2H8UA

Bucain, a cardiotoxin from the malayan krait bungarus candidus
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
RKCLIKYSQANESSKTCPSGQLLCLKKWEIGNPSGKEVKRGCVATCPKPWKNEIIQCCAKDKCNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bucain
publication title Crystal Structure of Bucain
rcsb
molecule tags Toxin
total genus 10
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h8uA00
1FF4A 2GOOC 1XT3A 4P7UA 2NBTA 1JBDA 1CDRA 1FFJA 3U73U 1LJZA 5DU1A 1IQ9A 1LX5B 1TFSA 1IKCA 2ABXA 1LXHA 1HOYA 2BHIA 1FSSB 1QKEA 2MHYA 1CVOA 1FASA 2PJYB 1CRFA 3EBXA 4RUDA 1HAAA 5DO6A 6EBXA 1ES7B 1NTXA 2H7ZB 5IMTD 1KBTA 1RL5A 1HC9A 5EBXA 4DO8A 3BT1U 2JQPA 1H0JA 1KXIA 3FEVA 4QTIU 2FD6U 1IDIA 4UY2C 2QJBC 4EY8B 2LA1A 2MFAA 1CREA 4BIKB 1I02A 1KFHA 1QKDA 1TGXA 1JE9A 1KL8A 1G6MA 1YWHA 2MJ4A 3KFDI 2H62C 1CDTA 3HH7A 2LCRA 1IDHA 4ZQYA 4OM4A 1S4YA 1VB0A 2CRSA 1NYSA 2X8BB 1NORA 2JVEA 1CDQA 1ABTA 1TXBA 1CXOA 2UWRA 1IDLA 1LXGA 4HQPF 2J8BA 1CB9A 1KBAA 1ONJA 3NEQA 5DZ5A 4LFTA 2L5SA 1ERGA 2H8UA 4IYEA 1MR6A 2QJ9C 1NXBA 2H64B 2MUPA 2HLRA 1F94A 3LAQU 1CODA 1BTEA 1FSCA 3EVSC 1KC4A 2K3GA 1PLOA 2QC1A 2MJ0A 2CDXA 1JGKA 2ERAA 2PJYC 2MUOA 3NDSA 4XJJA 1NYUA 1B41B 2CRTA 1IK8A 1DRSA 4AEAA 3QB4B 1NTNA 4OM5A 1KU6B 3NH7A 2N99A 4FAOE 1CXNA 3KFDE 1ZADA 2GOOB 2H7ZA 2OFSA 1KS6A 3PLCA 2H64C 1V6PA 1KTZB 1NEAA 2MJYA 2QJAC 2CCXA 1M9ZA 2H5FA 4FAOC 3U74U 1W6BA 2BTXA 1FRAA 2CTXA 2UX2A 1KBSA 1L4WA 1RGJA 2HLQA 1REWC 1QM7A 2VLWA 1HC9B 1COEA 1MAHF 2L03A 1IDGA 1CTXA 1CDSA 3VTSA 5IMYC 1HAJA 3ERAA 1F8UB 4BDTB 1BXPA 1CHVS 3BT2U 1TXAA 1CCQA 1ERAA 1LSIA 2I9BE 1IJCA 1UG4A 2H62D
chains in the Genus database with same CATH superfamily
1FF4A 2GOOC 1XT3A 4P7UA 2NBTA 1JBDA 1CDRA 1FFJA 3U73U 1LJZA 5DU1A 1IQ9A 1LX5B 1TFSA 1IKCA 2ABXA 1LXHA 1HOYA 2BHIA 1FSSB 1QKEA 2MHYA 1CVOA 1FASA 2PJYB 1CRFA 3EBXA 4RUDA 1HAAA 5DO6A 6EBXA 1ES7B 1NTXA 2H7ZB 5IMTD 1KBTA 1RL5A 1HC9A 5EBXA 4DO8A 3BT1U 2JQPA 1H0JA 1KXIA 3FEVA 4QTIU 2FD6U 1IDIA 4UY2C 2QJBC 4EY8B 2LA1A 2MFAA 1CREA 4BIKB 1I02A 1KFHA 1QKDA 1TGXA 1JE9A 1KL8A 1G6MA 1YWHA 2MJ4A 3KFDI 2H62C 1CDTA 3HH7A 2LCRA 1IDHA 4ZQYA 4OM4A 4KSNA 1S4YA 1VB0A 2CRSA 1NYSA 2X8BB 1NORA 2JVEA 1CDQA 1ABTA 1TXBA 1CXOA 2UWRA 1IDLA 1LXGA 4HQPF 2J8BA 1CB9A 1KBAA 1ONJA 3NEQA 5DZ5A 4LFTA 2L5SA 1ERGA 2H8UA 4IYEA 1MR6A 2QJ9C 1NXBA 2H64B 2MUPA 2HLRA 1F94A 3LAQU 1CODA 1BTEA 1FSCA 3EVSC 1KC4A 2K3GA 1PLOA 2QC1A 2MJ0A 2CDXA 1JGKA 2ERAA 2PJYC 2MUOA 3NDSA 4XJJA 1NYUA 1B41B 2CRTA 1IK8A 1DRSA 4AEAA 3QB4B 1NTNA 4OM5A 1KU6B 3NH7A 2N99A 4FAOE 1CXNA 3KFDE 1ZADA 2GOOB 2H7ZA 2OFSA 1KS6A 3PLCA 2H64C 1V6PA 1KTZB 1NEAA 2MJYA 2QJAC 2CCXA 1M9ZA 2H5FA 4FAOC 3U74U 1W6BA 2BTXA 1FRAA 2CTXA 2UX2A 1KBSA 1L4WA 1RGJA 2HLQA 1REWC 1QM7A 2VLWA 1HC9B 1COEA 1MAHF 2L03A 1IDGA 1CTXA 1CDSA 3VTSA 5IMYC 1HAJA 3ERAA 1F8UB 4BDTB 1BXPA 1CHVS 3BT2U 1TXAA 1CCQA 1ERAA 1LSIA 2I9BE 1IJCA 1UG4A 2H62D
chains in the Genus database with same CATH topology
1FF4A 2GOOC 1XT3A 4P7UA 2NBTA 1JBDA 1CDRA 1FFJA 3U73U 1LJZA 5DU1A 1IQ9A 1LX5B 1TFSA 1IKCA 2ABXA 1LXHA 1HOYA 2BHIA 1FSSB 1QKEA 2MHYA 1CVOA 1FASA 2PJYB 1CRFA 3EBXA 4RUDA 1HAAA 5DO6A 6EBXA 1ES7B 1NTXA 2H7ZB 5IMTD 1KBTA 1RL5A 1HC9A 5EBXA 4DO8A 3BT1U 2JQPA 1H0JA 1KXIA 3FEVA 4QTIU 2FD6U 1IDIA 4UY2C 2QJBC 4EY8B 2LA1A 2MFAA 1CREA 4BIKB 1I02A 1KFHA 1QKDA 1TGXA 1JE9A 1KL8A 1G6MA 1YWHA 2MJ4A 3KFDI 2H62C 1CDTA 3HH7A 2LCRA 1IDHA 4ZQYA 4OM4A 4KSNA 1S4YA 1VB0A 2CRSA 1NYSA 2X8BB 1NORA 2JVEA 1CDQA 1ABTA 1TXBA 1CXOA 2UWRA 1IDLA 1LXGA 4HQPF 2J8BA 1CB9A 1KBAA 1ONJA 3NEQA 5DZ5A 4LFTA 2L5SA 1ERGA 2H8UA 4IYEA 1MR6A 2QJ9C 1NXBA 2H64B 2MUPA 2HLRA 1F94A 3LAQU 1CODA 1BTEA 1FSCA 3EVSC 1KC4A 2K3GA 1PLOA 2QC1A 2MJ0A 2CDXA 1JGKA 2ERAA 2PJYC 2MUOA 3NDSA 4XJJA 1NYUA 1B41B 2CRTA 1IK8A 1DRSA 4AEAA 3QB4B 1NTNA 4OM5A 1KU6B 3NH7A 2N99A 4FAOE 1CXNA 3KFDE 1ZADA 2GOOB 2H7ZA 2OFSA 1KS6A 3PLCA 2H64C 1V6PA 1KTZB 1NEAA 2MJYA 2QJAC 2CCXA 1M9ZA 2H5FA 4FAOC 3U74U 1W6BA 2BTXA 1FRAA 2CTXA 2UX2A 1KBSA 1L4WA 1RGJA 2HLQA 1REWC 1QM7A 2VLWA 1HC9B 1COEA 1MAHF 2L03A 1IDGA 1CTXA 1CDSA 3VTSA 5IMYC 1HAJA 3ERAA 1F8UB 4BDTB 1BXPA 1CHVS 3BT2U 1TXAA 1CCQA 1ERAA 1LSIA 2I9BE 1IJCA 1UG4A 2H62D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FF4 A;  2GOO C;  1XT3 A;  4P7U A;  2NBT A;  1JBD A;  1CDR A;  1FFJ A;  3U73 U;  1LJZ A;  5DU1 A;  1IQ9 A;  1LX5 B;  1TFS A;  1IKC A;  2ABX A;  1LXH A;  1HOY A;  2BHI A;  1FSS B;  1QKE A;  2MHY A;  1CVO A;  1FAS A;  2PJY B;  1CRF A;  3EBX A;  4RUD A;  1HAA A;  5DO6 A;  6EBX A;  1ES7 B;  1NTX A;  2H7Z B;  5IMT D;  1KBT A;  1RL5 A;  1HC9 A;  5EBX A;  4DO8 A;  3BT1 U;  2JQP A;  1H0J A;  1KXI A;  3FEV A;  4QTI U;  2FD6 U;  1IDI A;  4UY2 C;  2QJB C;  4EY8 B;  2LA1 A;  2MFA A;  1CRE A;  4BIK B;  1I02 A;  1KFH A;  1QKD A;  1TGX A;  1JE9 A;  1KL8 A;  1G6M A;  1YWH A;  2MJ4 A;  3KFD I;  2H62 C;  1CDT A;  3HH7 A;  2LCR A;  1IDH A;  4ZQY A;  4OM4 A;  1S4Y A;  1VB0 A;  2CRS A;  1NYS A;  2X8B B;  1NOR A;  2JVE A;  1CDQ A;  1ABT A;  1TXB A;  1CXO A;  2UWR A;  1IDL A;  1LXG A;  4HQP F;  2J8B A;  1CB9 A;  1KBA A;  1ONJ A;  3NEQ A;  5DZ5 A;  4LFT A;  2L5S A;  1ERG A;  2H8U A;  4IYE A;  1MR6 A;  2QJ9 C;  1NXB A;  2H64 B;  2MUP A;  2HLR A;  1F94 A;  3LAQ U;  1COD A;  1BTE A;  1FSC A;  3EVS C;  1KC4 A;  2K3G A;  1PLO A;  2QC1 A;  2MJ0 A;  2CDX A;  1JGK A;  2ERA A;  2PJY C;  2MUO A;  3NDS A;  4XJJ A;  1NYU A;  1B41 B;  2CRT A;  1IK8 A;  1DRS A;  4AEA A;  3QB4 B;  1NTN A;  4OM5 A;  1KU6 B;  3NH7 A;  2N99 A;  4FAO E;  1CXN A;  3KFD E;  1ZAD A;  2GOO B;  2H7Z A;  2OFS A;  1KS6 A;  3PLC A;  2H64 C;  1V6P A;  1KTZ B;  1NEA A;  2MJY A;  2QJA C;  2CCX A;  1M9Z A;  2H5F A;  4FAO C;  3U74 U;  1W6B A;  2BTX A;  1FRA A;  2CTX A;  2UX2 A;  1KBS A;  1L4W A;  1RGJ A;  2HLQ A;  1REW C;  1QM7 A;  2VLW A;  1HC9 B;  1COE A;  1MAH F;  2L03 A;  1IDG A;  1CTX A;  1CDS A;  3VTS A;  5IMY C;  1HAJ A;  3ERA A;  1F8U B;  4BDT B;  1BXP A;  1CHV S;  3BT2 U;  1TXA A;  1CCQ A;  1ERA A;  1LSI A;  2I9B E;  1IJC A;  1UG4 A;  2H62 D; 
#chains in the Genus database with same CATH topology
 1FF4 A;  2GOO C;  1XT3 A;  4P7U A;  2NBT A;  1JBD A;  1CDR A;  1FFJ A;  3U73 U;  1LJZ A;  5DU1 A;  1IQ9 A;  1LX5 B;  1TFS A;  1IKC A;  2ABX A;  1LXH A;  1HOY A;  2BHI A;  1FSS B;  1QKE A;  2MHY A;  1CVO A;  1FAS A;  2PJY B;  1CRF A;  3EBX A;  4RUD A;  1HAA A;  5DO6 A;  6EBX A;  1ES7 B;  1NTX A;  2H7Z B;  5IMT D;  1KBT A;  1RL5 A;  1HC9 A;  5EBX A;  4DO8 A;  3BT1 U;  2JQP A;  1H0J A;  1KXI A;  3FEV A;  4QTI U;  2FD6 U;  1IDI A;  4UY2 C;  2QJB C;  4EY8 B;  2LA1 A;  2MFA A;  1CRE A;  4BIK B;  1I02 A;  1KFH A;  1QKD A;  1TGX A;  1JE9 A;  1KL8 A;  1G6M A;  1YWH A;  2MJ4 A;  3KFD I;  2H62 C;  1CDT A;  3HH7 A;  2LCR A;  1IDH A;  4ZQY A;  4OM4 A;  4KSN A;  1S4Y A;  1VB0 A;  2CRS A;  1NYS A;  2X8B B;  1NOR A;  2JVE A;  1CDQ A;  1ABT A;  1TXB A;  1CXO A;  2UWR A;  1IDL A;  1LXG A;  4HQP F;  2J8B A;  1CB9 A;  1KBA A;  1ONJ A;  3NEQ A;  5DZ5 A;  4LFT A;  2L5S A;  1ERG A;  2H8U A;  4IYE A;  1MR6 A;  2QJ9 C;  1NXB A;  2H64 B;  2MUP A;  2HLR A;  1F94 A;  3LAQ U;  1COD A;  1BTE A;  1FSC A;  3EVS C;  1KC4 A;  2K3G A;  1PLO A;  2QC1 A;  2MJ0 A;  2CDX A;  1JGK A;  2ERA A;  2PJY C;  2MUO A;  3NDS A;  4XJJ A;  1NYU A;  1B41 B;  2CRT A;  1IK8 A;  1DRS A;  4AEA A;  3QB4 B;  1NTN A;  4OM5 A;  1KU6 B;  3NH7 A;  2N99 A;  4FAO E;  1CXN A;  3KFD E;  1ZAD A;  2GOO B;  2H7Z A;  2OFS A;  1KS6 A;  3PLC A;  2H64 C;  1V6P A;  1KTZ B;  1NEA A;  2MJY A;  2QJA C;  2CCX A;  1M9Z A;  2H5F A;  4FAO C;  3U74 U;  1W6B A;  2BTX A;  1FRA A;  2CTX A;  2UX2 A;  1KBS A;  1L4W A;  1RGJ A;  2HLQ A;  1REW C;  1QM7 A;  2VLW A;  1HC9 B;  1COE A;  1MAH F;  2L03 A;  1IDG A;  1CTX A;  1CDS A;  3VTS A;  5IMY C;  1HAJ A;  3ERA A;  1F8U B;  4BDT B;  1BXP A;  1CHV S;  3BT2 U;  1TXA A;  1CCQ A;  1ERA A;  1LSI A;  2I9B E;  1IJC A;  1UG4 A;  2H62 D; 
#chains in the Genus database with same CATH homology
 1FF4 A;  2GOO C;  1XT3 A;  4P7U A;  2NBT A;  1JBD A;  1CDR A;  1FFJ A;  3U73 U;  1LJZ A;  5DU1 A;  1IQ9 A;  1LX5 B;  1TFS A;  1IKC A;  2ABX A;  1LXH A;  1HOY A;  2BHI A;  1FSS B;  1QKE A;  2MHY A;  1CVO A;  1FAS A;  2PJY B;  1CRF A;  3EBX A;  4RUD A;  1HAA A;  5DO6 A;  6EBX A;  1ES7 B;  1NTX A;  2H7Z B;  5IMT D;  1KBT A;  1RL5 A;  1HC9 A;  5EBX A;  4DO8 A;  3BT1 U;  2JQP A;  1H0J A;  1KXI A;  3FEV A;  4QTI U;  2FD6 U;  1IDI A;  4UY2 C;  2QJB C;  4EY8 B;  2LA1 A;  2MFA A;  1CRE A;  4BIK B;  1I02 A;  1KFH A;  1QKD A;  1TGX A;  1JE9 A;  1KL8 A;  1G6M A;  1YWH A;  2MJ4 A;  3KFD I;  2H62 C;  1CDT A;  3HH7 A;  2LCR A;  1IDH A;  4ZQY A;  4OM4 A;  4KSN A;  1S4Y A;  1VB0 A;  2CRS A;  1NYS A;  2X8B B;  1NOR A;  2JVE A;  1CDQ A;  1ABT A;  1TXB A;  1CXO A;  2UWR A;  1IDL A;  1LXG A;  4HQP F;  2J8B A;  1CB9 A;  1KBA A;  1ONJ A;  3NEQ A;  5DZ5 A;  4LFT A;  2L5S A;  1ERG A;  2H8U A;  4IYE A;  1MR6 A;  2QJ9 C;  1NXB A;  2H64 B;  2MUP A;  2HLR A;  1F94 A;  3LAQ U;  1COD A;  1BTE A;  1FSC A;  3EVS C;  1KC4 A;  2K3G A;  1PLO A;  2QC1 A;  2MJ0 A;  2CDX A;  1JGK A;  2ERA A;  2PJY C;  2MUO A;  3NDS A;  4XJJ A;  1NYU A;  1B41 B;  2CRT A;  1IK8 A;  1DRS A;  4AEA A;  3QB4 B;  1NTN A;  4OM5 A;  1KU6 B;  3NH7 A;  2N99 A;  4FAO E;  1CXN A;  3KFD E;  1ZAD A;  2GOO B;  2H7Z A;  2OFS A;  1KS6 A;  3PLC A;  2H64 C;  1V6P A;  1KTZ B;  1NEA A;  2MJY A;  2QJA C;  2CCX A;  1M9Z A;  2H5F A;  4FAO C;  3U74 U;  1W6B A;  2BTX A;  1FRA A;  2CTX A;  2UX2 A;  1KBS A;  1L4W A;  1RGJ A;  2HLQ A;  1REW C;  1QM7 A;  2VLW A;  1HC9 B;  1COE A;  1MAH F;  2L03 A;  1IDG A;  1CTX A;  1CDS A;  3VTS A;  5IMY C;  1HAJ A;  3ERA A;  1F8U B;  4BDT B;  1BXP A;  1CHV S;  3BT2 U;  1TXA A;  1CCQ A;  1ERA A;  1LSI A;  2I9B E;  1IJC A;  1UG4 A;  2H62 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...