;  5GTI Z;  2EIL B;  3U0Z A;  2CK3 G;  1N8R W;  3AG2 B;  3H1L H;  3IAY A;  3JAK A;  1ZL8 B;  1EN5 A;  2DOS A;  3VQY A;  5CA3 A;  3A0R A;  4GX1 A;  1L1F A;  2RDC A;  3S3W A;  2AZ0 A;  4JAV A;  2ZE5 A;  4DR4 O;  3WG7 C;  1VQN V;  1BL8 A;  1OCZ B;  3APO A;  1QVF U;  4O4L B;  1K4C C;  4GX0 A;  2BOB C;  3KCY A;  2AW9 A;  2ZNI A;  3T4D A;  2K9P A;  3L75 H;  2QTS A;  1DK1 A;  3OTO O;  3NR7 A;  4JF3 A;  4JI7 O;  1GH6 A;  4ASU G;  2HJF C;  3G4S V;  3TGU H;  4R7C A;  3ZED A;  4JYA B;  2QKC A;  2DJV A;  4EFB A;  3ZX6 A;  4NTW A;  3CPW U;  3C3T A;  4RUE A;  4DV6 B;  4BW5 A;  4P2Z A;  3RT3 C;  1HNX B;  1Q3E A;  4JI4 O;  2ITD C;  1MNG A;  1OJH A;  5B1O A;  4OX9 B;  3CD6 V;  2UXB O;  1RP3 B;  4GKJ O;  3JAW A;  1JMK C;  3H9V A;  4DV4 O;  1YJN V;  1ZAU A;  1W2B U;  4MW3 A;  3BCC H;  2BSK A;  4JI5 B;  3SJC C;  1SQF A;  3I56 V;  4PD4 F;  5KA6 A;  3X2Q C;  4IHJ B;  3OFN G;  1L0L H;  3GB7 C;  5BZB A;  4LFB O;  3K06 A;  3OR6 C;  4X20 B;  1QQC A;  4L87 A;  3UO2 A;  5GON A;  1BSM A;  2Y0I A;  4LF7 O;  2P7T C;  1XQ8 A;  3WG7 B;  3ZRX A;  1PL0 A;  4QGP A;  2Y0P A;  1BQ0 A;  1GRJ A;  3RYI A;  1GK9 A;  4X1I A;  1PL4 A;  1SKV A;  2QR4 A;  3OGC C;  1GN4 A;  4MVQ A;  3ETE A;  1KD1 W;  1HNW B;  1U97 A;  3QG5 A;  2YXY A;  2UXC O;  1VQK V;  3BVO A;  2L6L A;  3B77 A;  1JJ2 U;  1EZJ A;  3JYC A;  1VF5 B;  5LOV A;  3SDL A;  1WA8 A;  2ZIO A;  4QPK A;  2EBO A;  5JH7 B;  1SER A;  3P3N A;  1UPG A;  2EZP A;  4YIP A;  4EB6 B;  3WFV A;  1Y74 A;  3SYO A;  3CRR A;  2WLJ A;  4I0X B;  1CXZ B;  2XND G;  1YEW A;  1Z5V A;  4JI1 B;  3E8G A;  5KUM A;  5H9C A;  2E74 B;  3SYA A;  5ITZ A;  1KQS U;  4MT8 A;  3ABK B;  3CWB H;  5LXT A;  1AI6 A;  5HFL A;  4JI2 B;  4FJC C;  3K5O A;  4J9Z B;  1M93 A;  2QA4 V;  3SYQ A;  2FL4 A;  1O9H A;  2IH1 C;  3X2Q B;  1FD9 A;  1WP7 A;  5EBW C;  1NH2 B;  1MAB G;  3RYF A;  4CC6 A;  4D7T A;  2ZT9 B;  1YXB A;  3ZMZ A;  4X1K A;  1WPB A;  4DV0 O;  2XUM A;  1P7B A;  1DLB A;  2F1M A;  2HG5 C;  4CC5 A;  4OPH A;  3SPI A;  2AGA A;  3B8M A;  5IWA B;  2FKX A;  2H8P C;  1N34 B;  3FYI B;  4JAU A;  2B1I A;  4PDR A;  4G27 B;  2YSU B;  3VBB A;  1WB7 A;  4I9Q A;  3L74 H;  3CJH A;  4U3F H;  3M8A A;  4Z1M G;  1SET A;  2V4D A;  1YJ9 V;  3JAK B;  1AB3 A;  4Q6G A;  1TGO A;  4KFM A;  3KKY A;  4B7K A;  2Y4T A;  1M56 C;  4B3M O;  2FYU H;  4NVP A;  5JJJ B;  5B1B B;  5EIB C;  3LNM B;  5BR8 O;  4TQF A;  4FIP C;  3ABU A;  2H3O A;  2WA3 A;  3ZS8 C;  2E76 B;  1SF9 A;  5AG2 A;  4R8C A;  2ODM A;  1N32 B;  1HWY A;  4MTF A;  1ORQ C;  4P30 A;  4X89 A;  1ZSP A;  5IE9 A;  3ZHS A;  2H94 A;  3OUF A;  1VF6 A;  4PHZ A;  1VIB A;  3BHP A;  3MHS C;  2IU0 A;  2BCC H;  4TV8 A;  4Z2W A;  3SPC A;  2ZDI A;  4DW1 A;  5KA5 A;  2QJ1 A;  5B5E Z;  2P6J A;  3LSS A;  5H5N A;  3A2F A;  3CRQ A;  1S77 D;  1IXB A;  3JAW B;  4UCR A;  2CTR A;  2LGQ A;  2ZCE A;  1XDC A;  4MVS A;  5KLV H;  2D3O W;  4JGS A;  1K33 A;  2DYS B;  3QTC A;  2BSK B;  3CHX A;  1H2G A;  1S5H C;  4UB6 Z;  3JAR B;  3RW0 A;  2JJ2 G;  3ASO C;  3CB2 A;  1PP9 H;  4DV5 B;  3RWR D;  2GDS A;  3HB3 B;  2F95 B;  3IC9 A;  4IIJ A;  1AR1 B;  3JCZ A;  1R3I C;  1GM8 A;  4HBN A;  1HR0 O;  5IYC O;  1YIT V;  1M56 B;  1YZB A;  2JS5 A;  1S0V A;  1YF2 A;  4J41 A;  1EZV H;  4DR1 O;  4DR3 O;  2W6I G;  2LW7 A;  4UCT A;  4JTC B;  4J7J A;  2NN4 A;  2P4V A;  3T1H B;  4AI8 A;  3RYI B;  4X1I B;  2Q9L A;  4JZ2 A;  3CXC U;  2F4V O;  1M4U A;  4MS2 A;  2DWD C;  4UV8 A;  1ZUQ A;  4O2A A;  4B3R B;  4O4J A;  4D7S A;  2EJR A;  2UXD O;  3K3W A;  4OGQ B;  4UVC A;  2A9H A;  2Y69 B;  1NS1 A;  4K35 A;  3RN4 A;  1CP9 A;  1F4N A;  2HP8 A;  3G6E V;  2UUC O;  5LOV B;  1WA8 B;  4K0K O;  4DV1 O;  1F7Y A;  4X65 B;  1Q82 W;  1QBZ A;  1Y74 B;  4UXN A;  1SA0 B;  1B6Q A;  1NH2 D;  4FLV A;  1VQ5 V;  3TJT A;  1XMO O;  4FZ0 A;  1N0J A;  1OCR C;  3SJA C;  3DC6 A;  3K0D A;  5ITZ B;  2RNB A;  5LXT B;  2VQE B;  2ITC C;  2PZS A;  2YID A;  2FTK A;  3OE7 G;  3SJB C;  1YDX A;  4X62 O;  3OGI B;  2XAF A;  3HKD A;  3FB6 C;  2ZDI C;  4BWA A;  3RYF B;  4MVR A;  4X1K B;  1LR1 A;  5IY5 C;  2X6C A;  5EBM C;  5LA6 A;  4K8Z A;  5DED A;  4RQF A;  4FM2 A;  3JD0 A;  4JV5 O;  2GTS A;  1EFR G;  4QIW F;  2R9I A;  3CYO A;  4N23 A;  3T4Z A;  3CJH B;  3LSQ A;  3L73 H;  4J42 A;  3CCE V;  2E75 B;  3CSX A;  3H1J H;  2CAZ C;  1VP7 A;  1M1K W;  1GN2 A;  1RPO A;  2O57 A;  1XBL A;  4I9W A;  2QSA A;  4I7Z B;  4KHP B;  1KYO F;  3RBZ A;  4UB8 Z;  2RQ6 A;  2B9Z A;  4LCU C;  3ML0 A;  5KAI Z;  4E4E A;  2L35 A;  4CS2 A;  1H8H G;  1K97 A;  3AK3 A;  4J9Y B;  1OCR B;  2JGD A;  2LW1 A;  3Q4H A;  1V54 C;  2DYR C;  2V1D A;  1J5E O;  3ZHR A;  2QWR B;  1R1B A;  4WFG A;  4DR6 B;  4CH5 A;  1OHH G;  2QWP B;  3FFQ A;  4JI8 O;  2XAS A;  3DTU B;  4TV8 B;  3W7S A;  1D5A A;  1KC8 W;  4MTX A;  1WLE A;  3AK2 A;  4QNH B;  3GWO A;  1XUQ A;  1W0J G;  5D5Q A;  1HW7 A;  3L70 H;  1TA8 A;  3ZRV A;  4IL6 Z;  1GN6 A;  5CA0 A;  4CH4 A;  4GT1 A;  1AI5 A;  1G4Y B;  1E1Q G;  5JJE B;  4DR4 B;  5EIB D;  5DN6 G;  4IHJ A;  5EYP B;  1GM7 A;  2RN9 A;  2WAM A;  1SQG A;  2R70 A;  4FFK A;  2Z5U A;  2ARH A;  4X20 A;  2QTO A;  2HLD G;  4PJ0 Z;  1VQP V;  2CTP A;  2EIM B;  3OTO B;  2NR5 A;  3BAB A;  4JI7 B;  3ZN0 A;  4B08 A;  1H2S B;  4LF5 O;  4FLT A;  4WBN A;  1OCO C;  3OEE G;  1GMG A;  3ZHT A;  4HYO A;  1Y4M A;  4R50 A;  5LBQ A;  2ETN A;  4JI4 B;  5KHK A;  1DGS A;  2UXB B;  4NYK A;  4DV7 O;  1IVS A;  4GKJ B;  4NXM O;  4KUM A;  1IBM O;  4DV4 B;  1OCZ C;  4FVM A;  4JI0 O;  1KB9 F;  4F6R B;  5IYZ A;  3D8C A;  3B40 A;  3P30 A;  3HKB A;  4ZOL A;  2JEU A;  2BTO A;  3M7M X;  1Y76 A;  1HNZ O;  4LFB B;  2P5O A;  2KKW A;  2C2A A;  3UCS C;  1Z2G A;  1KP2 A;  4LF7 B;  1XL6 A;  3TET A;  3WB0 A;  4MW8 A;  4B3S O;  4RQE A;  4MSW C;  4EEQ A;  3UKM A;  3HKD B;  1RSO A;  1K34 A;  2GV9 A;  4A5U B;  4CS3 A;  4B3T O;  2ZE7 A;  3CX5 F;  4H44 B;  1BMF G;  2JRI A;  3CMA V;  2IJH A;  3JD3 A;  4O2B A;  1UJW B;  2EJ7 A;  2UXC B;  1R73 A;  5JWP A;  4XDK A;  5LA6 B;  1H38 A;  2AZ2 A;  1VQ8 V;  1OCO B;  2A3Q A;  5IYB O;  1QNM A;  4CBC A;  2FML A;  1N36 O;  2OYQ A;  3QVN A;  4K3A A;  3ZHU A;  2F23 A;  1FFT B;  4UVB A;  1FAF A;  2P22 C;  2Q7G A;  2R72 A;  3CCU V;  4K8X A;  1SS3 A;  3AEI A;  1EN4 A;  2E3C A;  3CE2 A;  3BY6 A;  1JFF A;  5FL7 G;  2HHH O;  4TUY A;  3CC7 V;  4LH7 A;  5L3F A;  4JI3 O;  1EBO A;  3RGB A;  4DV0 B;  2JGD B;  5GW7 A;  2Z0A A;  3Q4H B;  3AG7 A;  5JQG A;  1WP8 A;  3I5D A;  3BRC A;  1WB8 A;  4PI2 A;  4LNU B;  4O4I A;  4DR7 O;  4DV2 O;  1K5Q A;  3O65 A;  4MVU A;  5CBF A;  4JAA A;  5CA0 B;  1VQ7 V;  3ABK C;  1VQM V;  3K03 A;  1I94 O;  1BQZ A;  5JVD A;  3JAR A;  5BR8 B;  5JJN B;  2YXL A;  4WFF A;  3ASN C;  4YHH O;  1AP6 A;  3MHH C;  1K4D C;  5LGU A;  3ZRW B;  2ZIM A;  3E89 A;  3T1Y O;  2WLK A;  5EC2 C;  4WBN B;  2QWQ B;  2N74 A;  3OD4 A;  4G28 B;  3ZHQ A;  4DUZ O;  2ZKO A;  4LC1 A;  3T1C A;  2Q73 A;  2XAJ A;  4ICG A;  4WCE V;  2EIN C;  2YEV A;  2QDO A;  1URF A;  4X1Y A;  5A2Q N;  5B1B C;  3JSN A;  2NLJ C;  1SZX A;  3CCM V;  5E1A C;  2WLH A;  4J10 A;  3CCL V;  4IYI A;  4IYH A;  5IYZ B;  2BTQ B;  1SA0 A;  3HKB B;  4ZOL B;  3MD0 A;  1Y76 B;  2LFS A;  2Q0A A;  1DF4 A;  1L0N H;  1KBH A;  1VQ6 V;  3LDE A;  2HKO A;  3LNN A;  3OAA G;  5C93 A;  1I7F A;  2CGN A;  1HR0 B;  2Q5Z A;  3CC2 V;  4Q20 A;  3IC7 A;  1R3J C;  3AK1 A;  4TV9 B;  4YIO A;  4H33 A;  1XIL A;  3OMI B;  4BR6 A;  4DR1 B;  4DR3 B;  3BEH A;  3CCR V;  4JTD B;  1QR9 A;  5LMU O;  2XHB A;  3ASN B;  1RSO B;  1JPX A;  1NI8 A;  4FZ1 A;  4I50 A;  2F4V B;  3OMA B;  4GUN A;  4NTY A;  1AR4 A;  1JA8 A;  2UXD B;  2DYS C;  4O2B B;  5FPR A;  2QM4 A;  1G6U A;  3HR0 A;  5A9G A;  2UUC B;  5L3G A;  4K0K B;  1DTO A;  3E8H A;  4OPA A;  4DV1 B;  4CZZ A;  3EXA A;  3OEH G;  2EIN B;  3G80 A;  2HVJ C;  1Q8I A;  2BE3 A;  2YDE A;  1G1X B;  2EIK B;  1XMO B;  1K3E A;  4I4T A;  1P4R A;  1MA1 A;  5LHI A;  3FAV B;  3QO7 A;  2UXN A;  4DO2 A;  2PI5 A;  4HNA A;  1G8M A;  2R9R B;  4UV9 A;  2XAG A;  4OXS A;  3BA9 A;  3J81 N;  1K92 A;  2WLL A;  4DV3 O;  4Z1V A;  4X62 B;  1JFF B;  2JJ1 G;  1IX9 A;  5JCO A;  3CCS V;  4FPP A;  3B09 A;  2QE7 G;  4TUY B;  2Y69 C;  3HKC A;  4YJ2 A;  4KXR A;  2E5L O;  2ADP A;  3CRC A;  3VQW A;  2DW4 A;  1NT2 B;  4DYL A;  3OM3 B;  1XMQ O;  1NZ6 A;  3BAA A;  5JQG B;  1ZX3 A;  1ZTE A;  1RPR A;  2GTA A;  4PA7 A;  2RJZ A;  2A06 H;  4KL1 A;  4JV5 B;  4O4I B;  3CXH F;  4ZKI A;  1NU1 H;  3MDS A;  1GAX A;  2AHY A;  1IBL O;  4PI0 A;  3VOU A;  4DRX A;  2IM9 A;  4CS4 A;  2KG7 A;  1RFY A;  1TUE B;  4TOI A;  2GBO A;  1IXM A;  4J80 A;  2N05 A;  5EYP A;  1WNS A;  2LJ2 A;  5H6R A;  5JVD B;  1M57 B;  2ZNJ A;  5EBL C;  2EIJ B;  4GYC B;  3JAT A;  4JYB A;  5KAF Z;  4H13 B;  4DR5 O;  1T5E A;  2VQF O;  2EX3 A;  2YUA A;  2ZXW C;  1ENV A;  3AG3 B;  4UCS A;  3J80 N;  2W6J G;  1JQ0 A;  1BE3 H;  1U96 A;  4L8J A;  5J2U A;  3CCQ V;  1PV0 A;  2UUB O;  2VWK A;  4TSF G;  4JYY A;  1J5E B;  2WA4 A;  1I0H A;  3WB2 A;  4JI8 B;  3OR7 C;  1Y67 A;  1J95 A;  2M6Y A;  3K9S A;  1IZ3 A;  2YEV B;  5B3S B;  4X1Y B;  4F6R A;  2OT5 A;  2WWW A;  2A7W A;  3H1H H;  4MVM A;  1AP5 A;  2PYJ A;  2HVK C;  2M7W A;  5B66 Z;  1AI4 A;  4DUY O;  3B4S A;  5J9P C;  3HPL C;  1WJZ A;  3D3Q A;  2ZR3 A;  1TUB A;  1V9P A;  5JCO C;  1YHQ V;  2UU9 O;  4LR3 A;  2CDY A;  3JD1 A;  1N34 O;  4D6T H;  1VF6 C;  5BY1 A;  4I55 A;  1MSW D;  2X7R B;  4LFA O;  1JOY A;  1S76 D;  3DGE A;  4LF5 B;  2PI4 A;  4N21 A;  1B06 A;  5C8Y A;  4JI6 O;  2QM7 A;  4PA4 A;  4AHC A;  2Q6A A;  2OCH A;  1XNQ O;  3CS5 A;  3ABT A;  1XNR O;  4NXN O;  2ZXW B;  4I50 B;  4LBE C;  3K9A A;  4DV7 B;  2DQ0 A;  3E86 A;  3W7X A;  4NXM B;  5FNV A;  1IBM B;  4JI0 B;  5IT9 N;  4J7Z A;  5KHH A;  1K9M W;  2WLI B;  3CCJ V;  4DR2 O;  1IBK O;  1HDJ A;  2EZO A;  1S5L Z;  5CB4 A;  5BMV B;  4LP8 A;  2EIM C;  3FX7 A;  3VQX A;  1HNZ B;  1PPJ H;  3RYH B;  5HFM A;  3UQ8 A;  3TXS A;  1XI1 A;  4I4T B;  3W7W A;  3ETG A;  5LGT A;  4UCO A;  1QLN A;  3IFX A;  3CRA A;  1WPX A;  4QJF B;  1QHT A;  4X64 O;  4HNA B;  1SQP H;  3H1I H;  2XAQ A;  2IU3 A;  2WLL B;  3RFR A;  1GN3 A;  4MTO A;  4YY3 O;  2QKS A;  4YJ3 B;  3JSL A;  1SQV H;  1FJG O;  3CME V;  1PD3 A;  3LUT B;  1XHX A;  3HKC B;  4YJ2 B;  5LYJ B;  2GHY A;  1MSD A;  2OIG A;  2LP7 A;  3JCU Z;  4LNU A;  1Q81 W;  1NTM H;  3EVK A;  1NTZ H;  2LQT A;  3SYP A;  4LF6 O;  1D2D A;  1N36 B;  2ZD9 A;  3PN1 A;  4DRX B;  1LUV A;  1OCC C;  2KG7 B;  1ZLZ A;  2FB5 A;  1H2N A;  1Q43 A;  4UCU A;  4WFB V;  1R3K C;  4B3R O;  4P9O A;  2Q0O C;  5LP6 B;  3JAT B;  1RM1 C;  1AJP A;  3N2G B;  2HEP A;  3CEI A;  3K5L A;  1N4C A;  2P67 A;  3ZRW A;  4R6Z A;  1YIJ V;  2ILM A;  2HHH B;  2HR3 A;  1K5S A;  2JEX A;  3BPZ A;  4U7N A;  4JI3 B;  5J2U B;  2DWE C;  2IJJ A;  3QO8 A;  4JZG A;  4ABM A;  1VMG A;  4BW9 A;  1MMM A;  1MOF A;  4FLU A;  4BIU A;  1LUW A;  1ZWI C;  2HJD A;  1SRY A;  2CH7 A;  1FS0 G;  2KSD A;  4LWS B;  3LDD A;  4DR7 B;  2QWN B;  1GO3 F;  3R66 A;  4H37 A;  3K0G A;  3G67 A;  1QLE B;  4O4H A;  4FM0 A;  2MK3 A;  5TIS Z;  1B04 A;  1YJW V;  2K1E A;  4LH6 A;  1I94 B;  4RO2 A;  4TQD A;  1I08 A;  2XAH A;  4GLX A;  2W0X A;  2BTQ A;  4FLX A;  3FD9 A;  1QR8 A;  1VEW A;  3EFF K;  3E22 A;  2QM8 A;  3ZMS A;  1XEQ A;  3EHB B;  3F5T A;  4ZI7 B;  4YHH B;  1TUB B;  3CRM A;  5FPO A;  3OW2 U;  4G2K A;  4FMT A;  3CCV V;  1OCC B;  2YI8 A;  4TV9 A;  5LGN A;  4ZHQ B;  2VRZ A;  3W7U A;  3T1Y B;  4I55 B;  2OTL V;  4AIL C;  1B3Q A;  1S5J A;  2Q7E A;  2YIB A;  2YIC A;  4LF4 O;  3TK1 A;  3K59 A;  5EC1 C;  3JAL A;  5D5P A;  5C8Y B;  3W7T A;  1RM1 B;  1GTO A;  4DUZ B;  3LSU A;  2EUL A;  3SR2 C;  3MAQ A;  4AQY O;  5IDJ A;  2ATK C;  2CGO A;  1YTF B;  1L8D A;  1PNM A;  3C3S A;  5IJ0 B;  5FNV B;  1SQB H;  2WPD G;  3CC4 V;  3KG2 A;  3ZMV A;  3VQV A;  4PA6 A;  1QCE A;  5LMN O;  2UXX A;  1PM9 A;  3K79 A;  5KMG B;  2IW5 A;  5CB4 B;  4XDJ A;  4LF8 O;  4LFC O;  1NVP B;  2LO1 A;  4EKW A;  2X6B A;  2A0L A;  3FAV A;  2Y4U A;  2IBZ H;  4QPJ A;  1VAR A;  2W0F C;  4I5S A;  1S72 V;  5LMU B;  2XTA A;  5EK0 A;  5CBH A;  1LNQ A;  4LF9 O;  3QO5 A;  1I5X A;  1K7D A;  1R6N A;  4JYC A;  1N33 O;  2ZE6 A;  2Q7H A;  2DQ3 A;  1BT8 A;  4YXW G;  4ZIB A;  1NTK H;  3ZHV A;  1JJO A;  3AG4 C;  2JDI G;  4NKG B;  2IJI A;  2UUA O;  1P7G A;  2P90 A;  2D2C B;  2ZE8 A;  2Q4P A;  3K04 A;  4RUF A;  2PF4 E;  3G71 V;  3K57 A;  4B3M B;  1M5I A;  3E35 A;  5EZY B;  2CTQ A;  1NJI W;  3ZJZ A;  4X8A A;  2ZM6 O;  1SZT A;  1KUQ A;  4MTG A;  3WB1 A;  3F7V C;  3UT5 A;  4X66 O;  4DV3 B;  4QE7 A;  2LGW A;  1PKX A;  4U7O A;  5CA1 A;  5IJ9 A;  2JVD A;  2JK5 C;  2V7Q G;  2E5L B;  5B1A C;  2YS8 A;  2JIZ G;  1BHB A;  3A0B Z;  3F7Y C;  4H0L B;  1XMQ B;  1HP8 A;  5H6Q A;  3K58 A; 
#chains in the Genus database with same CATH homology
 3LSQ A;  4PDL A;  4X88 A;  4ZKI A;  1CPY A;  3CCE V;  2GSM B;  2AHY A;  3VOU A;  5KUK A;  3K08 A;  2EIK C;  3LDC A;  4XDL A;  1M1K W;  1RPO A;  3SPJ A;  3ABM B;  1TUE B;  1W0K G;  3ZIA G;  4I9W A;  1IXM A;  5L3E A;  1CEZ A;  4UVA A;  3RBZ A;  5LHG A;  5H6R A;  4LCU C;  1VQ9 V;  1M57 B;  3ML0 A;  5EBL C;  2EIJ B;  4JYB A;  1M90 W;  3AG4 B;  1NKD A;  4ZBM A;  3STL C;  1H8H G;  4GCZ A;  4WFA V;  1K97 A;  4J9Y B;  1SES A;  2ZXW C;  3FYE B;  1ENV A;  1OCR B;  3AG3 B;  2W6J G;  4JTA B;  1JQ0 A;  1NQT A;  1V54 C;  2DYR C;  2V1D A;  3CCQ V;  2EIL B;  1YTF D;  2OCC C;  4F4L A;  4TSF G;  4QE9 A;  4WFG A;  3T2M A;  2CK3 G;  1N8R W;  1OHH G;  3AG2 B;  4PA9 A;  2XAS A;  3DTU B;  3W7S A;  1KC8 W;  4MTX A;  1WLE A;  4QNH B;  3GWO A;  1JX9 A;  4TWK A;  1W0J G;  2ZR2 A;  5CA3 A;  3A0R A;  3ZRV A;  3OR7 C;  4GX1 A;  1L1F A;  1K8A W;  3D36 A;  1J95 A;  4JAV A;  3WG7 C;  4GT1 A;  1AI5 A;  1G4Y B;  2YEV B;  1VQN V;  1BL8 A;  1OCZ B;  4BAY A;  5B3S B;  1NVP D;  1E1Q G;  1QVF U;  1K4C C;  4BIZ A;  2OT5 A;  4GX0 A;  2WWW A;  5DN6 G;  2BOB C;  4MVM A;  1GM7 A;  2WAM A;  2HVK C;  5B1A B;  2M7W A;  1AI4 A;  1DF5 A;  1M57 C;  4HZ3 A;  3T4D A;  2WLI A;  5J9P C;  1ROP A;  2EIJ C;  3HPL C;  2WLM A;  2Z5U A;  5B1N A;  2QTO A;  4JF3 A;  2HLD G;  2B5U A;  2ZR3 A;  4ASU G;  2HJF C;  3G4S V;  1VQP V;  2EIM B;  4R7C A;  1YHQ V;  1R6K A;  3AG3 C;  1QVG U;  1K73 W;  1OZ0 A;  3JD1 A;  3ZN0 A;  1AJN A;  3CPW U;  4RUE A;  4BW5 A;  3FB8 C;  4P2Z A;  3NXS A;  1MSW D;  1OCO C;  2X7R B;  3OEE G;  1JOY A;  1GMG A;  2ITD C;  1S76 D;  3DGE A;  2PI4 A;  4N21 A;  5B1O A;  4HYO A;  3CD6 V;  4E2L A;  1Y4M A;  4R50 A;  5LBQ A;  2QM7 A;  4PA4 A;  2Q6A A;  1FXK A;  3ABT A;  1YJN V;  2ZXW B;  4P9P A;  2LFR A;  4KUM A;  4LBE C;  1W2B U;  1R3L C;  4MW3 A;  3K9A A;  1OCZ C;  3I55 V;  5B3S C;  2DQ0 A;  3E86 A;  3W7X A;  3I56 V;  2OCC B;  4RAI A;  1YSC A;  3H01 A;  5KA6 A;  3X2Q C;  3P30 A;  3OFN G;  1K9M W;  3GB7 C;  4WF9 V;  2WLI B;  2JEU A;  1E79 G;  5BZB A;  3CCJ V;  2NNU A;  2IJK A;  3K06 A;  3OR6 C;  1KEC A;  2EZO A;  4L87 A;  4LP8 A;  2EIM C;  1VQL V;  1NR1 A;  5CBG A;  2C2A A;  2P7T C;  4WFE A;  5HFM A;  3WG7 B;  1KP2 A;  1COW G;  1PL0 A;  2Q69 A;  1XL6 A;  3ZRX A;  3TET A;  1JVM A;  1VQ4 V;  3STZ C;  3W7W A;  3ETG A;  3M99 B;  5LGT A;  1QLN A;  3IFX A;  4MW8 A;  4QJF B;  1WPX A;  1GK9 A;  4RQE A;  4MSW C;  3UKM A;  3OGC C;  4KP4 A;  1K34 A;  2XAQ A;  2IU3 A;  2WLL B;  3AG1 C;  4PEL A;  3E8F A;  4MVQ A;  3ETE A;  4TT3 G;  1KD1 W;  1PNK A;  2WLN A;  1BMF G;  4MTO A;  1VQK V;  2QKS A;  3B77 A;  1JJ2 U;  1EZJ A;  3JYC A;  2B1G A;  3CMA V;  2IJH A;  3JD3 A;  3CME V;  1UJW B;  1PD3 A;  3LUT B;  1R73 A;  2ZQM A;  2GHY A;  4QPK A;  3ZRS A;  2EBO A;  4JPR A;  1F51 A;  4XDK A;  1SER A;  5L3D A;  1H38 A;  2EZP A;  2LP7 A;  3WFV A;  1VQ8 V;  1OCO B;  3FKS G;  3SYO A;  5IYB O;  2Z3Y A;  4CBC A;  5CN0 A;  2WLJ A;  1Q81 W;  5IYD O;  5L3C A;  2XND G;  1V55 C;  3ABL C;  3SYP A;  4MVZ A;  3E8G A;  5KUM A;  5H9C A;  2ZD9 A;  3SYA A;  1KQS U;  4MT8 A;  3ABK B;  1FFT B;  1AI6 A;  5HFL A;  4UVB A;  1OCC C;  4FJC C;  2QA4 V;  4J9Z B;  3P32 A;  3SYQ A;  2IH1 C;  3CCU V;  3X2Q B;  4WFB V;  3AEI A;  1R3K C;  5EBW C;  1NH2 B;  3D3I A;  4P9O A;  1MAB G;  3BY6 A;  5FL7 G;  1BHA A;  1RM1 C;  1AJP A;  1FXK C;  3ZMZ A;  1P7B A;  2P67 A;  3ZRW A;  4R6Z A;  1DLB A;  3CC7 V;  1YIJ V;  2HG5 C;  5L3F A;  1ARO P;  1EBO A;  5GW7 A;  3SPI A;  2HR3 A;  1K5S A;  2JEX A;  3B8M A;  4U7N A;  1FXV A;  1AJQ A;  1THZ A;  2DWE C;  2AHZ A;  2H8P C;  2IJJ A;  3QO8 A;  5CMU A;  4PDM A;  3FYI B;  4JAU A;  2B1I A;  4PDR A;  4G27 B;  2YSU B;  3VBB A;  1MOF A;  4Z1M G;  1SET A;  4PDV A;  4BIU A;  1K5Q A;  1ZWI C;  3AG1 B;  1YJ9 V;  1SRY A;  1FS0 G;  4KFM A;  3LDD A;  3CP1 A;  4MVU A;  5CBF A;  1GO3 F;  3FB5 C;  3JD4 A;  4H37 A;  1M56 C;  3K0G A;  1GKF A;  1QLE B;  1VQ7 V;  3ABK C;  5B1B B;  2MK3 A;  1NBM G;  3K03 A;  1VQM V;  3LNM B;  4FIP C;  3ABU A;  3ETD A;  1FXH A;  1YJW V;  2K1E A;  4RO2 A;  3ASO B;  2XAH A;  2X6A A;  4PA3 A;  3E8B A;  4WFF A;  4R8C A;  1QR8 A;  3EFF K;  1HWY A;  4GX2 A;  3ASN C;  3RVY A;  4JAS A;  2QM8 A;  3ZMS A;  3MHH C;  2WSS G;  1V55 B;  1ORQ C;  1K4D C;  3EHB B;  3ABL B;  4MTF A;  4P30 A;  5LGU A;  2F43 G;  3B8N A;  1AI7 A;  1GM9 A;  1NR7 A;  4X89 A;  3ZRW B;  2H94 A;  3OW2 U;  1KKD A;  4G2K A;  3OUF A;  3E89 A;  4FMT A;  2X0L A;  3QNE A;  3CCV V;  1OCC B;  3MHS C;  2WLK A;  2IU0 A;  5LGN A;  5EC2 C;  3W7U A;  4UUJ C;  2OTL V;  3SPC A;  2ZDI A;  4G28 B;  5KA5 A;  3TK1 A;  4LC1 A;  5EC1 C;  3T1C A;  1Y66 A;  2P6J A;  2XAJ A;  2KB1 A;  3LSS A;  3W7T A;  1RM1 B;  3SJQ C;  2Q68 A;  1GTO A;  4WCE V;  2EIN C;  1FXK B;  1S77 D;  2A79 B;  1XL4 A;  2YEV A;  3F5W C;  3ZMT A;  5IDJ A;  2ATK C;  4MVS A;  1QLE C;  4JGS A;  2D3O W;  5B1B C;  2NLJ C;  1YTF B;  1K33 A;  2DYS B;  3CCM V;  1PNM A;  5E1A C;  2WLH A;  3CCL V;  1F23 A;  1H2G A;  1S5H C;  2WPD G;  3RW0 A;  2JJ2 G;  3CC4 V;  3ASO C;  3KG2 A;  1I5Y A;  3ZMV A;  3SPG A;  3ZN1 A;  3JD2 A;  4PA6 A;  1YI2 V;  3MD0 A;  5H6Q A;  3HB3 B;  1QCE A;  2LFS A;  2UXX A;  1DF4 A;  1AR1 B;  3JCZ A;  3K79 A;  1R3I C;  1GM8 A;  2IW5 A;  4XDJ A;  3OUS A;  5IYC O;  1VQ6 V;  1NVP B;  3LDE A;  1YIT V;  2HKO A;  1M56 B;  3OAA G;  5C93 A;  1S0V A;  3FB7 C;  4EKW A;  2X6B A;  2A0L A;  2W6I G;  3CC2 V;  1H8E G;  4Q20 A;  3IC7 A;  1E1R G;  1R3J C;  2Y48 A;  4JTC B;  4H33 A;  5DM6 V;  4QPJ A;  1MG1 A;  3SPH A;  3OMI B;  3UM7 A;  4DXW A;  2W0F C;  4WFH A;  3BEH A;  3CCR V;  4JTD B;  1QR9 A;  3CXC U;  1KP3 A;  4XBF A;  3ASN B;  2XOK G;  4MS2 A;  1JPX A;  2DWD C;  4I5S A;  4UV8 A;  1S72 V;  2QEX V;  1S3J A;  2EJR A;  5L3B A;  3K3W A;  4UVC A;  2A9H A;  3OMA B;  2Y69 B;  5IY5 B;  5EK0 A;  5CBH A;  1LNQ A;  3IGA C;  3QO5 A;  3ABM C;  1I5X A;  1K7D A;  1R6N A;  2DYS C;  1CP9 A;  1F4N A;  3G6E V;  4JYC A;  2DQ3 A;  2HFE C;  4FK5 C;  4YXW G;  1Q82 W;  1QBZ A;  5L3G A;  1DTO A;  3TCU A;  3AG4 C;  3E8H A;  4UXN A;  2JDI G;  3RVZ A;  1B6Q A;  2IJI A;  1NH2 D;  1F4M A;  4CZZ A;  1VQ5 V;  3OEH G;  2EIN B;  2HVJ C;  1OCR C;  2P90 A;  2EIK B;  1K3E A;  3K04 A;  3K0D A;  4RUF A;  1JCH A;  1P4R A;  2EIL C;  1Q7Y W;  5LHI A;  2ITC C;  1Q86 W;  3G71 V;  3QO7 A;  2FTK A;  2UXN A;  2Q67 A;  3OE7 G;  4DO2 A;  3E35 A;  2PI5 A;  3AG2 C;  1G8M A;  2R9R B;  2XAF A;  4UV9 A;  2XAG A;  3FB6 C;  4OXS A;  1NJI W;  1M9N A;  3ZJZ A;  4X8A A;  1K92 A;  2ZDI C;  2WLL A;  3E2E A;  1SZT A;  4MTG A;  3ZMU A;  4MVR A;  3OMN B;  2JJ1 G;  3F7V C;  2OTJ V;  3CCS V;  3ZCC A;  4FPP A;  4QE7 A;  1VQO V;  5LHH A;  2QE7 G;  2Y69 C;  5IY5 C;  1V54 B;  3PJS K;  1PKX A;  2DYR B;  4U7O A;  3R65 A;  2X6C A;  5EBM C;  2BOC C;  2DW4 A;  4HAM A;  3SYC A;  2JK5 C;  2V7Q G;  4RQF A;  3E83 A;  5B1A C;  3OM3 B;  3JD0 A;  2JIZ G;  1EFR G;  4QIW F;  1RPR A;  2R9I A;  3CYO A;  4PA7 A;  1BHB A;  4N23 A;  1PNL A;  3F7Y C;  4MVO A;  3T4Z A;  4GX5 A;  2IH3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...