2HA8A

Methyltransferase domain of human tar (hiv-1) rna binding protein 1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
Knots found
sequence length
159
structure length
159
Chain Sequence
b'LGKSISRLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSAEQWLPLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYCFPEKSLLLLGNEREGIPANLIQQLDVCVEIPQQGIIRSLNVHVSGALLIWEYTRQQLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAR (HIV-1) RNA loop binding protein
publication title The Crystal Structure of Methyltransferase Domain of Human TAR (HIV-1) RNA binding protein 1 in complex with S-adenosyl-L-homocystein.
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 57
structure length 159
sequence length 159
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2ha8A01
4RG1A 1X7OA 3KNUA 2Z0YA 4MCCA 2CX8A 5D9FA 4YQDA 3OIIA 3L8UA 4YQAA 2V3KA 1X7PA 4YQIA 1O6DA 2O3AA 4PZKA 3NK6A 1UAJA 4JALA 4JAKA 1Z85A 4YPXA 2HA8A 4IG6A 1VH0A 4CNDA 1IPAA 4X3MA 4YQ6A 4E8BA 3OIJA 4YQ0A 3DCMX 2V3JA 3N4JA 4YQ8A 4YQ3A 3AI9X 1K3RA 4FAKA 3KY7A 3ILKA 4CNFA 4YQNA 4YQPA 4L69A 4X3LA 3IEFA 4J3CA 4YQCA 3BBHA 4YPWA 4YQTA 4YVIA 1NS5A 2YY8A 4YQ2A 4YQ4A 3AIAA 2I6DA 4YQ1A 1TO0A 1MXIA 1VHYA 3E5YA 4YQ5A 4YQRA 3GYQA 2QMMA 3QUVA 4YQ7A 1NXZA 4CNEA 3NK7A 4KGNA 3AXZA 4MCDA 4YQBA 4YQGA 4XBOA 5CO4A 1UAKA 1V2XA 1OY5A 4YQLA 1J85A 4YQJA 4YVHA 4H3ZA 5GMCA 2EGVA 4KDZA 5FAIA 1V6ZA 4YQ9A 1P9PA 4YPZA 5GM8A 4YQOA 3BBEA 3N4KA 3O7BA 4YVJA 4YQKA 4YVKA 3KW2A 1UALA 4YQSA 4YVGA 3OINA 1VHKA 4H3YA 4YPYA 3BBDA 4MCBA 4YQQA 2QWVA 4CNGA 3KTYA 1UAMA 3IC6A 1ZJRA 3ONPA 1GZ0A 5GMBA 2EGWA
chains in the Genus database with same CATH superfamily
4RG1A 1X7OA 3KNUA 2Z0YA 4MCCA 2CX8A 5D9FA 4YQDA 3OIIA 3L8UA 4YQAA 2V3KA 1X7PA 4YQIA 1O6DA 2O3AA 4JWGA 4PZKA 3NK6A 1UAJA 4JALA 4JAKA 1Z85A 4YPXA 2HA8A 4IG6A 4JWJA 1VH0A 4CNDA 1IPAA 4X3MA 4YQ6A 4E8BA 3OIJA 4YQ0A 3DCMX 2V3JA 3N4JA 4YQ8A 4YQ3A 3AI9X 1K3RA 4FAKA 3KY7A 3ILKA 4CNFA 4YQNA 4YQPA 4L69A 4X3LA 3IEFA 4J3CA 4YQCA 3BBHA 4YPWA 4YQTA 4YVIA 1NS5A 2YY8A 4YQ2A 4YQ4A 4JWFA 3AIAA 2I6DA 4YQ1A 1TO0A 1MXIA 1VHYA 3E5YA 4YQ5A 4YQRA 3GYQA 2QMMA 3QUVA 4YQ7A 1NXZA 4CNEA 4JWHA 3NK7A 4KGNA 3AXZA 4MCDA 4YQBA 4YQGA 4XBOA 5CO4A 1UAKA 1V2XA 1OY5A 4YQLA 1J85A 4YQJA 4YVHA 4H3ZA 5GMCA 2EGVA 4KDZA 5FAIA 1V6ZA 4YQ9A 1P9PA 4YPZA 5GM8A 4YQOA 3BBEA 3N4KA 3O7BA 4YVJA 4YQKA 4YVKA 3KW2A 1UALA 4YQSA 4YVGA 3OINA 1VHKA 4H3YA 4YPYA 3BBDA 4FMWA 4MCBA 4YQQA 2QWVA 4CNGA 3KTYA 1UAMA 3IC6A 1ZJRA 3ONPA 1GZ0A 5GMBA 2EGWA
chains in the Genus database with same CATH topology
4RG1A 1X7OA 3KNUA 2Z0YA 4MCCA 2CX8A 5D9FA 4YQDA 3OIIA 3L8UA 4YQAA 2V3KA 1X7PA 4YQIA 1O6DA 2O3AA 4JWGA 4PZKA 3NK6A 1UAJA 4JALA 4JAKA 1Z85A 4YPXA 2HA8A 4IG6A 4JWJA 1VH0A 4CNDA 1IPAA 4X3MA 4YQ6A 4E8BA 3OIJA 4YQ0A 3DCMX 2V3JA 3N4JA 4YQ8A 4YQ3A 3AI9X 1K3RA 4FAKA 3KY7A 3ILKA 4CNFA 4YQNA 4YQPA 4L69A 4X3LA 3IEFA 4J3CA 4YQCA 3BBHA 4YPWA 4YQTA 4YVIA 1NS5A 2YY8A 4YQ2A 4YQ4A 4JWFA 3AIAA 2I6DA 4YQ1A 1TO0A 1MXIA 1VHYA 3E5YA 4YQ5A 4YQRA 3GYQA 2QMMA 3QUVA 4YQ7A 1NXZA 4CNEA 4JWHA 3NK7A 4KGNA 3AXZA 4MCDA 4YQBA 4YQGA 4XBOA 5CO4A 1UAKA 1V2XA 1OY5A 4YQLA 1J85A 4YQJA 4YVHA 4H3ZA 5GMCA 2EGVA 4KDZA 5FAIA 1V6ZA 4YQ9A 1P9PA 4YPZA 5GM8A 4YQOA 3BBEA 3N4KA 3O7BA 4YVJA 4YQKA 4YVKA 3KW2A 1UALA 4YQSA 4YVGA 3OINA 1VHKA 4H3YA 4YPYA 3BBDA 4FMWA 4MCBA 4YQQA 2QWVA 4CNGA 3KTYA 1UAMA 3IC6A 1ZJRA 3ONPA 1GZ0A 5GMBA 2EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG1 A;  1X7O A;  3KNU A;  2Z0Y A;  4MCC A;  2CX8 A;  5D9F A;  4YQD A;  3OII A;  3L8U A;  4YQA A;  2V3K A;  1X7P A;  4YQI A;  1O6D A;  2O3A A;  4PZK A;  3NK6 A;  1UAJ A;  4JAL A;  4JAK A;  1Z85 A;  4YPX A;  2HA8 A;  4IG6 A;  1VH0 A;  4CND A;  1IPA A;  4X3M A;  4YQ6 A;  4E8B A;  3OIJ A;  4YQ0 A;  3DCM X;  2V3J A;  3N4J A;  4YQ8 A;  4YQ3 A;  3AI9 X;  1K3R A;  4FAK A;  3KY7 A;  3ILK A;  4CNF A;  4YQN A;  4YQP A;  4L69 A;  4X3L A;  3IEF A;  4J3C A;  4YQC A;  3BBH A;  4YPW A;  4YQT A;  4YVI A;  1NS5 A;  2YY8 A;  4YQ2 A;  4YQ4 A;  3AIA A;  2I6D A;  4YQ1 A;  1TO0 A;  1MXI A;  1VHY A;  3E5Y A;  4YQ5 A;  4YQR A;  3GYQ A;  2QMM A;  3QUV A;  4YQ7 A;  1NXZ A;  4CNE A;  3NK7 A;  4KGN A;  3AXZ A;  4MCD A;  4YQB A;  4YQG A;  4XBO A;  5CO4 A;  1UAK A;  1V2X A;  1OY5 A;  4YQL A;  1J85 A;  4YQJ A;  4YVH A;  4H3Z A;  5GMC A;  2EGV A;  4KDZ A;  5FAI A;  1V6Z A;  4YQ9 A;  1P9P A;  4YPZ A;  5GM8 A;  4YQO A;  3BBE A;  3N4K A;  3O7B A;  4YVJ A;  4YQK A;  4YVK A;  3KW2 A;  1UAL A;  4YQS A;  4YVG A;  3OIN A;  1VHK A;  4H3Y A;  4YPY A;  3BBD A;  4MCB A;  4YQQ A;  2QWV A;  4CNG A;  3KTY A;  1UAM A;  3IC6 A;  1ZJR A;  3ONP A;  1GZ0 A;  5GMB A;  2EGW A; 
#chains in the Genus database with same CATH topology
 4RG1 A;  1X7O A;  3KNU A;  2Z0Y A;  4MCC A;  2CX8 A;  5D9F A;  4YQD A;  3OII A;  3L8U A;  4YQA A;  2V3K A;  1X7P A;  4YQI A;  1O6D A;  2O3A A;  4JWG A;  4PZK A;  3NK6 A;  1UAJ A;  4JAL A;  4JAK A;  1Z85 A;  4YPX A;  2HA8 A;  4IG6 A;  4JWJ A;  1VH0 A;  4CND A;  1IPA A;  4X3M A;  4YQ6 A;  4E8B A;  3OIJ A;  4YQ0 A;  3DCM X;  2V3J A;  3N4J A;  4YQ8 A;  4YQ3 A;  3AI9 X;  1K3R A;  4FAK A;  3KY7 A;  3ILK A;  4CNF A;  4YQN A;  4YQP A;  4L69 A;  4X3L A;  3IEF A;  4J3C A;  4YQC A;  3BBH A;  4YPW A;  4YQT A;  4YVI A;  1NS5 A;  2YY8 A;  4YQ2 A;  4YQ4 A;  4JWF A;  3AIA A;  2I6D A;  4YQ1 A;  1TO0 A;  1MXI A;  1VHY A;  3E5Y A;  4YQ5 A;  4YQR A;  3GYQ A;  2QMM A;  3QUV A;  4YQ7 A;  1NXZ A;  4CNE A;  4JWH A;  3NK7 A;  4KGN A;  3AXZ A;  4MCD A;  4YQB A;  4YQG A;  4XBO A;  5CO4 A;  1UAK A;  1V2X A;  1OY5 A;  4YQL A;  1J85 A;  4YQJ A;  4YVH A;  4H3Z A;  5GMC A;  2EGV A;  4KDZ A;  5FAI A;  1V6Z A;  4YQ9 A;  1P9P A;  4YPZ A;  5GM8 A;  4YQO A;  3BBE A;  3N4K A;  3O7B A;  4YVJ A;  4YQK A;  4YVK A;  3KW2 A;  1UAL A;  4YQS A;  4YVG A;  3OIN A;  1VHK A;  4H3Y A;  4YPY A;  3BBD A;  4FMW A;  4MCB A;  4YQQ A;  2QWV A;  4CNG A;  3KTY A;  1UAM A;  3IC6 A;  1ZJR A;  3ONP A;  1GZ0 A;  5GMB A;  2EGW A; 
#chains in the Genus database with same CATH homology
 4RG1 A;  1X7O A;  3KNU A;  2Z0Y A;  4MCC A;  2CX8 A;  5D9F A;  4YQD A;  3OII A;  3L8U A;  4YQA A;  2V3K A;  1X7P A;  4YQI A;  1O6D A;  2O3A A;  4JWG A;  4PZK A;  3NK6 A;  1UAJ A;  4JAL A;  4JAK A;  1Z85 A;  4YPX A;  2HA8 A;  4IG6 A;  4JWJ A;  1VH0 A;  4CND A;  1IPA A;  4X3M A;  4YQ6 A;  4E8B A;  3OIJ A;  4YQ0 A;  3DCM X;  2V3J A;  3N4J A;  4YQ8 A;  4YQ3 A;  3AI9 X;  1K3R A;  4FAK A;  3KY7 A;  3ILK A;  4CNF A;  4YQN A;  4YQP A;  4L69 A;  4X3L A;  3IEF A;  4J3C A;  4YQC A;  3BBH A;  4YPW A;  4YQT A;  4YVI A;  1NS5 A;  2YY8 A;  4YQ2 A;  4YQ4 A;  4JWF A;  3AIA A;  2I6D A;  4YQ1 A;  1TO0 A;  1MXI A;  1VHY A;  3E5Y A;  4YQ5 A;  4YQR A;  3GYQ A;  2QMM A;  3QUV A;  4YQ7 A;  1NXZ A;  4CNE A;  4JWH A;  3NK7 A;  4KGN A;  3AXZ A;  4MCD A;  4YQB A;  4YQG A;  4XBO A;  5CO4 A;  1UAK A;  1V2X A;  1OY5 A;  4YQL A;  1J85 A;  4YQJ A;  4YVH A;  4H3Z A;  5GMC A;  2EGV A;  4KDZ A;  5FAI A;  1V6Z A;  4YQ9 A;  1P9P A;  4YPZ A;  5GM8 A;  4YQO A;  3BBE A;  3N4K A;  3O7B A;  4YVJ A;  4YQK A;  4YVK A;  3KW2 A;  1UAL A;  4YQS A;  4YVG A;  3OIN A;  1VHK A;  4H3Y A;  4YPY A;  3BBD A;  4FMW A;  4MCB A;  4YQQ A;  2QWV A;  4CNG A;  3KTY A;  1UAM A;  3IC6 A;  1ZJR A;  3ONP A;  1GZ0 A;  5GMB A;  2EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...