2H9ZA

Solution structure of hypothetical protein, hp0495 from helicobacter pylori
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
b'MPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HP0495
molecule tags Structural genomics, unknown function
source organism Helicobacter pylori
publication title Solution structure of hypothetical protein, HP0495 (Y495_HELPY) from Helicobacter pylori.
pubmed doi rcsb
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04359 DUF493 Protein of unknown function (DUF493)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2h9zA01
5JJBA 1UJ6A 3TUIC 5FIIA 2RE1A 1SC6A 3ENVA 2P9CA 2J0XA 1PSDA 1YBAA 2NYIA 3OFGA 4GO5X 4NMLA 2QSWA 3N0VA 5IT4A 3OFFA 2LVWA 3MAHA 2I9SA 3AAWB 3L7OA 2QMXA 3KWMA 1YGYA 3NRBA 1ZPVA 3LOUA 3IBWA 2LQJA 2PA3A 3TUZC 2FGCA 3ENQA 1KS2A 1O8BA 2KO1A 2QRRA 1XTZA 3IXQA 3OFHA 5IS2A 3DC2A 3TUJC 3CEDA 3U7JA 3MTJA 2QMWA 2JOQA 2P9EA 1LK5A 2J0WA 2RQKA 4LUBA 5IT0A 1Y7PA 3LUYA 3HHEA 3DHXA 3AB4B 3ENWA 2P9GA 3AB2B 4M8LA 3DDNA 2F8MA 3UW1A 1LK7A 1LKZA 3MWBA 3K5PA 2F1FA 3W7BA 3DHWC 3P96A 4X84A 4GO7X 2MDAA 3OBIA 1M0SA 3OFEA 3O1LA 5T41A 2CDQA 2PC6A 1RWUA 2JHEA 2ZHOA 1UJ5A 1UJ4A 2DT9A 1U8SA 2H9ZA 2DTJA 2RQMA 4PWUA 4GMKA 3S1TA 4IO1A
chains in the Genus database with same CATH superfamily
5JJBA 1YJ9S 2WVDA 2JLGA 3C16A 4ZJLA 3EXCX 4M1KA 5CZXA 3IS9B 3TP2A 5D4NA 2FHJD 3J80Y 2QA4G 4LSLA 2UUAJ 3VCDA 2DJWA 2MEWA 3UWTA 2ZH4A 3BO3A 3UCZP 1H6KX 5H1SV 5GAEU 3ENVA 4F67A 5BR8F 4ECXA 2DR6A 4N7TA 3V6HA 2W7AA 2CQBA 3NGTA 2B43A 2IMWP 1A9NB 2OSRA 3JSBA 2VG5B 1DAXA 4CDIA 4F02A 4NI2B 2YQ1A 2V8HA 3IO1A 2F9DA 3A12A 2R7RA 3OV7A 5HATA 4I6YA 3RYLA 3CC2S 2HZCA 2Z58B 4JV5J 1FKOA 2MQNA 1M1KT 2R7UA 1ZTTA 4YHHF 1SJQA 1W2IA 2U1AA 3BZQA 3NS7B 2DHGA 4JI4J 1NMEB 1UVIA 1DHMA 3NMRA 4YEAA 3Q2TC 2AWZA 1R27B 2DNZA 2QGFB 3EDQB 3M2UB 1IKWA 1ZZNA 4JI3J 4J9PA 2YKMB 7FD1A 1SH0A 2XMMA 3PEJA 3G86A 5KFCA 4B3RF 1X4CA 3IG1A 1H7XA 3OXLA 1ZPWX 3IR6B 2X51A 5HBMA 3QZ8A 3K8WA 4NCAA 4HACB 3VAMA 4ECUA 2GMLA 3G8TA 4LFBF 1W26A 2ZVIA 4C8MA 2E1MC 5AXLA 1XTZA 3J7YI 1RWKB 5HJYA 3O6QA 1Q82T 5KFXA 1FWKA 2ZD1B 1T95A 2G1HA 1RCXB 2UVRA 1VHIA 1KFDA 1HD0A 2Z2YB 2I8EA 1NBEB 4RBUA 3TUJC 3X1LB 1KP6A 1VLYA 1HBOA 1D8ZA 2EKNA 2CVEA 3MMCB 4GVBB 5KFNA 2VQFF 5J2QB 2XWXA 2MKHA 3QFHA 5KFKA 2XY5A 4QU6A 1DFDA 1HWLA 3K58A 2HFUA 2HNYA 2DVIA 3TAPA 4K4ZA 4EFAC 3MPYA 4ECSA 4FKYA 2C2MB 4NLTA 1U1LA 4UTGA 1OY9A 4FNIA 3G82A 1B7FA 2NZ4A 1OQ6A 2MZSA 3CJQA 3QIPB 1QSSA 4B3MF 1FNMA 3JSMB 1LXJA 4LF8F 2YNHA 5KFOA 4JYAJ 1LWCA 3GV8B 1GFWB 1YZ7A 2E7VA 5LSRA 5F3TA 4HLBA 2CNNB 2MQLA 3HHLA 3QLHB 4PWWA 2J9CA 3BN7A 3MPDA 4NEZA 2FUG9 3LP1A 4P72A 4ENOA 4BC7A 2RF2A 5CD4H 1KC8T 2E5LJ 1H0HB 2HQGA 4U7CA 3PR5B 2OJ3A 2BRLA 1OQ3A 4E0DA 4FYVB 2X3GA 4WYLA 5C2GA 3E2EA 1WOOA 1UAWA 4PXBA 1JJ4A 1CC7A 3ONQA 5I4MA 4C8OA 2JWNA 2RILA 1NAQA 5KFZA 2QFIA 2MZQA 1TFWA 3OT9A 4CLWA 2CPJA 3PG9A 3EVOA 3U1LA 1QSYA 3QWPA 2NSCA 2UUTA 4ZN1A 5J2NB 2AKWB 2MB0B 1SXLA 1HWJA 3LP2B 5HQLA 1XR5A 3I4HX 4FKXA 2ZOGA 3CXCR 5I3UA 3RB6A 3L3CA 1RHKB 3JSYA 5AXMA 2BM1A 4OL8A 2YPYA 3WX4A 3MUVP 1U1MA 1JNRB 2ZH7A 5KFFA 3HZGA 1X9MA 3B6BA 4IR1A 2YKAA 4P7VA 3UD3P 1NK0A 1FE4A 1RI7A 2YTCA 1RT6A 2IVMA 6FDRA 1HI8A 2HHUA 2EK6A 2JL9A 2QYGA 1FJGF 1UP1A 2KKHA 4FPRA 3NS5A 2VFTA 4YR2A 2AJ4A 4TQRA 3OXGA 2EFPA 4DQPA 1RBOB 1V3SA 2RQMA 1CC8A 1KLMB 1FWPA 4F8RA 1FJGJ 3KNGA 2BQRA 1BLUA 3JQKA 1B0PA 1WC4A 4LRFA 2HS0A 1UPPA 1I6JA 4DR4J 1JLQA 2XYPB 1CJVA 2DIVA 1RYSA 3SSRA 4YR0A 1W25A 4CI0B 4NLQA 1PAUB 4Y2AA 4M5IA 4I7FA 4OZJA 4ZLPA 2WVCA 5JXSA 3DXSX 5KFMA 1SJ3P 4PEOA 3HHLD 1KQSR 1QAIA 1E6YA 4KV8A 4MTPA 2MQQA 1HWKA 1DZ5A 3BDPA 3MMCA 2C3MA 2BBEA 3PM9A 4WZMA 2WVFA 4DV4J 2NREA 2AJQA 1ZBTA 5E3PA 2HRYA 1AROP 3SCLE 4X66F 2UP1A 4NLXA 3FBFA 1SV5A 3AA8A 3M6XA 3FVYA 4A8OA 1I1GA 3JTPA 4YOEA 2XMTA 1RHUB 3UNYA 2R2SA 1QDUB 3LOUA 4OZLA 4IRCA 1RLCL 4WTOB 3QRQA 4IFYB 2D74B 4QWDA 2FIUA 1REVB 1QD1A 2Z2LA 3GWCA 2AJ0A 3AJ2A 4A47A 1Y5LB 2NSBA 2VFUA 2UXDF 4ITSA 2KT5A 2CQHA 3BSAA 2F40A 3MZIA 4RBTA 3G6YA 1RABB 2FLPA 1PBUA 1NB2A 4WP3A 3SZ2A 4MK8A 3TJ8A 3HJVA 1IKVA 4Y2KA 1IWAA 5H9EJ 2OIHA 4FZVA 2HLTA 5CABA 4NXMF 1TKTB 4ECQA 3MM7B 3ZTRA 4ED5A 1ULRA 3L7UA 1JX4A 2DO4A 4NA1A 2XMWA 1SB6A 4G1IA 3LH2S 2XC9A 2V8GA 3DI6A 4ZPTR 5FLXY 3M9NB 4DG1B 3T1YJ 2CPEA 4JI5F 3L4BC 5DZ7A 1BQNA 3MM5A 5L9XA 3MECA 3I82A 2CPZA 4LSLB 8AT1B 2W9AA 2J6TA 2HHHJ 5HK4A 4K2JA 4CWBA 2DNOA 2WOMA 1OJ4A 4HI1A 5L1JA 4GKJF 1S77D 3KLGA 1GMUA 2ZJPQ 1TELA 4M5DA 1ZYQA 3KXDA 4LIWA 5CH7B 3IGVA 4WP8A 2JEGA 2KFZA 2FJEB 3DHXA 2EVZA 3J7AN 2AGQA 1JJ2R 5GADU 4IH6A 3CC7S 2E9ZA 5G0RB 1RT2B 2QLJB 1QSLA 3QGIA 4KQZA 1Q1KA 1TKTA 1VRQC 5HQ8A 2IBKA 4NXNJ 3CPWR 4LFAJ 2DRAA 5LJ3Y 5F8LA 3RR7A 3IWXA 3D6TB 4DBQA 5A0YA 5EWEA 2F1FA 4ED6A 2FD2A 3JSMA 2DNKA 2JLFA 3H0PA 2VQEJ 3O44A 5KG7A 1U0SA 2YKNB 2CPIA 1FX2A 2GC8A 3IR5B 2MTLA 3DLGB 2ZH8A 1V3RA 3C15A 1TKXA 4ZVQB 4DF8A 3O1LA 3JS9A 2JRSA 4CYUA 2RRNA 3QNWB 4OV6A 4J9QA 3WIUA 4JI8J 1FVQA 2FHMA 1N0VC 2J0SD 1HPZA 4M5HA 2V8VA 2E9TA 2GIRA 3RG6A 1RQ0A 3RRGA 3SQGB 3KLFA 3NWGA 1L3TA 5DO2A 2XG8A 1TL7B 2YKPA 1G7CB 3W8GA 2VG6B 5KG4A 4DV0J 3C6TA 2J9DA 3BSNA 1UFKA 1IKXA 2HWTA 3H4DA 3BYRA 3CO9A 4NPOA 2BX6A 2CNKB 1FHTA 3CVKA 7AT1B 1GH8A 4DR3J 1S0MA 5J2MB 2GFFA 3CJRA 4B08A 2MLXA 5A2QY 2IY5B 3MR6A 2QX0A 1HARA 2GW8A 3P49B 1U1PA 3KG4A 1UVLA 1UKUA 4KGZB 1YRXA 3B78A 4N5SA 1P9QC 4MT1A 4URGA 2DHHA 3BB5A 4B3MJ 1URNA 2BQUA 1GMWA 1HBMA 4IG3B 2F4FA 1VRUB 4O3NA 3HVRA 1DRZA 4FXDA 2HHTA 1U8WA 4A46A 2IAJB 4QW8A 5AJ3J 3TAQA 2N3OA 2I38A 4YDXA 1I5OB 4K59A 3QPIA 3QSIA 5B0BA 4WPAA 2J76E 2X1BA 3KLEB 2OP5A 1SKWA 1OWXA 2IC3B 3H90A 3N28A 1L3UA 2ASDA 4YP3A 2UXBF 2MKJA 3LANA 2MZ1A 2E5IA 1X5PA 2D1CA 2QLBB 3VQTA 2V6AA 1S6QA 3MCMA 1VCTA 1IBKF 2VBWA 3TA0A 1U26A 4DZDA 4DG1A 2VKRA 4NLVA 3ENQA 3FQLA 1HBNB 5CHCB 3G87A 4LR9A 5LSOA 3GCXP 2DEJA 3BDEA 2MLZA 3QJJA 4LFBJ 1N32F 4FN5A 2F7VA 3POTA 5FDLA 3OFHA 3TZZA 4B9SA 1NPKA 1O5JA 2DCUB 2VIHA 2QEXS 1MU2A 1BE4A 2R4FA 3BKTA 2OLWA 3EDRB 4HHUA 4IDKB 4DR6J 3ZFVA 4LBPA 3GLJA 2BJDA 3MTJA 2VOPA 1RUSA 2JVOA 2KHCA 3N6LA 4LR8A 1W2BR 1HNXF 1D1UA 3MM6B 3IWLA 1K47A 2B9YA 5FD1A 1NKBA 1SQFA 1E6VA 4ZPCA 1B0TA 4ICLA 3IRWP 1EETB 2RQKA 3EGWB 5IOLA 4ZIWA 3C19A 4OYXA 1HWIA 4ZVSB 3FMBA 1RT1B 5HO4A 4LQ3A 3US5A 2BEFA 1YK9A 2LQ5A 1HMVB 3C14B 3N6MA 2OPSB 1HW8A 2P2CB 4UW2A 3DRPB 5DM6Q 1SL2A 2CPFA 3ADAC 3M8PA 1HBOB 4GVBA 2HHVA 1JJCB 4G1QB 4PRFA 3UFCX 4NCBA 3QFWA 4DQIA 5A8WA 5D0GA 5D4OA 3KLHB 2OGUA 4FF2A 1LFWA 1CQMA 3MD1A 1IN0A 3FCWA 3POTB 4HHHA 2IJRA 4UOFA 2DNLA 2XSJA 2YQ0A 3ZZTA 4A8QA 3UR0A 5RUBA 1SC1B 4CYUB 2WB1D 3R7BB 1RXOB 1LKZA 1K73T 5ETQA 1TZ0A 3VAIA 3G96A 3M2VA 1RTDA 2D7SA 3Q0AA 3RBEA 2ADCA 5HBMB 2OSQA 2V9WA 4X62J 1MNEA 1KOHA 2RUGA 4X4RA 3K5MA 1VQ5S 4ES1A 3HPOA 1RAJA 1OY8A 1TL3A 4H4MB 3VR1A 1S0VA 2CWKA 2EC2A 5KG1A 2ZZTA 4FVMA 1KLMA 1S48A 5KFLA 4YQWA 3KK1A 3RAQA 4W98A 3KMQA 3ISZA 1T03A 4RNOA 3C46A 5DDQC 1RU1A 1MWQA 1WDTA 2UU9F 2QSFA 4WFZA 1SJRA 2C28A 1VDHA 2EFOA 2PC6A 3VAKA 4OLOA 1RAEB 5G0RA 4MIAA 1F0XA 4AQYF 2LLZA 3V6JA 3OTBA 5EX0A 4K4XA 2RJZA 5KOXA 2EG1A 2LQBA 1LV5A 2LA6A 3HVAA 2DTJA 4ZCLA 5LSLA 3HM9A 1PC4A 1KFSA 2HMIB 2GMHA 3HZEA 2VDHA 4KHRA 3WDOA 5GMEA 4WKYA 4EBDA 5M2UA 1O51A 4J9NA 3I87A 1TR0A 4JI8F 1NK6A 4ID8A 5CCLA 2RU9A 1C1CB 2W7PA 2CNLB 2IM1A 2XTJP 3LAMA 3SV4A 3PW0A 4B9LA 2CJXB 4JI7F 4UY85 2A6MA 1XWLA 3PCOB 2J8AA 4Q2LA 5C2CA 4ZVUB 3P5BP 1K44A 1YBAA 1P6TA 2KJWA 2VASA 4QIGA 5F8NA 3D1OA 2IAJA 2RMLA 9RUBA 1IKYB 2DISA 4K2XA 2H5IB 3DGPA 1VBYA 2XB2D 1Q79A 3DM2B 5B08A 3M32A 3NBPA 1B64A 3GV5B 5ETMA 2O01C 4AUKA 5LXYA 4RUAA 5DLGA 2W8KA 4C3LA 3OQ2A 4DLGA 2FY8A 2U2FA 4O3QA 2Z2MA 4ZVTB 1YWXA 2PMZD 2FVSA 4ZN3A 3VZIA 3S7RA 1D09B 4F50A 4LQ9A 2F65A 3PRDA 2KI2A 3BGRA 4J9SA 4ETXA 1EZZB 3OVBA 2YKNA 2OAUA 1FFWB 2CQCA 3G82B 1HNWJ 1KKHA 4DSFA 3DLJA 1NK7A 2UZAA 2XZDB 4MIWA 2ZWPA 2X1AA 3DOMB 1NJIT 1BY9A 5D15A 1XEZA 2LYVA 1QTMA 2HVHA 2HPUA 3GZ7A 1N36J 3HHLC 3R8YA 2M4MA 1RT3B 4ZJQA 5D77A 4X4NA 1XMBA 2PEHA 3RU0A 4LSZB 4Q8FA 2E7WA 2YWGA 2GVDA 2IJNA 4C98A 2MY8A 4I69A 3TI0A 2VG6A 2ATCB 3LA0A 3VAFA 4MKAA 3A4TA 2LMIA 3CEDA 3D3CJ 2RHSB 5KFTA 1TKZB 3UR3C 4PXEA 2F9JA 2IA6A 2KJVA 4FF4A 1KQGB 1JLCA 2WHOA 3CCJS 2V2ZA 4K4UA 2OPSA 5CCMA 4CO1A 3MOJB 2FTRA 5SZTA 2QMWA 1WHYA 3T41A 2I0XA 4PZVA 1VR6A 4O3RA 3P5TL 3PRVA 4NE9C 3PY8A 1RWNB 4EBEA 1XNQJ 3KLIB 5MAOA 2VG7B 4X62F 2FPHX 4HVZA 3ZC4A 1AZSB 3TZXA 1NUEA 2HHHF 4NYPA 1FT8A 5A0YB 5B0FA 1RWWB 2QA1A 4ZLJA 3M1VA 2DXFA 3FBBA 2F8EX 4A8KA 3T5KA 1TK8A 1UVJA 3JAMY 2CG4A 1ZAXA 3ZZRA 4FYDA 1IJEB 3ZNUA 3R5JB 2I5JB 4JI5J 5L1KA 5L38A 5D0RA 2ZFHA 4OZ2A 2QC3A 3J80U 3MEGB 1NPPA 2GX8A 2ASLA 4EZ6A 3TRGA 4B3RJ 4M5DB 4DV4F 1Y10A 2V4JA 4X84A 3W65A 3SBMA 3GR0A 5KFAA 4H4MA 2Q1LA 1U49A 1N4LA 2R7OA 2KHDA 3VAGA 1SC4B 2D41A 4ZVPB 4F0KA 4J9LA 2AZ1A 3PYDA 3NAHA 2G1DA 3X3UA 4YS2A 3RBDA 1NZ8A 1VISA 2F63A 2W4PA 3BYPA 3M8YA 1RA7A 3M8WA 4I2QA 4OYWA 5KFUA 5KG0A 3WQPA 2UUAF 2WCXA 4ILMA 1KEKA 2QA4S 3ZTOA 1PILA 2AYMA 1S6PA 2B4OA 2XSJB 3D9BA 4OZ5A 5J1PA 1EQMA 3V4IA 1U1OA 4CNYA 4K4WA 2RT3A 2Y8WA 1SVDA 1UZHA 3EGNA 3ZTSA 2W7OA 2ZBRA 1FESA 3AXKA 2AT1B 3IM9A 1JXLA 1CLFA 3M1VB 4EO6A 1UFWA 2XCAA 1FK9A 1WKKA 4KH0B 1N32J 3N79A 1IWGA 4TY8B 4WCEQ 4ZHRB 2KT2A 3HSDA 4OYOA 2WTFA 1U1NA 4NZ0A 5CAAA 4PWUA 4R0JA 4GMKA 1HNZJ 3C15B 1TL5A 2I1RA 1BD6A 2FJVA 4DR6F 3HFKA 4ZVEA 3AJDA 1REVA 2B4UA 2QLWA 1T05B 3WC2A 2KZZA 2RD5C 4IFYA 4DR1J 2BJEA 1T05A 2EC0A 4UQGA 1C0TB 3BGLA 3ILLA 2FVPA 2D3ZA 3KUEA 3OPKA 5JVGQ 1NXIA 4FXVA 2FHOB 2PN6A 4ECZA 2QO3A 2ADBA 2J0XA 5BYSA 3GMGA 3QT6A 1IBMJ 1KLNA 3KDNA 2R7WA 4NL5A 4QWAA 5IM0B 2GA7A 2XS2A 2YWEA 4OJ1A 4RJVA 2HSEB 4RLEA 1VQNS 2CJYB 1FRXA 3DM2A 2QSWA 3CJ4A 2DGUA 3U27A 2PGCA 2CZ9A 4ZVRB 2LU2A 1NB7A 1QVFR 4YY3J 4DZ6A 4DV6J 4DR5F 1FRMA 1LW0B 2RDDA 2G2ZA 2W2OP 2HQDA 1BUXA 2Y3YA 3GB0A 1NH7A 2AF6A 3M8PB 4OZ3A 4P2SA 3SIPB 1HBNA 3PW7A 3UCUP 1X4FA 2FVCA 3GV7B 3T9NA 4CT9A 1FKPB 4URQU 3IA0A 4F7VA 2L41A 2HS3A 2PFFB 3DLGA 4LVNP 2A10A 1HR0J 1J5OB 5JUMA 1NJWA 1OS5A 1P9YA 1K1SA 5L8RC 3EVMA 3SCJE 3FCHA 3D6HB 3TX0A 4J9VA 3SSSA 4C8KA 4LBIA 1O0PA 4WFBQ 3TQ1A 3NMAA 1IM4A 1JLAA 4Z37A 3OUYB 1LEOA 3V81A 1UVMA 3MPWA 4ZA1A 3CDAA 1WF1A 2DNPA 3EICA 2LU1A 4QIEA 3RRKA 4L72B 2FLLA 3PKYA 1T9YA 1UEVA 3CD7A 3NY0A 1PIEA 2ASYA 1R8PA 3H2VE 4CQ1A 3ENAA 3LGHA 3O5TB 5IS2A 4IRKA 4RX6A 1KNZA 1DQ8A 3HI9A 4DL6A 3MMJA 1GMVA 3BS9A 1S6PB 2L9NA 4CLKA 2KM8B 4LRBA 4NCGA 3V4IB 1WSVA 1T03B 4X65J 2F4VF 4RW9A 2X7IA 4M95A 5B7WA 1C2PA 3H98A 4DV0F 1VRTB 3GFYA 3W5ZA 2JH3A 5F8HA 2ZZNA 3KHLA 1K0TA 1Q7LB 3B8HA 1YVFA 1WSRA 1NJXA 3MM8B 1A6LA 2JLEA 4YB1P 3LPYA 1VFJA 2K7KA 3I5BA 2RAQA 3W9IA 3M2RB 2ZKUA 2HQ3A 1XR7A 3U1MA 4CLYA 2HGLA 2YVSA 4X4OA 4JI1J 1T9WA 4C8LA 1N5SA 4FXWA 3G9CA 1XC9A 4USJC 3ENWA 1TKZA 2MPUA 2IRUA 3GIKA 5LMNF 2LFVA 4J37A 5MLCV 2VQFJ 4U8VA 1EKSA 3LP1B 5CA5A 3EE3A 2DHSA 1MROA 5A8KA 4ED8A 5KT6A 2M88A 2ROGA 2XNQA 3CJ0A 4QW9A 2YWKA 1GNKA 3D2WA 3Q23A 1BQMB 5I42A 1UW9A 5ETTA 3KK1B 4NXNF 2M8HA 3K7RA 3QWUA 4ZP8A 1RZMA 4ZLLA 4ED7A 4ZJOA 4JV2A 3GJTB 3THTA 3G71S 1RTZA 1Y00A 1VIXA 1LW2B 1S1UB 1YJTA 1UW4A 2FZGB 4BHQA 4ECVA 1LW2A 2FB0A 1WHXA 2B9EA 5E3CA 4NYZA 3LP0B 2APOA 4PG5A 3TYTA 4DPWA 4OLPA 4DFJA 1OMSA 1VQPS 1TMJA 4K0KF 3OFEA 3H25A 4YR3A 2JSXA 2LEPA 1EAYC 3AT1B 4M63A 5GMDA 3QQCD 1TK0A 3OL6A 1NKEA 4B9VA 3FEYB 4MIBA 1LXNA 4LSNB 4WWSA 3CUNA 3M30A 2IRXA 1SBRA 2RHQB 1YHQS 1NRKA 3KLFB 4F3OA 1EQ0A 3I96A 3CCLS 1TU0B 1LWXA 2VB6A 1SUQB 2BUNA 3MMAA 3ETMA 4P2XA 3DGVA 3R9LA 1L3SA 3W2VA 1S9FA 2HGNA 4QOTA 2CFXA 3W60A 4EGLA 3J81U 3KLGB 3HSZA 4EBCA 2FQQB 1F9HA 1Q5YA 4NLYA 2WB4A 2YXLA 4QR0A 1SL0A 3MFHA 2QMUB 2RE1A 1N33J 2CQ2A 4X64J 2JNJA 4XAKA 2FGOA 3LALA 4I67A 2ATLA 1JLEA 1SC6A 1X7VA 2CADA 4UQTA 2MJUA 3SEOA 2P9CA 3UVJA 4A4JA 4J9RA 3UE2A 3NCQA 4K4SA 2OELA 1UL3A 2EFQA 1K0VA 4HT7A 2AW0A 1RWVB 2RIJA 4IFVB 2BE9B 4G6VB 3VAJA 1XN9A 3DMJB 2QT7A 4YB5A 3MUTP 5FDLB 3KHGA 2WRMA 2YWFA 4Q8EA 4QYRA 1T94A 2I9SA 2R2TA 4ZLNA 4UY8T 3OTOJ 3BR9A 2DKOB 3V81B 5IWAJ 3C3LA 4F04B 5E41A 4RPFA 2R8IA 2A1BA 2HIQA 2ZH5A 3AD8C 1GTHA 3DXBA 2XSFA 2OPPB 4DR2J 2HURA 4B9TA 4V1Ak 1ICEB 3BBBA 2D3OR 5EDWA 3EPGA 1CS4A 3M6UA 3CCVS 2WAQD 3CJKA 4OV1A 3KUHA 5ETSA 4KY3A 5L9NA 1KS2A 1L3KA 3RZAA 1O8BA 3FQKA 1IKXB 1WC5A 3W66A 2CQIA 2YPZA 4Q44A 1N5TA 2X3DA 4WXOA 4C2MA 5C42B 3R5DA 1NK5A 1GX5A 1YDLA 3L9ZA 1R8AA 3R6LB 3TVZA 2ZHBA 2GIFA 5GADI 3OL7A 4P9SA 4B17A 2E1AA 3NAIA 4DOZA 4O4RA 2XYGB 2C2DA 1NJZA 3NNAA 4Y2MA 1S7HA 4IQMA 2YNHB 4F26A 4OX9J 2DCLA 4HACA 3KDOA 5GAEI 3V6DA 3C66A 2N7CA 1RK8A 1Q81T 4F4YA 4F25A 1RSCA 4ICLB 2ZUGA 1MN9A 2GV1A 3FEZA 5IT0A 4CLLA 3HP6A 2VQEF 1AUSL 1FEEA 1DQAA 3MF5A 3N6NA 2ZM6J 3HHEA 4FNHA 2Q6BA 3LO3A 3DNCA 2G13A 4K8RA 5GVQA 4N56A 3W2WA 2E29A 4XPEA 1KTVA 2FLOA 2W1BA 3J81j 1NU4A 2NUUG 3M32B 4WJBA 3BREA 2Y8YA 1TL7A 3CJ5A 4TQSA 3HXMA 3FSYA 2O5DA 5A8WB 3R1HA 2IRYA 2QYCA 3V2UC 1B3TA 2DXEA 1HHTP 4BC9A 4OX7A 5ETOA 4YMEA 4DUYF 1TUVA 4N41A 1T0TV 3K5LA 2H1YA 2QL7B 1RE1B 4YUDA 2XHCA 3W9JA 1WNEA 2W01A 3IG1B 4M5MA 4LF8J 2RRAA 2OH2A 1BQNB 1ZM9A 2W2PP 3MM5B 4F36A 3OHAA 1WOSA 2DGTA 3R5AA 1TVRB 1HNVA 1MMNA 4HDHA 4WU3A 3CD0A 3CJ3A 3HFZB 4NRUA 1U4BA 5K20B 2PIIA 1SJFA 4B3SF 4RWWA 1BGXT 2M9KA 3IAS9 3HLUA 3RJMB 1K8AT 3R2DJ 2XM3A 3R97A 3PRBA 2OPQA 4QWEA 3D6FB 3IBCB 1D3WA 1DTQA 1Z2ZA 1NO8A 2BE2B 2GAGC 2JZ5A 1JKHA 2VFVA 2VG7A 4DHVA 5B0DA 1NSPA 1YTYA 5D0HA 2XY7A 1CJKA 3TUIC 3BQ1A 4HKQA 1UWBA 2ZBIA 4L75A 4O23A 2K1RB 2IM3A 5I3QA 1N8RT 4R25A 5ETNA 4DQSA 3EUNA 1TQLA 2IHR1 1KHWA 1V3ZA 2EFGA 2YH1A 1ZH5A 2GQ2A 3E8OA 4IH7A 2ZBQA 4R5PB 4W90B 2EPIA 1VYAA 1U2RA 1VQ7S 2ZE2A 5IV3A 3GR1A 4LF9F 3JXOA 4KIAA 1Q78A 2C2EA 1I94J 4KKOA 2R7VA 4I4BA 4U95A 4J9MA 3AD7C 3CO0P 1WJ9A 1ZAWA 5ETKA 4RNHA 4X66J 1VRUA 1R0BG 2KYZA 2NUHA 2BA9A 4IYQA 3HT0A 4CH1A 2HRUA 2BXJA 4DV3F 2OMLA 3BGUA 5C7PA 5HMXA 4CLSA 3M6WA 1NHKL 2JC1A 3L7PA 4KHMA 4IOCQ 2QLFB 1NZAA 1F9FA 1FTCA 1G4CA 1VLOA 1ZA2B 2FJAB 2Q43A 2QMXA 3AAWB 4HL9A 3W64A 2V4QA 1TUWA 3FRYA 3GSIA 1YGYA 2LECA 5JMNA 1N6QA 2J9EA 1FXDA 1RT1A 3ET6A 4QYZJ 3TA1A 2NQPA 3A8KA 3ET6B 2KVQE 3KJVA 1UTAA 2C3PA 2ACYA 1RHQB 3BGRB 3THVA 2RKIA 4M5NA 1YZ6A 1WHWA 4UZCA 1P1LA 3FK4A 1Q8IA 2PFDA 1FKOB 2EBEA 1XMOJ 4JI4F 2PDAA 4TYAA 1ACMB 3H5YA 2D3UA 2DYAA 5K5MA 4U96A 1MMDA 2RH3A 3VVUA 2HWHA 2CDRB 3CDUA 4JB8B 4KPCA 3VGTA 5F0UA 3OJSA 3AXMA 2J0QD 2MZRA 4EYHB 1S0NA 4OMFG 4TKTA 5EWGA 3KK2B 2ZHAA 3QMQA 2BDPA 4NMXA 4AL5A 4QYZK 1S1WB 2CJAA 2DY1A 1S6OA 5I3PA 5KG2A 5DGAA 4F4KA 1S1TB 1EHWA 2GNKA 1QE1B 2YX1A 3H59A 3KJQB 1Z2LA 3W9HA 4ZIVA 2HVDA 1RT7B 1BHNA 5B0EA 5B0GA 3CCUS 1ITPA 2LXFA 4DUYJ 2JVRA 1HA1A 3CDWA 4LBHA 4J9UE 3KOAA 2RDIA 2DGXA 1VS3A 2EW9A 2P6SA 4TNOA 2EXUA 1QAYA 3N01A 4USUA 3VTIA 2I6WA 2JFDA 4DFMA 4C0OC 1UEUA 2CWXA 3KUGA 1YJWS 1S76D 1F1BB 5EGYA 2V94A 2R7QA 3NNCA 1F5CA 1HQ2A 2B7CB 3NL0A 2DNRA 5IXUA 3CCRS 4PXCA 3BF4A 3MPVA 3ITHB 4C11B 1N34J 2F8MA 4CO0A 5B09A 4RWXA 1YITS 1FDAA 2AJ1A 2R7TA 3DYAA 4IOBA 3DRRB 1B4SA 1U7LA 4CO3A 3DLKB 2V2QA 3IN5A 1QAJA 5L46A 5JVHQ 3K5PA 1M5HA 5D8HB 3FRZA 3OSNA 4GO7X 3ZTQA 3EZUA 4MK7A 3S6EA 5KT5A 3Q8VA 4PG7A 1RAIB 3MECB 3TW0A 1K9MT 4FBTA 4ELVA 4KRWA 1HBUB 1RU2A 2MHEA 1WG4A 2BABA 2XHWA 1JK9B 4QBUA 4OHVA 4RW6A 1F60B 5LMUJ 2CDQA 3OL9A 4DU7A 1N48A 1IBMF 4AT1B 1FI4A 3GIJA 2AJ2A 2GJIA 4QWBA 1HHQA 3DOLA 2R7SA 2MSTA 4IRDA 1IR2A 1S4FA 4OJHA 1PCAA 1AA1B 1U47A 3H8YA 3IWNC 4WE1B 3HF5A 4LIRA 2YNFA 4MKBA 1RBLA 3QO9A 3ZZOA 3RB3A 5FIIA 2YKMA 3QBCA 4RBVA 1ROFA 1IKWB 3PJ9A 3V6DB 2RUSA 1RAGB 5D4LA 3KTQA 4ZDNA 4TXSA 4C8YA 1N34F 1SV5B 4TY8A 2NXEA 3RB0A 4IO9Q 2FYXA 1Y4ZB 1HIYA 3SV3A 1HQUB 4H4KC 2FJWA 2Z8QA 1MROB 2EWHA 1NH8A 5DRKA 5A8KB 4NLGA 1NHUA 4N77A 2L3MA 2UUCF 1UMJA 1U1QA 2HHWA 2X1FA 1RT2A 4WKRA 2LVWA 3MAHA 2FHJA 4RNFA 3ZTPA 1X4HA 3QSYB 5L39A 2AMCB 5KFDA 1B99A 2XI2A 1R89A 4OI2A 2DNNA 5KFPA 2IBOA 2W8LA 5D78A 4C97A 3BKUA 4OI0A 4K5RA 4O4GA 3J7A1 1N33F 1L3VA 2ZNZA 2HHSA 5B0CA 3RB4A 1WG5A 3LF0A 5IWAF 3LP2A 5BR8J 1FFGB 3CF5Q 4E8UA 2PO4A 2BANB 4O3OA 5J2NA 4NLPA 1OYEA 3SQOP 2HMIA 2Z0GA 1TL1B 2BW7A 3L95X 2H48B 4P71A 1S10A 1Q0NA 2FGCA 2EEYA 3DI6B 2XCPA 3MEGA 3GCWP 3PR4A 4LFAF 1S4EA 2D9OA 4ZOSA 3DYAB 2C1EB 2M2BA 1CJUA 2Q79A 2VPWB 1SKSA 3GE9A 4FP9A 4GC7A 1QVGR 2RQ4A 1RT4B 1RTJA 1GK8A 4MAKA 4YHHJ 1D0EA 1HKAA 3TNVA 1CPZA 4LRAA 3BH6B 4DSIA 1DLOB 5KTQA 1YI2S 4O44A 1IKVB 1D9DA 3M4XA 1VI7A 3P8BB 3HHKA 3OUYA 2GVZB 2ZH6A 3JB9k 1KDNA 5HANA 4RO0A 1R0AB 4E2FB 3E01B 4I6AA 4DUZJ 5M2PA 3PACA 1P1TA 3D28A 4ES3A 4ILRA 2BOPA 3I0SA 3CULA 2HRTA 5DLFA 2CQDA 1URRA 2RNEA 1C4AA 1AXQA 2YNFB 3LGMA 2CPYA 2MGZA 4JI1F 1J5EF 3CWJA 1HQEA 2NYHA 1S49A 2FC8A 4Y2IA 5GAHI 2B4VA 2HK3A 4A8YA 2AGOA 1U45A 3PYGA 4USVA 5C24B 1KSPA 1C1BA 1HLWA 3IR7B 5C24A 3PJWA 7FDRA 3AODA 2OO4A 3JTOA 1FVSA 4F4AA 3D67A 3Q8PB 3SFGA 1IBLF 2C3OA 2LKZA 1RWOB 2BVZA 3B54A 3D68A 2ZEJA 3PVXA 2CJ9A 3FEXB 3LPEA 2LXIA 5BXIA 5A8RA 2ROEA 5DGBA 1FTRA 5KFIA 4FVCA 3DHWC 2PSZA 1HHSA 3D1HA 3KJVB 5FLXU 1CJVB 1O6XA 2CQ0A 4QWCA 2MQOA 1TL4A 1FRJA 2VHGA 3TJ9A 4YB7A 2HNYB 2ZVSA 5LXRA 1U25A 1FE0A 2IA0A 1RJJA 3ZNJ1 3T5LA 3BQ0A 2WSFC 3FZ2A 3D5MA 5T41A 2HBRB 2CQ1A 3MUMP 2DO0A 2H4YB 4J5OA 4R8UB 1T3NA 2YQ3A 1X5SA 2CPXA 3GONA 1RTIA 2KRBA 3WIVA 3GQCA 5DQHA 3MCSA 3CIZA 4FPIA 5F9NA 3BPSP 3BPDA 2ZE2B 4G3IA 1ZS6A 1OIAA 4K5SA 2GQQA 3OHBA 4AYBD 1U8SA 2Y0SD 3H7HB 5E2QA 4U8YA 2XO6A 4WFXA 1TL1A 4Y00A 2NXJA 2DPIA 2B0GA 2DB1A 2J6UA 3R7NB 2CVIA 1JXVA 4KHPF 2P5VA 2OPPA 4QJVA 3B82A 3TEGA 5DG9A 3EX7B 4FF3A 2OTLS 1R0AA 5M2RA 4CLZA 3GJQB 4M5KA 1U0HB 2HAIA 2JFKA 2OPQB 1KHVA 4QPTA 3HD1A 5J2PA 4OYBA 1X5OA 2YY3A 1CG2A 3I0RA 1WF0A 2OUGA 2QN6B 4A8SA 2VFRA 2VODA 2FHKA 1HWUA 1S9GA 4OQJA 4P10A 1RAOA 1S72S 1S9GB 3GIRA 2ZM6F 3MAQA 1H73A 4NI2A 2AV5A 2DIUA 3RUBL 2ZJRQ 3HSGA 1OPZA 1S1VA 3OR1A 1JLFA 3MEKA 2JX2A 1X60A 3CIMA 4QPXA 3UVJB 4C4WA 4ZCIA 2CJKA 5HJXA 4PCQA 1Q8KA 1RLDA 3NRBA 2L48A 2HBZB 2LP4A 2HVEA 2VU5A 5F41A 1TL3B 2BV3A 3C6UA 2RDJA 3IS9A 3QATA 2W2MP 3C2PA 2YKQA 3NP5A 5IC4B 2XLIA 3D6MB 1DQ9A 3G6XA 1YLXA 1NDCA 2V34A 1APSA 2PA3A 1C4CA 3HCXA 4B02A 4YY3F 4DR5J 1WTBA 2XZWA 3T1HJ 1JWWA 3HVTA 1X4GA 3A8IA 3MEDA 1MMLA 4JV0A 2Z56B 1IR0A 3C6TB 3VAHA 2KYXA 2Y9HA 1EJ7L 4ZP6A 5GAHU 5LMUF 1KOOA 3D54A 1E6YB 4KV8B 3LTOA 3AHPA 3OVAA 3RTVA 3DFEA 3FKBA 4CH0S 4DX6A 2XZTB 4PQAA 4RW4B 5CYMA 2MGZB 5CXTA 2AYGA 1KWMA 2UXDJ 1KRPA 2RB7A 4FYYB 2HNZB 4DR7J 3SCKE 4ZCMA 3Q83A 3M7VA 4IQXA 3VHQA 1GXUA 4ZPWR 3UNGC 3QO9B 3NGDA 2EK1A 3RAMA 3G8SA 4IOAQ 1RHJB 1ZAVA 2IIHA 2CUYA 3MCNA 1GQEA 5T7LB 2QTWA 4Y28C 1KVJA 1GT8A 2J6SA 4K0KJ 3FFIA 3CMES 3QAUA 4I56A 2AU0A 1IKYA 2GHVC 2C22A 4KGXB 4WK3A 5CQGA 2UU9J 3I0RB 1YBTA 3N9UC 2IYGA 2E1CA 5D6GA 5ETRA 1QY7A 1XERA 2LA4A 2HK2A 2RS8A 4ANCA 1VQKS 2R8JA 4KGVB 2GO8A 5E0OA 4AD6A 1CS4B 4HYKA 4CLTA 1XK8A 2VA3A 2B8PA 2KN4A 3IGNA 4U67Q 1S97A 2V8PA 2B9WA 2K1RA 3NGUA 3M8RA 1H72C 1S5ZA 5H9EK 3CJ8A 5DZ6A 5AE2A 3PKMA 2BACA 3E01A 3NNHA 3W61A 1M0SA 5F8MA 1WC1A 4J9OA 3I5CA 4JV1A 4C9DA 2GMJA 2W9BB 4LFCF 3S8SA 2CQGA 3DLKA 3BN4A 4UUWA 5K14A 5KT3A 4MJKA 2I2YA 3DRRA 1RB0A 3F44A 4ECRA 4OYPA 2BJ7A 2KXNB 3TWZA 5KFGA 4CLUA 3ISNC 4C8NA 3SI8A 4P73A 4WTYA 2HVIA 3M30B 3KHRA 2B5JB 2OPRA 4QZVB 4DL0C 3PDNA 5F8GA 3PZPA 1VQOS 1SL1A 4UOHA 2HBYB 4PR6A 3W2WB 1XMOF 1KR4A 3GFHA 4TVAB 4F3MA 4U6PA 1N0UA 3HKWA 1QM9A 3BEGB 4B9MA 2E66A 1Q95G 4PABA 1FFSB 2RRBA 4LF7J 3EGZA 3D0HE 1RACB 5LL6d 3DRXA 2NXUA 4AXJA 1FDNA 3DOKA 2O3DA 1S7IA 5E3AA 4CLFA 2XMKA 5J1NA 4NX9A 2GGPB 2J8SA 3VGVA 4Y0FA 3CCQS 3ILOA 3HD2A 2ZZMA 4RW4A 5CYMB 5DETA 2VPZB 2W2QP 4LVOP 1QLNA 1X4EA 1W7WA 4X4UA 2WONB 2BKNA 4DV3J 3I5AA 4NA2A 1YG0A 2GCFA 4HDGA 3IMQJ 2ABYA 3AOCA 4DPYA 1R0CB 3QYYA 4USKA 2BKPA 3T1HF 2CAJA 2XMJA 2CZVC 4LSNA 4U9RA 1HL6A 2P8IA 4OJ3A 4DSEA 4DL4A 3L7OA 2R8HA 2XO7A 4IH5A 3N5FA 2MKCA 3QZ7A 1C0TA 3JQMA 3MFIA 2OEKA 1NHVA 4TYBA 2ZBCA 2BM0A 2DGVA 1IQTA 2ZITA 2V63A 4OIXA 4WK1A 4DV1J 4HTJA 4NASA 4P2MA 4F0MA 2DITA 1YJ7A 2N4DA 3H2UB 1JKHB 1TUGB 3EJMA 4H4KA 4CO5A 2V4JB 3K2YA 1DTQB 1FERA 2AEMA 1WOPA 2DBBA 3I9V9 5E7OB 3MR3A 5I42B 4RR5A 3MR5A 4DV7J 1KVIA 2M7SA 4FF1A 4CP5A 3PIPQ 3G6VA 3BBCA 1GX6A 1U6FA 3I6PA 2QIFA 4CM0A 4DCOB 4KPYA 2XMUA 2OMOA 2IVFB 3OR2B 5F8IA 4ATNA 2E44A 1VQ4S 3U7JA 5D4PA 3Q8RB 4O3SA 1A0OB 4C0BA 4LF5J 4QCLA 1GXTA 5K14B 5IFMA 1RT5A 3FGVA 3CMAS 2AEFA 3HVWA 3D3BJ 1JLBA 4NLDA 3R27A 4X4TA 2YNIA 1LK5A 4NRTA 2WOMB 2POKA 1S9EA 2GQCA 1RHRB 4CT8A 5B0AA 5KFWA 3RW6A 1S9EB 2MQMA 3CE8A 1J5OA 1RT7A 2Y0BB 2Z30B 4QR1A 3W2VB 2VJVA 2XLKA 2NR0A 6FD1A 2ZC3A 1S1WA 2XY6A 1X9SA 1VBXA 3EGVA 3BJYA 4USWA 2EKYA 3H20A 4EWTA 3AB4B 4Z7CA 2N82B 2HFNA 3K8VA 4XTTA 3ZXWA 3KK3A 4DWIA 3RR8A 1I3OB 1LOUA 1Y5NB 3CTRA 4M5JA 5GMKa 1PAEX 3H5SA 2ZUAA 3BKFA 3PO5A 3AFGA 3UW1A 2HBQB 4H4OA 1WD6A 2HFOA 1C0UB 1DJ0A 3MDFA 4DX5A 4PPDA 1UCNA 4XIUA 4GKKF 3TVKA 4DQQA 4ES2A 4ZP7A 1IJFB 2MQ8A 3MWBA 4CRJA 4X4SA 4KO0B 3W7BA 4DDFA 3P96A 4KFBA 4YN3B 3QIPA 5BJRA 2Y1IA 3H4BA 4MMOA 2HG4A 3DN9A 2ZJQQ 3PW4A 3DDKA 3A8JA 4DX7A 4PQUA 1X31C 3CT9A 5HMWA 1M5VC 1VQ6S 4DI6A 1FKPA 1WI6A 1S1TA 1S59A 2M3DA 3SFUA 1FXLA 4CO2A 3KJNB 3MHYA 3P3DA 1SUQA 1T11A 2NPFA 2ERRA 2AYEA 1SI9A 5KFSA 3ZZPA 5T14A 3OJUA 1HYSA 3G8QA 4J90A 4KE5A 1SIZA 4CZCA 2WVBA 1DBDA 4P75A 3W1YC 3G6ES 1B0VA 3HVTB 3MEDB 4H54A 1TK5A 2W4DA 3TEHB 5K8NA 4ZS6A 1JLGA 4PWDB 1BWEA 3I56S 2A6OA 2DR9A 2B6AB 1RAHB 2ZDPA 3D66A 4MYUA 4DR1F 4AXIA 5A76A 1BQXA 5HI7A 1U1KA 2R8GA 2KRRA 4MK9A 2OEMA 1H7WA 3LP0A 4OJGA 2H3EB 3MM8A 1YBUA 2AHOB 1CJKB 2LQ9A 1B7YB 4DMZA 2OTJS 2XQCA 1KVKA 3OL8A 3D0IE 2IJFA 2JEFA 1FO1A 1VRTA 1WEXA 3SMZA 4JUZA 5ADZA 1MG7A 4V19X 2GJFA 2M70A 1FRHA 1DTTA 2DGQA 2YNGB 4ED4A 2OHDA 4DN0A 3QGHA 2NYIA 3DLEA 3OFGA 4Z7YA 4OHZA 4NA3A 4EO8A 2KT3A 4NMLA 4Q43A 3ILIA 3I32A 4HHJA 5HROB 2HQCA 3ILJA 1SKRA 5IT4A 2A2DA 3KNAA 1VBKA 3CD5A 4KKOB 2IPOB 2CRLA 3KK3B 2G2YA 1HW9A 4B9NA 1H3DA 1ZETA 2OD6A 3M8SA 2BQ3A 3CCES 3WX8A 1NDPA 4CTAB 3SXLA 4TN2A 3KLVA 4M94A 1IM6A 3R5GA 9ATCB 2IDLA 1RWXB 2H51B 4ZPAA 3RGIA 5HP1A 3JSRA 1OSDA 3L09A 3M6VA 5KAKA 2UVUA 3DLLQ 3T9ZA 1TTHB 3ZZUA 1AFJA 3AH6A 3BGOP 5CZVA 1T9TA 2HLUA 3VF0B 4KTQA 2NCKL 4LF4F 2XYHB 3K0JA 3KG0A 4N76A 2LXUA 2D69A 2KO1A 4NCGB 1S6UA 3T1AA 2K06A 1XNQF 4LMZA 3CDBA 1LW0A 2HHQA 3HHNB 1RTIB 5DDRC 3OR2A 3KYLA 4FYXB 2R2RA 3AQOA 2KL8A 3PYFA 2KFYA 3BO2A 4JYAF 4DCPB 2C42A 2B4PA 3MOZA 5KG6A 3KG1A 3DLEB 4ID5A 3HHLB 1F3FA 4Y6IA 3UQSA 3CCTA 1TVRA 3MXHP 1AYEA 1SJ4P 2VONA 1MN7A 5EN1A 1Q8BA 1NK8A 2UXCF 3TO8A 4X2BA 3CCWA 2K7JA 2VZ9A 3QT5A 3NWRA 3DRSA 4I64A 3BO4A 3H5XA 2LDIA 1HI1A 3A8EA 1E6VB 2HFZA 4J7CA 3SDEA 2MKIA 4OYIA 3QAEA 1VQ9S 2B6AA 1RKIA 4Z2XA 1CBKA 4TLQA 4UUXA 5D0EA 2GS8A 1BQMA 3K5NA 4DQRA 4FDFA 5K8PA 2VICA 3CCSS 2G4BA 3CGIA 4OI1A 1V9OA 2N3LA 2P9GA 4QIWD 3GJRB 3AB2B 2HS4A 1EP4A 2HNDB 3B4DA 3E51A 4L73A 1GXLA 3DDNA 4RW7B 2DH7A 4ZMMA 5K8OA 1G2EA 3M9OB 2YKOA 3MR7A 3P4UB 3Q8UA 3DU5A 3GFXA 4K4VA 1BWVA 2DR8A 1ZM3A 4OHWA 4B3TF 4PXDA 3P45B 1JNZB 1RTHB 5KFYA 4ED2A 4BWJA 4KGKA 5HLFB 1VBZA 3SCIE 4TU8A 1NDLA 3RAXA 2QA2A 5SUHA 2L9WA 4PKDB 2VPXB 4BCAA 2LCWA 5KFQA 3T5JA 2D9PA 4NZ6A 4QIFA 5HQMA 3R5BA 1JIHA 3WHIA 1LWFB 1MSWD 2LEBA 3PX4A 1DLOA 2V2KA 3UD4P 2C2OB 1NLKL 2MKYA 2BR0A 2F5GA 3TAMB 2ZH9A 3TUPA 1RWUA 3TAMA 4RNNA 5HMZA 1MWZA 4XK8C 3TJAA 3OLAA 3HHDA 4F4WA 2VG5A 1UWAA 1UJ5A 1PJ6A 4OYAA 1UEKA 2EBGA 4PYDA 4USHA 5F0WA 3J7YU 3ZZ0A 4BDPA 2UV8A 4I6WA 3MGJA 1WORA 3NEKA 3VGSA 3OTCA 4ZKAA 4DV2F 1HD1A 2R3VA 4Q0BA 2M8DB 2V50A 2IM0A 3EYZA 1VC5A 1B70B 3W62A 4LFCJ 4JI3F 4ALZA 4DV2J 1ELOA 1RTHA 1KN6A 3MAAB 4DCJB 1JLBB 2W2NP 1SCJB 4UF4A 2QFJA 5HVFA 5DG7A 2OD4A 3CW2C 4DR7F 2VDIA 3R2CJ 2R42A 2MKSA 1WACA 1Y11A 3Q86A 1HNIA 5KFVA 3CNQP 2HFSA 1U24A 4LF4J 4JI2F 2NPIA 2ZH3A 3OFFA 1TP7A 1Y0HA 1VQ8S 1UFLA 4RUBA 1PKUA 2QJ3A 1RTDB 4FYWB 2W24A 2DH8A 2W9CB 2Q3PA 3NXZA 2RKIB 5E33A 1F2GA 3DOMA 4PG8A 1YJVA 2HNZA 4G1PA 3BSCA 1OYDA 3GPAA 1H2TZ 2XBPA 3FSIA 5KT4A 2FZKB 1MWYA 4WE1A 5IV4A 3TUZC 5KT7A 3QRRA 1RAFB 4LREA 4S0MA 3H5UA 3OTDA 3NS6A 1J27A 3VQSA 3WC0A 4ZHRA 2VJUA 2C2ZB 2QRRA 2NS1B 2V4RA 4AL7A 2HQIA 2XS5A 1PYOB 4J91A 2CZ4A 4WP9A 1M5SA 2UUBF 5ETVA 4ANDA 1CSJA 1D9AA 4NLOA 2OFHX 4OZ0A 3RBXA 4USMA 1J2VA 1J5EJ 1WEZA 2MY7A 1JB0C 3MPUB 2QG9B 4RW6B 2XNRA 3W3SA 3ULHA 4QU7A 4NWBA 4E98A 4I7FB 1EARA 2UV8G 4RU9A 1IBKJ 2GGPA 1GEHA 4WZQA 2VUGA 4JI6F 1YQHA 2KTQA 3G2XA 3GP9A 3GYGA 1S1UA 3V6KA 2BE7D 3T5HA 2CQPA 5HP1B 3F56A 4OHXA 1FRLA 1ZOTA 3EXYA 1UZDA 2ZH2A 3NCRA 2FVRA 1X4AA 1FK9B 1N52B 5ETLA 1S1VB 5BYQA 4ID5B 2RSQA 2CNOB 4KT0C 2I5JA 1BMQB 4EUVA 4WU2A 2FVQA 4C3KA 1WTFA 2HZVA 1N5YB 4OX9F 2G0JA 1R8CA 5CYJA 1FF2A 1FJEB 1LK7A 1HNWF 1UVKA 3THPA 3NOCA 1U0HA 1LWFA 2AZ3A 1DY3A 1P27B 1PG5B 4W4MA 5BYRA 3CCZA 3J7Z5 3MAAA 3LWMA 4V19J 3QIDA 2G2OA 3OSPA 5F3ZA 2Y1JA 2HWIA 1PJ7A 2AQ4A 3QJLA 3CC4S 2WVEA 1L5UA 1DURA 3T6BA 3UI3A 3EM1A 3UDEA 2DD8S 4KHPJ 5ETPA 2KG0A 4CTAA 1NSAA 2H5EA 4F4XA 1YIJS 3EMTA 4RW9B 4R0EA 1TAUA 1AW0A 2XMAA 4ECWA 2DNHA 5LJ5Y 4B3SJ 4RW8B 4IKAA 2R9LA 4X4QA 2YBVA 2MJNA 3QGPA 1IR1A 2Q6CA 4JI7J 3OD2A 2W4CA 2CA9A 3UN3A 5KOWA 5C5JA 2DGWA 1EP4B 2HNDA 2Z2ZA 3MM7A 3MEEB 4UOCA 5E3QA 3VWSA 1HBMB 5KFRA 1D8YA 4PUOB 4L76A 1FEHA 3HMJG 2AEJA 2CPDA 3ETOA 3HULA 2IFXA 3MD3A 4NLSA 5T7LA 3PX6A 1RT3A 1JLAB 4A48A 1OSCA 4CCHA 4HT5A 2Z4PA 3TVYA 1PC5A 5HL7Q 1M5OC 1VGYA 2DNYA 3PX0A 8ATCB 1EX8A 5IQQA 1K1QA 1U6ZA 1UJ6A 4NLWA 4DFPA 1PYTA 3GJSB 4DV5J 1S1XA 1SIWB 4ANEA 3R1LA 3PV8A 2WZ1A 5KFJA 2ASJA 1N6QB 2CYYA 2GO9A 2JDJA 2PI4A 1UPMB 1TV6B 1YRTA 3BGFA 3T19A 2CJBA 2HFVA 1G3OA 3R6GB 5J2MA 1IBCB 2W9CA 1NPRA 1JLCB 1YSJA 4FBUA 5F8JA 2GHPA 4AQYJ 1F3VA 3HDSA 3GU0A 4MH8A 1BC6A 4A8WA 2PEBA 4L3NA 1T9XA 3AD9C 5KFHA 4K4TA 3CJTA 3N0VA 2WSEC 3WBZA 5A6PA 1FJCA 2H54B 3NG8A 1OPIA 1RAAB 2AIRB 4LT6A 3TQEA 5L1IA 1UA0A 4CH7A 2ZKTA 4L6V3 2QLXA 2IDEA 3DRYA 1RKJA 1SQEA 2DNQA 4ECTA 4RU2A 3M2RA 1NEEA 5L1LA 1SQGA 2VD3A 3IRXB 1VQMS 1ZPVA 1SC3B 3DKDA 1IBLJ 1SPBP 2E5GA 1RGVA 2B3TB 1M5KC 2LQJA 3RBZA 3C6UB 2KXFA 4D3GA 3UDLA 3D0GE 3CCMS 2E1PA 4ZITA 2YX4A 4K7QA 4ED1A 2HYIB 2LDYA 4MFBB 4C7QA 3GTYX 2DK2A 3MM6A 4P52A 2QV6A 2IC3A 4JP8A 2WBMA 5J1EB 3BM7A 2OI2A 1Z1ZA 2BW2A 4GVLA 3TARA 2M0GB 5C25A 3I31A 3G4SS 4OYZA 2ZWOA 1HNZF 1FCAA 4X4PA 3NBPB 2G0IA 3NKYA 3IXQA 1YJNS 1R6VA 4BWMA 4DPTA 1CVJA 3KFWX 3GG1A 1HI0P 1QJHA 5A6WA 5HN0A 5DG8A 5E3RA 4KSEB 2V2VA 3K89A 3IFEA 2L08A 2DNGA 4RW8A 1IXKA 1H2UX 3TX8A 1VK3A 1JQGA 4PPZA 4GKKJ 2C3UA 4DUZF 2XLJA 2W9BA 1WF2A 4DR2F 3A3NB 4I2QB 1Q16B 1XJWB 2FDNA 4RUCA 3PIOQ 1IVZA 1JXEA 2JOQA 4MYTA 1FX4A 1S6QB 3IM8A 1ZZFA 3BR8A 1Q5VA 3PNIA 4A8FA 4LUBA 2WBRA 4OZ1A 3Q24A 3IRXA 3R5CA 2E1RA 3O3LA 3W5YA 4RZRA 2OFGX 3EPIA 4EEYA 3OXFA 3TZYA 3KKFA 1NSKL 1AT1B 1RDRA 2F8HA 3MMAB 2XGPA 4ERDA 5E5NA 2FC9A 2V5HG 3UDVA 2RQCA 1N56A 2XS7A 3K5OA 4DPXA 1N5YA 4OI3A 2JC0A 4M8LA 2JEJA 2UVVA 2V67A 2P6TA 3F0NA 2A3JA 4IG3A 4LRDA 3VALA 3NOGA 2B51A 4OYMA 1N5VA 1ZM4A 4A8XA 5KG5A 2J5AA 1M1GA 3F41A 3UN5A 1FXRA 5DDPC 1U48A 5D3GA 1P8GA 3CSKA 3FMWA 5KG3A 1X9WA 1ZA1B 5CYQA 3DU6A 4C6AA 4FS1A 3PW5A 2BKOA 4AE5A 3RW7A 3F73A 3PEHA 2UXCJ 2DY9A 4DPUA 3NGKA 1X4DA 5K8MA 3TANA 2UUCJ 3M2VB 1IUJA 3CJSA 3M9MB 1S57A 2CQ3A 5HSPA 2MKKA 3FCVA 3PJXA 5H9FJ 1QTNB 3EVWA 1SH2A 3KJFB 3DOLB 1OY6A 3I4PA 2VKZG 5KT2A 4DV5F 3AQPA 1RCOB 3JQJA 4N8OA 3V4MA 4ECYA 1F9EB 1N36F 4JI0J 1R3NA 4PUOA 3CD6S 4WF9Q 1Q86T 1Y3JA 4M5GA 1Y5IB 3GYXB 2JHEA 4KC5A 4J9KA 3NCPA 1HYSB 2BJ9A 3HJFA 1TKDA 2K3IA 3A3OB 4CM2A 2CKWA 4DN9A 2SXLA 2ILYA 3CJKB 2ZC4A 2H9ZA 1X0FA 2DH9A 3S1TA 4DV6F 3JTNA 4IUFA 5IT9U 3SDEB 1YKWA 3I0SB 2BJ1A 2FZCB 2FLNA 4B9UA 2N4CA 2BYCA 3IAM9 2MYFA 4I1TA 2DGSA 4DF4A 2Q66A 4USIA 2UXBJ 3LW5C 4PG4A 2PE8A 4KO0A 4UOGA 3ISND 1FWLA 2BE2A 2KM8C 2V9KA 2KFNA 2DRDA 2KVIA 4DV1F 3GSDA 2V0NA 4N47A 3OR1B 1WWHA 2F3JA 3N5BA 1WG1A 2XMVA 1T02A 1H74A 2EI5A 2Y1RI 4WIQA 3OTOF 2BZ2A 3EWGA 4C11A 2XGQA 1RT6B 3A13A 5IT9Y 3ZZYA 2HGMA 4IFVA 4ZPVR 3MM9B 3Q8YA 3AOBA 3QLHA 1Q53A 2HKEA 1QUPA 1G6BA 1X5TA 1OO0B 1XBWA 2PD1A 4KH1B 4I68A 4DPOA 1WKLA 5J1EA 5KFEA 2FJXA 4JV5F 3I9ZA 2H4WB 4NLRA 4ZCKA 1C1CA 2MZJA 3VZHA 2VF3A 1U1RA 3CJ2A 4XDDA 1H98A 3GIIA 1N5QA 4JBCA 1R8BA 5KFBA 4CIOA 2ZH1A 1EB0A 5DQGA 2HIYA 1H2VZ 5EWFA 4FS2A 1VK8A 3GYNA 4BLGA 2NXNA 5LT5A 3TA2A 1FDBA 4JI2J 4DL7A 1R7IA 4HH1A 2O66A 4C0HA 4RKUC 3QGGA 2GAHC 4Q5VA 1CJTB 4WFAQ 3O2IA 1SJ1A 4WXWA 3VVTA 4G1QA 5IQ6A 2VBXA 2WONA 3U1NA 2UUBJ 1DTTB 1U2FA 2FJDB 2YNGA 3FUYA 2MXYA 3TZWA 3KHHA 3S01A 2UVWA 1FRIA 1TKXB 4ELTA 2P9EA 4XDCA 3OW2R 2MZTA 3A3PB 1S1XB 2HEKA 2OEJA 5IZHA 1AB8A 5HLFA 3Q8SB 2ZOFA 4F0HA 1Y7PA 2IMOA 3D1QA 3LAKA 1CULA 1S79A 2VH7A 1YX2A 1AFIA 4NXMJ 1JLGB 1Q8LA 2V69A 4TLRA 3W8PA 4MKYA 3ICLA 3UPFA 4DSLA 4IR9A 4HI2A 4DSJA 1VIOA 2K8GA 3DGPB 3GG0A 5C42A 1ZM2A 4YFUA 4RW7A 1CEZA 1NJYA 2AGPA 1WC6A 2KZMA 1R31A 4RNMA 3R7SB 3SYZA 2JEIA 1RWPB 4MKVA 4ZPDA 4R5PA 1Y3KA 5THWA 8RUCA 2BOAA 1NK4A 1XQIA 5I3UB 4HR2A 2YH0A 3AY0A 1F5BA 2J7UA 1MLAA 2LQ8A 2V8DA 5HVHA 1UWBB 4ZVFA 3EZ5A 2H5JB 3M8QA 1WHVA 2BMBA 2O1PA 2YNIB 3M2UA 4LR7A 4Q0BB 1G1XA 4OFZA 4B3OB 4EI2A 4CNZA 3MMBA 3OTEA 2Y1LB 5DS7A 4HEA9 1WELA 1WDDA 3FNNA 1R8HA 3MM9A 2KDOA 4X64F 4QIVA 4DL3A 3NLCA 4XPCA 4Y3CA 4IG0A 1FNXH 1RT4A 1RTJB 3PTWA 3GILA 4IG0B 1U02A 3FFIB 1KQFB 3T6JA 5AE1A 4DL2A 3VGUA 2AX0A 5C25B 3FBCA 3I55S 3RRHA 4ZVOB 3PHEA 2NZCA 3PW2A 1H38A 2ROPA 1UJ4A 2DT9A 5ITHA 3JAMU 1AZSA 1FKAF 4ELUA 2XWYA 1F5AA 1Q4RA 1SH3A 1GMWD 2C2KB 4EU0A 4K50A 2ZOMA 4KBIA 3QT8A 4Q7AA 3LGNA 2E5LF 2ZNYA 4Y2CA 2KU7A 5U47A 3R3TA 1I94F 1VC0A 1AUDA 5AE3A 4F2RA 3HSJA 4PG6A 4GO5X 4CO4A 1IQZA 4F3QA 3OVSA 3P6YC 2CG8A 2YX7A 3FJ2A 3T3FA 4TY9A 2NXCA 1KQKA 1T8EA 5HROA 1VMBA 2K2PA 3SQGA 4KB7A 1FRKA 2BRKA 1WC3A 2GVDB 3N4WA 4UT4A 4GC6A 1RHMB 5IM0A 5LM7E 3BV8A 3NGSA 4DSKA 1ZTWA 1KBRA 1T3OA 1JJHA 4W92B 4D3HA 3KWMA 2DEIA 1JMTA 1HMVA 3C14A 1TV6A 3FC9A 1CULB 3M05A 4KR0B 4P74A 5K9FA 4P2FA 1NDKA 4PAAA 3JYTA 1TFYA 1MW7A 2CQ4A 3DRSB 3K17A 2PI5A 4U7UK 4P7TA 1JLQB 2DPJA 2DNMA 2MMYA 2VV5A 4OX8A 4CLPA 2O67A 4C8ZA 1TAQA 4DX8H 3PFOA 5D3GB 3UO0A 4AFFA 1FD2A 4QQBA 1VQLS 5HVGA 2DHXA 2G9OA 5AT1B 4BS2A 1A7GE 1NNDA 1M1HA 5CD4A 2D3O1 2X1GA 2R7XA 2EFNA 2XULA 1MU2B 1X8DA 2MSSA 2VL1A 1CJTA 2B5JA 2OPRB 3MEEA 3PYEA 4XO0A 2KH9A 1U6BA 3QJPA 1SKUB 2OKQA 2N7YA 2GZOA 2GJ2A 2NLWA 3DC2A 3PHTA 5DQIA 3T1YF 1HNIB 1HPZB 1FJ7A 5G4DA 2HVZA 4JI0F 4Q45A 4DU8A 3LQVA 3VV2B 4EK2A 3CB4A 1HBUA 4L3KA 1XNRJ 4LF5F 4ILLA 1NKCA 3FZBA 2VA2A 1LNQA 3KMSA 3AA9A 3TR5A 4UZBA 2HZAA 1PJ5A 2J0WA 3DOKB 4O0IA 1R43A 1KTQA 2WW4A 1Q7YT 3C16B 1REGX 3IBFB 2RS2A 4JI6J 1S99A 1WI8A 1KONA 4WYWA 3EZOA 2ACMA 4Y65A 4O4GB 1VOMA 5EUHA 3GIMA 3DCAA 3KLEA 4KJIA 3LUYA 2AD9A 3AJ1A 1RP5A 3WZ0A 4P6QA 1LWEB 1YRUA 4A8MP 1RYRA 4Y34A 1N54B 2W25A 3B4MA 4NEYA 4URSA 4ED3A 4X4VA 1KD1T 4KYZA 4LF2A 4OZNA 3DMJA 4R8UA 2E9RX 1RA6A 4L74A 3H42A 3A1YG 1XR6A 3MI7X 2J7KA 4DLEA 6AT1B 3MMBB 3H2LA 2A2CA 3U02A 3J81Y 4EYIB 4MFBA 4ZP9A 3MR2A 2PMHA 3CDEA 4OI6A 4YB6A 1FA0A 3IC1A 5DM7Q 2G0CA 3O8WA 1UETA 3JYTB 2MHNA 1QE1A 2BJ3A 1M90T 4F2SA 1Z4UA 2CXEA 2R2UA 2KB2A 4PWDA 4DS5A 2RU3A 4ZPBA 2IYIA 3MCOA 2L9DA 3DLHA 2VOOA 3KLHA 2C2RA 1T9UA 2CIMA 2VFSA 2XEXA 2ZD1A 3HO1A 4TU9A 4AL6A 1VC6A 2M52A 1T7PA 4WFNQ 3DRPA 3E3XA 4HH0A 3UDCA 3ZZZA 4I2PB 5GAGU 4N8NA 4G65A 3J7ZT 4DL5A 1XMQJ 3FSXA 4BBYA 2GHWA 4PQUB 2C3YA 3TOQA 3PO4A 1XMQF 1NM2A 1VQSA 2DXDA 5LOQA 2B9XA 4KFBB 1HNXJ 2HQFA 3DDIA 3UCGA 4ED0A 3SSQA 2J7WA 3ZO7A 3HKZD 5A8RB 4F4ZA 4LF6J 4K4YA 5HMYA 1PSDA 4KGMA 1V5IB 3QRPA 2MQPA 4C48A 2R8KA 4DFKA 4O44B 1WEYA 4IDKA 2QZ8A 4YDDB 2ZDOA 2HHXA 2RVJA 2AP6A 3BQ2A 1EKRA 3Q89A 3GFZA 2HHPA 3M8ZA 1F6TA 2DRBA 5HAOA 4DR3F 4C3MA 5FJ4A 1CQNA 1LWEA 2COLA 4DR4F 3W63A 2ALYB 1PO6A 2B8QA 5AJ3F 2EG2A 1GTEA 1N88A 1PYSB 3BBFA 1S0OA 1NCLA 2BJ8A 3MTKA 5DJBA 1X0PA 2HAFA 2LEAA 3K57A 1Y9OA 1M5PC 4M5LA 2B7BB 2AX1A 3BH7B 3PXGa 3M8QB 3IBWA 2YWWA 4LF9J 3HT3A 3UN2A 4B3TJ 2IVYA 3AOAA 2Z57B 1XNRF 2AJFE 2K3KA 2VC0A 5AXKA 1VQYA 4PYAA 4NYOA 2ZBPA 3Q8QB 1RT5B 1WUUA 2ILZA 2JJ4D 3KK2A 3Q22A 1TMMA 1QAXA 2YWHA 1RWMB 4LF1A 2ALZA 4NOHA 4U7UD 1RBAA 1WKJA 2WK4A 4X65F 2DR7A 1CJUB 2F4VJ 1R6YA 1YJRA 2WW8A 4DJBA 1X4BA 1HQUA 2PT0A 5J2PB 2HW3A 2A0FB 5EHHA 1F2HA 3IP0A 3MURP 3K59A 1V6HA 1PBAA 2MLYA 3HFVA 1RISA 2H65B 1JLEB 2PMWA 1S12A 3BSOA 3H40A 4OI4A 2FJBB 4DUTA 5IC6B 1BXNA 2AYBA 3HK2A 1FNOA 1U2CA 3KLIA 4HTIA 4DEZA 4WIIA 1NK9A 4OX6A 4EZ9A 2BANA 4O3PA 2E5JA 1UVNA 3DLBA 2CPHA 4TU7A 2VC1A 1PGZA 1I51B 2C2NA 1RADB 5LMNJ 5EX3A 4ETZA 2VBYA 1YJUA 5A2QU 3D4JA 4ZVGA 4Q2MA 4JOUA 4LRCA 1VJWA 4NZ7A 5DDOC 3OLBA 3V5RA 2UUWA 2RF2B 2V68A 1VJQA 4USTA 2DHAA 4ZVHA 1U09A 1HR0F 4WFYA 1NSQA 4NLUA 2FY1A 3W5XA 2A18A 1V5VA 1QUVA 2J9DE 1LWCB 3FBEA 3FDSA 2VBZA 3PFEA 3LWLA 3QT7A 2WSCC 3C8YA 2E7XA 4WBFA 3UD5A 4ZK7M 2KG1A 2QL5B 4DV7F 5GAGI 1HFEL 2M5YA 2PA8D 1EETA 2QL9B 2MDAA 2QE5A 3NGRA 1T9VA 4O0NA 4QR2A 3OBIA 3D7SB 1GAOA 3Q2SC 5CYQB 4EMDA 2B56A 1LFPA 1XIQA 2GIQA 2GVZA 4I2PA 4LJMA 5AXNA 4LF7F 5J2QA 5F9LA 1JLFB 1FD8A 1C0UA 2IM2A 4KAIA 4ER8A 1UA1A 5H9FK 4H4OB 1DARA 4I0WA 1EIYB 4GRSA 1FDDA 1D9FA 3ITHA 1LQ9A 2XI3A 1C1BB 4DXLA 4LF6F 4RUHA 1WC0A 2ZHOA 2EFVA 2CJQA 2KXHA 1HQEB 2DR5A 1VHFA 2E5HA 3HX9A 1HNVB 4DS4A 2VPYB 3ELHA 4OHYA 4B3OA 4GKJJ 3CMQA 2DGOA 4IO1A 4RL1A
chains in the Genus database with same CATH topology
5JJBA 1YJ9S 2JLGA 2QA4G 3EXCX 4M1KA 5CZXA 3IS9B 3TP2A 5D4NA 2FHJD 3J80Y 4LSLA 3VCDA 2DJWA 3UWTA 2ZH4A 3BO3A 3UCZP 1H6KX 5H1SV 5GAEU 3ENVA 4F67A 5BR8F 4ECXA 3V6HA 2W7AA 2CQBA 2B43A 1A9NB 2OSRA 3JSBA 2VG5B 1DAXA 4F02A 2V8HA 3IO1A 2F9DA 2R7RA 3OV7A 4I6YA 3RYLA 3CC2S 2HZCA 1FKOA 2MQNA 1M1KT 2R7UA 1ZTTA 4YHHF 1SJQA 1W2IA 2U1AA 3BZQA 2DHGA 1UVIA 1DHMA 3NMRA 4YEAA 3Q2TC 2AWZA 1R27B 2DNZA 3M2UB 1ZZNA 1IKWA 4J9PA 2YKMB 7FD1A 1SH0A 2XMMA 3PEJA 3G86A 5KFCA 4B3RF 1X4CA 3IG1A 1H7XA 3OXLA 1ZPWX 3IR6B 2X51A 5HBMA 3QZ8A 3K8WA 4NCAA 3VAMA 4ECUA 2GMLA 3G8TA 4LFBF 4C8MA 2E1MC 5AXLA 1XTZA 3J7YI 3O6QA 5KFXA 2ZD1B 1T95A 2UVRA 1KFDA 1HD0A 2I8EA 3TUJC 4RBUA 3X1LB 1VLYA 2CVEA 1HBOA 1D8ZA 3MMCB 5KFNA 2VQFF 5J2QB 2XWXA 2MKHA 5KFKA 2XY5A 4QU6A 1DFDA 1HWLA 3K58A 2HNYA 2DVIA 3TAPA 4K4ZA 4EFAC 4ECSA 4NLTA 1U1LA 4FNIA 1B7FA 2NZ4A 1OQ6A 2MZSA 3QIPB 1QSSA 4B3MF 1FNMA 3JSMB 1LXJA 4LF8F 2YNHA 5KFOA 1LWCA 3GV8B 5LSRA 5F3TA 4HLBA 2MQLA 3HHLA 3QLHB 2J9CA 3BN7A 5CD4H 2FUG9 3LP1A 5IT9Y 1KC8T 4BC7A 2RF2A 1H0HB 4U7CA 3PR5B 2OJ3A 2BRLA 1OQ3A 4E0DA 3E2EA 2X3GA 4WYLA 1UAWA 4PXBA 1JJ4A 1CC7A 3ONQA 5I4MA 4C8OA 2JWNA 2RILA 1NAQA 5KFZA 2MZQA 1TFWA 2CPJA 3U1LA 1QSYA 2MB0B 3QWPA 2NSCA 2UUTA 5J2NB 1SXLA 1HWJA 3LP2B 1XR5A 3I4HX 5I3UA 2ZOGA 3CXCR 3RB6A 3L3CA 3JSYA 5AXMA 2BM1A 4OL8A 3WX4A 3MUVP 1U1MA 1JNRB 2ZH7A 5KFFA 3HZGA 1X9MA 4IR1A 2YKAA 4P7VA 3UD3P 1NK0A 1FE4A 1RI7A 2YTCA 1RT6A 2IVMA 6FDRA 1HI8A 2HHUA 2EK6A 2JL9A 1UP1A 2KKHA 4FPRA 3NS5A 2VFTA 4YR2A 2AJ4A 4TQRA 3OXGA 2EFPA 4DQPA 1V3SA 2RQMA 1CC8A 1KLMB 3KNGA 2BQRA 1BLUA 4K50A 1B0PA 2HS0A 1I6JA 1JLQA 2DIVA 1RYSA 3SSRA 4YR0A 1W25A 4CI0B 4NLQA 4Y2AA 4I7FA 4OZJA 4ZLPA 5JXSA 5KFMA 3DXSX 1KQSR 1SJ3P 3HHLD 1QAIA 1E6YA 4KV8A 4MTPA 2MQQA 1HWKA 1DZ5A 3BDPA 3MMCA 2C3MA 2BBEA 3PM9A 4WZMA 2NREA 2AJQA 1ZBTA 5E3PA 2HRYA 1AROP 3SCLE 4X66F 2UP1A 4NLXA 1SV5A 3AA8A 3M6XA 3FVYA 4A8OA 1I1GA 3JTPA 4YOEA 2XMTA 2R2SA 3LOUA 4OZLA 4IRCA 4IFYB 2D74B 4QWDA 2FIUA 1REVB 3GWCA 2Z2LA 2AJ0A 3AJ2A 4A47A 1Y5LB 2NSBA 2VFUA 2UXDF 4ITSA 2KT5A 2CQHA 3BSAA 2F40A 3MZIA 4RBTA 3G6YA 2FLPA 2IMWP 4DQIA 3SZ2A 4MK8A 1IKVA 4Y2KA 5H9EJ 4FZVA 2HLTA 4NXMF 1TKTB 4ECQA 3MM7B 4ED5A 1ULRA 1JX4A 2DO4A 4NA1A 2XMWA 1SB6A 4G1IA 3LH2S 2XC9A 2V8GA 3DI6A 4ZPTR 5FLXY 3M9NB 4DG1B 2CPEA 4JI5F 1BQNA 3MM5A 3MECA 3I82A 2CPZA 4LSLB 2W9AA 2J6TA 5L1JA 2DNOA 2WOMA 4GKJF 4HI1A 1S77D 3KLGA 2ZJPQ 4M5DA 1ZYQA 4LIWA 5CH7B 3IGVA 2JEGA 2KFZA 2FJEB 3DHXA 2EVZA 2AGQA 1JJ2R 5GADU 4IH6A 3CC7S 2E9ZA 5G0RB 1RT2B 1QSLA 3QGIA 4KQZA 1Q1KA 1TKTA 5HQ8A 2IBKA 2DRAA 3CPWR 5LJ3Y 5F8LA 3RR7A 3IWXA 4DBQA 5A0YA 5EWEA 2F1FA 4ED6A 2FD2A 3JSMA 2DNKA 2JLFA 3O44A 5KG7A 2YKNB 2CPIA 2GC8A 3IR5B 3DLGB 2ZH8A 1V3RA 1TKXA 4DF8A 3O1LA 2JRSA 4J9QA 2RRNA 2J0SD 1FVQA 2FHMA 1N0VC 1HPZA 2V8VA 2E9TA 2GIRA 1RQ0A 3RRGA 3SQGB 3KLFA 3NWGA 1L3TA 5DO2A 2XG8A 2YKPA 1G7CB 2VG6B 5KG4A 3C6TA 2J9DA 3BSNA 1IKXA 2HWTA 3H4DA 3CO9A 4NPOA 1FHTA 3CVKA 1GH8A 1S0MA 5J2MB 2GFFA 4B08A 5A2QY 3MR6A 1HARA 2GW8A 3P49B 1U1PA 3KG4A 1UVLA 1UKUA 1YRXA 3B78A 4N5SA 1P9QC 4URGA 3BB5A 1URNA 2BQUA 1HBMA 4IG3B 2HHTA 1VRUB 4O3NA 3HVRA 1DRZA 4FXDA 4A46A 2IAJB 4QW8A 3TAQA 2N3OA 2I38A 4YDXA 4K59A 3QPIA 5B0BA 2J76E 2X1BA 3KLEB 2OP5A 1SKWA 1OWXA 2IC3B 3N28A 1L3UA 2ASDA 4YP3A 2UXBF 2MKJA 3LANA 2MZ1A 2E5IA 1X5PA 2D1CA 3VQTA 1S6QA 1IBKF 2VBWA 3TA0A 1U26A 4DG1A 2VKRA 4NLVA 3ENQA 3FQLA 1HBNB 5CHCB 5LSOA 3BDEA 3QJJA 1N32F 4FN5A 2F7VA 3POTA 5FDLA 3OFHA 4B9SA 1O5JA 2DCUB 2QEXS 1MU2A 2R4FA 2OLWA 4IDKB 3ZFVA 2BJDA 3MTJA 2VOPA 2JVOA 2KHCA 3N6LA 1HNXF 1W2BR 1D1UA 3MM6B 3IWLA 2B9YA 5FD1A 1NKBA 1E6VA 4ZPCA 1B0TA 4ICLA 3IRWP 1EETB 2RQKA 3EGWB 1HWIA 5HO4A 3FMBA 1RT1B 4LQ3A 3US5A 2LQ5A 1HMVB 3N6MA 2OPSB 1HW8A 3DRPB 5DM6Q 1SL2A 2CPFA 3M8PA 1HBOB 2HHVA 4G1QB 4PRFA 3UFCX 4NCBA 5A8WA 5D4OA 3KLHB 4FF2A 1LFWA 1CQMA 3MD1A 1IN0A 3POTB 3ZZTA 4A8QA 2DNLA 2XSJA 3UR0A 2WB1D 1LKZA 1K73T 1TZ0A 3VAIA 3G96A 3M2VA 1RTDA 2D7SA 3Q0AA 3RBEA 2ADCA 5HBMB 2OSQA 2V9WA 3K5MA 1MNEA 1KOHA 2RUGA 4X4RA 1VQ5S 4ES1A 3HPOA 1RAJA 1TL3A 4H4MB 3VR1A 1S0VA 5KG1A 4FVMA 1KLMA 1S48A 5KFLA 4YQWA 3KK1A 3RAQA 3KMQA 3ISZA 1T03A 4RNOA 3C46A 5DDQC 2UU9F 2QSFA 4WFZA 1SJRA 2C28A 2EFOA 2PC6A 3VAKA 4OLOA 5G0RA 4MIAA 1F0XA 4AQYF 2LLZA 3V6JA 3OTBA 5EX0A 4K4XA 2RJZA 5KOXA 2EG1A 2LQBA 1LV5A 2LA6A 3HVAA 2DTJA 4ZCLA 5LSLA 3HM9A 1PC4A 1KFSA 2HMIB 2GMHA 3HZEA 4KHRA 3WDOA 4WKYA 4EBDA 5M2UA 1O51A 4J9NA 3I87A 1TR0A 4JI8F 1NK6A 4ID8A 5CCLA 2RU9A 1C1CB 2W7PA 2IM1A 3LAMA 3SV4A 3PW0A 4B9LA 4JI7F 4UY85 1XWLA 2J8AA 4Q2LA 2KJWA 2VASA 1P6TA 1YBAA 4QIGA 5F8NA 3D1OA 2IAJA 2RMLA 1IKYB 2DISA 4K2XA 3DGPA 2XB2D 1VBYA 1Q79A 3DM2B 5B08A 3M32A 3NBPA 1B64A 3GV5B 4RUAA 2O01C 4AUKA 5LXYA 2W8KA 5DLGA 4C3LA 3OQ2A 4DLGA 2U2FA 4O3QA 2Z2MA 2PMZD 1YWXA 2FVSA 2JEIA 3VZIA 3S7RA 4F50A 4LQ9A 3PRDA 2KI2A 3BGRA 4J9SA 4ETXA 3OVBA 2YKNA 2OAUA 2CQCA 1NK7A 3DLJA 1NJIT 2UZAA 4MIWA 2X1AA 1BY9A 1QTMA 1XEZA 2LYVA 2HVHA 2HPUA 3GZ7A 3HHLC 2M4MA 1RT3B 4X4NA 5D77A 1XMBA 2PEHA 3RU0A 4Q8FA 2E7WA 2YWGA 2IJNA 4C98A 2MY8A 4I69A 3TI0A 2VG6A 3VAFA 4MKAA 2LMIA 3CEDA 5KFTA 1TKZB 3UR3C 4PXEA 2F9JA 2IA6A 2KJVA 4FF4A 1KQGB 1JLCA 2WHOA 3CCJS 4K4UA 2OPSA 5CCMA 4CO1A 3MOJB 2FTRA 5SZTA 2QMWA 1WHYA 2I0XA 3P5TL 3PY8A 4EBEA 3KLIB 5MAOA 2VG7B 4X62F 2FPHX 4HVZA 3ZC4A 2HHHF 4NYPA 1FT8A 5A0YB 5B0FA 2QA1A 3M1VA 2F8EX 4A8KA 3T5KA 1TK8A 1UVJA 3JAMY 2CG4A 1ZAXA 3ZZRA 4FYDA 1IJEB 2I5JB 5L1KA 5L38A 2ZFHA 3MEGB 2GX8A 2ASLA 4EZ6A 3TRGA 4M5DB 4DV4F 2V4JA 4X84A 3GR0A 5KFAA 4H4MA 2Q1LA 1U49A 1N4LA 2R7OA 2KHDA 3VAGA 2D41A 4J9LA 3NAHA 2G1DA 3X3UA 3RBDA 5KFUA 2W4PA 4I2QA 1RA7A 5KG0A 2UUAF 2WCXA 4ILMA 1KEKA 2QA4S 3QJPA 1PILA 2AYMA 1S6PA 2B4OA 2XSJB 4OZ5A 5J1PA 3V4IA 1U1OA 4CNYA 4K4WA 2RT3A 2W7OA 3EGNA 1JXLA 1FESA 1CLFA 3M1VB 4EO6A 1UFWA 2XCAA 1FK9A 3N79A 4TY8B 4WCEQ 4ZHRB 2KT2A 2WTFA 1U1NA 4NZ0A 4PWUA 4R0JA 4GMKA 1TL5A 2I1RA 1BD6A 2FJVA 4DR6F 3HFKA 4ZVEA 3WC2A 1REVA 2B4UA 2QLWA 1T05B 2KZZA 2RD5C 4IFYA 1T05A 2BJEA 2EC0A 4UQGA 1C0TB 3BGLA 2FVPA 2D3ZA 3OPKA 5JVGQ 4FXVA 2FHOB 2PN6A 4ECZA 2QO3A 2ADBA 2J0XA 5BYSA 3GMGA 2XS2A 1KLNA 2R7WA 4NL5A 4QWAA 5IM0B 2GA7A 2YWEA 4OJ1A 4RLEA 1VQNS 1FRXA 3DM2A 2QSWA 3CJ4A 2DGUA 3U27A 2PGCA 1NB7A 1QVFR 2LU2A 4DR5F 3JB9k 4F8RA 1FRMA 1LW0B 3MPYA 4EZ9A 1ZH5A 3GB0A 1NH7A 2AF6A 3M8PB 4P2SA 3PW7A 1HBNA 3UCUP 1X4FA 2FVCA 3GV7B 3T9NA 4CT9A 1FKPB 4URQU 3IA0A 2L41A 2PFFB 2HS3A 3DLGA 4LVNP 2A10A 1J5OB 5JUMA 1NJWA 1OS5A 1K1SA 5L8RC 3SCJE 3FCHA 3SSSA 4C8KA 1O0PA 4WFBQ 3TQ1A 3NMAA 1IM4A 1JLAA 4Z37A 3OUYB 3V81A 1UVMA 3MPWA 4ZA1A 3CDAA 1WF1A 2DNPA 4QIEA 2LU1A 3RRKA 4L72B 2FLLA 3PKYA 1UEVA 3CD7A 2ASYA 1R8PA 3H2VE 4CQ1A 5IS2A 3O5TB 4IRKA 4RX6A 1KNZA 1DQ8A 3HI9A 4DL6A 3MMJA 3BS9A 1S6PB 2L9NA 2KM8B 3V4IB 1T03B 4NCGA 2F4VF 4RW9A 4M95A 5B7WA 1C2PA 3H98A 4DV0F 1VRTB 3GFYA 2ZZNA 2JH3A 5F8HA 1K0TA 3KHLA 1Q7LB 3B8HA 1YVFA 1NJXA 3MM8B 1A6LA 2JLEA 4YB1P 3LPYA 1VFJA 2K7KA 3I5BA 3M2RB 2ZKUA 2HQ3A 1XR7A 3U1MA 2HGLA 2YVSA 4X4OA 4C8LA 1N5SA 4FXWA 3G9CA 1XC9A 4USJC 3ENWA 1TKZA 2MPUA 2IRUA 3GIKA 5LMNF 4J37A 5MLCV 3LP1B 4ED8A 5CA5A 2DHSA 1MROA 5A8KA 5KT6A 2M88A 2ROGA 2XNQA 3CJ0A 4QW9A 2YWKA 1GNKA 3D2WA 3Q23A 1BQMB 5I42A 3KK1B 4NXNF 2M8HA 3K7RA 3QWUA 4ZP8A 4ED7A 4JV2A 3THTA 3G71S 1Y00A 1VIXA 1LW2B 1S1UB 1YJTA 1UW4A 4BHQA 4ECVA 3V6KA 1LW2A 2FB0A 1WHXA 5E3CA 4NYZA 3LP0B 2APOA 4PG5A 3TYTA 4DFJA 4OLPA 1VQPS 4K0KF 3OFEA 3H25A 4YR3A 2JSXA 2LEPA 4M63A 1TK0A 1NKEA 3OL6A 4B9VA 3FEYB 4MIBA 1LXNA 4LSNB 3CUNA 3M30A 2IRXA 1SBRA 1YHQS 1NRKA 3KLFB 4F3OA 3I96A 3CCLS 2VB6A 1SUQB 2BUNA 3MMAA 1L3SA 3W2VA 1S9FA 2HGNA 4QOTA 2CFXA 3KLGB 4EGLA 4EBCA 4QR0A 4NLYA 2WB4A 1SL0A 3MFHA 2RE1A 2CQ2A 4XAKA 2FGOA 3LALA 4I67A 2ATLA 1JLEA 1SC6A 1X7VA 3SEOA 4UQTA 2MJUA 4A4JA 2P9CA 4J9RA 3UE2A 3NCQA 4K4SA 1UL3A 2EFQA 4HT7A 2AW0A 2RIJA 4IFVB 4G6VB 3VAJA 1XN9A 3DMJB 2QT7A 4YB5A 3MUTP 5FDLB 3KHGA 2WRMA 2YWFA 4Q8EA 4QYRA 1T94A 2I9SA 2R2TA 4UY8T 3BR9A 3V81B 3C3LA 5E41A 2R8IA 2A1BA 2HIQA 1GTHA 3DXBA 2XSFA 2OPPB 4B9TA 2D3OR 5EDWA 3EPGA 3CCVS 3M6UA 2WAQD 3CJKA 4OV1A 5L9NA 1KS2A 1L3KA 3RZAA 1O8BA 3FQKA 1IKXB 2CQIA 4Q44A 1N5TA 4WXOA 4C2MA 5C42B 3R5DA 1NK5A 1GX5A 3TVZA