2H9ZA

Solution structure of hypothetical protein, hp0495 from helicobacter pylori
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of hypothetical protein, HP0495 (Y495_HELPY) from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein HP0495
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04359 DUF493 Protein of unknown function (DUF493)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2h9zA01
1PSDA 4LUBA 3IBWA 3UW1A 2QMXA 2P9CA 5IT0A 3TUJC 2PA3A 2ZHOA 2PC6A 3OFGA 2J0XA 2JHEA 3O1LA 1LK7A 1UJ5A 3P96A 3OFHA 1M0SA 1YGYA 4IO1A 3ENWA 3K5PA 2P9EA 2RQMA 5JJBA 3DC2A 4GO5X 2DTJA 2LVWA 2J0WA 5T41A 3ENVA 3L7OA 2NYIA 1UJ6A 2KO1A 1LKZA 2RE1A 3CEDA 3TUIC 1Y7PA 3ENQA 2H9ZA 3OBIA 1SC6A 3S1TA 2P9GA 1RWUA 3LOUA 4GMKA 3OFEA 3IXQA 2QRRA 1YBAA 4NMLA 3MTJA 2F8MA 4GO7X 2QSWA 2FGCA 2I9SA 2LQJA 1O8BA 3OFFA 3DDNA 1KS2A 3MWBA 2MDAA 3MAHA 2JOQA 3DHWC 3AB2B 4X84A 5FIIA 3LUYA 2F1FA 3DHXA 2DT9A 1U8SA 2RQKA 1ZPVA 3NRBA 5IT4A 4PWUA 5IS2A 3TUZC 2CDQA 2QMWA 1LK5A 3AB4B 4M8LA 3HHEA 3AAWB 3N0VA 3KWMA 3U7JA 3W7BA 1XTZA 1UJ4A
chains in the Genus database with same CATH superfamily
3M8PA 4G65A 3GIRA 3HULA 3QT8A 5AE2A 3T1YJ 2MTLA 5FLXY 3GFYA 1VRTB 2GHPA 3MD3A 2NS1B 1RWNB 3R1LA 3D54A 3DRXA 5HMWA 2M8HA 2RQ4A 2LMIA 5IT0A 2ZM6F 2JEGA 3QLHB 2MKYA 3PO5A 5HQMA 2L41A 3C16B 1UVIA 4WJBA 2PA3A 1KD1T 3QAEA 1ZETA 4CCHA 1YBTA 4C3KA 3GWCA 2YPYA 4EFAC 3IR5B 2N3OA 1B7YB 5K9FA 2GIRA 3OTOF 4LF4F 2GO8A 4I6AA 2E9ZA 3K5NA 2HKEA 3DLKA 4IH7A 4ANDA 5DG9A 4JI7F 2RKIB 2DGXA 1S79A 1RAJA 5E3AA 2EWHA 3Q89A 3UN3A 4N56A 1RAAB 3K5PA 4XK8C 2Z4PA 4KHRA 4NLTA 1BE4A 2DH8A 4NLYA 5HAOA 3ZTRA 3E2EA 3PV8A 1SL1A 3JAMU 2BRLA 3QRPA 2EW9A 3A8EA 2WRMA 4EBEA 2J0WA 4NX9A 5A0YA 2XO6A 2VU5A 4W90B 2YX4A 3DRSA 3PJWA 5KFEA 3MMAA 4F02A 3R2CJ 4DV7J 4K0KJ 3W2WB 2J8AA 2VC0A 3F41A 2VQFF 3PW0A 4JI4J 2EPIA 2C2RA 1SQEA 2Q66A 3ENQA 2HFSA 3BBFA 1JNZB 2V69A 1WNEA 2HFOA 4OZNA 3A4TA 3I87A 4OJGA 2V9KA 1RBOB 4F0HA 3D2WA 1NJWA 1L3TA 3D6TB 2MKKA 3V4IB 5JXSA 4GKKJ 2W7AA 4ANEA 3BREA 3BPSP 2BKNA 3AJ2A 2MLXA 2POKA 4DV5J 1FJ7A 1NK8A 1RT1B 1ZBTA 5A8RA 4NMLA 1S9GA 5BYRA 2BACA 2KDOA 2V34A 3JS9A 1D1UA 1KSPA 1MMNA 2YNFB 4ZPWR 3CCJS 2W2NP 2IVYA 2X7IA 2QE5A 4DCPB 4X62F 2HBRB 2B9EA 1AFIA 1WI6A 3N6LA 5ETKA 1HNWJ 3IAS9 3IG1A 5ETQA 3QIDA 2FHKA 3HX9A 1YG0A 3GZ7A 3NCQA 4TNOA 2GX8A 1SKSA 2CJAA 2JVOA 2F4VF 1TV6B 3W61A 1U26A 1UZDA 2G2OA 1IKVA 1SQFA 2VFRA 1FNXH 3DDNA 4OX9J 4RR5A 2CNOB 3BO4A 2EEYA 3CMQA 3HDSA 2IIHA 3KDNA 4DV6F 1YTYA 3AXKA 2AYMA 1T9UA 4MK8A 1UTAA 2YNIB 4QWAA 1U47A 1HLWA 4OV6A 3UD5A 3GFXA 1PYOB 4DSLA 5D0RA 1TKTA 3SV3A 3ZFVA 2Y1IA 3LUYA 1Q53A 3I32A 2MQPA 1N5QA 2M9KA 2FZCB 3UDCA 2R2TA 2E5LF 3RBEA 1FJEB 3MCNA 4K4VA 3VAIA 2JWNA 5F8NA 3BR9A 4ECVA 1RWMB 2FY1A 1AROP 1CS4A 1GX5A 1T02A 3C2PA 3R2DJ 2CDQA 1LFPA 1S48A 1PAUB 9ATCB 2DNQA 3MMCB 1VBYA 2L48A 4J91A 4MT1A 3GQCA 3J7YI 2V50A 4FF2A 2CQCA 3FCWA 1U24A 2KRRA 2FD2A 1R89A 4TXSA 2E9TA 2Z56B 5J1EA 1PBUA 3BYRA 3HHLD 1S59A 3OTBA 4Z2XA 3OW2R 1QVGR 3OR2B 1JWWA 2M52A 4ECTA 5B0FA 3DRYA 4P2MA 2M88A 5IV4A 4Q43A 2DO0A 3SQOP 2G2ZA 4K4TA 3MXHP 3NCPA 2XM3A 4M5DB 3PO4A 4C4WA 1ZZNA 1R8PA 1VQNS 4EYIB 2ZE2B 2AP6A 3LGHA 3O2IA 2V0NA 1HWJA 4BC7A 5K8NA 5KFBA 2XY6A 4ZIVA 2DJWA 4AL6A 1JK9B 1IR2A 1VOMA 4O4GA 3WHIA 4DR5J 1TKDA 3OL8A 1JLFA 3RR7A 3QT6A 2BOPA 1X4FA 2RUSA 2DY1A 2FVCA 3K8WA 3QIPA 3CVKA 4YHHJ 3GG0A 3MHYA 4LT6A 4B3RF 1Q5VA 1YBUA 4Q7AA 3SFGA 3FRYA 4NYPA 3ZTQA 1IM6A 2WCXA 2BQ3A 1FWKA 1BQNA 3I4PA 3IWLA 4RL1A 5KFCA 4AUKA 4UY85 1U6ZA 1NSAA 5K8OA 1YJ7A 2ZDPA 2IM1A 1S7HA 1SBRA 4UF4A 4U96A 4DV5F 3RAXA 1U48A 1J5OA 4PCQA 4PWDA 1UPMB 4PEOA 2HQIA 4K4ZA 3OPKA 2AX1A 1CPZA 2O5DA 4NI2B 5HQ8A 5B0GA 3CMAS 1EQMA 3D0GE 5M2PA 2CPFA 4KT0C 5KOXA 4FVCA 1Q5YA 1TL3B 1UFLA 1WKLA 3PDNA 1V5IB 4B3TF 4KSEB 2IVMA 3B4DA 1TL1B 2B7CB 1TP7A 4FN5A 4IFYB 5A6PA 3X1LB 1GXLA 1X5SA 5KTQA 1BWEA 2FB0A 4CLPA 1R0CB 1D9DA 4GMKA 3BH6B 3N79A 4B9NA 4IFYA 2OPRA 3D0IE 3S7RA 1H72C 2Y8WA 3ZZYA 3PNIA 3J7YU 4PQUB 3BSAA 4TU8A 1CBKA 2CRLA 3CO9A 1MN9A 2YTCA 1EHWA 2XMMA 3M7VA 4NI2A 2CQPA 1YJTA 4F4WA 1KVIA 3Q0AA 3DLGA 5ETNA 1UFKA 2VDHA 2DGUA 3DRRA 4ZPBA 2E9RX 4OX8A 1HQUA 1J5OB 1MROA 3ZZTA 2YNHA 1RHUB 5AXMA 3UQSA 3KLHA 1FRMA 3KFWX 2XSJB 4NWBA 4ZPDA 3M6UA 4USMA 1KVJA 1BQNB 2NSBA 2E5HA 4M95A 3M9MB 3KMSA 4YMEA 4EWTA 5HJYA 1X4AA 2K3KA 1IKVB 1CVJA 1TV6A 3K5OA 3CC2S 5DLFA 5DDRC 3KHRA 4UOHA 4DFPA 3PTWA 2QL9B 2JC1A 2EFPA 3OVAA 4QQBA 3MFIA 3UN2A 2MPUA 5KG6A 2GJIA 2AU0A 1JXEA 1TVRB 1SJ4P 1HKAA 2FVPA 3RBDA 1ZTTA 1Z2LA 1S1UB 5M2UA 2IFXA 3TAQA 4WYLA 2CPIA 1RT1A 2QTWA 5A8RB 4O3NA 3HP6A 5MLCV 3J81U 3FRZA 3U1LA 4KTQA 5FD1A 2P8IA 3FC9A 1AFJA 2C2KB 1Y0HA 1D09B 3QGHA 2OKQA 2QA2A 1PKUA 3V4IA 4DZDA 3HHEA 3BN4A 1TUVA 2WVEA 3LH2S 3H5UA 5D4NA 4RX6A 5J1EB 4PG6A 3ILOA 4CNYA 3SSSA 1SL0A 3OL9A 3IWXA 4ZDNA 2ZHAA 1BLUA 4YY3F 1U1OA 4Z7CA 1S6PA 2DYAA 3BO3A 1WD6A 2MZSA 1GMVA 3P49B 3PHEA 1BY9A 3B54A 3AQPA 3Q8SB 5T7LA 3KLFA 2B4PA 4EBDA 2CQ3A 2FVSA 4WYWA 2MQ8A 3MMAB 3N6MA 2W2MP 1WJ9A 1OIAA 4I69A 4RWXA 3VQTA 3KOAA 1DHMA 4TYBA 1NPKA 4DU7A 4C6AA 5A0YB 2EI5A 5IQ6A 2XY5A 2J0XA 5HANA 2AX0A 2O3DA 4KIAA 4NLPA 4F0KA 4UOGA 4MFBA 2JEFA 4C8YA 1UJ5A 2MSTA 1YJ9S 5IT9Y 2CJBA 3EMTA 3SCJE 4E0DA 3EVMA 4IRDA 4K8RA 3L09A 1JLCA 1YI2S 2ZEJA 3FBEA 2HEKA 4TY9A 2YNIA 4DL0C 5HMYA 2BM0A 3DLKB 2RAQA 1NJZA 5D0EA 1WG5A 1QUVA 3CDUA 4C3MA 2ZH9A 2PMWA 2C2DA 4JUZA 1HNWF 1X60A 2OHDA 1EARA 2HNDB 1JJHA 1QJHA 3D3CJ 1UVKA 2DR6A 2N3LA 3KG4A 4JI8F 2KYXA 3C16A 2WK4A 5DO2A 5IC4B 2CWKA 3QLHA 1R0AB 2UVRA 3ISND 4YR3A 3I55S 4LF2A 1Y10A 1LKZA 2RRAA 3HFVA 4A4JA 1NK6A 3CEDA 3EZUA 3QO9B 2VJUA 4OIXA 4RUCA 2VONA 3IR7B 4QR0A 3EZ5A 1RLDA 1SH0A 2VL1A 5BR8F 4ER8A 4DBQA 4DX6A 2W1BA 1KVKA 1WELA 2ZNYA 1HWUA 1FFSB 2HGLA 2P9GA 2YQ0A 1SI9A 3TZXA 2HHHF 4P52A 1FTCA 1N32J 2XY7A 1PBAA 1A9NB 5DZ6A 3SDEA 3ZTSA 3VF0B 3NCRA 5E41A 3CXCR 2PE8A 3V6JA 1AT1B 1MW7A 2EG2A 5CCMA 4RBTA 2VFSA 2OPSA 3THPA 1H73A 2AEMA 2DH7A 2PFDA 5GMEA 1U49A 3LA0A 4U7UK 2UZAA 1N56A 2L08A 2OEJA 2IM3A 3OHBA 3G6VA 4ECXA 3MGJA 2HQGA 3QFHA 3VZIA 1MNEA 3R9LA 2VASA 4URQU 3BGOP 4WP9A 3C6UB 5CCLA 4ECRA 5D8HB 3QPIA 2V94A 1ZTWA 1WC4A 3PACA 4PKDB 2HK2A 2KRBA 2MQNA 3DRSB 2CPZA 2J6SA 1TMMA 4MMOA 3GFZA 3LP2A 4PG7A 4XO0A 1PO6A 2OSRA 2P6TA 4KQZA 4CLKA 3PW2A 2IDEA 1FX2A 3KDOA 2FVRA 2IJFA 1RT6B 3VWSA 2NQPA 1N0VC 3LP2B 1HBOB 2A6MA 4AXJA 2HMIA 2ZOFA 4USTA 4WFZA 2VG5B 2RKIA 4QIGA 4P74A 4OI0A 1NMEB 3NMRA 4NCBA 4ED7A 1O5JA 1VRQC 2MZRA 2IM2A 5ETLA 3DHXA 4EI2A 5HL7Q 1XK8A 5J2QA 2Y1LB 3OUYB 1OSCA 2HIQA 1U8SA 4RKUC 5LT5A 5IZHA 4JI1J 3KXDA 3LW5C 3Q8QB 2NXCA 2C2MB 4B3SJ 2UVVA 4QBUA 3HMJG 1S5ZA 3CWJA 2LDIA 2XMJA 2QGFB 3PFEA 4LQ3A 4MKVA 4O3PA 2MMYA 3D4JA 3T1YF 1PJ6A 2Z58B 2DIUA 1KTQA 2ZVSA 4KAIA 3DM2A 4ZVSB 2EG1A 2IVFB 1VRTA 3SDEB 3ZZPA 2BR0A 2A6OA 4N41A 2DCLA 1FKOB 2HWHA 1B0VA 2IRUA 3AOBA 4L75A 2XYGB 4YB7A 2QFIA 3TYTA 3WBZA 1D3WA 1N48A 1PGZA 2FLLA 2QL5B 3QO9A 2BVZA 3I0RA 3IBWA 3L7UA 3N6NA 4Y0FA 3TANA 2FLNA 2H4YB 4DL4A 2VHGA 3NNAA 2QMXA 1VQPS 4B9TA 2P9CA 5L9NA 1ZPWX 3CJ4A 2D41A 2XO7A 2BDPA 3P6YC 1RAIB 1X4EA 1T95A 2CXEA 2KHDA 2AJQA 1T9XA 2CQHA 2MKJA 3OFGA 4L74A 1JKHB 1XMQF 2BE2B 1K0VA 2WW8A 4JI0F 5CD4A 2V4JB 2IJNA 2X3DA 3KHHA 1UEUA 2BUNA 1W25A 1U0SA 3JXOA 4MAKA 4AT1B 3V6HA 3BS9A 1HNIA 3HHNB 5T14A 4RNMA 1JLCB 3TO8A 5DQGA 2ERRA 3PM9A 2IRXA 2HZVA 2BA9A 2DNNA 2OAUA 1V9OA 5J2NB 2R7SA 3RB6A 1HI8A 2J8SA 4WFYA 3HVAA 4CO1A 4JI5F 2RDIA 1X4BA 4OI1A 2DRDA 4UZCA 1GQEA 4LR9A 1GXTA 1UJ6A 2C22A 2XGQA 4KC5A 1DY3A 3T1HJ 1YQHA 1X7VA 3UR0A 3KLFB 1UZHA 2LLZA 2RE1A 3EGNA 3FEXB 4KO0A 1L5UA 2DPJA 3DLBA 2BOAA 3TUIC 2HVZA 3R6GB 4NLWA 3W9HA 2VJVA 4Z7YA 4ZLPA 1UW9A 2HS0A 5I42B 4NLGA 1MMDA 1VIOA 2PI4A 5M2RA 1Q8BA 2BW2A 3AJDA 2VBYA 4MIWA 4BC9A 3FEYB 3KNGA 4OZ5A 3MEEA 1A6LA 5CXTA 4DR6F 1TKXA 2QN6B 1AYEA 5KT6A 1TUWA 2MZTA 1W7WA 5AJ3F 2AEJA 4FNIA 3QQCD 3D6FB 2F8MA 4GO7X 2BW7A 4J9UE 3GJTB 1SC1B 1FNMA 4NOHA 5GAGU 2O66A 2LCWA 5KFWA 1KOHA 4C9DA 3C14B 2PMHA 1DAXA 2GNKA 2NUUG 3BGLA 3BKTA 3BGRA 3ET6B 1JLQA 2R7QA 3T41A 5KT7A 1WTBA 1J27A 2CZ4A 2LXIA 2RB7A 4FKYA 3AD7C 1SKUB 1Q86T 4ID5A 2EBGA 2BYCA 1OYDA 1WKJA 2FZKB 2DGOA 2DISA 2FZGB 3T9ZA 5BXIA 1BMQB 4AQYF 5J1NA 1FNOA 4C11A 4LF1A 4BWMA 3VVUA 5C25B 3M05A 4NEYA 4UT4A 3MEDA 3MUTP 4OQJA 4FXDA 2ZOGA 4I7FB 1X5OA 2ATCB 1BXNA 3H7HB 3ZZOA 4W4MA 4ILMA 4H4KC 3KLHB 1FCAA 4KV8A 1XNQJ 1DQ8A 2YNHB 2JL9A 4NLOA 3I9ZA 1HQUB 2A18A 4LVNP 3DRRB 4HDHA 4NA3A 1L3UA 5E3RA 1KKHA 3PIOQ 3T9NA 3K7RA 1WC1A 2W01A 2Y9HA 4NE9C 1T11A 3M9NB 2E44A 3N01A 4LFAF 1MLAA 2EC0A 2B6AA 2PT0A 2K2PA 1X8DA 3KK1A 3JB9k 4J9NA 1J2VA 2RS8A 3DXBA 4R8UA 4A8KA 3KJVB 2OPRB 4BDPA 2BM1A 2C2EA 1L3SA 2J6UA 1LK5A 3P8BB 5E7OB 1EETA 4PG8A 2KT5A 1VRUB 3TI0A 4PUOB 2UVWA 2KYZA 1TL1A 2CPEA 1S1WA 1Q7YT 3OSNA 3CNQP 3KWMA 3N0VA 5FDLA 5G0RA 3U7JA 1M90T 3OTEA 1TL3A 4FS2A 4RUAA 3HXMA 3SCIE 2MQMA 4J9PA 3M2VA 3QMQA 5C5JA 2ATLA 2IMWP 3NWGA 1R6YA 1VIXA 2IC3A 4DR4F 2ZZNA 2AJ0A 3KK3B 3OR1A 1JLGA 2V8HA 4IDKA 3EJMA 4IOAQ 2CFXA 3QBCA 1HW9A 3CO0P 2H5IB 5ITHA 1VBZA 3GSIA 3K58A 3IRXA 4W98A 1KHVA 1VQ9S 4B9SA 2J0SD 5H9FK 2GS8A 2MLZA 4ZVRB 2DXDA 7FDRA 5GADI 4P72A 4ZHRB 2LU1A 5H9EJ 3CSKA 2XSFA 4KGVB 4WZQA 4S0MA 1UEVA 3GJQB 4HHJA 1RUSA 4DSKA 2Z8QA 2NZ4A 4ED0A 4ZN3A 3DLLQ 2WVDA 4E98A 1F9EB 4QWEA 3HVTA 3Q86A 3R3TA 1F2GA 3AHPA 4EUVA 4OLOA 2DNOA 3M2RA 2RU3A 1JLFB 2GAGC 2YH0A 2E7XA 2HRTA 3AXMA 1LEOA 2M7SA 4IR1A 1G1XA 3D67A 1ZAWA 4O4GB 4F2RA 1WUUA 1MU2B 2LECA 1RKJA 2HHXA 2WOMB 1HNVB 3DYAB 3RAMA 2IRYA 3MECA 5CABA 2OPQB 3F56A 5KFTA 3H25A 1P9QC 1XNRF 1HHTP 1VYAA 2B7BB 2OSQA 1S49A 2PA8D 4M5DA 3IBCB 1SH3A 1TQLA 3RBZA 3SI8A 4CWBA 5HSPA 1JLBB 4DV1J 2JLEA 4NRTA 1C0TB 5MAOA 1AB8A 2V67A 3CJ3A 4DHVA 5EX3A 2B4OA 5E2QA 5CQGA 1SJFA 1PYSB 3OR2A 2PEHA 2IYGA 2XLKA 3U27A 1IKWB 1RSCA 4C97A 1VHFA 5DJBA 1HR0F 1QM9A 4P2FA 2R7VA 2KM8C 2VA3A 3WX4A 1N32F 4WFAQ 4F50A 5KFMA 2GVZB 2XNQA 3CCZA 1JXLA 2VPYB 3MMCA 4UQGA 3M8YA 3V2UC 4JOUA 1FX4A 1JLAA 3KJFB 1B0PA 3UR3C 3MAQA 3P5BP 5F8MA 1N8RT 1KONA 2BBEA 3IGNA 3TP2A 5HN0A 1RWKB 4J9MA 2I38A 2ILZA 4N8NA 3M32B 3CJ5A 4LF8F 2FHJA 2FYXA 4G1QB 3IFEA 3JQMA 4B3MJ 3JQKA 2J9DE 2WB4A 4QIEA 4C8OA 5DS7A 4C8NA 4NYOA 3GIIA 3DI6B 4LRFA 1SJQA 4ZMMA 1X4GA 1G6BA 2HNYB 3OXGA 4JI2F 3OLAA 3HT3A 3IA0A 3GR0A 4BBYA 1GEHA 2D7SA 1NSKL 2JRSA 4QPTA 4RLEA 2YWFA 4ATNA 5CA5A 4OHYA 2HZAA 1I94J 4F67A 3ZTPA 4O3QA 3SEOA 3ZZUA 4LFCJ 4K4UA 4HACA 4K0KF 4IRKA 3GYNA 5AJ3J 3GP9A 4JV0A 1YVFA 4ZVQB 4AXIA 3SCLE 4HT7A 2AJ2A 5C42A 2XCAA 3JSYA 2KI2A 2OLWA 4FYXB 3PCOB 4F36A 3M1VA 1QAJA 2LFVA 4DV0J 4JI3F 5DG8A 2UXBJ 1N5VA 1VR6A 2QLXA 4M5IA 2YY3A 1YIJS 3MPWA 2DGQA 2K06A 4C0BA 4M5KA 1S9GB 3HFKA 1WDTA 1M5KC 1DJ0A 2HIYA 4FS1A 4X4QA 3RRHA 2B9YA 4K4YA 1ITPA 1HI1A 3ONQA 4ZPAA 3IGVA 3A3NB 2XS5A 3AB4B 3BDPA 1WG1A 1CULB 3LO3A 3EGZA 4I0WA 4X65J 2N4DA 2HFNA 5KFYA 1FXDA 3LAKA 1PC5A 4BWJA 3MR5A 1P1LA 2MHEA 1KRPA 1IN0A 1W26A 2CQ1A 3BJYA 4YB1P 2YWGA 3GILA 1SJ3P 2MKCA 2F4VJ 1IKXA 3NXZA 2EC2A 3I0SA 5ETMA 4PR6A 2YVSA 3RB0A 4DPXA 2HVDA 3MOZA 1YSJA 2V8PA 4C8ZA 3CDEA 3P5TL 1BWVA 1KDNA 2C3UA 3I5CA 3Q8YA 5ETPA 5THWA 4LMZA 1FA0A 2NPFA 5KFPA 1B4SA 4DV3F 3RZAA 1S0NA 1H74A 3U1MA 3M4XA 6FD1A 3KG1A 3A12A 2MQLA 5L8RC 2PEBA 1T9VA 2K8GA 3CCSS 1JLEB 5AT1B 2YKPA 5LSLA 3M9OB 1KC8T 3R5BA 4QWBA 1HL6A 4DDFA 1T03A 1K8AT 4B3MF 1PG5B 2JSXA 3B82A 1RQ0A 4DUZJ 4X64J 1X0FA 2HRUA 4LF7F 4FF4A 2O67A 2RQMA 5IT9U 1C1BB 1RT3A 1WSRA 3WIUA 1F5AA 1S4FA 2ZJQQ 2VODA 3BYPA 3DKDA 1NAQA 1URRA 3IMQJ 1D0EA 1OY9A 3K57A 3CTRA 3ENVA 4X4NA 2QIFA 3R7BB 5HO4A 2NYIA 2R42A 1VI7A 4UUXA 1RE1B 2VFTA 2AGQA 4QYZK 2GVDA 3M2UB 5LSRA 1WOSA 5C2CA 4QIWD 4ZCKA 2J9EA 1KLNA 2AZ1A 3BV8A 4OJHA 3DRPB 1HD1A 4GC6A 1IBMF 2QLBB 1CEZA 3T6BA 3MMBB 4UW2A 4KHPJ 2GW8A 3NLCA 1VISA 4LREA 3OBIA 1IM4A 3T1AA 4ZP9A 5GAGI 5F8HA 2W9BB 4MIBA 4ZVPB 2KFYA 1IR0A 1WOPA 5HROA 3LOUA 4OHXA 3VGTA 1R7IA 1XR7A 2QYGA 4PRFA 3NGUA 3OTDA 2VBZA 4UOCA 5B7WA 2MJNA 3TZWA 2HK3A 4LIWA 1EZZB 2XI3A 1SVDA 2EBEA 1H7XA 2FGOA 3BPDA 1YBAA 2IYIA 1RTHB 4I56A 3NOCA 5B08A 4C0OC 2CG8A 4NZ6A 2FVQA 1VHIA 4C8LA 4A8YA 1FTRA 5I3QA 1AUSL 3OTOJ 4CT9A 4NLRA 4J9RA 2WTFA 4O3SA 4PXBA 1APSA 1U1RA 2ALZA 3FZ2A 4RW8B 2HW3A 4ETXA 5GMKa 3CD6S 1RT2A 1TKZB 2IBOA 2CIMA 1RJJA 2B4UA 4LRAA 1N4LA 2FJDB 2SXLA 3BH7B 3I4HX 2PFFB 1NH8A 1WEYA 4YY3J 3JAMY 4RUHA 1SV5B 4IYQA 4DUTA 3NS7B 2E5GA 1Q82T 3UD4P 1Z1ZA 2ZOMA 5ETTA 3D66A 1AW0A 3DNCA 2JOQA 1SC4B 1WC6A 5E0OA 4GC7A 3C6TA 1LNQA 3TX0A 5L39A 3TUPA 5KT5A 2O01C 3T1HF 4DR7J 1A7GE 1QAIA 4OYAA 2BANA 3LP1B 3BZQA 4KHMA 4YR0A 4ZCIA 2VPWB 3W9JA 4DX8H 2E7WA 4NA1A 2QLFB 4R0JA 2LP4A 4ECWA 2AGPA 2XS7A 3MCOA 3V6DA 2E5JA 2Z2LA 4X4OA 3CJTA 2VBWA 4P9SA 1DURA 4WXWA 3NMAA 1B3TA 1KLMB 2DNLA 4ZN1A 2YPZA 2V9WA 3DGPB 3MPYA 4I2QA 2R7RA 5KG7A 2D74B 2FLOA 4KH0B 4PXDA 2BJDA 5F0WA 2N7CA 4X4RA 4DFKA 1LWCB 4K2XA 5FLXU 4LRDA 1VDHA 2ILYA 2ZH2A 3K0JA 5DDPC 3FBBA 4DG1B 2ZH6A 3LP0B 2R7XA 5C2GA 1Y3KA 3TZYA 3AAWB 4MJKA 2PIIA 2R7UA 1LW2A 2Z30B 3KLEA 3W7BA 3UD3P 2XEXA 3V81A 1K1SA 5GADU 2G0IA 3Q2TC 4F04B 1S72S 5L38A 5HMZA 4IG0B 5KG2A 3M6VA 4FVMA 4RW4B 2KFZA 2NXUA 4ZP7A 2ZNZA 1VQLS 2YWKA 4ZLLA 2PDAA 3O8WA 4NLVA 4Y2MA 3MDFA 3W60A 4CLZA 3OLBA 1YJNS 3HFZB 2H4WB 3OSPA 3TUJC 3W9IA 1G3OA 1Z2ZA 2WVFA 3N5BA 2BJ3A 3NGKA 4ZVTB 2W9CB 4DQQA 4LSNA 5G4DA 2JLFA 3L7PA 2KVQE 2ZHOA 4DV7F 1KP6A 5GAEI 5HJXA 2A0FB 4RW6A 2ZC4A 4GVBB 1NSQA 1QD1A 2Q3PA 5CYQA 5LOQA 1CLFA 3ZXWA 1Q79A 2Z2MA 2BJEA 5L1LA 2M3DA 1RACB 3OFHA 5KFLA 1K47A 4KGXB 2I2YA 4QR1A 1UAWA 4CP5A 4Q8EA 4B3TJ 1HBMA 3VCDA 2JVRA 2FDNA 1CJTB 3HKZD 4RUBA 5ETSA 1XC9A 1VK8A 2ROGA 4TY8B 3J7A1 1NZAA 2VD3A 4K5SA 4HTIA 4DUYJ 1F3VA 4H4OA 5EWFA 1M1KT 1P6TA 1HWIA 3MM6A 1P1TA 1C4CA 2KJVA 3L7OA 5IM0B 1VQYA 2KO1A 4WU2A 2VDIA 2ZHBA 1RYRA 1FWLA 1U7LA 4U7UD 8RUCA 3GV7B 3A13A 4G1IA 1YK9A 1YX2A 3FUYA 2NXEA 1TTHB 4IH6A 4NMXA 3DLHA 3UCUP 3MUMP 5ADZA 3IN5A 1OO0B 1ZH5A 2HYIB 1S1VA 1U2FA 1NDLA 4OMFG 2PSZA 4JI6F 3THVA 1Q81T 1N36F 2A1BA 2Y1RI 2MHNA 1HNXJ 4OZ3A 3KHGA 2DY9A 5HLFB 3CJSA 5KG3A 1FHTA 5IC6B 4DSFA 1SIZA 3M30B 3MM5B 4OI3A 3A3PB 4OFZA 5F8JA 1U0HB 2AF6A 3TOQA 5LMNF 1LWEB 4RNNA 1F1BB 2YKMB 4O44B 3S01A 2YKNB 1NNDA 3QJPA 3UE2A 2ALYB 3D3BJ 2W2QP 4NA2A 1HQEB 1G7CB 3B4MA 3UI3A 1IR1A 4A48A 1N34J 2DRBA 2UXCF 5ETVA 3QFWA 1QAXA 2XTJP 2Y0BB 4CT8A 1VLYA 5C24B 3CC4S 2QYCA 3PEHA 4NXMF 3OQ2A 3OTCA 3KUHA 2R8JA 2JLGA 5AE1A 1KFDA 1DARA 4FZVA 2JZ5A 3MWBA 1FKPB 2DR5A 2MDAA 2VG6B 3JTNA 1N5SA 3FJ2A 2XYHB 3NG8A 4RW7B 2FIUA 2BKPA 1CJKB 4QWDA 2DNKA 1LFWA 4B3OB 2HGNA 4OI2A 1Q7LB 4A8OA 2RDDA 3UDLA 3SV4A 3HJFA 2IAJB 2Y8YA 4DPUA 3DOKA 3VGVA 1B70B 3POTA 3LPYA 4RNHA 4CYUA 1S1TB 4AQYJ 1HYSB 2ROPA 2F9DA 1H7WA 3QAUA 2BZ2A 3BF4A 3V5RA 4DXLA 3FSIA 4O0NA 1IJFB 3I82A 4L3KA 3ILLA 4X66J 3PIPQ 3RTVA 2UXDJ 4C8MA 3GIKA 1W2IA 4FYDA 1K0TA 1RBAA 1OMSA 1MWZA 5HP1A 5D0GA 1FEHA 3DGVA 4IG3A 3UWTA 1U1KA 2D3O1 4YB6A 5HVGA 3MM9A 1FRHA 3WX8A 2HURA 2XCPA 4A8WA 4W92B 1NBEB 2DXEA 4WK3A 1G4CA 3NS5A 4LR7A 1BQMB 3LQVA 3OXFA 1HI0P 2ZH8A 2HHSA 3G82B 2PN6A 2QL7B 2XYPB 2DVIA 1B7FA 2F65A 2Q1LA 4ZKAA 2KVIA 4Y2CA 3HK2A 2HQDA 2YXLA 1BHNA 4OZ2A 4Y28C 2EFOA 2GMHA 2XHWA 2GIFA 5DRKA 4DPWA 5F9LA 2RH3A 2YNGA 2ZKUA 1NSPA 3CCVS 3CJ8A 3R6LB 4TU7A 3FNNA 1RT7B 4PXCA 3CUNA 2M4MA 4B02A 2LDYA 1XWLA 2DR8A 4YB5A 5A8KB 4DCJB 5KFFA 2JHEA 4NASA 4F4AA 3KK2A 1S1XA 4WE1B 2OELA 2XMTA 2D1CA 4A8XA 1NUEA 1H2VZ 3MR3A 1IQZA 4YR2A 3HT0A 3H20A 4IUFA 5LMNJ 2FUG9 4KFBA 1RWWB 2V2VA 3L95X 4O4RA 1WI8A 4C2MA 3TARA 1AZSA 2YWEA 4NPOA 3TA1A 2H51B 4I6WA 4NXNJ 2Z57B 1OY6A 1F9HA 2R8IA 1RYSA 1O51A 2CVEA 3TQEA 2CQ2A 2P9EA 1RI7A 2XS2A 3PG9A 1NDKA 4LBIA 5F3TA 3T5JA 4JI4F 3HHLB 2LVWA 2FJBB 3D28A 3MPDA 3AD9C 3QNWB 3ZTOA 4G3IA 1CQNA 1S6QB 5K8PA 1V3RA 4XPEA 3CPWR 2OTJS 4X4PA 2HHVA 2C2OB 4L3NA 3JYTB 3VAJA 1TFWA 2PGCA 4GVLA 5ETOA 3CJKA 4C48A 3ELHA 1Q95G 4NXMJ 1WKKA 1RKIA 3FVYA 4HHHA 3TX8A 5IWAF 4Q45A 1S97A 1N5YB 1BGXT 2H5EA 3PJ9A 4ZJLA 1KTVA 5DLGA 1UETA 2P2CB 2WVBA 3FSYA 3GPAA 3QSIA 3S1TA 3TW0A 5I3UB 2ZBQA 1RWUA 2VA2A 4DSIA 4LF9F 2QT7A 1EP4A 3BGUA 3MPUB 1TZ0A 2F40A 1WEXA 2FJWA 4UUWA 2EKNA 2J0QD 3EDRB 3EGVA 1DTTA 5D15A 1NRKA 1NJIT 3GJSB 5KG0A 1GMUA 5B0BA 4R5PA 4ES2A 1S9EB 4LF5F 2HHPA 2Q6BA 3D1HA 4DV6J 3MM7B 2CNLB 1URNA 1HPZA 1BQXA 2I5JB 4KY3A 4K4WA 5EX0A 2CZ9A 3D9BA 2CPHA 3R5JB 1JB0C 4LSLB 4P2SA 2FGCA 2KB2A 1RP5A 1FDNA 2YKAA 4G1PA 4EMDA 5F8IA 1FXRA 2YQ1A 5EUHA 5J2PA 4QYRA 5HI7A 2W4CA 2KL8A 1O8BA 4OX7A 1H0HB 1C1CA 4R25A 3BSNA 2VPZB 2QO3A 2XMKA 1FJGJ 3GMGA 2UU9J 4WF9Q 3OT9A 1RWVB 2DGWA 3JSMA 2ROEA 2JNJA 3VTIA 2UUBJ 1NK0A 2AEFA 1PC4A 1CG2A 3GTYX 3LPEA 1I6JA 1FDBA 1UMJA 4X84A 5GAHI 3J80Y 1N88A 2ZD1A 2E1CA 4N8OA 2AYEA 4TLQA 2J7UA 1HMVA 3ZO7A 1PAEX 5D3GB 4DR2J 2G9OA 2UU9F 3CE8A 4ILLA 1RK8A 4U67Q 2D69A 2FC8A 1RA6A 3O6QA 4HHUA 5KFVA 5DETA 2MGZA 4C8KA 2VFUA 4KRWA 1AA1B 1CQMA 5BJRA 3HVWA 5L1IA 4OLPA 4EO8A 2LEPA 4E2FB 1VQ7S 4A8FA 1JJ2R 4MKYA 3TAMB 2M5YA 1XERA 2Q79A 3GCWP 3W2VB 4OHVA 1I3OB 1U1LA 1XNRJ 2GIQA 3X3UA 3V4MA 5KFGA 1NDCA 2HBZB 4XDCA 4ZPTR 1XTZA 2NSCA 2WW4A 5KFDA 1XMBA 2ASDA 1UVJA 3JQJA 3FMWA 3RG6A 2V68A 3G6YA 4F4KA 1XMOJ 2LQ9A 1FDDA 4CLFA 4LF6F 2X1AA 4PPDA 4PPZA 3Q22A 1U09A 3W8GA 3FGVA 4RW9B 2VV5A 2HHUA 1GTEA 1HBUA 2IHR1 2BX6A 4OYWA 1FF2A 1KQSR 3B6BA 1RWXB 3DDKA 4WIQA 2HS3A 2ZWPA 4I1TA 5U47A 3SIPB 5A8WB 4URGA 1NKCA 1FE4A 3H2VE 2OPPB 4M1KA 4OI6A 4RPFA 4ED8A 1HBNA 8AT1B 2W9AA 2WB1D 4LJMA 1UP1A 2KZMA 1Y00A 4RNOA 1H38A 2IBKA 2YKQA 3R8YA 4P7TA 2IMOA 5KOWA 1UA0A 1HA1A 4U8VA 2KHCA 4ES3A 1C2PA 1SKRA 1SUQB 4IH5A 5L9XA 1Y5NB 2H65B 1RDRA 3LWMA 3M8RA 1TAUA 1HARA 1FRKA 1WSVA 1QLNA 4F7VA 3T3FA 3RJMB 1FI4A 7FD1A 2XZDB 4A8MP 1FE0A 1WHYA 3K8VA 3GU0A 1RAEB 3UDEA 1Y3JA 4LSLA 3MM8A 2CJKA 2RHSB 2COLA 2VKZG 2I5JA 4JYAF 1NJXA 3MM7A 5A6WA 3WDOA 1S9EA 4K5RA 1QDUB 2E1PA 4WP8A 4R5PB 4J9KA 5D3GA 3MAAB 2LKZA 1S6UA 2LQ8A 1UFWA 2BABA 2Y3YA 3Q2SC 1T9WA 1RTIB 4MH8A 4NCGA 3G6ES 4ZS6A 1RCXB 4ZOSA 1GAOA 3EE3A 3IXQA 3TWZA 1KN6A 2CZVC 4KGMA 5EWGA 4K4XA 3CULA 2F9JA 3HHKA 4B9MA 2GGPB 1RT5A 5JVHQ 4Y2IA 4D3HA 3RYLA 1U6FA 1JIHA 5D77A 4U6PA 3M8SA 2AWZA 2RUGA 3QATA 4ID8A 4XAKA 1N5YA 1GNKA 2CQDA 3CB4A 3HSJA 1RABB 4PABA 2CQ0A 2AIRB 3CJKB 1EIYB 4F0MA 4I2PB 3JYTA 2HWTA 1FK9B 3E01A 2HNZB 5KFAA 4CLTA 3CCMS 1VC0A 2CA9A 4ED5A 3W8PA 1RA7A 4BS2A 3FQKA 3O5TB 4DF4A 1QE1A 2CQGA 2RRNA 4CLYA 2VG7A 1TL7A 2MZJA 3GE9A 3TR5A 1RHMB 4CLWA 4ELUA 1DTQA 9RUBA 1S0OA 4YN3B 3NAIA 2ZH4A 1IXKA 2B43A 2WAQD 4LBHA 3QGGA 4P73A 4ZCLA 2W2PP 1WG4A 2DHAA 3FFIB 3ITHA 4DV1F 4K2JA 3CCTA 4DOZA 1SQGA 4OJ1A 2GMLA 4Q0BB 2EFGA 4OI4A 2KFNA 5FIIA 2R2RA 2Z2ZA 4A8SA 4H4MA 1QAYA 3AJ1A 3V6KA 2L3MA 2W4DA 1R27B 1X4HA 2V6AA 1FFGB 4P2XA 4N77A 2BMBA 4URSA 1EX8A 2KXHA 1SL2A 4R0EA 4G6VB 3R5DA 1ZA2B 3HD1A 3OV7A 3DOMA 3P45B 2N82B 2FHOB 4F3OA 3AODA 4BCAA 1YITS 2OTLS 2B5JB 4LF4J 1RT4A 4DQPA 1UCNA 1B64A 1QTMA 7AT1B 3DXSX 4MKAA 5LM7E 3CCLS 3MEGA 1CJVB 2FY8A 3QT5A 4UOFA 4ZVGA 1U2RA 2E66A 4U8YA 2OMOA 4DU8A 1N34F 1HNZF 2UXCJ 3PJXA 1WHVA 2BXJA 2BRKA 3W66A 4NZ7A 2HWIA 2RF2B 5H1SV 1R8AA 3CCES 3WC2A 4KHPF 1P8GA 5KFHA 1XQIA 3JSRA 5J2MB 4KB7A 3QT7A 4NLXA 1QY7A 5SZTA 4B08A 3GG1A 1RTJA 2CQ4A 3C15A 4ICLA 2WSCC 4D3GA 3DLEA 1MMLA 2F7VA 4LQ9A 1RU2A 3SQGB 4A46A 2XNRA 1V5VA 3L9ZA 4DF8A 5E33A 1HYSA 2HQ3A 2ZZTA 1FEEA 3GLJA 2UV8G 3VHQA 3W3SA 5LXYA 3NBPA 3I5BA 2W24A 4IR9A 3H2LA 1F3FA 5CYMA 4YHHF 1CJKA 2FJAB 3IRWP 3I5AA 2QA4G 3Q23A 4GKKF 3IR6B 1LOUA 5E5NA 1TMJA 3HLUA 3SQGA 3KLGB 3NNCA 5JJBA 4DR2F 3W5YA 2BE7D 1M5OC 3CIMA 1VLOA 2OH2A 2ADBA 3MFHA 1X5PA 5HBMA 2A2CA 4ICLB 1IBLJ 4GKJF 3ILJA 1VMBA 1VQSA 3PRDA 1N0UA 1A0OB 2ZZMA 1XEZA 4JI8J 4CTAA 4FF1A 4U7CA 1JQGA 3EPIA 1ZM9A 2CWXA 4P6QA 1K9MT 2YKNA 3PYFA 1NK5A 3A8KA 5EHHA 1SC3B 3QZ8A 1DLOA 1WC3A 1LWEA 2WHOA 1HR0J 3O3LA 2EK6A 2H9ZA 2JH3A 1U1NA 1Q4RA 1IQTA 2GQQA 1S0VA 2LA6A 3IS9A 1LW0B 2LXFA 2FTRA 1RT4B 2DK2A 2VQFJ 1RTDB 3KLIA 1VK3A 3KLIB 5RUBA 4I64A 3OFEA 4MYUA 1LW0A 3SFUA 1FXLA 4DL6A 1YRTA 1VC5A 1E6YB 3CIZA 3HM9A 2FHMA 2U1AA 1S1VB 2G13A 5C7PA 1DLOB 4KKOB 1DQ9A 2LA4A 3FZBA 3NEKA 5HVFA 5DGBA 1NK7A 2VOOA 3EXYA 2MQOA 3H5YA 2R9LA 4UTGA 3JTPA 4OYZA 1UVMA 3AFGA 3HD2A 2WONA 1N6QA 4FNHA 4O3RA 3CC7S 5D4PA 4X4TA 2HAIA 3DOLB 1NHVA 5IM0A 3CCUS 2CYYA 2J9CA 2RMLA 3EM1A 1DBDA 1FO1A 5HBMB 4Q0BA 3DDIA 4CO5A 2ZBRA 5D4OA 1OPZA 4LF6J 1D9FA 4QYZJ 4H4OB 4WKYA 3GV5B 2AKWB 2J7KA 4MKBA 1D8YA 2H48B 3VZHA 2U2FA 3M6WA 1DQAA 4DV4J 2RSQA 5D78A 1CC8A 3C8YA 2VG7B 1ULRA 3MCMA 2XULA 4NLQA 5CYMB 3UCGA 3G8SA 1QE1B 4M5NA 2APOA 4DV3J 3D1QA 3F0NA 1RHQB 1YRUA 5DM6Q 3EVWA 2XMVA 5CYQB 1NLKL 4KE5A 4GVBA 3Q8PB 1N33F 2OO4A 2J76E 1S4EA 4RW6B 1R8HA 2RQKA 3H59A 4F3MA 2WBRA 2X1BA 2Y0SD 5JUMA 3DLEB 1AXQA 5H9EK 1HW8A 4YQWA 1VQ4S 4QCLA 3C15B 1RTJB 2A10A 2F63A 4OYPA 3H98A 2ZBPA 5AE3A 5F9NA 2QG9B 1IKYA 1CJUA 1IWGA 2OEMA 2AYBA 2PI5A 4DCOB 1B99A 2D3ZA 4WZMA 4B17A 4ALZA 1VQMS 1T05B 3N9UC 2G0JA 1RADB 4IG0A 1Q16B 4YUDA 1REVB 1CJVA 1I1GA 3MEGB 3R27A 4NCGB 3W62A 5K8MA 3R97A 3Q24A 2HFZA 1KWMA 5LXRA 4ECZA 1XMQJ 4BHQA 3IM8A 2AD9A 2MLYA 3VAFA 3EVOA 3US5A 1T8EA 2KG0A 4HTJA 4Y34A 3TA2A 1L3KA 2B5JA 4Q2LA 4HT5A 3BBCA 3I96A 1LWFA 4UY8T 1SB6A 1LWCA 3A3OB 3CDBA 1KQKA 4AL5A 1FJCA 3P4UB 1P27B 2CG4A 5KT3A 3PX6A 4MIAA 5DG7A 4EZ9A 1KQGB 3DGPA 2HQFA 3RBXA 4HH1A 4K4SA 4WTOB 5KFOA 3L3CA 4CI0B 5CHCB 3V6DB 4NLDA 3HSDA 2CJXB 3M8QA 4LRCA 2XG8A 4LVOP 4WWSA 2XMAA 1C0UB 3KMQA 1K1QA 4HKQA 2RJZA 1T9YA 4RU9A 4ZITA 4OX9F 2VIHA 2R7TA 1ZOTA 2B4VA 1MG7A 3SMZA 5KG5A 2V63A 3FFIA 1NH7A 3E51A 4ILRA 1FJGF 3NKYA 3SBMA 2UP1A 2K3IA 3C19A 4AFFA 2BE9B 3QGPA 5B0AA 2AQ4A 3DC2A 4GO5X 5CH7B 1TL7B 4JI1F 1SV5A 3N28A 4PYDA 3CF5Q 1HBUB 1NHKL 4GRSA 5K14B 2W8LA 5BYSA 1ROFA 4LF8J 3E01B 1RT2B 1TKZA 2XBPA 4Q2MA 3W64A 4I2PA 4J9SA 4J9QA 4RW8A 3TEHB 3MR6A 2WSEC 1FD2A 3AD8C 1SKWA 1Y7PA 1OSDA 3ICLA 5D6GA 4LF7J 2K7JA 2LEAA 1X31C 3H0PA 2VQEJ 4FF3A 2ZITA 1U4BA 2HQCA 2E1RA 3D5MA 5IFMA 2WVCA 3HI9A 2HG4A 2IA6A 2LU2A 2XMWA 3W2VA 3MR2A 3G4SS 3G2XA 1SH2A 2ZUAA 4DS4A 2DNMA 2L9NA 3R7NB 1OQ3A 3WZ0A 1RTIA 4EK2A 3VAKA 4ECYA 1UWBA 1X9WA 3IM9A 3EPGA 2W9BA 4KPCA 2OD6A 1VBKA 3MTJA 2MGZB 3G71S 3MMBA 4IFVA 2CVIA 1F0XA 2ZH7A 1E6VB 2L9DA 2M2BA 3UVJA 3DRPA 3D1OA 3H42A 4ZVUB 5KT4A 3MM8B 1XN9A 1XR6A 2AZ3A 2Q43A 4FP9A 4F4YA 5DM7Q 1VQOS 2BQUA 4KPYA 2GVDB 1D8ZA 3M2UA 1SJRA 3TJ9A 4DN0A 1U1MA 5KG1A 3DMJA 4CLSA 4XPCA 4F2SA 4K50A 2LQJA 1IJEB 2K1RB 3DU5A 1QTNB 4WIIA 5KFZA 5KFQA 3TVKA 3GR1A 1PYTA 3MI7X 3PVXA 1C1BA 1RT3B 2UV8A 2VQEF 1W2BR 1VQKS 4ANCA 3G86A 3OVSA 4DQRA 4JV5J 1F9FA 4MK9A 2M70A 3PXGa 2A3JA 2DNZA 4DEZA 1C1CB 3QJLA 4QJVA 2W2OP 3AB2B 1RAGB 2K1RA 4A8QA 4DI6A 2AJ4A 1U25A 3DMJB 2B9XA 4JV1A 3FEZA 4KGZB 1HBNB 5GMDA 3BSOA 2DGTA 2OPPA 3MCSA 1YJRA 5A8WA 2HBQB 5AXLA 3S6EA 2XLJA 4DSEA 4M5GA 3T5HA 1E6VA 1FRLA 2ZVIA 1HPZB 3UVJB 4IFVB 4V1Ak 2H54B 3PR4A 2XQCA 3ILIA 4ED6A 2V2KA 1RXOB 3PKMA 5A2QY 5KFNA 1XMOF 2X51A 2YX1A 1FT8A 4DFMA 1Y5LB 2EKYA 1UWBB 2LXUA 3I0SB 4PAAA 2GQ2A 3QYYA 2AJFE 4OJ3A 2QMWA 3BR8A 6FDRA 2GV1A 3CJRA 1RAFB 3QZ7A 1FDAA 1RWOB 2BKOA 2NUHA 4E8UA 3VVTA 1JMTA 3SZ2A 1REGX 3VAMA 4JV5F 2CJ9A 4PG4A 4NLSA 4B3SF 2GZOA 4ZK7M 3ZC4A 2OJ3A 2R7OA 3ETOA 3FKBA 1R0BG 1Q1KA 1IBCB 3TEGA 2XZTB 4HVZA 1R8BA 4CM0A 3EDQB 5IWAJ 4X62J 3FBCA 5A2QU 4J9VA 3TVZA 2VICA 2QZ8A 1PJ7A 2B0GA 2YQ3A 4FKXA 3HF5A 1YZ7A 2BV3A 4HL9A 2C42A 2HLUA 2KT2A 4J5OA 5K14A 1NPRA 1S6QA 1O0PA 1XBWA 1NK4A 1S0MA 2N7YA 4O3OA 2B8QA 2GJFA 3HHLA 4ERDA 3M1VB 1NB2A 3QWPA 4TU9A 1PJ5A 1KHWA 2KT3A 2DHGA 3RUBL 4XIUA 2HZCA 3PR5B 3PY8A 1XJWB 5B0EA 1RHKB 1BC6A 2VH7A 3ENWA 4XTTA 4KFBB 1MWQA 1T3NA 2KZZA 3KYLA 1C0UA 3H4BA 3PYGA 3OD2A 1NJYA 3JSMB 4CNZA 3FBFA 3FCHA 3M8QB 2ZJPQ 4JYAJ 4ZVHA 3KK2B 5KAKA 5KT2A 2DTJA 3DU6A 4JI6J 1NKEA 2OI2A 1IWAA 3I31A 1RISA 3HCXA 4X65F 4X4VA 3TRGA 1R31A 1YZ6A 3ISNC 2JX2A 2BJ9A 4JI7J 4A47A 3OL6A 2I8EA 3PHTA 3M8ZA 1LWFB 2DB1A 3N4WA 5AXNA 4Y00A 2B56A 1UWAA 3M32A 2QMUB 3U1NA 4IOBA 1N36J 1KR4A 3B78A 1PCAA 1GMWA 1SC6A 1KOOA 4U95A 2ZM6J 4DLGA 1UPPA 1WHXA 1S9FA 3QSYB 1REVA 3CJ0A 3K59A 2GHVC 3HZGA 3IC1A 1ZM3A 3MM9B 3FSXA 5KFIA 1T05A 1IBKF 2R8KA 2HLTA 1FRJA 4CH0S 4CLLA 2AV5A 4IG3B 4Q5VA 2R7WA 4ECSA 2ABYA 2FLPA 3BB5A 1RGVA 5HP1B 3HPOA 4OYBA 1CJUB 1IKYB 3ZNJ1 1I94F 4CH1A 1UA1A 1TUGB 1XNQF 1UVNA 2QSWA 2W8KA 3CD5A 4DPOA 2ZJRQ 2HS4A 4DQSA 2F4FA 3L4BC 3MF5A 2MJUA 3D6MB 4RBUA 4KH1B 5F8LA 3MZIA 1X4DA 3POTB 4RZRA 2UUCF 3CJ2A 2C3YA 2HGMA 3DOKB 3KUEA 4L76A 5K20B 2R3VA 2RVJA 2VBXA 3LALA 3MPVA 4ZVOB 1NKBA 3IO1A 3PEJA 4P7VA 1ZS6A 3R7SB 1MU2A 1UL3A 3OFFA 4Q44A 2IY5B 4UZBA 4LFBJ 1KS2A 2OFHX 1WC0A 1WF1A 2OEKA 2R2SA 1R3NA 1RCOB 2DGSA 3M2RB 3NS6A 2K7KA 4NRUA 4X4SA 2PD1A 3AT1B 1AZSB 2QX0A 4L73A 3MD1A 5C24A 3K5LA 4ZIWA 2R8HA 2VOPA 1S76D 3QRQA 3TJ8A 1B0TA 3DOLA 3T5KA 3GSDA 4DMZA 4HI1A 2WONB 4QZVB 5EWEA 1N6QB 4I68A 2CADA 3HO1A 1HFEL 3ZZRA 5A8KA 3WQPA 4ZJQA 2X1GA 1M5VC 3TA0A 2CDRB 1V3ZA 3GIJA 2MZQA 2CQIA 2E1AA 2ZDOA 3LTOA 3PRBA 4KKOA 5AXKA 3SSQA 4CM2A 5A76A 1C4AA 2E5IA 1U0HA 2YNGB 1UVLA 1E6YA 4QR2A 3MM5A 3TJAA 5IV3A 3FMBA 3UNYA 1NCLA 1JLGB 1R8CA 3OR1B 2D3UA 2ZH1A 4DR1F 4EEYA 4V19J 1YJVA 1S77D 2EFNA 1RTDA 2IC3B 3C46A 2RS2A 3Q8VA 3IS9B 4P71A 4Y2AA 5HLFA 3RRKA 1Q8IA 4CZCA 1QUPA 4PWWA 1UJ4A 4LF5J 5FDLB 1OWXA 1NZ8A 1S1WB 3IAM9 2C3OA 2C28A 1Q0NA 1TL5A 4PQAA 3WC0A 1EETB 4EO6A 2HRYA 4I4BA 5CZVA 3T6JA 2NCKL 3AA9A 4O23A 4CTAB 4ED4A 4J9OA 1U6BA 1WWHA 3CW2C 3NGTA 4R8UB 3RB3A 5E3CA 4CQ1A 3KK1B 5DDOC 1YRXA 2Z2YB 2QC3A 2UUTA 2YWHA 5DQIA 2NXNA 2EK1A 3OL7A 1LXJA 1HWKA 2BJ8A 3MM6B 2X1FA 4FYVB 2PC6A 4DS5A 2CNKB 3KLGA 2ZBCA 5FJ4A 3U02A 2RRBA 3P96A 4USKA 4CH7A 2ASLA 3LANA 4FXWA 4KV8B 3RU0A 4EU0A 4TKTA 5L46A 1JJ4A 2IAJA 4DZ6A 3N5FA 3NBPB 4IO1A 3OVBA 1M1HA 2DD8S 5J1PA 5KFXA 3KKFA 3RW6A 3MEDB 1NM2A 4H4KA 2QJ3A 2VG6A 5KG4A 5C25A 3H5XA 3UCZP 1WORA 3UDVA 4DV0F 1AUDA 4JI3J 1VJWA 2RQCA 2MXYA 4LSNB 2W7PA 5F8GA 4ID5B 5T41A 2ZUGA 3CD7A 1FRIA 4F4ZA 4USVA 5B09A 2EFVA 3ULHA 5J2MA 1T7PA 4YEAA 3CDWA 2YBVA 1RHRB 2RF2A 3ET6A 2RD5C 4NLUA 3K2YA 1Q8KA 4QOTA 4ZA1A 3TNVA 5KFKA 3J81j 1YHQS 2HVEA 4JI5J 2B9WA 2F5GA 1UW4A 2GHWA 1L3VA 1IBLF 3VGSA 4LFAJ 1YJWS 5H9FJ 3Q8UA 2VPXB 3DLJA 3KJQB 2KU7A 3KLEB 3PW4A 1IBMJ 3BKUA 3M30A 2MKSA 1TKXB 3LP0A 1NK9A 5D0HA 4NZ0A 4FBTA 2J6TA 3MEEB 2B3TB 3NP5A 3LWLA 4J37A 2EFQA 4PYAA 4OZ1A 4ZPCA 3NGDA 3KLVA 4YFUA 1M1GA 1NB7A 5EN1A 3DOMB 4HR2A 2GA7A 3E3XA 2D9PA 4WU3A 2W7OA 2ZH5A 4P10A 2FPHX 1PILA 1U45A 2XMUA 2C2NA 1VQ8S 4PZVA 4DR5F 1KLMA 3AOAA 3VGUA 1ZAXA 1X5TA 2NLWA 3HHDA 4WKRA 1Y11A 2DNHA 1RU1A 4H4MB 5SUHA 2QV6A 2DR7A 1S7IA 3EICA 2ZFHA 2XGPA 3EGWB 4ZLNA 4IO9Q 2BANB 4ZVEA 5HATA 4B9LA 1HQ2A 2VZ9A 1GXUA 3C6TB 4CLUA 3ITHB 3G8QA 1HNZJ 3QWUA 4YOEA 3O44A 5J2NA 3TVYA 1N54B 2IA0A 3G9CA 1DTQB 2J7WA 3BDEA 3ZZZA 3MOJB 4YDXA 4F26A 2D9OA 1HBMB 3R1HA 3P3DA 3DHWC 1FD8A 1RLCL 4Y6IA 3VR1A 2BJ7A 2V5HG 3TQ1A 5I3PA 3C3LA 1LQ9A 5CZXA 2HNZA 1FK9A 1NXIA 1ZM4A 2F1FA 4USWA 5LL6d 4OZ0A 4WK1A 4J90A 1RTZA 4LSZB 1DFDA 3OXLA 2DH9A 1U8WA 1VQ6S 2W9CA 4DL5A 3PX4A 4FPIA 1F5CA 2WBMA 1RT5B 1S99A 2GGPA 4MYTA 2HPUA 3R5CA 2F3JA 4ECUA 3ETMA 5ETRA 5HMXA 2GC8A 4KGKA 4ZVFA 5I4MA 4FDFA 4KBIA 2HHTA 1NU4A 4HH0A 2MY7A 3EWGA 2DEJA 1X4CA 3FDSA 4EYHB 2NXJA 3MAAA 3EZOA 4DX7A 3S8SA 4L72B 3MR7A 2Z0GA 1LW2B 3GV8B 1J5EF 1VQ5S 2UUAJ 4M94A 1KNZA 3ZZ0A 4DPTA 2CUYA 2OFGX 2ZBIA 4DG1A 4DL7A 2ASJA 2QEXS 1FKOA 4LUBA 8ATCB 3KTQA 3UW1A 2HSEB 3ZNUA 3BQ2A 4EGLA 3GB0A 4IQMA 2Y1JA 5DGAA 2OD4A 2OIHA 4DFJA 4DN9A 4IQXA 3BO2A 1XIQA 2V4QA 1JX4A 4ITSA 3BBBA 3JTOA 3UO0A 5CAAA 4FPRA 1JJCB 2JJ4D 1EKSA 2AMCB 2XHCA 3CCWA 1H6KX 5DDQC 5J2QB 3AY0A 1NO8A 2KH9A 2MZ1A 1SUQA 3EUNA 4QW9A 4X2BA 3RR8A 1NHUA 4CDIA 3LP1A 2N4CA 3QGIA 3CCRS 3NY0A 2VG5A 3KJNB 5F3ZA 5E3PA 1X0PA 2KJWA 1XR5A 3VV2B 3W65A 2DNRA 2XZWA 2GFFA 4O0IA 2KTQA 5DQHA 1F2HA 2JFKA 1K73T 3R5AA 3AA8A 3OJUA 1TK8A 1O6XA 1WC5A 2V2QA 4CO3A 1S12A 2DR9A 3J7ZT 2DO4A 2FJXA 2RIJA 4OYIA 1Y5IB 2R2UA 1MN7A 2QLWA 4I67A 3NGSA 1OJ4A 4RW9A 4EZ6A 1FRXA 3C6UA 4FYYB 2V4RA 2CNNB 1KBRA 5IQQA 4DSJA 3IBFB 1ELOA 5GAHU 1CC7A 4AL7A 3HVRA 1VCTA 1BUXA 2VC1A 1ICEB 4USUA 2OUGA 2XWXA 3GJRB 4OZJA 1ZYQA 2FHJD 3E8OA 3RW7A 4USIA 3H5SA 4WBFA 3VAGA 2KM8B 4F8RA 1N52B 2DNYA 2DNGA 5F0UA 3J7Z5 1J5EJ 3G87A 3TAMA 4F25A 5CD4H 2RHQB 3BSCA 2HVHA 2QRRA 4ECQA 1ACMB 1N5TA 3J81Y 1TELA 4QIVA 5GVQA 2PMZD 2HHQA 4QPXA 2BEFA 3BGFA 4FBUA 4ED3A 5LMUJ 4GKJJ 4QWCA 1HMVB 1EB0A 3PX0A 5IOLA 2I9SA 4ED1A 1IBKJ 2ZD1B 3HSGA 4MTPA 6AT1B 3KHLA 2L9WA 1K44A 3UNGC 2ZH3A 1R0AA 1I5OB 2B8PA 4PXEA 3A8JA 4X64F 3AOCA 4OYOA 1ZM2A 4HACB 2HNDA 3FQLA 4JP8A 1FWPA 4YDDB 5EDWA 4YP3A 2H3EB 4DR4J 3TZZA 2DHXA 2QA1A 3BM7A 3QRRA 2G1HA 2QA4S 1N33J 3LAMA 1T03B 3PZPA 3RAQA 1YDLA 1SXLA 3DCAA 3F73A 3PFOA 1RWPB 2F8EX 1GFWB 1JLEA 2C3PA 4WFBQ 3G6XA 4ZLJA 4TQRA 3BKFA 2HNYA 4ES1A 3R5GA 3DI6A 4QW8A 5J2PB 1IUJA 4YS2A 4N76A 1VJQA 2HVIA 1RAHB 2O1PA 4MFBB 4OX6A 1HD0A 1D9AA 1RZMA 2ZC3A 4I6YA 2DT9A 1NEEA 2IPOB 2JFDA 3PKYA 3DFEA 2HHHJ 3I6PA 1VGYA 1EJ7L 2CPXA 4K59A 5B0CA 5HQLA 4N5SA 2OMLA 2DITA 4HLBA 5T7LB 1HHQA 1DTTB 1IKXB 4DR7F 3IP0A 3CD0A 2ACYA 3PYEA 1UKUA 4OL8A 1BD6A 1EP4B 1S6PB 4ED2A 2DRAA 4DV4F 4M8LA 4QU6A 4MK7A 2MY8A 3THTA 1CSJA 2AT1B 5I3UA 2MKIA 4LRBA 1WF2A 1F5BA 2FQQB 2VFVA 4Y65A 4ELVA 1V6HA 1CULA 1EKRA 1PSDA 1VFJA 1QVFR 4PG5A 4LFBF 3ADAC 4EBCA 1JLBA 4CRJA 2V2ZA 4Q8FA 4M5JA 5CYJA 2G0CA 5E3QA 3RRGA 4DLEA 5LMUF 1S1UA 2YKOA 2CJYB 2E1MC 1KFSA 1JXVA 2OPQA 1X9SA 2V8VA 1NDPA 1TVRA 1HNVA 1NPPA 2WOMA 3DYAA 4C7QA 4AD6A 2G1DA 1LK7A 1T0TV 2I1RA 3BN7A 4OYXA 3D6HB 2GCFA 4NEZA 4WXOA 1R43A 1U1PA 3LF0A 5C42B 3HHLC 4HDGA 4CO4A 5EGYA 3C66A 2JEJA 2E7VA 1TL4A 1YGYA 2J9DA 2X3GA 3H4DA 2QSFA 4UQTA 1TFYA 3HVTB 5LSOA 5D4LA 3IWNC 2CPDA 5DZ7A 2R4FA 3CJQA 4USHA 1RB0A 1S1XB 4WE1A 1S57A 2NZCA 1VS3A 4ZHRA 2IJRA 2DBBA 2GAHC 1P9YA 1GMWD 5F41A 4CO0A 5IXUA 1JNRB 4HEA9 2EVZA 2AW0A 2XSJA 3IRXB 1RT7A 3G8TA 1TK5A 4ZP8A 3NAHA 1ZZFA 3ISZA 3OJSA 3CCQS 1MROB 2VUGA 1FFWB 4ZCMA 5KFSA 4DR3F 1LWXA 4DR6J 4IDKB 1FVSA 3DLGB 2UVUA 4G1QA 5HVHA 1MWYA 4BLGA 2I0XA 2HHWA 4Z37A 1WACA 3M2VB 2AYGA 1M5HA 2FJEB 4Y3CA 3G82A 1FVQA 4HYKA 2MB0B 2NR0A 1OQ6A 4PQUA 2HAFA 1BQMA 3W1YC 4C0HA 2MEWA 2DHHA 1JLAB 4WCEQ 2EXUA 2MSSA 4ENOA 2HBYB 1R6VA 1GT8A 2GVZA 3EYZA 3QJJA 4H54A 2LEBA 3EX7B 1YLXA 2B6AB 1IKWA 3HZEA 3SXLA 4QU7A 3SYZA 2A2DA 4JI0J 4B9VA 3ENAA 4N47A 3RGIA 2IM0A 3A8IA 4RBVA 5KFUA 4LBPA 1C0TA 1I51B 2MYFA 2Q6CA 1SIWB 1VC6A 2CAJA 3W63A 4DV2F 4WP3A 3LGNA 3RB4A 4PWDB 1S1TA 4CYUB 2YWWA 1T94A 1GTHA 2B51A 4M5HA 2R8GA 2XWYA 1Y4ZB 1RBLA 2YH1A 1HNXF 2JDJA 3MECB 4I7FA 1SPBP 2LQ5A 1FERA 2H5JB 3PW5A 4B3OA 1SJ1A 2WSFC 4N7TA 4RW7A 2UXBF 1FKPA 1U02A 4C11B 1RHJB 2C2ZB 3MAHA 1LXNA 3W5ZA 1OY8A 1EAYC 2M8DB 1PIEA 1T9TA 1GX6A 3QIPB 4M5LA 4DQIA 4F4XA 5B0DA 3VAHA 4DWIA 2MQQA 1Z4UA 4IKAA 4WFNQ 1HQEA 3G96A 2RDJA 4CIOA 2GO9A 3TAPA 1YJUA 2ADCA 1FESA 1WOOA 2XB2D 1HWLA 3BGRB 3F44A 4JV2A 3C14A 4C98A 2E5LJ 2AGOA 3LGMA 4X66F 5L1KA 2ZE2A 3D0HE 1GK8A 1YWXA 2YKMA 2DGVA 4O44A 2NYHA 3PRVA 5IT4A 4JI2J 4TLRA 1KEKA 1H3DA 1H98A 3HSZA 4NL5A 4J9LA 4AE5A 3TUZC 3KK3A 4M63A 4WPAA 3KNAA 4DL2A 2ZKTA 1RAOA 1M5PC 1M5SA 4WTYA 1S6OA 2ZWOA 1TU0B 3NOGA 2AJ1A 2E29A 4KR0B 5G0RB 3SCKE 3GIMA 1DZ5A 4LFCF 1X9MA 5I42A 4QIFA 1EQ0A 1VRUA 5KFJA 1WF0A 4PUOA 3UPFA 3CGIA 4KO0B 2D3OR 2DPIA 2KN4A 3AH6A 3NGRA 3KJVA 1IVZA 1CS4B 2VKRA 1WEZA 3A1YG 1VBXA 2GQCA 1KQFB 4OYMA 3NL0A 5LJ5Y 2J5AA 4DV2J 4F3QA 4OHZA 4NCAA 3DN9A 3MURP 2HFUA 3JSBA 1OS5A 3VALA 3O1LA 2KXNB 2VB6A 2PO4A 3OHAA 4ZP6A 1TR0A 4TY8A 2XC9A 2BJ1A 4JB8B 2XLIA 1HHSA 1CJTA 1TKTB 2W25A 2UUBF 1OYEA 4B9UA 2KKHA 1M0SA 2FC9A 2JC0A 4RO0A 3UN5A 3H90A 2OP5A 1HNIB 1MSWD 2V8DA 3GFHA 4NXNF 4TYAA 5JMNA 1G2EA 5KFRA 4WFXA 4TQSA 1V3SA 3EXCX 2BE2A 1JKHA 3CDAA 3GYGA 4JBCA 4TVAB 3BQ0A 2RNEA 1UEKA 1YKWA 4OZLA 5BR8J 2UUCJ 4DJBA 2UUAF 4DX5A 1T3OA 3PYDA 5K5MA 3IG1B 3GONA 3T5LA 2DEIA 3W5XA 2ACMA 2UUWA 2GMJA 1WDDA 3CMES 3BEGB 1F6TA 2H1YA 1JLQB 4ZPVR 5GAEU 2DCUB 2VF3A 3D7SB 4HI2A 4DR3J 1S10A 1OPIA 3I0RB 1FKAF 4RW4A 4AYBD 2YNFA 2AHOB 3KUGA 3K5MA 2FJVA 4ETZA 2JEIA 3V81B 4IOCQ 1ZAVA 2DNPA 2QLJB 4RJVA 1TK0A 4DUYF 4RWWA 4XDDA 4LF9J 4U9RA 4J7CA 4TN2A 3M8WA 4KYZA 5BYQA 1LV5A 3Q83A 3Q8RB 3NNHA 3MUVP 2DIVA 3DM2B 1TAQA 2CPJA 2RU9A 2CQBA 2G4BA 4NYZA 4DPYA 3NWRA 4C3LA 1DRZA 4I2QB 2KG1A 3AQOA 4V19X 1WHWA 2NREA 4ZJOA 1ZA1B 5LJ3Y 3W2WA 3OUYA 1H2UX 4OV1A 2UXDF 2GJ2A 4USJC 3KG0A 3MMJA 4RU2A 3HJVA 3HKWA 1U1QA 4FXVA 1Q78A 3FCVA 1Q8LA 2RILA 4P75A 3J80U 3MTKA 1HBOA 5HK4A 2HMIB 1RT6A 4RNFA 2KXFA 1QSYA 1QSLA 2P5VA 3K17A 3H40A 1U2CA 3M6XA 4K7QA 5L1JA 3GYXB 2C1EB 2NPIA 2C3MA 2LYVA 4DR1J 4LIRA 4IRCA 2G2YA 4LR8A 2M0GB 3SSRA 3UFCX 1WTFA 3BQ1A 4Y2KA 3H2UB 2V4JA 2XI2A 2I6WA 3I56S 4FYWB 4KJIA 2DHSA 2HFVA 1HIYA 3VQSA 4L6V3 2P6SA 3I9V9 1Y9OA 1ZPVA 3J7AN 1SCJB 3H8YA 4DUZF 2W4PA 1GH8A 2CJQA 3NRBA 4B3RJ 3PW7A 2OPSB 2MKHA 2OGUA 3WIVA 4PWUA 3D68A 2F8HA 4M5MA 3T19A 1RTHA 1H2TZ 2CKWA 2DXFA 2LQBA 2RT3A 3B8HA 4OHWA 5IS2A 4DL3A 2QFJA 3FK4A 2ASYA 3K89A 4CO2A 3MEKA 2DKOB 1F60B 3M8PB 5HROB 1QSSA 3GCXP 4X4UA 3CT9A 2V8GA 2BQRA 2CPYA 2IDLA 5JVGQ 4ELTA 2YX7A 2WZ1A
chains in the Genus database with same CATH topology
3M8PA 5AE2A 5FLXY 3R1LA 3GFYA 1VRTB 2GHPA 3MD3A 2NS1B 3D54A 3DRXA 5HMWA 2M8HA 2RQ4A 2LMIA 5IT0A 2ZM6F 2JEGA 3QLHB 3PO5A 1UVIA 2L41A 4WJBA 2PA3A 1KD1T 3QAEA 1ZETA 4CCHA 4C3KA 3GWCA 4EFAC 2N3OA 3IR5B 3OTOF 5K9FA 2GIRA 2E9ZA 4LF4F 2GO8A 4I6AA 3K5NA 3DLKA 4IH7A 5DG9A 4JI7F 2RKIB 2DGXA 1S79A 1RAJA 5E3AA 2EWHA 4N56A 1X9SA 5HI7A 3K5PA 4XK8C 2Z4PA 4KHRA 4NLTA 2DH8A 4NLYA 3E2EA 3PV8A 1SL1A 2BRLA 2EW9A 3A8EA 2WRMA 4EBEA 2J0WA 4NX9A 5A0YA 4W90B 2YX4A 3DRSA 3PJWA 5KFEA 3MMAA 4F02A 3W2WB 2J8AA 2VC0A 3F41A 2VQFF 3PW0A 2EPIA 2C2RA 1SQEA 2Q66A 3ENQA 1JNZB 1WNEA 2HFOA 4OZNA 1NJWA 3I87A 4OJGA 2V9KA 3D2WA 1L3TA 2MKKA 3V4IB 5JXSA 2W7AA 3BREA 3AJ2A 1FJ7A 2POKA 1NK8A 1RT1B 1ZBTA 5A8RA 4NMLA 1S9GA 5BYRA 2BACA 2KDOA 1D1UA 1KSPA 1MMNA 2YNFB 4ZPWR 3CCJS 2IVYA 2QE5A 4X62F 1AFIA 1WI6A 3N6LA 3IAS9 3IG1A 3QIDA 2FHKA 3HX9A 1YG0A 3GZ7A 3NCQA 4TNOA 2GX8A 1SKSA 2CJAA 2JVOA 2F4VF 1TV6B 1U26A 2VFRA 1FNXH 1IKVA 3DDNA 3BO4A 1YTYA 3HDSA 4DV6F 4C8YA 4QWAA 2AYMA 4MK8A 1U47A 2YNIB 3GFXA 4DSLA 1TKTA 3SV3A 3ZFVA 2Y1IA 3LUYA 1Q53A 3I32A 2MQPA 1N5QA 2M9KA 2R2TA 3UDCA 2E5LF 3RBEA 1FJEB 4K4VA 3VAIA 2JWNA 5F8NA 3BR9A 4ECVA 2FY1A 1AROP 1GX5A 1T02A 3C2PA 2CDQA 1LFPA 1S48A 2DNQA 3MMCB 1VBYA 2L48A 3GQCA 3J7YI 4FF2A 2CQCA 1U24A 2KRRA 2FD2A 1R89A 4TXSA 2E9TA 5J1EA 3HHLD 4Z2XA 3OTBA 1QVGR 3OW2R 3OR2B 1JWWA 2M52A 4ECTA 5B0FA 3DRYA 2M88A 4Q43A 2DO0A 3MXHP 4K4TA 3NCPA 4M5DB 3PO4A 4C4WA 1ZZNA 1R8PA 1VQNS 4EYIB 2ZE2B 2AP6A 3O2IA 4BC7A 2V0NA 1HWJA 5KFBA 2XY6A 2DJWA 4AL6A 1JK9B 1VOMA 4O4GA 1TKDA 3OL8A 1JLFA 3RR7A 2BOPA 1X4FA 2FVCA 3K8WA 3QIPA 3CVKA 3GG0A 3MHYA 4LT6A 4B3RF 4Q7AA 3SFGA 3FRYA 4NYPA 2WCXA 2BQ3A 1BQNA 3I4PA 3IWLA 5KFCA 4AUKA 4UY85 1U6ZA 5K8OA 2ZDPA 2IM1A 1S7HA 1SBRA 4DV5F 3RAXA 4PWDA 1U48A 1J5OA 4PCQA 2HQIA 4K4ZA 3OPKA 2AX1A 1CPZA 2O5DA 5HQ8A 5B0GA 3CMAS 5M2PA 3D0GE 2CPFA 4KT0C 5KOXA 4FVCA 1TL3B 1UFLA 3PDNA 4B3TF 4KSEB 2IVMA 3B4DA 1TL1B 2B7CB 1TP7A 4FN5A 4IFYB 5A6PA 3X1LB 1GXLA 1X5SA 5KTQA 1BWEA 2FB0A 1D9DA 4GMKA 3N79A 4B9NA 4IFYA 2OPRA 3D0IE 3S7RA 3ZZYA 3PNIA 3J7YU 4PQUB 3BSAA 4TU8A 2CRLA 3CO9A 2YTCA 2XMMA 2CQPA 1YJTA 4F4WA 1KVIA 3Q0AA 3DLGA 4ZPBA 2E9RX 2DGUA 3DRRA 4OX8A 1HQUA 1J5OB 1MROA 3ZZTA 2YNHA 5AXMA 3UQSA 3KLHA 1FRMA 3KFWX 2XSJB 4NWBA 4ZPDA 3M6UA 1KVJA 1BQNB 2NSBA 2E5HA 4M95A 3M9MB 3KMSA 4YMEA 4EWTA 1X4AA 2K3KA 1IKVB 1CVJA 1TV6A 3K5OA 3CC2S 5DLFA 5DDRC 3KHRA 4DFPA 2JC1A 2EFPA 3OVAA 4QQBA 3MFIA 2MPUA 5KG6A 2GJIA 2AU0A 1JXEA 1TVRB 1SJ4P 2FVPA 3RBDA 1ZTTA 1Z2LA 1S1UB 5M2UA 2IFXA 3TAQA 4WYLA 2CPIA 1RT1A 5A8RB 4O3NA 3HP6A 5MLCV 3FRZA 3U1LA 4KTQA 5FD1A 1AFJA 1Y0HA 3QGHA 2OKQA 2QA2A 3V4IA 3HHEA 3BN4A 1TUVA 3LH2S 5D4NA 3H5UA 4RX6A 5J1EB 4PG6A 4CNYA 1SL0A 3SSSA 3OL9A 3IWXA 4ZDNA 2ZHAA 1BLUA 4YY3F 1U1OA 1S6PA 3BO3A 1WD6A 2MZSA 3P49B 3PHEA 1BY9A 3Q8SB 3AQPA 3KLFA 5T7LA 4EBDA 2B4PA 2CQ3A 2FVSA 4WYWA 3MMAB 3N6MA 1OIAA 4I69A 4RWXA 3VQTA 3KOAA 1DHMA 4TYBA 5A0YB 2XY5A 2EI5A 5IQ6A 2J0XA 2AX0A 2O3DA 4KIAA 4NLPA 2JEFA 4MFBA 1UJ5A 2MSTA 1YJ9S 5IT9Y 2CJBA 3SCJE 4E0DA 4IRDA 3L09A 1JLCA 1YI2S 4TY9A 2YNIA 4DL0C 5HMYA 2BM0A 3DLKB 1NJZA 1WG5A 1QUVA 3CDUA 4C3MA 2ZH9A 2C2DA 4JUZA 1HNWF 2HNDB 1JJHA 1QJHA 1UVKA 2N3LA 3KG4A 4JI8F 2KYXA 2WK4A 5DO2A 2UVRA 1R0AB 3QLHA 3ISND 4YR3A 3I55S 1LKZA 2RRAA 4A4JA 1NK6A 3CEDA 3EZUA 3QO9B 4OIXA 4RUCA 2VONA 3IR7B 4QR0A 3EZ5A 1SH0A 2VL1A 5BR8F 4DBQA 1WELA 2ZNYA 1HWUA 2HGLA 2P9GA 2HHHF 1SI9A 1FTCA 2XY7A 1A9NB 3SDEA 3VF0B 3NCRA 5E41A 3CXCR 2PE8A 3V6JA 1MW7A 2EG2A 5CCMA 4RBTA 2VFSA 2OPSA 3THPA 2DH7A 1U49A 4U7UK 1N56A 2UZAA 2L08A 2IM3A 3OHBA 3G6VA 4ECXA 3MGJA 3VZIA 5CCLA 1MNEA 2VASA 4URQU 4ECRA 3C6UB 5D8HB 3QPIA 2V94A 1ZTWA 3PACA 4PKDB 2KRBA 2MQNA 3DRSB 2CPZA 2J6SA 4MMOA 3GFZA 3LP2A 4PG7A 4XO0A 1PO6A 2OSRA 2P6TA 4KQZA 3PW2A 2FVRA 2IJFA 1RT6B 3VWSA 2NQPA 1N0VC 3LP2B 1HBOB 4AXJA 2HMIA 2ZOFA 4WFZA 2VG5B 2RKIA 4QIGA 4OI0A 3NMRA 4NCBA 4ED7A 1O5JA 2MZRA 5HL7Q 2IM2A 3QJPA 3DHXA 5J2QA 1XK8A 3OUYB 1OSCA 2HIQA 1U8SA 4RKUC 5LT5A 5IZHA 3LW5C 3Q8QB 2UVVA 4QBUA 3HMJG 3CWJA 2LDIA 2XMJA 3PFEA 4LQ3A 4O3PA 3T1YF 2MMYA 2IVFB 2ZVSA 2DIUA 1KTQA 4KAIA 3ZZPA 3DM2A 5K8NA 2EG1A 3SDEB 1VRTA 2BR0A 4N41A 2DCLA 1FKOB 2HWHA 1B0VA 2IRUA 4YB7A 3TYTA 3WBZA 1D3WA 1N48A 1PGZA 2FLLA 3QO9A 2BVZA 3I0RA 3IBWA 3N6NA 3TANA 4Y0FA 2FLNA 4DL4A 3NNAA 2QMXA 1VQPS 4B9TA 2P9CA 5L9NA 1ZPWX 3CJ4A 2D41A 2XO7A 2BDPA 3P6YC 1X4EA 1T95A 2KHDA 2AJQA 2CQHA 2MKJA 3OFGA 1XMQF 1JKHB 1K0VA 2BE2B 2WW8A 4JI0F 2V4JB 2IJNA 3KHHA 1UEUA 2BUNA 1W25A 3V6HA 3HHNB 4MAKA 3BS9A 1HNIA 5T14A 4RNMA 1JLCB 3TO8A 5DQGA 2ERRA 3PM9A 2IRXA 2BA9A 2DNNA 2OAUA 1V9OA 5J2NB 2R7SA 3RB6A 1HI8A 4WFYA 3HVAA 4CO1A 4JI5F 2RDIA 1X4BA 4OI1A 1GQEA 1GXTA 1UJ6A 2C22A 2XGQA 4KC5A 1YQHA 1X7VA 3UR0A 3KLFB 2LLZA 3EGNA 2RE1A 3FEXB 4KO0A 1L5UA 2DPJA 3DLBA 3TUIC 2HVZA 4NLWA 4ZLPA 4NLGA 2HS0A 5I42B 1MMDA 1VIOA 2PI4A 5M2RA 1Q8BA 2BW2A 4MIWA 2VBYA 4BC9A 3FEYB 3KNGA 4OZ5A 3MEEA 1A6LA 5CXTA 4DR6F 1TKXA 5KT6A 2MZTA 5AJ3F 4FNIA 2F8MA 4GO7X 1FNMA 4NOHA 5GAGU 2O66A 2LCWA 5KFWA 1KOHA 4C9DA 2PMHA 1DAXA 2GNKA 2NUUG 3BGLA 5KT7A 3BGRA 1JLQA 2R7QA 1WTBA 2CZ4A 2LXIA 2RB7A 1Q86T 4ID5A 2EBGA 2BYCA 2DGOA 2DISA 3T9ZA 4AQYF 5J1NA 1FNOA 4C11A 4BWMA 5C25B 3M05A 4FXDA 3MEDA 3MUTP 4OQJA 2ZOGA 4I7FB 1X5OA 3ZZOA 4ILMA 4H4KC 3KLHB 1FCAA 4KV8A 1DQ8A 2YNHB 2JL9A 4NLOA 3I9ZA 1HQUB 2A18A 4LVNP 3DRRB 4HDHA 4NA3A 1L3UA 5E3RA 3PIOQ 3T9NA 3K7RA 3M9NB 2E44A 3N01A 4LFAF 2EC0A 2B6AA 2PT0A 2K2PA 1X8DA 3KK1A 3JB9k 4J9NA 2RS8A 1J2VA 3DXBA 4R8UA 4A8KA 3KJVB 2OPRB 4BDPA 2BM1A 2C2EA 1L3SA 2J6UA 1LK5A 5E7OB 4PG8A 1EETA 3TI0A 2KT5A 1VRUB 4PUOB 2UVWA 2KYZA 1TL1A 2CPEA 1S1WA 1Q7YT 3OSNA 3N0VA 3KWMA 5FDLA 5G0RA 3U7JA 1M90T 1JJ2R 3OTEA 1TL3A 4FS2A 4RUAA 3HXMA 3SCIE 2MQMA 4J9PA 3M2VA 3QMQA 5C5JA 2ATLA 2IMWP 3NWGA 1R6YA 1VIXA 2IC3A 4DR4F 2ZZNA 2AJ0A 3KK3B 3OR1A 1JLGA 2V8HA 4IDKA 4IOAQ 2CFXA 1HW9A 5ITHA 1VBZA 1VQ9S 3K58A 3IRXA 1KHVA 4B9SA 2J0SD 7FDRA 5GADI 4ZHRB 2LU1A 5H9EJ 3CSKA 2XSFA 4WZQA 1UEVA 4HHJA 4DSKA 2Z8QA 2NZ4A 4ED0A 3DLLQ 4E98A 4QWEA 3HVTA 3R3TA 1F2GA 3AHPA 4EUVA 4OLOA 2DNOA 3M2RA 2RU3A 1JLFB 2YH0A 2E7XA 4IR1A 1G1XA 2M7SA 1ZAWA 4O4GB 4F2RA 1MU2B 2LECA 1RKJA 2HHXA 2WOMB 1HNVB 3DYAB 3RAMA 2IRYA 3MECA 2OPQB 3F56A 5KFTA 3H25A 1P9QC 1XNRF 1HHTP 2B7BB 2OSQA 1S49A 2PA8D 4M5DA 1SH3A 1TQLA 3SI8A 1JLBB 2JLEA 4NRTA 1C0TB 5MAOA 3CJ3A 4DHVA 5EX3A 2B4OA 5E2QA 5CQGA 1SJFA 3OR2A 2PEHA 2IYGA 2XLKA 3U27A 1IKWB 1HR0F 4C97A 1VHFA 5DJBA 1QM9A 2R7VA 2KM8C 2VA3A 3WX4A 1N32F 4WFAQ 4F50A 5KFMA 2XNQA 3CCZA 2VPYB 3MMCA 4UQGA 3V2UC 4JOUA 1N8RT 1JLAA 3UR3C 1B0PA 3MAQA 5F8MA 1KONA 2BBEA 3IGNA 3TP2A 5HN0A 4J9MA 2I38A 2ILZA 4N8NA 3M32B 3CJ5A 4LF8F 2FHJA 4G1QB 3IFEA 2J9DE 2WB4A 4QIEA 4C8OA 5DS7A 4C8NA 4NYOA 3GIIA 3DI6B 1SJQA 4ZMMA 1X4GA 1G6BA 2HNYB 3OXGA 4JI2F 3OLAA 3HT3A 3IA0A 3GR0A 4BBYA 2D7SA 2JRSA 4QPTA 4RLEA 2YWFA 4ATNA 5CA5A 4OHYA 4F67A 4O3QA 3SEOA 3ZZUA 4K4UA 4K0KF 4IRKA 3GYNA 4JV0A 1YVFA 4AXIA 3SCLE 4HT7A 5C42A 2XCAA 3JSYA 2KI2A 2OLWA 1QAJA 3M1VA 4JI3F 5DG8A 1N5VA 2QLXA 2YY3A 1YIJS 3MPWA 2DGQA 4C0BA 1S9GB 3HFKA 1M5KC 1DJ0A 4FS1A 4X4QA 3RRHA 2B9YA 4K4YA 1HI1A 3ONQA 4ZPAA 3IGVA 2XS5A 3AB4B 3BDPA 1WG1A 3LO3A 3EGZA 4I0WA 2N4DA 2HFNA 5KFYA 1FXDA 3LAKA 1PC5A 4BWJA 3MR5A 1P1LA 2MHEA 1KRPA 1IN0A 2CQ1A 3BJYA 4YB1P 2YWGA 3GILA 1SJ3P 2MKCA 1IKXA 3I0SA 4PR6A 2YVSA 3RB0A 3MOZA 1YSJA 4C8ZA 3CDEA 3P5TL 2C3UA 3I5CA 5THWA 4LMZA 1FA0A 2NPFA 5KFPA 4DV3F 3RZAA 1S0NA 3U1MA 3M4XA 6FD1A 3KG1A 2MQLA 5L8RC 2K8GA 3CCSS 1JLEB 3M9OB 2YKPA 5LSLA 1KC8T 3R5BA 4QWBA 1HL6A 4DDFA 1T03A 1K8AT 4B3MF 2JSXA 3B82A 1RQ0A 4LF7F 1X0FA 2HRUA 4FF4A 2O67A 2RQMA 1C1BB 1RT3A 1F5AA 1S4FA 2ZJQQ 2VODA 1NAQA 1URRA 1D0EA 3K57A 3CTRA 3ENVA 4X4NA 2QIFA 5HO4A 2NYIA 2AGQA 1VI7A 4UUXA 2VFTA 3M2UB 5LSRA 4QIWD 4ZCKA 2J9EA 1KLNA 4OJHA 3DRPB 1HD1A 4GC6A 1IBMF 1CEZA 3T6BA 3MMBB 4UW2A 2GW8A 3NLCA 3OBIA 1IM4A 3T1AA 4ZP9A 5GAGI 5F8HA 2W9BB 4MIBA 2KFYA 1IR0A 5HROA 3LOUA 4OHXA 1R7IA 1XR7A 4PRFA 3OTDA 4UOCA 2VBZA 5B7WA 4V19X 2MJNA 4LIWA 4LQ9A 2XI3A 2EBEA 1H7XA 2FGOA 1YBAA 2IYIA 1RTHB 4I56A 5B08A 2FVQA 4C0OC 4NZ6A 4C8LA 4A8YA 1FTRA 5I3QA 4CT9A 4NLRA 4J9RA 2WTFA 4O3SA 4PXBA 1APSA 1U1RA 2ALZA<