2H9ZA

Solution structure of hypothetical protein, hp0495 from helicobacter pylori
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLDKVVQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of hypothetical protein, HP0495 (Y495_HELPY) from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein HP0495
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04359 DUF493 Protein of unknown function (DUF493)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2h9zA01
3TUZC 2F1FA 1ZPVA 2QRRA 3IBWA 4LUBA 2NYIA 2RQMA 3AB2B 1KS2A 3W7BA 3OBIA 5FIIA 1RWUA 1U8SA 1LK7A 2PA3A 3U7JA 3ENWA 3AB4B 5T41A 2QMWA 2DT9A 4NMLA 1PSDA 3OFHA 2PC6A 3MAHA 1UJ6A 3MTJA 3CEDA 4IO1A 2H9ZA 2J0WA 2QSWA 2I9SA 3HHEA 3P96A 2J0XA 2JOQA 3OFGA 3NRBA 3OFFA 1SC6A 3TUJC 3KWMA 2FGCA 4GO7X 4X84A 2KO1A 1O8BA 2RQKA 4GMKA 3DHXA 5JJBA 1UJ5A 5IT4A 2ZHOA 3UW1A 3O1LA 3ENQA 2MDAA 2LVWA 2P9GA 1UJ4A 1YBAA 5IS2A 3L7OA 1LK5A 2DTJA 2P9CA 3LUYA 3IXQA 3N0VA 3DC2A 3K5PA 1Y7PA 2CDQA 3LOUA 4M8LA 3DDNA 3OFEA 2P9EA 1M0SA 3TUIC 2JHEA 2F8MA 4PWUA 3ENVA 3AAWB 1XTZA 1YGYA 1LKZA 4GO5X 2QMXA 3S1TA 2RE1A 2LQJA 5IT0A 3MWBA 3DHWC
chains in the Genus database with same CATH superfamily
1FDNA 2YWKA 3FCVA 2HQCA 2NS1B 4TYBA 5LXYA 1NO8A 1FRJA 4F50A 3EDQB 4LVOP 1HQUA 3EVOA 1YK9A 3LPYA 4OYPA 5IV3A 4J90A 1XQIA 4JI5J 2YH1A 2MQQA 4UY85 3A8JA 2OPQB 1RT6A 1TKXB 2QC3A 3AB2B 3LO3A 4NYPA 4DFMA 3I5CA 2HFNA 3QT5A 3CUNA 2R2UA 2XS2A 1LWFA 3LP2B 1I3OB 2B8QA 4FYVB 4WIIA 1VYAA 1RWUA 2W9BA 3MR2A 1UTAA 2XMUA 2DXDA 4O3PA 4JUZA 2R2RA 1VQ4S 4KRWA 2XMAA 3HHLC 1MWYA 3UN3A 4F7VA 2ZBIA 2NREA 1KN6A 1GXLA 2WBRA 3BZQA 3NGKA 3OHAA 2DNHA 3GFYA 2WB4A 1ZA1B 1KD1T 2W2OP 4HVZA 4D3HA 3ISND 5ETMA 1N5YB 1QAJA 2D69A 3MAHA 4MKVA 3LAKA 5FDLB 1X4CA 2H5IB 3W1YC 5B09A 3MEDA 1NDCA 2CWKA 2HVEA 2W2NP 3LALA 4A8YA 2EFQA 2JVRA 5D0EA 2CNNB 2HK3A 2MZQA 4ZCMA 1AB8A 2MQOA 2KFNA 3MAAB 2DITA 4LR9A 2V2KA 1U45A 2JC1A 2HNDA 1XC9A 4A4JA 3RUBL 4ZOSA 3US5A 3CWJA 1S12A 4RW9B 4A8MP 2DR5A 3Q2SC 3HKZD 5J2QB 2KT3A 2C2ZB 2VFTA 1LQ9A 2WOMB 5KFZA 3W8GA 2UP1A 1S1XB 3UFCX 4FKXA 2Q6BA 3M6UA 3MCSA 4P10A 3V2UC 4F4WA 2X51A 1NJZA 1RWNB 2VODA 4N8OA 4TN2A 5J2NA 1IWAA 1RAGB 2FGCA 3P4UB 2AJ4A 1WWHA 3MDFA 2JJ4D 3OR1A 3LP1A 2W8KA 1HNWJ 4GO7X 2GJIA 3QGPA 3T6JA 5KT6A 2FJWA 1K0VA 1ZM3A 1S7HA 1RAHB 2RRNA 1F0XA 2MPUA 1MMDA 5CH7B 1SQEA 4WYWA 2LYVA 3I9ZA 4N56A 3FZ2A 2Q79A 4CLWA 5JJBA 3OW2R 3D3BJ 4WCEQ 1X5PA 3ETMA 4IG0B 4KGKA 3CD5A 3AOAA 1FRHA 1JLFA 2HFZA 3M30B 4NRTA 4UOFA 1U2CA 2LFVA 4MK7A 5KFMA 5KFRA 2ZM6J 5LMNF 2YKMB 2DH9A 3NWGA 1VQ9S 2A6OA 1TKDA 4HH1A 1ACMB 1FVSA 3BBCA 3CDWA 2QJ3A 2EK1A 3KG4A 4PCQA 2M9KA 3MD3A 2W7AA 2EFVA 2GQCA 1NHVA 2H5EA 1VRUB 4PKDB 1C0UB 4WK3A 2GX8A 1NKCA 1N0VC 1TKTB 3ISNC 2CJBA 3V81B 4O0IA 2J76E 3JS9A 3CCQS 3I0RA 5ETSA 5DQGA 1FNOA 1K1QA 2NLWA 2VQEF 2V2QA 4DV3F 4MK8A 4DV0J 5F8GA 2HMIA 3LGHA 3BS9A 1X5OA 3QWPA 4AFFA 2O1PA 4DUYF 1K1SA 3ILJA 4DUZF 1YJUA 2H4YB 1S1VA 1GK8A 3CIZA 4JI8J 2ACMA 3IM8A 3MM9A 3OTEA 2YNHA 3NMRA 3POTA 4I56A 2WRMA 5H1SV 4MKAA 3SCKE 4TQSA 1CJKA 4DCJB 3PVXA 1TK0A 1FKAF 4PWWA 4IQXA 1H0HB 3JQJA 1PC5A 3CDAA 5HVHA 3PR5B 2FVSA 2I8EA 4M5LA 2XSFA 1T03B 3EXYA 2HHUA 3MZIA 2IVMA 4YDDB 4OHXA 4RNNA 4IR1A 1Y4ZB 1PYOB 2LQJA 2ZITA 5IM0B 1J2VA 1ZM9A 3BDEA 4DS5A 2F1FA 4BC7A 4QIGA 5KFVA 2IA6A 4W92B 3CCSS 3IBWA 1VRTB 4ZPWR 3CJTA 3V6HA 2DRBA 1KNZA 2DIUA 1KSPA 4TU7A 1GX6A 1UETA 3N79A 2ABYA 2DBBA 1YQHA 3J80U 4B3MF 2FHOB 4WXOA 2GJ2A 2H65B 4WFYA 1SJ1A 2Q66A 1WNEA 3CE8A 1MN7A 5FIIA 2OAUA 5DDQC 4K4ZA 4KFBA 2QO3A 2FY8A 4JI7J 2JEIA 1T3NA 1FD2A 4LQ9A 4ELVA 1BHNA 4ID5B 2B7BB 4NMLA 3M32B 2DNKA 1PSDA 4RKUC 1J5OA 4O44B 1VC0A 1Y0HA 1S7IA 4O23A 4DBQA 5A8KB 1RAEB 2RSQA 1JX4A 4IDKA 1KRPA 1VC6A 2YH0A 3HM9A 1RTDA 2P5VA 2DXEA 4JI3F 3JSMB 4NYOA 4DV3J 3AA8A 2UV8A 4USIA 4DPUA 3BPSP 5E3RA 3QQCD 3DLHA 2IJFA 4DUZJ 4ECSA 2M52A 1FNXH 1HNXJ 4C7QA 1HWJA 1PAEX 3PTWA 4EFAC 1R27B 5CYJA 2NZ4A 2A2DA 2NXJA 2E1RA 2B9YA 4ETXA 3VGVA 4N41A 3T41A 4LRFA 3D54A 8ATCB 4EZ9A 4LFAF 2OD4A 3LF0A 4CZCA 1F2GA 4USTA 5A2QY 5LT5A 2MSTA 2ZC3A 3IO1A 2ZBPA 5U47A 2CVEA 1SQGA 1S9GB 3WIUA 4E8UA 5HBMB 1NK5A 1TU0B 4DR4F 1RE1B 4WZMA 3P49B 4DQQA 3J81j 2J9CA 5F41A 3ONQA 2VA3A 2DYAA 2P6TA 1REVA 3GWCA 2QX0A 3K57A 3R9LA 1V5IB 2ZBRA 2B5JB 2ZHOA 4QWDA 1SJRA 3CDUA 3O1LA 4YFUA 4FF3A 4E2FB 1LNQA 4UOCA 2A18A 3CCTA 2IRXA 4RL1A 1KQKA 2KVQE 2H51B 1FEHA 2EW9A 2XMMA 3BGOP 5MLCV 4IRCA 2YWWA 3HJVA 3GYNA 1PILA 2VQEJ 1HD1A 5M2PA 1ZAWA 2DHXA 3IRXB 1SJQA 3PZPA 4F2SA 1ZM2A 4QWEA 5IFMA 1LW0A 1EQMA 4FS2A 1XMBA 1AUDA 2IC3A 2ZH4A 5G0RA 3SQGB 2VG5B 2I5JB 1OS5A 4QPXA 2W8LA 1HNZF 1T9YA 3D4JA 4DSIA 1CJVB 2BZ2A 4NA2A 4MH8A 3SCIE 1JNZB 3THPA 5LOQA 3GU0A 1RB0A 4LBIA 4BWJA 2UUBJ 4CLLA 4K0KF 4K8RA 4ZVQB 3ZZOA 4B9LA 4R8UA 4DMZA 1T9UA 4MKBA 1VQPS 4K5SA 2NPFA 2M8HA 2JHEA 4ANEA 5C7PA 3J7YU 3JYTB 2W9CB 2R42A 2JFKA 1C1BA 4K5RA 1TKZB 4XK8C 3KMSA 4DR2F 4X2BA 3BSNA 3HF5A 2CG8A 2HNZA 1M5PC 2A10A 5A8WA 3Q8UA 2DD8S 1J5EJ 5E3AA 5B0GA 2KZZA 1UP1A 2QRRA 3HCXA 3MECA 3RBEA 1IR2A 4OQJA 3NCPA 1T0TV 3JTNA 4Z37A 3J81U 4LUBA 3IGVA 2MZRA 5THWA 3HJFA 2UXCF 1DURA 1U0SA 4RNFA 4O3SA 1RU1A 2KH9A 2RQMA 4HT5A 3TA2A 1XMQF 4JI4F 2RD5C 3A8IA 1NJXA 3Q8QB 4FF1A 4RW6B 2MSSA 2FHJA 1VJQA 2C2EA 3MPWA 5BYRA 1SIWB 4LF2A 4CCHA 2B0GA 5HLFA 3TI0A 4EBDA 1N5QA 4DL5A 2FLLA 2FLNA 5KFGA 2VHGA 3GJSB 2V2VA 1AROP 3THTA 3TVKA 4TU8A 5J1EA 1WHWA 3D5MA 3GFHA 3OJSA 2QN6B 4RNHA 1KVKA 1P9YA 1SCJB 2GQ2A 3MOJB 3UN5A 4PYAA 3FEYB 1SJ3P 1N6QA 3LW5C 3EVWA 3C16A 3BR9A 4DUTA 3TZZA 3OSPA 3T3FA 4F26A 1LWXA 1RKIA 3QLHA 1X4HA 5E5NA 3KHHA 2ZH9A 3B4MA 2JWNA 3GJQB 2R7TA 3L9ZA 1YRXA 5HVGA 3MM6A 3H40A 2AGQA 4DFJA 3UCGA 4B3RJ 2XNQA 4KAIA 5EDWA 5D4LA 1UEVA 5KFCA 4EBEA 3IM9A 4KH1B 5M2UA 1C2PA 3T5LA 1I51B 4WE1B 5DS7A 2LXFA 3KLEB 1AZSA 1N54B 1S97A 3EGVA 3HHNB 1H74A 4X4PA 3RTVA 2K3IA 4LF4J 1RU2A 3BKFA 5KFEA 1SUQA 3RJMB 3LAMA 3OT9A 2IFXA 4ZPVR 2VH7A 3HFKA 2FLOA 2XZWA 3NEKA 2D9PA 3GILA 1VBYA 4JI0F 2VC0A 2DGOA 2IRYA 2YNGB 4AL5A 3QPIA 3DMJA 2WONA 2W4PA 3PYDA 1MROA 2CUYA 4IFYB 2RVJA 1NKEA 2KO1A 2QLXA 1VMBA 2IMOA 3IMQJ 3T1AA 4WTOB 1W2BR 1KP6A 4EWTA 5DQIA 4NLVA 3MPYA 3I82A 1VHIA 1JQGA 1U1RA 1NRKA 1HPZB 1NM2A 3M2VB 2X1FA 1ICEB 3MMBB 4ZDNA 2R8IA 1X9SA 4QYZJ 4FN5A 2UZAA 4MK9A 3BKUA 1DQ9A 3HDSA 1VISA 1DTQB 1OSDA 3W9JA 1IUJA 4I4BA 2IM2A 3HZEA 3UNGC 2BDPA 2MKYA 3MPVA 2VFUA 3K17A 1QAIA 2AP6A 2AKWB 3CNQP 3DI6B 4DV5J 3MFHA 1IBLJ 1ZZFA 2QIFA 4KBIA 2X1BA 5ETTA 5A6PA 1R8CA 1Z2LA 3TVYA 4RU9A 2L9NA 2ZHAA 1NK8A 3HLUA 3LWMA 3OPKA 3K5PA 1KQGB 3IA0A 1ZH5A 2UVUA 4Y6IA 3TJ9A 3M9MB 1X9WA 3PY8A 4ZCLA 5LM7E 2NXCA 5HP1B 2LU1A 2V34A 2IDEA 3CJQA 1XN9A 3DRSB 4P7TA 3CCES 4P2SA 5IT9Y 4CLZA 1SV5B 3UQSA 1P6TA 2OP5A 5CYQA 2O66A 2Y1LB 3HT3A 3M6WA 1JLCB 5A0YA 4ZVTB 3IRWP 4LF8F 2XCAA 4DSEA 4YHHJ 2XLIA 1U2RA 4FPRA 4WFZA 2GIRA 1Q8LA 5DG8A 2AZ3A 2H1YA 2EVZA 4OYWA 3J7AN 1JLBA 3E01A 2E5LF 4JI1J 2WVFA 2YKOA 3FBBA 2OMLA 4GO5X 3FRYA 4KSEB 4YMEA 2QL9B 2RKIB 1JJ4A 2KDOA 2OKQA 4B3SJ 3KK2A 4J9SA 3DHWC 3ICLA 3ILOA 1ROFA 1RI7A 3AT1B 2R2SA 2BM1A 3DLEA 1C1CB 1FDAA 3F56A 5EX0A 2VASA 2Z56B 1VBXA 3NNAA 3G82B 5HL7Q 2OPRA 1K47A 1QVGR 1RWOB 4Y2IA 4CLTA 4L75A 3KXDA 1N32J 2R4FA 4Q8EA 4B9VA 2C22A 5KOXA 1CJTA 1R8AA 3M05A 3PACA 2KRRA 4WFNQ 3OLAA 2ZH7A 4NXNF 2L41A 2KXNB 3JSYA 3CF5Q 2VICA 2FJXA 2GA7A 2AJQA 3W7BA 1RT3B 2DEIA 1NMEB 2Y0SD 3FDSA 1TV6B 1SH3A 2WCXA 2MXYA 3DOMA 3R1LA 1CULB 3PCOB 1RTJA 5M2RA 1U0HB 2FHJD 4Q44A 2HZCA 2XYHB 2E1AA 1N88A 1SVDA 1S76D 5GAEI 4KT0C 3AD7C 2MLXA 1PJ6A 3AJ2A 2XSJB 1PCAA 2EXUA 4L72B 3TO8A 1GH8A 2ZUGA 4EO8A 4ZP7A 2ZOMA 2ZWPA 4C6AA 5KFPA 3UVJA 3CJKA 3JXOA 2DEJA 2WK4A 3LGNA 4DPWA 4KYZA 2D7SA 2HIQA 3GFZA 4DPYA 2KM8B 3HVRA 2DPJA 2WHOA 1OY8A 3S8SA 1N48A 2HFVA 4EUVA 1F2HA 2LEPA 1MU2B 3P96A 3UCUP 1XNQF 2C2MB 2VFRA 2YKQA 4FKYA 4DPOA 2KJVA 3PW2A 2MKSA 3IS9B 4YDXA 3BQ0A 4ECUA 3U02A 1VLOA 2Z8QA 1TVRB 3PFOA 3Q8YA 2QA2A 2O5DA 3MR6A 4LF9F 4RW7B 3VAIA 2EFGA 4PEOA 1RYSA 4C4WA 3W66A 4ZITA 4WWSA 2ZNZA 4C8YA 4OYAA 4ED5A 1Y3KA 3W60A 2HGMA 3G71S 5LXRA 1S1UB 5LJ5Y 1J5EF 2Y8WA 3QFHA 1FE0A 1NPRA 4PAAA 1CG2A 2K06A 1S0VA 3FC9A 3HD2A 2VIHA 4BHQA 3D6HB 4C48A 4DV6J 5AJ3F 2BE7D 4MIAA 3TWZA 1WEXA 1ZBTA 4OHWA 1RHJB 3KDOA 3QGHA 5IXUA 3UWTA 5IT4A 4RW8A 2W4CA 4USKA 5F8MA 4ER8A 3VAKA 1NH8A 2UUAJ 1AFJA 2DIVA 2R7XA 4OHYA 4V19X 4M5KA 1RTIA 3SDEA 1KVJA 5A6WA 3DFEA 4C8OA 2HRUA 4W4MA 3CCLS 1R89A 5FJ4A 1SC1B 3E3XA 1SQFA 1Y5LB 4NA1A 4RBUA 4RJVA 1NSQA 5EWGA 2ZM6F 1N5VA 2DNZA 3G86A 3CCMS 4J9PA 4LF8J 2NCKL 2VB6A 3H5SA 1HWIA 3CTRA 3H2VE 1VGYA 2CWXA 2AZ1A 2OI2A 1DQ8A 3KG0A 2R7UA 4OI6A 2HHQA 3HHDA 4K4XA 2IM0A 2QL5B 3LOUA 3MCOA 3WX8A 1YTYA 3A3PB 3D1QA 3M8QB 3CC7S 4B3RF 2OPSB 2GW8A 1OSCA 4OIXA 4OZLA 1RWKB 4B3SF 3PIOQ 2PE8A 1S5ZA 1WDDA 3PHEA 5KT2A 4O3RA 2X7IA 1JKHB 4ECWA 3MEEA 1VBKA 5I3QA 1S10A 5EUHA 4ECXA 4K59A 3QT6A 2VKRA 5F9NA 2UU9F 1YGYA 2Z2LA 4WFBQ 4GKKJ 4K4SA 1FX2A 1SH2A 4USWA 1O51A 4DQSA 3HULA 2D41A 2DHHA 4DG1A 2MKJA 2VBZA 2MGZA 5L1JA 3DOLA 5J2PB 2BANB 2KRBA 4U96A 1ELOA 5K14A 1BE4A 1ITPA 1TVRA 3EICA 4HDGA 1VLYA 2LECA 2HHHJ 3X1LB 2HGNA 1EARA 2JX2A 4WP9A 4DFKA 5B7WA 1AW0A 1EB0A 1NU4A 4C2MA 4I7FA 4ICLB 4YY3J 1B3TA 3ZZTA 4LF5J 1CLFA 2BYCA 1FDDA 4S0MA 1S9FA 1SJFA 2HFUA 2FHKA 2G2YA 4I0WA 2GIQA 3BGLA 5HVFA 4X4SA 1XERA 4DCOB 4LFBF 4IKAA 1S79A 4CLSA 5MAOA 4ETZA 2OTLS 3NOCA 4J9KA 4J37A 1IKWA 2HS3A 1RGVA 4U67Q 2OMOA 3F44A 1Q5VA 4LJMA 1IXKA 1XR5A 1QTMA 3V6KA 3HSZA 3H42A 1Q81T 4B3MJ 3M8PB 4KKOB 2XQCA 3SSSA 1OIAA 4DL4A 3M8YA 2CZ4A 2E29A 2HNYB 3DNCA 2RHQB 1RAOA 5B0CA 2QLFB 2F63A 2JH3A 4KQZA 4P6QA 1N0UA 2YPZA 1RTHB 4V1Ak 4LR8A 1N34J 2OSQA 1Q78A 4UW2A 1MNEA 1ZM4A 1RTJB 3K8WA 5IWAF 2DRAA 1A0OB 2RQCA 2I9SA 2IHR1 1KHWA 4HT7A 4N5SA 3FMBA 4DV1J 1MWQA 1FFGB 2AX1A 2QLWA 4J91A 4BDPA 2NXEA 1RT4B 2E1MC 2LQ5A 3I9V9 4YHHF 1QAYA 2NR0A 3QRQA 1N52B 2HHXA 3NXZA 2GAGC 2YWGA 3DRXA 4WU2A 4DX5A 3G82A 4CLYA 2IMWP 5J2MA 3KJNB 5HQLA 1J27A 2ZH3A 2MYFA 4J9QA 1FK9A 2BQ3A 1D9AA 1NXIA 2XZTB 1UAWA 1VOMA 1X4EA 3K89A 5EGYA 4A8SA 1P1LA 4BCAA 1NK7A 1NPKA 2RKIA 1QM9A 2OUGA 1CS4B 3GG1A 1TQLA 2AEMA 2M4MA 2PT0A 4URSA 4U8VA 3ZZ0A 1Y11A 1FK9B 1WC1A 4JP8A 4IRKA 9ATCB 3TZWA 3W5ZA 3UDEA 1VQ5S 4LMZA 1RSCA 2E9ZA 2HHHF 3ZO7A 2DRDA 2HAFA 4DL3A 3LGMA 3RYLA 5HQ8A 1VQ6S 3D3CJ 2CQDA 4P2XA 5LSRA 2C3OA 2RS8A 2ZJPQ 3R3TA 3KHRA 3O8WA 3G6VA 2HHPA 1T11A 2LU2A 2FLPA 2G1DA 1QJHA 1H98A 2J9DA 2FJDB 4ZJQA 1NBEB 3R7NB 1TTHB 4QIFA 1HL6A 2Z0GA 5RUBA 4ZCKA 2IA0A 2FYXA 1WKJA 3DLGB 3CVKA 2VU5A 3VR1A 2HNYA 4ZVUB 5A2QU 1O5JA 1S4FA 1LFWA 1YJTA 3M8PA 4KKOA 4OI3A 1JXLA 2Y9HA 1G2EA 3IP0A 2DHSA 3DI6A 1TK8A 2Z2YB 3G2XA 1MW7A 2Z30B 1IKWB 2JFDA 3PEJA 1JJCB 5F0WA 3W63A 4ES3A 3J80Y 2XWXA 3SCJE 1CEZA 3PV8A 2GO9A 3QIDA 4URGA 4UQTA 4NZ7A 2W01A 1Y5IB 3CO0P 3KLIB 1Z1ZA 1WHXA 2HVDA 4DL2A 1R8HA 3E51A 1IVZA 3MMBA 3Q8SB 4JYAJ 2ACYA 1IQTA 4CTAA 4G65A 4PG4A 5K14B 4FYWB 4C3KA 5KFBA 2AYEA 5A8RB 3AXKA 1JLQA 3O6QA 3GPAA 4LSNB 2E7WA 4DG1B 2MGZB 5J2PA 4U6PA 2CQ2A 3A8EA 3DMJB 3C3LA 3KMQA 4WKRA 3R5DA 4LF5F 2GVZB 3R5CA 2RJZA 2QSFA 5CZVA 8RUCA 3I0SB 1HYSA 3TYTA 4JI0J 1CJUA 1FA0A 2Z4PA 3CJRA 1U49A 3GFXA 1O6XA 2BR0A 2VV5A 4FNIA 1Q4RA 2PGCA 3CCJS 2CADA 4CDIA 4WU3A 3CGIA 1KFDA 1Y00A 2LP4A 2EG2A 3NAIA 4ZPCA 2AYGA 1TZ0A 1YLXA 3D0HE 1RLCL 4WP3A 2OPSA 4WYLA 1R6YA 4HYKA 3M8QA 4R25A 4OYBA 4RW4A 3QLHB 2WTFA 3ZC4A 1QLNA 4M5MA 2UXDJ 2AYMA 2NXUA 3R27A 2B43A 2HQFA 2DGWA 2CQ4A 3N5BA 4NI2B 4I1TA 5E7OB 4O3OA 2PC6A 2XG8A 2HZVA 4FYDA 1D3WA 2PDAA 1AXQA 3D67A 3CEDA 3M2RA 5KG3A 4IO1A 4OI0A 3NG8A 4PWDA 3GR1A 2R7OA 5HLFB 3IR6B 1RTIB 2ROPA 3SDEB 1EHWA 4NA3A 4X62J 3BO4A 3UNYA 3B4DA 2AMCB 1WHVA 2Q1LA 1HHTP 1YKWA 2VJVA 1X8DA 1Q7YT 2OPPB 3M8SA 1XNRF 2E5JA 4M5HA 3A3NB 1T95A 4OZ3A 1HR0J 2DNPA 4X4NA 1X4AA 3OFGA 3M2UB 4CWBA 5HO4A 3FUYA 2MY8A 1FKPA 2DNQA 3OL9A 2HW3A 1SJ4P 3TX8A 1AFIA 3Q83A 5C24B 3GB0A 1FJCA 1S1UA 1LXJA 3FVYA 1Q82T 1EETA 2U2FA 3MCNA 4HR2A 4NLUA 3TOQA 4QU6A 1RHQB 3H2UB 3H5UA 3PRDA 2VFSA 3R97A 3RB6A 3OVBA 3KLHB 1SPBP 2UUWA 2ZVIA 4MFBA 2KZMA 2VBYA 2BABA 4L74A 5CD4A 3MM8B 2XS7A 2RH3A 1TL3A 2BJ3A 3H59A 4G1IA 2ASJA 2RILA 3W2VA 2GS8A 2HS0A 4R8UB 4Q2LA 4OZNA 1W7WA 4OI2A 3PX6A 4KGMA 2K3KA 3HT0A 1YG0A 1WKKA 3G8SA 2PMZD 4YR2A 5L9NA 3EZ5A 2BUNA 3RBZA 3KLVA 3GTYX 2AYBA 2CQ0A 3DLJA 5T7LA 3CC4S 2I5JA 2Y1RI 5DLFA 1WSVA 1FI4A 3GIJA 4JBCA 4P74A 4HI1A 1U8WA 4HDHA 2MKIA 2RS2A 4ECTA 3U1NA 2EI5A 2BOAA 1H7XA 3N0VA 3VGUA 1NK9A 4C0HA 3C14B 4DL6A 3IRXA 1VI7A 3MMJA 4ECRA 1WEYA 4QZVB 2GVDB 3KUEA 1EAYC 2J6TA 3W9HA 1KTVA 4FVMA 3NP5A 1Q86T 4JI3J 1RAIB 2BV3A 5HK4A 1TV6A 4UUXA 3FCHA 5KFLA 3BBFA 1NJWA 1DAXA 5KFSA 5BR8F 3NGUA 3HP6A 1M5KC 1P27B 3C6UB 5L39A 3OL8A 3MAQA 2ZZTA 4Y2MA 4ES2A 4X66J 3H8YA 4DXLA 5GAEU 1YI2S 4ANDA 1VQMS 4XAKA 2B8PA 4Q7AA 3K5NA 1RYRA 1OMSA 4DQIA 4PWUA 5B0AA 3ENVA 5C5JA 3WC2A 2CPIA 2XLJA 2QG9B 3DLEB 4LBHA 5AXKA 3MR3A 4ZK7M 1VQLS 4B9UA 3AXMA 2FTRA 1LXNA 3MD1A 2F5GA 4DJBA 1N5TA 1RBAA 2CNKB 2CPJA 2OH2A 4G1QB 2VOOA 1S6QA 1IJEB 4W90B 2F7VA 1RHRB 1S59A 4YB6A 2EG1A 3F73A 2HHSA 2MQ8A 4EYIB 2DO4A 2HEKA 1E6VA 4JB8B 2XTJP 2B9EA 3CJ8A 4AYBD 1ZA2B 3MEKA 1F5AA 2BW2A 5CYQB 4LF9J 5F8NA 2CVIA 1YBTA 2GHPA 3A13A 2O3DA 4M5GA 2AGOA 4LRBA 4UY8T 2DH8A 4ELTA 2VL1A 1WF1A 3MCMA 3PIPQ 1KLMB 4RPFA 1U6ZA 4F3QA 1RTDB 5CQGA 2BOPA 1N32F 2P6SA 7AT1B 3RB0A 1ZTWA 3CD0A 3AY0A 4NLPA 4DQRA 4IR9A 1Q8BA 3VQTA 1RLDA 2N3OA 3CJSA 3ADAC 3BF4A 4F36A 5EWEA 2GAHC 2ZEJA 3T6BA 3GV8B 1XNRJ 3BGFA 2V8DA 2VKZG 4R5PA 1OJ4A 3N4WA 4TVAB 3G6ES 4QYZK 9RUBA 4U7UK 3C15A 4C8MA 4CO5A 4QIWD 2XB2D 1PC4A 2QSWA 4J5OA 4DV0F 4JI6J 2ZDPA 4JV5J 3NCQA 1NSPA 4TLRA 3S01A 2OD6A 1FD8A 5DQHA 1DTQA 2E5HA 3R5AA 4X4VA 4KY3A 4AD6A 3FZBA 3AA9A 3PNIA 3R5GA 1NHKL 4X64F 3NLCA 1S6QB 2W24A 4WPAA 5IC6B 3VWSA 5EWFA 1I94J 2EWHA 3W61A 5E3QA 4LQ3A 3HXMA 1H3DA 3L09A 1WTBA 2RNEA 1BWEA 1KFSA 5C25B 1IQZA 1GNKA 1WOOA 4F0HA 4DR2J 1MROB 3ET6B 3VGTA 1WC0A 2J7WA 5CAAA 4IUFA 4B9SA 1FXLA 3W5YA 4PXBA 5IM0A 4CO1A 5JVGQ 2MJNA 2L08A 2CPDA 1HBOA 2KL8A 3SI8A 1SL2A 2FVRA 4O0NA 4F25A 4X4UA 1DQAA 3GCWP 3K5MA 1O8BA 1TR0A 3K8VA 4P52A 4EU0A 5KT7A 1EP4A 5H9FK 1IM4A 5DRKA 5K9FA 1AZSB 4YN3B 2OLWA 2KB2A 2WB1D 3R7BB 1D0EA 5E3PA 2N4CA 4LFCJ 2MDAA 3K58A 2LVWA 2KYZA 2P9GA 1OYEA 3IN5A 2DHAA 4PXDA 1QVFR 4DV6F 4FBUA 2BA9A 3AQOA 4F0KA 1PBUA 2PI4A 1Y5NB 3SSRA 3QJLA 3KFWX 1HBUA 4P72A 3ZZYA 2DNNA 2P2CB 3BYRA 4ZP8A 1QAXA 4WFAQ 4NLDA 2QA4S 2OEMA 3PJXA 3GR0A 4X66F 5B08A 2POKA 3FJ2A 1VQYA 2MMYA 2RB7A 2R7QA 2WVDA 3U27A 2MLZA 1TL3B 2GMJA 2LLZA 3MM8A 5ETOA 1RWXB 3NGSA 4MFBB 1RQ0A 3KLHA 2J6SA 2ZJRQ 3ZXWA 4DR5J 2AHOB 4RO0A 3ZNJ1 1FF2A 3UO0A 3OUYB 1I94F 1HNXF 4KTQA 1FEEA 2ZH1A 3OFEA 5KFJA 2B3TB 4NLYA 3IAM9 4CRJA 5C24A 1HNZJ 2V9WA 1WEZA 3CO9A 3FQLA 3MF5A 5F3TA 3VVTA 2FVPA 4BS2A 3MECB 4KB7A 3BM7A 1TUGB 2COLA 1HA1A 1LKZA 2CRLA 3M2UA 2E9RX 1Y9OA 4NLSA 3IAS9 1L3VA 1M5VC 2M3DA 3TAQA 3LP1B 3OR1B 4AE5A 3KNAA 1FRIA 5A8WB 2JLGA 3QSYB 1EQ0A 2MKHA 4HLBA 3OUYA 2IYIA 1TKZA 2Q6CA 5SZTA 1Y3JA 3TEHB 2AD9A 2EC0A 4N47A 1WORA 3NS7B 2B4OA 4LREA 2OIHA 1KR4A 1BLUA 4KGVB 4FXWA 2BE9B 2FDNA 2ZUAA 3GIIA 5J2QA 2LXUA 4QWBA 4GKKF 3M2RB 4Z7CA 1V5VA 4XDDA 2D3ZA 4PWDB 3JTPA 4ZMMA 5DDOC 3JTOA 3R6GB 7FD1A 5HSPA 2KN4A 1X5TA 3HVAA 3IFEA 1YJVA 2V8HA 2A3JA 2KT2A 3IBCB 1U09A 3OBIA 2VJUA 4NI2A 1SI9A 1U8SA 3DDKA 1GAOA 2GO8A 3PJ9A 5LSOA 4DF8A 3CULA 2PFDA 3O5TB 1HBUB 3AJ1A 4NLOA 1VQNS 2HBYB 2XULA 5LJ3Y 2J6UA 3H7HB 3RGIA 5KG5A 1R0BG 2VG5A 3MEDB 1BQXA 2A1BA 2B7CB 3Q89A 4J9UE 4RW4B 4ATNA 5D78A 3TZXA 1LW0B 1VHFA 3BR8A 2C28A 5IZHA 3G9CA 2R7SA 3Q8PB 4XDCA 1UJ6A 2DPIA 1EZZB 2MZJA 1RCXB 4LBPA 2Z58B 4J7CA 1RADB 4NCBA 1YX2A 4YS2A 3T1HF 1DFDA 3I4HX 2WVCA 4O4RA 1CSJA 1EP4B 2DO0A 3N9UC 4TYAA 3HHEA 1CJUB 3DCAA 4I6YA 4C0OC 4F0MA 3I0SA 2Y0BB 2ZHBA 3EXCX 2Y1JA 2C1EB 5L1LA 2XMWA 1RWWB 1HBOB 2UXBJ 2B5JA 2FJBB 1RT6B 2GVZA 3Q86A 1QTNB 4G6VB 4DV2J 2NYHA 4OI1A 2W25A 3PO4A 5EX3A 3IR7B 4EGLA 1APSA 3B8HA 1WKLA 3ET6A 2FC8A 4ZCIA 1HQUB 1FWLA 2DNMA 3NRBA 1JLQB 4LSNA 2Q43A 4MMOA 1S49A 4NLXA 2M7SA 5A8RA 5C25A 7FDRA 2UVVA 1GMUA 2Y3YA 4NZ6A 4C97A 2YY3A 2E7VA 1ZETA 4Z2XA 5CABA 3OR2B 3RB4A 2DNYA 2BKPA 3SQOP 3GMGA 2DXFA 3GCXP 4WFXA 5GMKa 1YBUA 2JLFA 1AA1B 1YVFA 3KLIA 1KONA 2H48B 4ZPBA 2GMLA 1V3RA 3CXCR 1UVNA 2ZDOA 2V4RA 2ADBA 4GMKA 1FTCA 1RHMB 2DGUA 3M4XA 1OPZA 1LFPA 2WZ1A 2E9TA 4YP3A 1IBKF 1B7YB 3C15B 1NPPA 2VC1A 3UW1A 3W9IA 2H3EB 3FBFA 5J1PA 4R5PB 3G6XA 1HW8A 1XEZA 4WK1A 4DU8A 2DKOB 3QATA 1REGX 4NEZA 3AHPA 2UUCJ 3DLGA 4ZJOA 4RWWA 4CNZA 3GV7B 1UL3A 3L7OA 5E41A 2DB1A 2BW7A 4DR3J 1KLMA 1RT1A 5HMZA 4IDKB 3N6LA 4I68A 3G6YA 3BSCA 4DR6F 3D6FB 1K9MT 1VDHA 1YIJS 3P5TL 5A8KA 3EE3A 1WG4A 2XCPA 5DLGA 5FLXU 1CPZA 4CO0A 1C0TA 3D7SB 4OMFG 1RHKB 3M32A 4KHMA 1D8YA 1WSRA 4MIWA 1RK8A 3BO3A 2RDJA 2H54B 3TR5A 5F0UA 3T1HJ 1K0TA 1E6VB 1F6TA 4X4TA 2C3UA 4KFBB 4J9OA 1QSSA 2ADCA 2HQGA 3QFWA 1IR1A 4HHUA 2N3LA 1Q53A 1HI1A 1UKUA 3FSXA 1W2IA 1ZS6A 3OLBA 3I56S 2VQFF 2BJ9A 1B0VA 2Q3PA 2YX7A 4G1QA 4J9NA 3KK3B 1X5SA 1U1MA 4OJ3A 3FQKA 4DV2F 2P9EA 4XPEA 4F04B 3RRGA 1VRTA 4IRDA 4DS4A 2HSEB 4C0BA 5J2MB 4L76A 1XTZA 3BDPA 1PYSB 4AT1B 1VK3A 2WSCC 4DZDA 1L3TA 2YKAA 2HPUA 2YX1A 3GJRB 3C6UA 1ZPVA 1RT4A 3GZ7A 4KIAA 4RX6A 4QPTA 1YWXA 1KWMA 1S6OA 3V4MA 5A76A 4DWIA 3RBXA 1WJ9A 2MEWA 2E5LJ 4JI1F 3VAJA 2XZDB 4LF7F 2GVDA 2LA4A 5D4NA 3C14A 1S1VB 4I2PB 5KT4A 3H5XA 4MTPA 1UFWA 2ATLA 2Y8YA 4FXDA 1T02A 2DGVA 3W5XA 8AT1B 2JVOA 5D15A 3TUPA 1RJJA 2J7KA 4ENOA 2RRBA 3AB4B 5T7LB 2QMWA 4MAKA 1MSWD 2HKEA 1OY6A 1IJFB 3NAHA 2QFJA 3LH2S 1XMOJ 1X60A 1PIEA 3UDLA 4K4WA 4DR6J 1R0CB 3P3DA 3T9NA 4RNMA 3OTDA 4NXNJ 1AYEA 1U24A 3VZIA 2XY5A 1S4EA 4FYXB 3PW5A 4M95A 3EPIA 4ZIWA 2H9ZA 4YEAA 3CDEA 3W2VB 4YR3A 3OXGA 1U48A 2HQDA 3QGGA 3KTQA 2F8HA 4UF4A 4DQPA 3FGVA 4CH1A 3EGZA 1R8PA 2HQ3A 2CJKA 1RWPB 3DU5A 4GKJJ 2BANA 2HLUA 4ILRA 2XWYA 4L3NA 3VALA 3R7SB 5DDPC 1NB7A 1W26A 2X1GA 2VQFJ 4A46A 1EETB 2GGPA 5ETNA 5C42A 4DR4J 3EYZA 3OTCA 2IJRA 3CCWA 4ZKAA 2BKOA 5KFOA 1FKPB 3OFFA 1KEKA 2XC9A 3H2LA 3FBEA 3NS6A 1SKRA 3IR5B 3KWMA 2UVWA 3MEEB 2F65A 1JLEA 1SXLA 2ZOFA 3BV8A 3H98A 4Z7YA 4JV0A 2L9DA 2OPPA 4DPTA 4M5IA 5J2NB 3JAMY 4HTJA 1QSYA 4OJ1A 1UVIA 2IIHA 1FCAA 2HFOA 5IQ6A 3TQ1A 1NH7A 4TKTA 1RISA 2RUSA 3DXBA 1JXVA 3TA1A 5JMNA 1UVMA 2J8SA 5D0HA 1T9TA 4PG8A 5BYSA 1C4AA 4U95A 4FS1A 4DR7F 1RXOB 2GCFA 3RW7A 1YBAA 3HSDA 3J7Z5 5IS2A 1V6HA 4W98A 2F9JA 2IRUA 2QLJB 1H2TZ 4BLGA 4DL0C 3KYLA 4CO2A 5H9EJ 5CCLA 2EPIA 1JXEA 2M88A 5FDLA 4DX6A 2UUBF 3CDBA 1PBAA 3P5BP 1N5YA 2PFFB 4WZQA 1SH0A 2GC8A 2V63A 4IH7A 2KTQA 4AUKA 4QBUA 2G2ZA 2HWHA 2PEBA 4RW8B 2CJAA 3GIRA 1TL5A 1Y7PA 1WI6A 4H54A 3VTIA 4DZ6A 3MUMP 2HIYA 1X0FA 3C66A 3SXLA 3EDRB 1VR6A 1YITS 2KHCA 2IDLA 4JOUA 5ETPA 1HYSB 1T9WA 3DDNA 3LTOA 3MURP 5T14A 4RBTA 4DSJA 2B9XA 2JEFA 3IGNA 2C3YA 4OYOA 1FFSB 4KHPJ 4H4KC 4LRDA 2XHCA 2RHSB 3SYZA 2W9AA 2JLEA 3BN4A 2UXCJ 4JV1A 4CTAB 3L3CA 1QDUB 5LMUJ 4LF7J 3HSGA 4JI4J 5D3GA 1UZDA 1BWVA 1QE1B 1RT2B 1G7CB 2J5AA 2B4PA 2RIJA 2RDDA 2FQQB 2ZWOA 4XO0A 3OV7A 4J9RA 3RB3A 3K5LA 1MU2A 4H4OA 5DZ6A 2XNRA 1KQFB 3QNWB 2UU9J 2ASDA 2QT7A 4Y00A 3PDNA 1TL7A 4F3OA 5B0EA 5HMXA 4NOHA 4IQMA 4OX9J 1B7FA 3RW6A 3R5BA 1QSLA 2UUAF 4B3OB 4IG3A 4ED4A 2HHWA 2XGPA 4ELUA 2XSJA 2AEFA 1RAJA 2IJNA 3T5HA 1RCOB 1JJHA 2WVBA 1R3NA 2HZAA 3QBCA 1S6PA 4I64A 3WX4A 1PAUB 1H38A 1WD6A 2LDYA 3FEZA 4P2MA 3TX0A 1T8EA 1F60B 1HIYA 3VQSA 3BKTA 3G87A 5F8LA 5GAHI 2PEHA 4DR3F 4QW9A 4YY3F 1HHQA 1K8AT 2HBZB 1MMNA 1Q16B 4ALZA 3CD6S 1UW4A 2V50A 4OFZA 1FVQA 1RT3A 3P45B 3ZTOA 4DDFA 3R1HA 4MIBA 2YNIB 2UVRA 1KVIA 2MHEA 4DU7A 1OPIA 4G3IA 1M1KT 5ETQA 1FJEB 2CIMA 2K2PA 3FFIB 1TFWA 2G1HA 2WW4A 4CYUB 2R8KA 4JI2J 1NK4A 2OPRB 3H0PA 3KK1A 1I1GA 1MN9A 3DGPB 4WIQA 1RACB 2LCWA 5I3PA 1C1CA 3ILIA 2V4QA 3DRYA 1HNVA 1T9XA 2J0XA 2CJXB 5KFDA 3MMAB 1CS4A 4YB1P 1IKXA 1HARA 2QTWA 3J7YI 1YJNS 1FWKA 2BE2B 4I6WA 2CA9A 1HWLA 4FF2A 3OTOF 3TAMA 3OVSA 3QO9B 3BB5A 3TJ8A 4USUA 3U1LA 1JLBB 2SXLA 3E01B 4DN0A 2KU7A 2QA1A 1SC6A 3MFIA 2CG4A 2G0CA 2XLKA 3S6EA 1ZPWX 2VZ9A 1X4GA 2BRLA 4F4AA 3NMAA 4X64J 1TP7A 3UE2A 4H4KA 3M9NB 4RWXA 2CNOB 1NSKL 2KXFA 1VBZA 1SV5A 2AW0A 1U6FA 3NGRA 1URNA 3DRSA 1TMJA 2FIUA 1IKYA 3HKWA 5DJBA 2IBOA 2HRTA 1D8ZA 1NZ8A 1UJ5A 3RAXA 2LQ8A 1WF0A 2UUTA 3QAUA 1SKWA 1IBLF 3E2EA 3I4PA 4RZRA 1WDTA 1RTHA 3QMQA 4M94A 5D77A 4KR0B 2AU0A 2PIIA 1WG5A 2E5GA 4DX7A 4OYZA 2W2PP 1NDLA 2G0IA 3PYFA 2HFSA 4I2QB 4F3MA 2V8VA 3MM7B 4NWBA 3HHLD 2QYGA 4N8NA 4Q43A 2AWZA 4Y34A 1XIQA 1LV5A 3PX0A 5F8HA 1X7VA 2OJ3A 3AD8C 2JEGA 4IFVA 5FD1A 5AT1B 1LK5A 3BYPA 4YR0A 1XMOF 1NHUA 1OQ3A 2JL9A 3TW0A 4GC6A 1F9FA 3UD5A 4RU2A 2E44A 1HW9A 2FPHX 5IQQA 2BQRA 2OHDA 1JIHA 1YRUA 5LMNJ 2CQGA 4M5JA 2E1PA 2J9DE 1X31C 1U1PA 4HHHA 3GONA 2EC2A 2N7YA 2CDQA 4I7FB 4ICLA 5IWAJ 3IBFB 4GRSA 2J0QD 4QW8A 2KT5A 1HPZA 3GYGA 3RG6A 4Y28C 4RUHA 4C3MA 4YQWA 2KG1A 2NUUG 4JI2F 4B17A 3FSIA 3BSOA 4EBCA 3MXHP 4DV4F 3R5JB 3ZNUA 2X3GA 3DOLB 2GHWA 3EPGA 4ED8A 1WACA 4OL8A 4NE9C 2CJYB 2WONB 1SKSA 2VA2A 3M6XA 4NCAA 3K0JA 1N56A 1LW2B 5DG9A 1RDRA 3THVA 1F9HA 1YJ9S 3CJ2A 3P6YC 4ZPAA 2FB0A 1VFJA 2YKPA 2YWEA 1KDNA 4B9MA 3BBBA 2KJWA 3DM2B 4C8KA 1SKUB 3J81Y 1UEKA 2HQIA 4CO3A 3T19A 4DEZA 4ZN3A 1JKHA 2R8HA 4I67A 3MWBA 4C3LA 2DISA 3GG0A 4P75A 3ZTPA 4ZVOB 2HRYA 3TUZC 4NPOA 4F4XA 3H4DA 5BJRA 3G8TA 3MM6B 1KTQA 1FWPA 2NYIA 4J9LA 1I5OB 3W2WA 1HFEL 3HHKA 2HBQB 3FMWA 3H4BA 1R6VA 3D6TB 4DV7F 3RAQA 2I6WA 2E5IA 1D09B 1FXRA 3EWGA 2CQPA 3I96A 2JEJA 1UMJA 2AEJA 2K7JA 4U7CA 1U25A 1WC5A 5J1EB 1BQMA 3TRGA 3U7JA 3CW2C 4K2XA 2AGPA 4PPZA 5C2CA 1N36J 3D9BA 2MZ1A 4L73A 3Q24A 1NDKA 3NGDA 4A8FA 1ZOTA 2PO4A 3WIVA 5KFHA 2O01C 4Y65A 2ERRA 3DLKB 5KFIA 2LDIA 5F9LA 1FERA 1KOOA 3D6MB 5GADI 1N8RT 1GQEA 1D9DA 2KYXA 2ZD1A 4USVA 3MGJA 3HX9A 2FJEB 2C3MA 4TY9A 4C11B 3SCLE 4XIUA 3UI3A 2Y1IA 5C2GA 4TY8B 1K73T 4HACB 4UUWA 1WI8A 3VAHA 3GP9A 4DV4J 1TELA 3I5BA 1JLAB 4OX8A 4WTYA 2JNJA 2AQ4A 1FTRA 2CPFA 1S1TB 2OELA 1JLGA 4JYAF 1FT8A 2JOQA 1G1XA 2HWIA 4CH0S 2HG4A 2L3MA 1C1BB 4A8QA 4X4QA 1Z2ZA 4RR5A 4RW7A 3UDVA 2W9CA 3FKBA 4BC9A 4KO0A 3JYTA 1BD6A 1F3VA 5GVQA 5LMUF 3VAMA 4IOAQ 5D8HB 2NXNA 4HH0A 1R0AA 2VPYB 3IS9A 2KXHA 2W1BA 3UD3P 1RAFB 4N7TA 1HBNA 5F3ZA 3RU0A 1CJVA 3EM1A 4OZ5A 3KJQB 3CJKB 1YJRA 1GXTA 2Z2ZA 3PM9A 3UVJB 3S7RA 5KG2A 3SQGA 3D66A 4K4TA 5G0RB 3DLBA 1NZAA 2IC3B 5D4OA 5HN0A 4FXVA 5KG4A 3RZAA 4RUBA 4NXMJ 2C42A 2WSEC 2YXLA 3GSIA 3MUVP 3Q2TC 5CYMA 1U0HA 2VOPA 2VG6B 2W2MP 1CULA 3B82A 3I6PA 3DOMB 4OX7A 5DGBA 5F8IA 4RUAA 1HI0P 2B6AB 3BGUA 4FVCA 5BYQA 3ZTRA 2MHNA 2AT1B 2G0JA 4CO4A 3DC2A 1QUVA 3FRZA 4PG6A 2IM1A 1XBWA 1HNIB 1DARA 1CJTB 1MWZA 1RHUB 2A0FB 2XHWA 2XI3A 3K5OA 3NWRA 4DHVA 2F8EX 3ELHA 2R2TA 2BJDA 2R3VA 1M1HA 3KLFA 1VQSA 3ETOA 4ES1A 1BGXT 3ILLA 2ZH2A 2CXEA 3SMZA 1OQ6A 1FRMA 1R43A 2YWFA 2GZOA 3K7RA 3KK2B 4YB7A 5F8JA 2ATCB 3NOGA 3G4SS 5ETKA 4A8KA 4FPIA 3J7A1 1JMTA 1TL1B 4ID8A 4LFAJ 4K4UA 4JI5F 3FEXB 1H72C 2QMXA 4X65F 4LR7A 1OWXA 4A8WA 1F1BB 1IN0A 1QD1A 5IT0A 4KPYA 1JLCA 2YBVA 3FK4A 5A0YB 1HNWF 2KI2A 1WF2A 4F02A 3MM5A 4NASA 4LFBJ 3G8QA 3TZYA 4NCGA 2F40A 1SL0A 4XPCA 1B4SA 5HP1A 2ZKTA 2E7XA 2I0XA 4IYQA 4TU9A 3W3SA 2GJFA 3D0GE 4OV1A 4NYZA 5K8PA 3UDCA 1BC6A 2WSFC 2FY1A 4LSLB 2GFFA 4ZPDA 1TUWA 4WP8A 1FDBA 4LFCF 1FFWB 5DM6Q 4PRFA 1E6YB 4ZVFA 1DHMA 4M1KA 4Q0BB 3NL0A 1RT5B 2B56A 1JJ2R 5HJXA 4EZ6A 1D1UA 4H4MB 2XO6A 5L1IA 1FO1A 3K2YA 3M8WA 2V94A 4J9VA 4PPDA 3PXGa 1FJ7A 2ZH8A 3HZGA 3JQKA 1RUSA 2CJQA 3B54A 3GE9A 3NBPA 4A47A 3UPFA 3Q23A 1RT7B 3NS5A 4FP9A 4QJVA 2X1AA 1LWCA 3L95X 3GYXB 4FYYB 5L38A 4YB5A 4B9NA 1S6UA 2OGUA 2IVFB 4A8XA 4RUCA 3M2VA 2ALYB 5KFKA 1GMWD 2LQ9A 3ENAA 3OL6A 2DCLA 3EVMA 1VK8A 3AFGA 5CCMA 4C9DA 2MKKA 4MYUA 4QWAA 4P71A 4ZLLA 2C2DA 5DZ7A 1YHQS 1GEHA 4F67A 4DR5F 2RF2A 3ZZRA 1Q0NA 3W62A 2IPOB 1VJWA 1HLWA 3LPEA 4IFYA 4C98A 1RZMA 5FLXY 1T9VA 2YNGA 3AQPA 4CLFA 5JVHQ 5LSLA 2MZTA 2DNRA 3T1YJ 2GHVC 4JI6F 1BQNB 3SSQA 5HROA 4DSKA 4AXJA 2LEBA 3M1VA 1SUQB 1RBOB 1S1WA 2DHGA 2YTCA 2H5JB 1CJKB 4OYMA 4QQBA 4USMA 4J9MA 2K1RB 3KLEA 2OFGX 4LF1A 2XMJA 1UW9A 1Q1KA 2K8GA 2YNHB 4HL9A 4WE1A 3MM9B 4E98A 1DTTB 1ULRA 4AQYF 1RBLA 4URQU 1UA0A 2V8GA 5CZXA 2PD1A 4N77A 1RA6A 2EFOA 4K7QA 2XM3A 3N01A 4V19J 4CH7A 2HMIB 4GC7A 3AH6A 1R8BA 2YKNA 3C16B 4ECZA 5EHHA 2FUG9 1N6QB 4Q8FA 2ILYA 1MLAA 4DCPB 5HANA 3MR7A 3BEGB 3B6BA 3ENQA 3UD4P 2VF3A 3V81A 5KT3A 2LMIA 2RRAA 1TKTA 3M8RA 4UOHA 2WVEA 1KQSR 1C0UA 1LOUA 2CQHA 3T9ZA 1RKJA 1NCLA 1PO6A 3RR8A 4DN9A 5IT9U 1QY7A 5I3UA 5L8RC 3BQ1A 2G9OA 5D4PA 1WHYA 4OHZA 3WC0A 2ZH6A 4DUYJ 3Q8VA 2YKMA 4PQAA 3C19A 2EKYA 4RW6A 2R7RA 4M5DB 1DRZA 1U26A 4E0DA 1EX8A 2XMVA 2RUGA 1F9EB 3M30A 3VF0B 5I3UB 1M90T 2HVHA 2R7WA 3CT9A 2MB0B 4JV5F 3VAFA 1OY9A 4HI2A 3BN7A 4PG7A 4RLEA 4TLQA 5CHCB 5E2QA 5JXSA 1NEEA 4OHVA 1Q8IA 1HWKA 4X65J 1M5HA 2B4UA 2EBEA 1U1QA 1WC4A 2BJ8A 1YJ7A 2LXIA 2YKNB 4QIVA 1A6LA 1X0PA 1M0SA 5GAHU 2A6MA 2HVIA 2HNZB 3TUIC 2F8MA 3KNGA 3T1YF 2JSXA 2CPYA 5KAKA 3CCRS 5GAGU 3RR7A 5B0DA 1S1XA 1PYTA 1FRKA 3OJUA 3PRBA 2ASYA 2BEFA 1K44A 2CQCA 2GNKA 2JDJA 2RE1A 2VD3A 3S1TA 1OYDA 3SIPB 4CQ1A 1HBMB 2MQNA 1NJYA 1S0NA 2FHMA 1KLNA 4DOZA 1PG5B 2FGOA 2XEXA 5ITHA 4U8YA 1W25A 3UR0A 2HNDB 4KHPF 2GQQA 2KG0A 4F2RA 1RWVB 2KFZA 2BM0A 4IOCQ 3MAAA 5KG6A 2NQPA 2R7VA 1Q8KA 1P1TA 1B0TA 2UXDF 2K7KA 2QA4G 2MY7A 4FNHA 3H90A 3ZTQA 2QEXS 2RF2B 3CIMA 3DYAB 3OSNA 3O3LA 4CM2A 4ILMA 2HHVA 1AT1B 2B9WA 2QYCA 2E1CA 5AE2A 2DR9A 4NXMF 3DLLQ 1LK7A 1WUUA 1IBCB 2PA3A 3ISZA 2BXJA 3JSRA 4Q45A 2BJEA 2U1AA 3TVZA 4ZA1A 1LWCB 5JUMA 5DDRC 2BJ7A 3CJ3A 3QZ8A 3CJ4A 1CQMA 1Q95G 4LT6A 4QWCA 3G96A 3NNCA 1H2UX 2JZ5A 1B70B 3GSDA 1NDPA 5KFXA 2W9BB 3D68A 5G4DA 3FSYA 4DLGA 4EEYA 1L3UA 1D9FA 3CMAS 1Q79A 4Y2CA 1VQKS 1TKXA 4H4MA 4ED1A 2YQ3A 1REVB 1RT5A 2C2OB 5ETVA 2I2YA 4QCLA 1PJ7A 4TNOA 5EN1A 2DGXA 4DFPA 4Q5VA 2LQBA 1E6YA 2RU9A 5HATA 1BXNA 4B3TJ 4OLOA 1IKVB 1RABB 3EMTA 4OV6A 2M0GB 4JI8F 5DETA 4LSLA 3A3OB 4K4VA 2FC9A 1S9GA 5HBMA 2ZJQQ 2KKHA 3UCZP 5H9EK 1FJGJ 3A12A 4K2JA 2VG7B 1S9EA 2BMBA 1ZYQA 1U2FA 3D28A 4EI2A 2I38A 5E0OA 3CD7A 3FBCA 4ZVGA 2XBPA 2V0NA 3TUJC 2CKWA 2F9DA 2AJ0A 4ZVPB 2IY5B 3H5YA 1HQ2A 3TQEA 1XNQJ 4ILLA 1TFYA 2OTJS 2YWHA 1IM6A 4PABA 1M5OC 4X84A 4ECQA 1ZZNA 2FZGB 3KJFB 3V4IB 4OYXA 4F8RA 2RQKA 5AE3A 3LA0A 3ZZUA 1S9EB 2CQIA 3N5FA 5LL6d 3JSMA 3M8ZA 3AOCA 3H20A 5HI7A 4Q2MA 2X3DA 3SBMA 1XMQJ 3DN9A 2E66A 2HAIA 1G6BA 4IH6A 2ZE2B 3SEOA 1IKVA 5KFYA 4EK2A 4ZLJA 4ZVSB 3KHGA 1UJ4A 3D0IE 3V6JA 4O44A 3OXLA 4MYTA 4P73A 2QZ8A 4ED3A 1J5OB 2LKZA 4F4YA 3AOBA 1KC8T 4ID5A 3C46A 2RT3A 1HNIA 2V69A 4U7UD 3OTBA 2DTJA 3U1MA 3VCDA 4LVNP 4NMXA 4KJIA 4KE5A 1N5SA 5BR8J 2JC0A 2B6AA 4K0KJ 3IXQA 2V4JB 2L48A 3AD9C 4TXSA 3CCVS 1ZTTA 1CVJA 1FKOA 3DGVA 3EUNA 2VG6A 4B9TA 4IOBA 2OFHX 5SUHA 5CYMB 4ZPTR 1EKRA 4KHRA 5D0RA 1TAUA 1G3OA 1NLKL 3KG1A 4OZ2A 3VAGA 4K4YA 3L4BC 2AX0A 2NSBA 4HHJA 4CP5A 2C2RA 3DYAA 4ED2A 1JNRB 2ZZNA 3GV5B 1H73A 3PHTA 2ZNYA 2ZBQA 4OLPA 4A8OA 1DZ5A 1SC3B 1FJGF 3F41A 4EYHB 3EX7B 1ZAVA 1WG1A 2DGQA 3R8YA 2CAJA 2MQLA 3PKMA 1HBNB 1N33F 5GMDA 5B0FA 4LF4F 3AAWB 3KJVA 5DO2A 1T03A 4UOGA 4QU7A 2C2KB 1S0MA 2M5YA 1MMLA 5K8MA 4DLEA 3GIKA 4UT4A 2AJFE 3LWLA 1HBMA 2ROEA 3BO2A 2F3JA 3POTB 1TUVA 3DU6A 4EMDA 4KO0B 4HEA9 4FBTA 5KTQA 4U9RA 3A4TA 1UEUA 2FZKB 1XK8A 2LEAA 4KC5A 2F4FA 3GLJA 4QR1A 1SL1A 2DR8A 1TL4A 1Z4UA 3VZHA 2KVIA 2MZSA 1JLGB 3KKFA 1S1TA 1YZ7A 2WAQD 1VS3A 1IBKJ 4PZVA 3R2DJ 3C6TA 3I0RB 1GTHA 5E33A 3CSKA 1JLAA 2CPHA 4QYRA 4LF6F 2XS5A 2VONA 5ADZA 2RMLA 2NPIA 1WELA 2ZFHA 1V9OA 4TY8A 4DR7J 3V6DA 1VRUA 1NAQA 2B51A 2JRSA 2FZCB 2RAQA 1VIXA 3NCRA 1VQ7S 2D1CA 4OJGA 5T41A 3L7UA 2FVCA 1T94A 2DT9A 2ZD1B 3JSBA 4B3TF 2V68A 2XMKA 4NLWA 4M5DA 4C8NA 3OL7A 2ALZA 2M8DB 3HSJA 2CJ9A 2XYPB 2NSCA 3DLKA 1XR7A 3OFHA 5DM7Q 1TK5A 1HQEB 2PA8D 1PGZA 3NNHA 4C8LA 2D3O1 4PR6A 3CMES 3TAPA 2VBXA 4USHA 1JLFB 1V3ZA 1N36F 4ZP9A 1DY3A 3B78A 4IG0A 2J0WA 1BQMB 5KFQA 2H4WB 4MKYA 3LP0B 3DRPB 3PR4A 3RBDA 2I1RA 2DVIA 2ZOGA 4CLUA 4NLRA 4DX8H 2F4VJ 5DG7A 2IAJB 1U1NA 4NZ0A 2QLBB 3HPOA 3SFUA 4PUOB 3UN2A 2A2CA 1VIOA 3QWUA 1HI8A 3I31A 2HHTA 3W2WB 3TJAA 2IYGA 6FD1A 3KHLA 2QL7B 4KV8A 3QT7A 2XI2A 3NKYA 5AE1A 1WC3A 3OHBA 3D2WA 1HMVA 4OZJA 4NLGA 4ZN1A 5CA5A 1U02A 4GKJF 1DTTA 2M70A 3EGNA 2WOMA 1X4FA 3GJTB 2K1RA 4O3QA 4CLPA 3QJPA 4RW9A 3DRRB 4EO6A 3CCZA 3DM2A 3I55S 2BX6A 1S1WB 4IH5A 2NZCA 3M1VB 3IG1B 1BQNA 5HROB 3QIPB 3RRHA 5D3GB 3O44A 5KFNA 3DHXA 1N4LA 2KFYA 4DV5F 1NNDA 2GMHA 3OQ2A 1LW2A 1EJ7L 3QSIA 3DDIA 3MMCA 3P8BB 2WBMA 4R0JA 3LANA 2V9KA 4KGXB 4M63A 4USJC 4ITSA 3TNVA 2PMHA 3E8OA 2EFPA 3O2IA 1LEOA 3MEGA 2APOA 4L3KA 4F4ZA 3IWNC 2J8AA 5KOWA 1QUPA 2FD2A 3GIMA 2CPEA 3D1OA 2UV8G 3QJJA 4BBYA 2RU3A 1RT7A 5KFTA 3CJ5A 4OX6A 4X4OA 3NBPB 2XY7A 1VCTA 1Q7LB 1LWEB 2MJUA 1LWFB 3LP2A 4ZHRB 2AJ1A 2DJWA 3HFVA 3L7PA 2HWTA 2OPQA 4IFVB 3PO5A 3ZTSA 3ZZPA 4N76A 4CI0B 4Q0BA 4WJBA 3CPWR 2J9EA 2CQ3A 3MM7A 5KFWA 4DPXA 4PQUA 5GMEA 3PG9A 4HKQA 3DOKA 2DY1A 2D3UA 1S57A 4LRCA 4IO9Q 5I42A 3PRVA 1GMWA 2HS4A 3WHIA 3GQCA 4K50A 1HWUA 3I5AA 4WXWA 2XMTA 2HYIB 1UFLA 2N82B 1RAAB 1T3OA 4CM0A 3K59A 3JB9k 5K8NA 4QIEA 1CQNA 1IKYB 2HVZA 2VPZB 4NCGB 3VVUA 1DLOA 3AJDA 2MQMA 3HVWA 3HVTA 1S72S 3KLGB 1NB2A 4NL5A 3MM5B 2XO7A 3W8PA 4NEYA 1FRXA 1U47A 3ITHA 2MLYA 1MG7A 2VDIA 2AF6A 2YNFA 2QV6A 5HMWA 1T05B 1YZ6A 1FESA 4WF9Q 3EZOA 3OXFA 5AXLA 3H25A 1P9QC 1TL1A 4F4KA 4JI7F 3KDNA 3CCUS 1JWWA 3BPDA 2BE2A 3W64A 1IKXB 3MMAA 3BGRB 3SV3A 1WC6A 5GAGI 5I4MA 4Y3CA 3SFGA 4DI6A 4X4RA 1UCNA 2D74B 4KH0B 3KLFB 1FHTA 3PW0A 5KG0A 4O4GA 3QT8A 4ZVHA 5IV4A 3Q0AA 1U1KA 3FFIA 1NK0A 3ENWA 4ED7A 3C2PA 2YPYA 5AXMA 1U6BA 2YNIA 2Z2MA 2F4VF 1DJ0A 2UXBF 3HMJG 2W7OA 1M5SA 1V3SA 3Q22A 1IBMF 2GIFA 4ERDA 1X4BA 3QRRA 4ZP6A 4WKYA 3BGRA 2PSZA 3HHLB 4M5NA 3W65A 5K8OA 4GVBB 1JB0C 3EZUA 2DR7A 2OSRA 3MTKA 1VQ8S 4PXCA 4PG5A 2NUHA 1GXUA 2MTLA 3HFZB 3N28A 3TA0A 3R6LB 4IG3B 2DGTA 3BQ2A 4WBFA 3D1HA 3PYGA 5D0GA 1T05A 2V2ZA 4RBVA 4DSFA 2YQ1A 2DNOA 2N4DA 2O67A 3EJMA 1TL7B 4NRUA 3I87A 4A48A 1TMMA 1N33J 1WTFA 1Y10A 5HQMA 5E3CA 5K20B 3Q8RB 1GMVA 1DLOB 4RNOA 4X62F 1M1GA 2V5HG 2PMWA 1UVJA 1O0PA 4UZCA 1IWGA 1QE1A 1BUXA 1RT2A 1UWAA 3CB4A 2G13A 1R0AB 4I6AA 1NJIT 4MT1A 2ZVSA 3MOZA 2DNLA 2J7UA 3N6MA 5I42B 3OTOJ 3DOKB 4FZVA 3ZFVA 3DKDA 4ZVEA 3IWXA 4ZLNA 1YJWS 4PQUB 3HD1A 3OD2A 3KUGA 3T5KA 4OX9F 2FVQA 1B0PA 4TQRA 2D9OA 1R31A 1UWBA 1CC7A 1URRA 3PW4A 3M6VA 4LF6J 3KOAA 4AQYJ 4ZHRA 4B08A 1LWEA 1VQOS 1NKBA 4HACA 2HURA 1FRLA 4NLQA 1SB6A 1X9MA 2W2QP 4OZ1A 1NSAA 1FXDA 2PN6A 4C11A 1A9NB 1G4CA 3SZ2A 4C8ZA 4OI4A 2CPXA 3VGSA 1UVKA 6AT1B 3FCWA 3MEGB 1C4CA 5KG1A 4ECVA 2ASLA 3F0NA 4CLKA 1T7PA 1L3SA 1IBMJ 3IC1A 2GV1A 4BWMA 3BH7B 1F5BA 3I32A 2BQUA 3MMCB 5IOLA 5ETLA 4YUDA 3MUTP 3PW7A 4PXEA 3PKYA 3MI7X 2N7CA 1VC5A 2DK2A 5AXNA 1A7GE 1YDLA 2AV5A 4DV1F 3QIPA 4M8LA 4G1PA 4ZS6A 3IG1A 1UPPA 4FDFA 2EBGA 2D3OR 5K5MA 5HMYA 3IWLA 1XR6A 2Z57B 4DR1F 1UFKA 2QE5A 3DRRA 4UZBA 2DR6A 3QRPA 1F5CA 4CNYA 3PJWA 1RWMB 3HO1A 1UPMB 3JQMA 1HD0A 3VV2B 4QR0A 3OVAA 2YVSA 3NGTA 3CJ0A 2CDRB 2HBRB 3MHYA 2V6AA 4AXIA 1HMVB 1WOSA 2BKNA 3NY0A 5L46A 5KFAA 4KV8B 3WBZA 1U1LA 4OJHA 2J0SD 2DH7A 4ZVRB 2C2NA 1JLEB 2DGSA 3BREA 4DSLA 1TAQA 1IR0A 3TEGA 4ED0A 3MPDA 2CFXA 2QMUB 3WZ0A 4PUOA 2G4BA 3CMQA 2IAJA 1F3FA 1RTZA 1X4DA 4CT9A 2ROGA 5AJ3J 5KFFA 1L5UA 3DRPA 3LP0A 4UQGA 5IC4B 5C42B 1FNMA 2GGPB 2RDIA 2CNLB 2UUCF 5HAOA 2DNGA 2BACA 2CYYA 3MR5A 3LQVA 2IVYA 3AODA 2FJVA 1HQEA 1KS2A 3C8YA 1Q5YA 1ZAXA 5H9FJ 1U7LA 2CQ1A 2R9LA 5DGAA 4P2FA 1UA1A 2XYGB 2P8IA 4CIOA 5J1NA 1R7IA 5L9XA 3QYYA 3V5RA 2V67A 2VDHA 1FE4A 1VRQC 1PKUA 2EK6A 3EGWB 5KT5A 4ZLPA 3PEHA 2M2BA 3BH6B 2CZVC 5B0BA 4Y0FA 4LIWA 2B4VA 4DV7J 2AIRB 2DY9A 3JAMU 3V6DB 2W4DA 4OZ0A 3ULHA 4NLTA 1U4BA 3HI9A 2EFNA 3TANA 2HK2A 3SV4A 3MTJA 1EKSA 1GTEA 1UWBB 1FX4A 3C6TB 3MPUB 1YRTA 3QGIA 4NX9A 2BJ1A 1AUSL 2HLTA 3DXSX 5KG7A 5CD4H 3BJYA 2RQ4A 3TARA 2L9WA 3R2CJ 2BVZA 2ZZMA 2ZBCA 4I2QA 2VFVA 4Y2AA 2VPXB 2G2OA 3N6NA 4I2PA 4QR2A 2CQBA 2XGQA 3X3UA 4DR1J 3QAEA 4ZIVA 4ED6A 2EEYA 2VUGA 3PFEA 2DCUB 2OEKA 4LSZB 4R0EA 1NK6A 3HK2A 6FDRA 1KBRA 5BXIA 1OO0B 1XJWB 5ETRA 3KJVB 3ZZZA 4GVLA 4LIRA 2ILZA 2C3PA 4LRAA 4OYIA 3RAMA 1CBKA 1EIYB 1GX5A 3CC2S 1BY9A 3A8KA 2CZ9A 2R8GA 1S0OA 1KOHA 4AL6A 1KKHA 2XY6A 5CXTA 4ECYA 5KFUA 2ZC4A 2AJ2A 4PYDA 3QO9A 1B99A 3TAMB 2MKCA 4UTGA 4ZJLA 2ZH5A 2OEJA 4GVBA 1SC4B 3QZ7A 3KK3A 2W7PA 1B64A 1SIZA 2QFIA 2KM8C 3HHLA 1L3KA 4FF4A 1FKOB 1HNVB 4O3NA 5HJYA 1H7WA 3T5JA 2V4JA 1S48A 3DGPA 2BBEA 3KK1B 3FNNA 2YQ0A 4MJKA 3PYEA 4CYUA 1SBRA 1RA7A 3KUHA 4B02A 1GFWB 2V8PA 3M9OB 4ANCA 3VHQA 2MQPA 3J7ZT 2BRKA 3BSAA 2HGLA 1S99A 2CPZA 1I6JA 3M7VA 1CC8A 1C0TB 2VBWA 4D3GA 2P9CA 2WW8A 1JK9B 1UZHA 4O4GB 1GT8A 3LUYA 4XTTA 2VPWB 4CT8A 2YX4A 2ZE2A 4KPCA 1N34F 1WOPA 1RT1B 4YOEA 3UR3C 2ZKUA 1HKAA 3A1YG 3WQPA 1DBDA 4KGZB 1RP5A 1XWLA 1HHSA 1S6PB 1YSJA 2LA6A 5GADU 2R8JA 1H2VZ 4P9SA 4AL7A 1U1OA 1NUEA 4HTIA 2OO4A 2FJAB 1P8GA 1UVLA 3V4IA 3WDOA 4B3OA 1BMQB 4DL7A 2YNFB 5L1KA 3ITHB 4JV2A 2EKNA 2KHDA 2IM3A 1H6KX 4Y2KA 1HR0F 4H4OB 3RRKA 3KLGA 4P7VA 2IBKA 3HVTB 4DF4A 1KHVA 1PJ5A 5D6GA 3TP2A 2QGFB 3PX4A 2VG7A 1S77D 2PI5A 4L6V3 4I69A 3OR2A 4QOTA
chains in the Genus database with same CATH topology
1FDNA 2YWKA 2NS1B 4TYBA 5LXYA 1NO8A 1FRJA 4F50A 4LVOP 1HQUA 3LPYA 4UY85 2YH1A 2MQQA 2OPQB 1RT6A 1TKXB 4NYPA 3AB2B 3LO3A 4DFMA 3I5CA 2HFNA 3CUNA 2R2UA 2XS2A 1LWFA 3LP2B 3T5HA 4WIIA 2W9BA 1RWUA 3MR2A 2XMUA 4O3PA 4JUZA 2R2RA 1VQ4S 4KRWA 3HHLC 1MWYA 2ZBIA 2NREA 1KN6A 1GXLA 2WBRA 3BZQA 3NGKA 3OHAA 2DNHA 3GFYA 2WB4A 4HVZA 4D3HA 3ISND 1N5YB 1QAJA 3MAHA 3LAKA 5FDLB 1X4CA 5B09A 3MEDA 3LALA 4A8YA 2EFQA 2JVRA 2MQOA 4ZCMA 2MZQA 2KFNA 2DITA 2V2KA 1U45A 2JC1A 2HNDA 1XC9A 4A4JA 4ZOSA 3US5A 3CWJA 4RW9B 4A8MP 2DR5A 3Q2SC 3HKZD 5J2QB 2KT3A 2VFTA 5KFZA 1LQ9A 2WOMB 2UP1A 1S1XB 3UFCX 2Q6BA 3M6UA 3MCSA 4F4WA 3V2UC 1NJZA 2X51A 2VODA 4N8OA 4TN2A 5J2NA 2FGCA 2AJ4A 1WWHA 3MDFA 2JJ4D 3OR1A 3LP1A 2W8KA 4GO7X 2GJIA 3QGPA 3T6JA 5KT6A 2FJWA 1ZM3A 1S7HA 2RRNA 1F0XA 2MPUA 1MMDA 5CH7B 1SQEA 4WYWA 2LYVA 3I9ZA 4N56A 3FZ2A 2Q79A 5JJBA 3OW2R 2XB2D 4WCEQ 1X5PA 4IG0B 4KGKA 3CD5A 1FRHA 1JLFA 2HFZA 3M30B 4NRTA 5KFMA 4MK7A 5KFRA 5LMNF 2YKMB 2DH9A 3NWGA 1VQ9S 1TKDA 4HH1A 1FVSA 3CDWA 3KG4A 2EK1A 4PCQA 2M9KA 3MD3A 2W7AA 2EFVA 2GQCA 1NHVA 2H5EA 1VRUB 4PKDB 1C0UB 4WK3A 2GX8A 1NKCA 1N0VC 1TKTB 3ISNC 2CJBA 3V81B 4O0IA 2J76E 3CCQS 3I0RA 5DQGA 1FNOA 1K1QA 2NLWA 2VQEF 4DV3F 4MK8A 5F8GA 2HMIA 3BS9A 1X5OA 3QWPA 4AFFA 2O1PA 4DUYF 1K1SA 4DUZF 1YJUA 1S1VA 3CIZA 3MM9A 3OTEA 2YNHA 3NMRA 3POTA 4I56A 2WRMA 5H1SV 4MKAA 3SCKE 4TQSA 3PVXA 4IQXA 1TK0A 1FKAF 1H0HB 2FVSA 1PC5A 3CDAA 3PR5B 2HHUA 2I8EA 1T03B 2XSFA 3EXYA 3MZIA 2IVMA 4YDDB 4OHXA 4RNNA 4IR1A 1Y4ZB 2LQJA 2ZITA 5IM0B 1J2VA 1ZM9A 3BDEA 4DS5A 2F1FA 4BC7A 4QIGA 5KFVA 2IA6A 4W92B 3CCSS 3IBWA 1VRTB 4ZPWR 3V6HA 2DRBA 1KNZA 2DIUA 1KSPA 4TU7A 1GX6A 1UETA 3N79A 2ABYA 2DBBA 1YQHA 4B3MF 3KMQA 2FHOB 4WXOA 2GJ2A 2Q66A 4WFYA 1SJ1A 1WNEA 3CE8A 5FIIA 2OAUA 5DDQC 4K4ZA 4KFBA 2QO3A 2JEIA 1T3NA 1FD2A 4LQ9A 4ELVA 4ID5B 2B7BB 4NMLA 3M32B 2DNKA 1PSDA 4RKUC 1J5OA 4O44B 1VC0A 1Y0HA 4DBQA 4O23A 5A8KB 2RSQA 1JX4A 4IDKA 1KRPA 1VC6A 2YH0A 3HM9A 1RTDA 2P5VA 4JI3F 3JSMB 4NYOA 3AA8A 2UV8A 4USIA 5E3RA 3DLHA 2IJFA 4ECSA 2M52A 1FNXH 4C7QA 1HWJA 5CYJA 4EFAC 1R27B 2NZ4A 2A2DA 2E1RA 2B9YA 4ETXA 4N41A 3D54A 2OD4A 3LF0A 4CZCA 1F2GA 5A2QY 5LT5A 2MSTA 2ZC3A 3IO1A 5U47A 2CVEA 1S9GB 5HBMB 4E8UA 4DR4F 4WZMA 3P49B 4DQQA 2J9CA 5F41A 3ONQA 2VA3A 2P6TA 3GWCA 1REVA 3K57A 4QWDA 2B5JB 2ZHOA 1SJRA 3CDUA 3O1LA 4YFUA 4FF3A 4UOCA 2A18A 3CCTA 2IRXA 1KQKA 1FEHA 2EW9A 2XMMA 5MLCV 4IRCA 3GYNA 1PILA 1HD1A 5M2PA 1ZAWA 2DHXA 3IRXB 1SJQA 3PZPA 1ZM2A 4QWEA 5IFMA 1LW0A 4FS2A 1XMBA 1AUDA 2IC3A 2ZH4A 5G0RA 3SQGB 2VG5B 2I5JB 1OS5A 4QPXA 2W8LA 1HNZF 4DSIA 2BZ2A 4NA2A 4MH8A 3SCIE 1JNZB 3THPA 4BWJA 4K0KF 3ZZOA 4B9LA 4R8UA 4DMZA 1VQPS 4MKBA 4K5SA 2NPFA 2M8HA 2JHEA 3J7YU 3JYTB 2W9CB 2JFKA 1C1BA 4K5RA 1TKZB 4XK8C 3KMSA 4DR2F 4X2BA 3BSNA 3HF5A 2HNZA 2A10A 5A8WA 2DD8S 5E3AA 5B0GA 2KZZA 1UP1A 2QRRA 3MECA 3RBEA 4OQJA 3NCPA 3JTNA 4Z37A 4LUBA 3IGVA 2MZRA 5THWA 3HJFA 2UXCF 1DURA 4RNFA 4O3SA 4JI4F 2KH9A 2RQMA 4HT5A 3TA2A 1XMQF 2RD5C 1NJXA 3Q8QB 4FF1A 4RW6B 2MSSA 2FHJA 3MPWA 5BYRA 1SIWB 4CCHA 2B0GA 5HLFA 3TI0A 4EBDA 1N5QA 4DL5A 2FLLA 2FLNA 5KFGA 1AROP 3THTA 3TVKA 4TU8A 5J1EA 1WHWA 3D5MA 3GFHA 3OJSA 4RNHA 3MOJB 2GQ2A 3FEYB 1SJ3P 1N6QA 3LW5C 3OSPA 3BR9A 3T3FA 4F26A 1RKIA 3QLHA 5E5NA 1X4HA 3KHHA 2ZH9A 3B4MA 2JWNA 2R7TA 3H40A 1YRXA 3MM6A 2AGQA 4DFJA 3UCGA 2XNQA 4KAIA 5EDWA 5D4LA 1UEVA 5KFCA 4EBEA 5M2UA 3T5LA 1C2PA 4WE1B 5DS7A 2LXFA 3KLEB 1N54B 1S97A 3HHNB 4X4PA 3RTVA 2K3IA 5KFEA 1SUQA 3LAMA 4ZPVR 2IFXA 2VH7A 3HFKA 2FLOA 2XZWA 3GILA 2D9PA 1VBYA 4JI0F 2VC0A 2DGOA 2IRYA 2YNGB 4AL5A 3QPIA 3DMJA 2WONA 2W4PA 4IFYB 1MROA 2RVJA 1NKEA 2KO1A 2QLXA 1VMBA 2IMOA 3T1AA 1W2BR 4EWTA 5DQIA 4NLVA 3MPYA 3I82A 1U1RA 1NRKA 1HPZB 3M2VB 2X1FA 3MMBB 4ZDNA 2R8IA 4QYZJ 4FN5A 2UZAA 4MK9A 3HDSA 1DQ9A 1DTQB 1OSDA 1IUJA 4I4BA 2IM2A 3HZEA 3UNGC 2BDPA 3MPVA 2VFUA 1QAIA 2AP6A 3DI6B 3MFHA 1ZZFA 2QIFA 4KBIA 2X1BA 5A6PA 1KQSR 1R8CA 1Z2LA 3TVYA 4RU9A 2L9NA 2ZHAA 1NK8A 3HLUA 3OPKA 3K5PA 1KQGB 3IA0A 2UVUA 4Y6IA 3M9MB 1X9WA 3PY8A 4ZCLA 5HP1B 2LU1A 1XN9A 3DRSB 4P7TA 3CCES 4P2SA 5IT9Y 1SV5B 3UQSA 1P6TA 2OP5A 5CYQA 2O66A 3HT3A 3M6WA 1JLCB 5A0YA 3IRWP 4LF8F 2XCAA 4DSEA 2XLIA 1U2RA 4FPRA 4WFZA 2GIRA 1Q8LA 5DG8A 2EVZA 1JLBA 3E01A 2E5LF 2YKOA 4GO5X 2OMLA 3FRYA 4KSEB 4YMEA 1JJ4A 2RKIB 2KDOA 2OKQA 3KK2A 4J9SA 3DHWC 3ICLA 1ROFA 1RI7A 2R2SA 2BM1A 3DLEA 1C1CB 1FDAA 3F56A 5EX0A 2VASA 1VBXA 3NNAA 5HL7Q 2OPRA 1QVGR 4Y2IA 2R4FA 4Q8EA 4B9VA 2C22A 5KOXA 2ZH7A 1R8AA 3M05A 3PACA 2KRRA 4WFNQ 3OLAA 4NXNF 2L41A 2KXNB 3JSYA 3CF5Q 2AJQA 2GA7A 3W7BA 1RT3B 2Y0SD 3FDSA 1TV6B 1SH3A 2WCXA 2MXYA 3DOMA 3R1LA 1RTJA 5M2RA 2FHJD 4Q44A 2HZCA 2E1AA 1N88A 1S76D 5GAEI 4KT0C 3AJ2A 2XSJB 4L72B 3TO8A 1GH8A 2ZUGA 4EO8A 4ZP7A 2ZOMA 5KFPA 3CJKA 2WK4A 3LGNA 2DPJA 4FF4A 2D7SA 2HIQA 3GFZA 2KM8B 3HVRA 2WHOA 3S8SA 1N48A 4EUVA 2LEPA 1MU2B 3P96A 3UCUP 1XNQF 2VFRA 2YKQA 4DPOA 2KJVA 3PW2A 2MKSA 3IS9B 4YDXA 3BQ0A 4ECUA 3U02A 2Z8QA 1TVRB 3PFOA 2QA2A 2O5DA 3MR6A 4RW7B 3VAIA 2EFGA 1RYSA 4C4WA 4C8YA 4ED5A 2ZNZA 1Y3KA 2HGMA 3G71S 5LXRA 1S1UB 5LJ5Y 1J5EF 1FE0A 1CG2A 1S0VA 4BHQA 5AJ3F 4MIAA 1WEXA 1ZBTA 4OHWA 3QGHA 5IXUA 3UWTA 5IT4A 4RW8A 2W4CA 5F8MA 3VAKA 1NH8A 1AFJA 2DIVA 2R7XA 4OHYA 4V19X 1RTIA 3SDEA 1KVJA 5A6WA 3DFEA 4C8OA 2HRUA 3CCLS 1R89A 5FJ4A 3E3XA 1Y5LB 4NA1A 4RBUA 5EWGA 2ZM6F 1N5VA 2DNZA 3G86A 3CCMS 4J9PA 2VB6A 3H5SA 1HWIA 3CTRA 3H2VE 1VGYA 2R7UA 1K0VA 1DQ8A 3KG0A 4OI6A 2HHQA 3HHDA 4K4XA 2IM0A 3LOUA 3CC7S 1YTYA 4B3RF 3D1QA 3M8QB 2OPSB 2GW8A 1OSCA 4OIXA 4OZLA 4B3SF 3PIOQ 2PE8A 3PHEA 5KT2A 4O3RA 1JKHB 4ECWA 3MEEA 5I3QA 1S10A 5EUHA 4ECXA 4K59A 2VKRA 5F9NA 2UU9F 1YGYA 2Z2LA 4WFBQ 4K4SA 1SH2A 1O51A 4DQSA 2D41A 5L1JA 4DG1A 2MKJA 2VBZA 2MGZA 3DOLA 5J2PB 2BANB 2KRBA 1ELOA 5K14A 1TVRA 4HDGA 1VLYA 2LECA 3X1LB 2HGNA 2JX2A 4DFKA 5B7WA 1AW0A 1NU4A 4C2MA 4I7FA 4ICLB 3ZZTA 1CLFA 2BYCA 1FDDA 1S9FA 1SJFA 2FHKA 4I0WA 2GIQA 3BGLA 4X4SA 1XERA 4LFBF 4IKAA 1S79A 5MAOA 4BS2A 4ETZA 2OTLS 4J9KA 4J37A 1IKWA 2HS3A 1RGVA 4U67Q 2OMOA 3F44A 4LJMA 1IXKA 1XR5A 1QTMA 3V6KA 1Q81T 3M8PB 4KKOB 3SSSA 1OIAA 4DL4A 2CZ4A 2E29A 2HNYB 3DNCA 5B0CA 2JH3A 4KQZA 4P6QA 1N0UA 1RTHB 2OSQA 1Q78A 4UW2A 1MNEA 1ZM4A 1RTJB 3K8WA 5IWAF 2DRAA 2RQCA 2I9SA 2IHR1 1KHWA 4HT7A 4N5SA 3FMBA 2AX1A 2QLWA 4BDPA 1RT4B 2E1MC 2LQ5A 3I9V9 4YHHF 1QAYA 2NR0A 1N52B 2HHXA 2YWGA 3DRXA 4WU2A 5J2MA 2ZH3A 4J9QA 2MYFA 1FK9A 1D9AA 1UAWA 1VOMA 1X4EA 5EGYA 4A8SA 1NK7A 1P1LA 4BCAA 1M5PC 2RKIA 1QM9A 2C2EA 3GG1A 3ZZ0A 1TQLA 2M4MA 2PT0A 4URSA 2MQPA 2JEJA 1FK9B 4IRKA 1VQ5S 4LMZA 2E9ZA 2HHHF 4DL3A 3LGMA 3RYLA 5HQ8A 1VQ6S 2CQDA 5LSRA 2C3OA 2RS8A 2ZJPQ 3R3TA 3KHRA 3O8WA 3G6VA 2HHPA 2LU2A 2FLPA 2G1DA 1QJHA 1H98A 2J9DA 2FJDB 4QIFA 1HL6A 2Z0GA 4ZCKA 2IA0A 3DLGB 3CVKA 3VR1A 2HNYA 1O5JA 1S4FA 1LFWA 1YJTA 3M8PA 4KKOA 4OI3A 1JXLA 1G2EA 2DHSA 3DI6A 1TK8A 3PEJA 1MW7A 1IKWB 2JFDA 5F0WA 4ES3A 3J80Y 2XWXA 3SCJE 1CEZA 2GO9A 3QIDA 4URGA 4UQTA 4NZ7A 3KLIB 1Y5IB 1Z1ZA 1WHXA 4DL2A 1R8HA 3E51A 3MMBA 3Q8SB 2ACYA 1IQTA 4CTAA 4PG4A 5K14B 4C3KA 5KFBA 2AYEA 5A8RB 3O6QA 1JLQA 5J2PA 4LSNB 2E7WA 4DG1B 2MGZB 4U6PA 2CQ2A 3A8EA 3DMJB 3C3LA 4WKRA 3R5DA 4LF5F 3R5CA 2RJZA 2QSFA 5CZVA 1HYSA 3I0SB 3TYTA 1FA0A 2Z4PA 1U49A 3GFXA 2BR0A 2VV5A 4FNIA 1Q4RA 2PGCA 3CCJS 4WU3A 3CGIA 1KFDA 1Y00A 3NAIA 2EG2A 4ZPCA 2AYGA 1TZ0A 3D0HE 4HYKA 4WYLA 2OPSA 1R6YA 3M8QA 4R25A 4RW4A 3QLHB 2WTFA 3ZC4A 1QLNA 2AYMA 2NXUA 3R27A 2B43A 3N5BA 2DGWA 2CQ4A 4I1TA 5E7OB 4O3OA 2PC6A 2XG8A 4FYDA 1D3WA 2PDAA 1AXQA 3CEDA 3M2RA 5KG3A 4IO1A 4PWDA 3NG8A 3GR1A 2R7OA 5HLFB 3IR6B 1RTIB 2ROPA 3SDEB 4NA3A 3BO4A 3B4DA 1WHVA 2Q1LA 1HHTP 1XNRF 1Q7YT 1X8DA 2OPPB 3M8SA 2E5JA 1T95A 4X4NA 2DNPA 1X4AA 3OFGA 3M2UB 5HO4A 2MY8A 1FKPA 2DNQA 3OL9A 2HW3A 3TX8A 1AFIA 5C24B 3GB0A 1FJCA 1S1UA 1LXJA 3FVYA 1Q82T 1EETA 2U2FA 4NLUA 3TOQA 4QU6A 3H2UB 3H5UA 3PRDA 2VFSA 3RB6A 3OVBA 3KLHB 4MFBA 2UUWA 2KZMA 2VBYA 2BABA 3MM8B 2XS7A 2RH3A 1TL3A 3H59A 4G1IA 2ASJA 2RILA 3W2VA 2HS0A 4R8UB 4Q2LA 4OZNA 4OI2A 3PX6A 4KGMA 2K3KA 1YG0A 3G8SA 2PMZD 4YR2A 5L9NA 3EZ5A 2BUNA 3KLVA 2AYBA 2CQ0A 3DLJA 5T7LA 3CC4S 2I5JA 2Y1RI 5DLFA 3GIJA 4JBCA 4HI1A 4HDHA 2MKIA 2RS2A 4ECTA 3U1NA 2EI5A 1H7XA 3N0VA 1NK9A<