2HA8A

Methyltransferase domain of human tar (hiv-1) rna binding protein 1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
Knots found
sequence length
159
structure length
159
Chain Sequence
LGKSISRLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSAEQWLPLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYCFPEKSLLLLGNEREGIPANLIQQLDVCVEIPQQGIIRSLNVHVSGALLIWEYTRQQLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAR (HIV-1) RNA loop binding protein
publication title The Crystal Structure of Methyltransferase Domain of Human TAR (HIV-1) RNA binding protein 1 in complex with S-adenosyl-L-homocystein.
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 57
structure length 159
sequence length 159
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2ha8A01
1VH0A 4CNDA 4YQPA 3N4KA 4YQ1A 1J85A 1V6ZA 3GYQA 4JAKA 4YQQA 3KW2A 3BBDA 4YQLA 3IC6A 3AI9X 3NK7A 5D9FA 4YQKA 4YQ4A 4YPZA 4L69A 4YQIA 4MCCA 4CNEA 2QWVA 4RG1A 1O6DA 4YQJA 2HA8A 1X7OA 4YQAA 3QUVA 4YQ3A 4JALA 1MXIA 4H3YA 3ONPA 4YPXA 4YVGA 1K3RA 4YPWA 4CNGA 5GMBA 2Z0YA 4YQDA 4YQBA 3N4JA 3AIAA 2YY8A 3BBEA 3OIJA 3AXZA 4YQOA 4YPYA 5GM8A 4YVHA 3BBHA 5FAIA 4XBOA 1UALA 1ZJRA 1GZ0A 4YQ5A 3OINA 4YQ2A 3E5YA 4IG6A 1VHYA 3KNUA 3ILKA 2EGWA 4KGNA 4YQ8A 1V2XA 4YQRA 2QMMA 4MCBA 1NXZA 3IEFA 4MCDA 3KTYA 1Z85A 2O3AA 4PZKA 4YQNA 3L8UA 3OIIA 1X7PA 4YVJA 4YQ7A 1P9PA 1VHKA 4YQ0A 2I6DA 4YVIA 1UAMA 4YQ6A 1IPAA 4KDZA 4E8BA 4J3CA 5CO4A 4YVKA 4YQ9A 4FAKA 3KY7A 2EGVA 2V3KA 1NS5A 4X3LA 4H3ZA 4YQCA 2CX8A 1UAJA 4YQGA 4CNFA 4YQTA 3O7BA 1TO0A 4YQSA 5GMCA 1UAKA 3NK6A 1OY5A 4X3MA 2V3JA 3DCMX
chains in the Genus database with same CATH superfamily
1VH0A 4CNDA 4YQPA 3N4KA 4YQ1A 1J85A 1V6ZA 3GYQA 4JAKA 4YQQA 3KW2A 3BBDA 4YQLA 3IC6A 3AI9X 3NK7A 5D9FA 4YQKA 4YQ4A 4YPZA 4L69A 4YQIA 4MCCA 4CNEA 2QWVA 4RG1A 1O6DA 4YQJA 2HA8A 1X7OA 4YQAA 3QUVA 4FMWA 4YQ3A 4JALA 1MXIA 4H3YA 3ONPA 4YPXA 4YVGA 1K3RA 4YPWA 4CNGA 5GMBA 2Z0YA 4YQDA 4YQBA 3N4JA 3AIAA 2YY8A 3BBEA 3OIJA 3AXZA 4YQOA 4JWGA 4YPYA 5GM8A 4YVHA 3BBHA 5FAIA 4XBOA 1UALA 1ZJRA 1GZ0A 4YQ5A 3OINA 4YQ2A 3E5YA 4IG6A 1VHYA 3KNUA 3ILKA 2EGWA 4KGNA 4YQ8A 1V2XA 4YQRA 2QMMA 4MCBA 1NXZA 3IEFA 4MCDA 3KTYA 1Z85A 2O3AA 4PZKA 4YQNA 3L8UA 3OIIA 1X7PA 4YVJA 4YQ7A 1P9PA 1VHKA 4YQ0A 2I6DA 4YVIA 1UAMA 4YQ6A 1IPAA 4KDZA 4E8BA 4J3CA 5CO4A 4JWFA 4YVKA 4YQ9A 4FAKA 3KY7A 2EGVA 4JWHA 4JWJA 2V3KA 1NS5A 4X3LA 4H3ZA 4YQCA 2CX8A 1UAJA 4YQGA 4CNFA 4YQTA 3O7BA 1TO0A 4YQSA 5GMCA 1UAKA 3NK6A 1OY5A 4X3MA 2V3JA 3DCMX
chains in the Genus database with same CATH topology
1VH0A 4CNDA 4YQPA 3N4KA 4YQ1A 1J85A 1V6ZA 3GYQA 4JAKA 4YQQA 3KW2A 3BBDA 4YQLA 3IC6A 3AI9X 3NK7A 5D9FA 4YQKA 4YQ4A 4YPZA 4L69A 4YQIA 4MCCA 4CNEA 2QWVA 4RG1A 1O6DA 4YQJA 2HA8A 1X7OA 4YQAA 3QUVA 4FMWA 4YQ3A 4JALA 1MXIA 4H3YA 3ONPA 4YPXA 4YVGA 1K3RA 4YPWA 4CNGA 5GMBA 2Z0YA 4YQDA 4YQBA 3N4JA 3AIAA 2YY8A 3BBEA 3OIJA 3AXZA 4YQOA 4JWGA 4YPYA 5GM8A 4YVHA 3BBHA 5FAIA 4XBOA 1UALA 1ZJRA 1GZ0A 4YQ5A 3OINA 4YQ2A 3E5YA 4IG6A 1VHYA 3KNUA 3ILKA 2EGWA 4KGNA 4YQ8A 1V2XA 4YQRA 2QMMA 4MCBA 1NXZA 3IEFA 4MCDA 3KTYA 1Z85A 2O3AA 4PZKA 4YQNA 3L8UA 3OIIA 1X7PA 4YVJA 4YQ7A 1P9PA 1VHKA 4YQ0A 2I6DA 4YVIA 1UAMA 4YQ6A 1IPAA 4KDZA 4E8BA 4J3CA 5CO4A 4JWFA 4YVKA 4YQ9A 4FAKA 3KY7A 2EGVA 4JWHA 4JWJA 2V3KA 1NS5A 4X3LA 4H3ZA 4YQCA 2CX8A 1UAJA 4YQGA 4CNFA 4YQTA 3O7BA 1TO0A 4YQSA 5GMCA 1UAKA 3NK6A 1OY5A 4X3MA 2V3JA 3DCMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH0 A;  4CND A;  4YQP A;  3N4K A;  4YQ1 A;  1J85 A;  1V6Z A;  3GYQ A;  4JAK A;  4YQQ A;  3KW2 A;  3BBD A;  4YQL A;  3IC6 A;  3AI9 X;  3NK7 A;  5D9F A;  4YQK A;  4YQ4 A;  4YPZ A;  4L69 A;  4YQI A;  4MCC A;  4CNE A;  2QWV A;  4RG1 A;  1O6D A;  4YQJ A;  2HA8 A;  1X7O A;  4YQA A;  3QUV A;  4YQ3 A;  4JAL A;  1MXI A;  4H3Y A;  3ONP A;  4YPX A;  4YVG A;  1K3R A;  4YPW A;  4CNG A;  5GMB A;  2Z0Y A;  4YQD A;  4YQB A;  3N4J A;  3AIA A;  2YY8 A;  3BBE A;  3OIJ A;  3AXZ A;  4YQO A;  4YPY A;  5GM8 A;  4YVH A;  3BBH A;  5FAI A;  4XBO A;  1UAL A;  1ZJR A;  1GZ0 A;  4YQ5 A;  3OIN A;  4YQ2 A;  3E5Y A;  4IG6 A;  1VHY A;  3KNU A;  3ILK A;  2EGW A;  4KGN A;  4YQ8 A;  1V2X A;  4YQR A;  2QMM A;  4MCB A;  1NXZ A;  3IEF A;  4MCD A;  3KTY A;  1Z85 A;  2O3A A;  4PZK A;  4YQN A;  3L8U A;  3OII A;  1X7P A;  4YVJ A;  4YQ7 A;  1P9P A;  1VHK A;  4YQ0 A;  2I6D A;  4YVI A;  1UAM A;  4YQ6 A;  1IPA A;  4KDZ A;  4E8B A;  4J3C A;  5CO4 A;  4YVK A;  4YQ9 A;  4FAK A;  3KY7 A;  2EGV A;  2V3K A;  1NS5 A;  4X3L A;  4H3Z A;  4YQC A;  2CX8 A;  1UAJ A;  4YQG A;  4CNF A;  4YQT A;  3O7B A;  1TO0 A;  4YQS A;  5GMC A;  1UAK A;  3NK6 A;  1OY5 A;  4X3M A;  2V3J A;  3DCM X; 
#chains in the Genus database with same CATH topology
 1VH0 A;  4CND A;  4YQP A;  3N4K A;  4YQ1 A;  1J85 A;  1V6Z A;  3GYQ A;  4JAK A;  4YQQ A;  3KW2 A;  3BBD A;  4YQL A;  3IC6 A;  3AI9 X;  3NK7 A;  5D9F A;  4YQK A;  4YQ4 A;  4YPZ A;  4L69 A;  4YQI A;  4MCC A;  4CNE A;  2QWV A;  4RG1 A;  1O6D A;  4YQJ A;  2HA8 A;  1X7O A;  4YQA A;  3QUV A;  4FMW A;  4YQ3 A;  4JAL A;  1MXI A;  4H3Y A;  3ONP A;  4YPX A;  4YVG A;  1K3R A;  4YPW A;  4CNG A;  5GMB A;  2Z0Y A;  4YQD A;  4YQB A;  3N4J A;  3AIA A;  2YY8 A;  3BBE A;  3OIJ A;  3AXZ A;  4YQO A;  4JWG A;  4YPY A;  5GM8 A;  4YVH A;  3BBH A;  5FAI A;  4XBO A;  1UAL A;  1ZJR A;  1GZ0 A;  4YQ5 A;  3OIN A;  4YQ2 A;  3E5Y A;  4IG6 A;  1VHY A;  3KNU A;  3ILK A;  2EGW A;  4KGN A;  4YQ8 A;  1V2X A;  4YQR A;  2QMM A;  4MCB A;  1NXZ A;  3IEF A;  4MCD A;  3KTY A;  1Z85 A;  2O3A A;  4PZK A;  4YQN A;  3L8U A;  3OII A;  1X7P A;  4YVJ A;  4YQ7 A;  1P9P A;  1VHK A;  4YQ0 A;  2I6D A;  4YVI A;  1UAM A;  4YQ6 A;  1IPA A;  4KDZ A;  4E8B A;  4J3C A;  5CO4 A;  4JWF A;  4YVK A;  4YQ9 A;  4FAK A;  3KY7 A;  2EGV A;  4JWH A;  4JWJ A;  2V3K A;  1NS5 A;  4X3L A;  4H3Z A;  4YQC A;  2CX8 A;  1UAJ A;  4YQG A;  4CNF A;  4YQT A;  3O7B A;  1TO0 A;  4YQS A;  5GMC A;  1UAK A;  3NK6 A;  1OY5 A;  4X3M A;  2V3J A;  3DCM X; 
#chains in the Genus database with same CATH homology
 1VH0 A;  4CND A;  4YQP A;  3N4K A;  4YQ1 A;  1J85 A;  1V6Z A;  3GYQ A;  4JAK A;  4YQQ A;  3KW2 A;  3BBD A;  4YQL A;  3IC6 A;  3AI9 X;  3NK7 A;  5D9F A;  4YQK A;  4YQ4 A;  4YPZ A;  4L69 A;  4YQI A;  4MCC A;  4CNE A;  2QWV A;  4RG1 A;  1O6D A;  4YQJ A;  2HA8 A;  1X7O A;  4YQA A;  3QUV A;  4FMW A;  4YQ3 A;  4JAL A;  1MXI A;  4H3Y A;  3ONP A;  4YPX A;  4YVG A;  1K3R A;  4YPW A;  4CNG A;  5GMB A;  2Z0Y A;  4YQD A;  4YQB A;  3N4J A;  3AIA A;  2YY8 A;  3BBE A;  3OIJ A;  3AXZ A;  4YQO A;  4JWG A;  4YPY A;  5GM8 A;  4YVH A;  3BBH A;  5FAI A;  4XBO A;  1UAL A;  1ZJR A;  1GZ0 A;  4YQ5 A;  3OIN A;  4YQ2 A;  3E5Y A;  4IG6 A;  1VHY A;  3KNU A;  3ILK A;  2EGW A;  4KGN A;  4YQ8 A;  1V2X A;  4YQR A;  2QMM A;  4MCB A;  1NXZ A;  3IEF A;  4MCD A;  3KTY A;  1Z85 A;  2O3A A;  4PZK A;  4YQN A;  3L8U A;  3OII A;  1X7P A;  4YVJ A;  4YQ7 A;  1P9P A;  1VHK A;  4YQ0 A;  2I6D A;  4YVI A;  1UAM A;  4YQ6 A;  1IPA A;  4KDZ A;  4E8B A;  4J3C A;  5CO4 A;  4JWF A;  4YVK A;  4YQ9 A;  4FAK A;  3KY7 A;  2EGV A;  4JWH A;  4JWJ A;  2V3K A;  1NS5 A;  4X3L A;  4H3Z A;  4YQC A;  2CX8 A;  1UAJ A;  4YQG A;  4CNF A;  4YQT A;  3O7B A;  1TO0 A;  4YQS A;  5GMC A;  1UAK A;  3NK6 A;  1OY5 A;  4X3M A;  2V3J A;  3DCM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...