2HAKA

Catalytic and ubiqutin-associated domains of mark1/par-1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
309
Chain Sequence
PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural variations in the catalytic and ubiquitin-associated domains of microtubule-associated protein/microtubule affinity regulating kinase (MARK) 1 and MARK2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
molecule keywords Serine/threonine-protein kinase MARK1
total genus 100
structure length 309
sequence length 317
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2hakA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hakA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hakA01
3EZRA 4KNBA 2RFNA 4AW5A 4RLKA 4IC7A 2X8EA 3QWJA 4ZP5A 3TNIA 4RBLA 4EHZA 3DKGA 2CLXA 4K0YA 1WMKA 4FSTA 4W9WA 3RZBA 3ROCA 3SAYA 5CANA 3ROYA 2B9HA 4AWIA 1WR1B 1PKGA 3VHEA 3PXKA 4RQVA 3UO4A 3PXQA 3A61A 2REIA 4O0TA 5GINE 4XH6A 2YERA 4EK4A 1B39A 2VGOA 2Y4IB 2OXDA 3F5PA 4QYGA 4G2FA 3TKIA 2WIHA 3P79A 3FSFA 1J1CA 3KRLA 4YO4A 4YZBA 4EONA 2JAVA 4DFUA 4C4EA 3G0FA 3EL7A 5HTIA 3DT1A 4U43A 3M11A 5EI8A 2ZV7A 4FKWA 4YTHA 3R63A 4RC2A 3LKMA 4YBJA 2J90A 3FZRA 4KIQA 3VNTA 1IR3A 3Q6UA 3ZH8A 3UZRA 4QP9A 4N6ZA 5AR4A 5CXHA 3CEKA 2QG5A 3NUUA 4IWDA 2FH9A 2CKPA 1P3QQ 3N51A 4OTWA 4AT3A 2X7OA 1Y6BA 3Q4UA 3EH9A 2IN6A 2OZAA 2YCRA 3F3ZA 3LW0A 3TNQB 3QTSA 2QHMA 1PY5A 2GDOA 3PPZA 4BZOA 3R04A 4M66A 4YO6A 5BVKA 5AFVA 4M8TA 4FEWA 2IW6A 4MTAA 5CVHA 5C01A 4TWOA 3R7VA 5A6NA 5BMSA 5IQGA 2CJMA 2W1DA 2WOUA 4EZ7A 2YFXA 1VYWA 2JBPA 4IW0A 2UW4A 3QCXA 5H8BA 4ERWA 2QD9A 4L43A 4TPTA 4U40A 4ONAA 2IZSA 3BU5A 4ANLA 4BB4A 4I4EA 5C8MA 4OTRA 2OJ9A 4BWPA 4FL3A 3R01A 3UO6A 3UDBA 2OIBA 2PU8A 3TWJA 2HWPA 2OU7A 3W1FA 3QALE 5CSVA 3D5VA 3Q2MA 3EQHA 3O0GA 5HCYA 3ZS5A 1YDTE 3GU6A 4YP8A 4OAUC 3KULA 2OWBA 3TV7A 1OL6A 4RVTA 4RG0A 1VQ1A 5E8YA 1U59A 3MSSA 5TKDA 3NAXA 4FKGA 3GC9A 4H05A 4OBQA 2WQOA 3HMIA 2MGWA 2VWVA 4RMZA 4O1OA 4NL0A 2IW9A 1TQMA 4BRXA 3G51A 2IJMA 1ZY5A 3RAKA 4JDIA 4TZRA 5IA2A 1JLUE 4PDYA 2CLQA 5HNBA 4UWBA 1OBDA 3VF8A 1BLXA 5C03A 3G9NA 3PLSA 4MF1A 4NCTC 4UBAA 2R3OA 1PXKA 3OWPA 1YRPA 4ALVA 4AOTA 3LLTA 3W2QA 2UZEA 2IWIA 4XP2A 2J2IB 4CZUA 5JT2A 2BKZA 3SX9A 5KX8A 3IW4A 3ZFMA 2JY6B 2AUHA 3AQVA 4YJTA 2GHMA 3VWAA 2YDJA 2G15A 3E3PA 3OROA 3DTCA 3VW6A 1ZOEA 3ACKA 4F6UA 2OG8A 1PXMA 2G9XA 2OJIA 5AUWA 5KKRC 4FODA 2A1AB 4H36A 4ASXA 5E8UA 3EKKA 4G3EA 4X6QC 4NFMA 1SMHA 4E6AA 1OL2A 2PMLX 3OTVA 3FZ1A 5CEOA 4LL5A 1YHSA 4P5ZA 4QQCA 4O7VA 2OLCA 3NMUF 2RG6A 4FSZA 4AAAA 4M12A 3KRWA 4WG5A 5H9BA 3UZPA 1MN3A 3H0ZA 3OHTA 5EOBA 2YA9A 3LAUA 2C6EA 3TIYA 3CIKA 4HYUA 4LRJA 4EQUA 4MXCA 5JZNA 5TT7A 2ZV9A 3ORXA 1VEJA 3TNWA 3QWKA 2DQ7X 5AUYA 5FP5A 1YOJA 5IA3A 5KHXA 3NNWA 1U54A 1VZOA 3WARA 4M0YA 3UIMA 3HMOA 5IMXA 4A9RA 4CYIA 2R0IA 4NK9A 3DNEA 2DENA 2JITA 3PZEA 4NW6A 2CKEA 4TYJA 4EBWA 1NVQA 3LLAA 3II5A 2OOBA 2JIUA 2F7EE 3DKFA 3MH1A 4ENYA 4U81A 1OZ1A 3UPXA 4CNHA 4EQCA 4S34A 4RFMA 1KWPA 3BQCA 2KNZA 1Q24A 4DTAA 4Y72A 5HD4A 1IG1A 3R1NA 4R3CA 1KUTA 4IC8A 4AW1A 4M97A 4QPAA 4BGQA 5CQWA 3CTHA 3MW1A 4F0FA 5I0BA 3QL8A 1CMKE 2ZYBA 1ZYSA 2PVMA 3MI9A 3KCKA 4IXPA 4O0WA 4XOYA 4ZSLA 2IVUA 3CD8A 5KBQA 4L01A 4JXFA 5D9HA 4AU8A 4YUQA 1KOAA 3LXNA 4DH7A 4GFGA 4F2LA 1WBSA 1ZRZA 3PRIA 3A7JA 4U42A 3N4TA 4N57A 1ZYDA 4U0IA 2WMVA 3QUEA 3RK7A 4EORA 4A4LA 2XNEA 1MUOA 1E94E 4ZTSA 3PFQA 4QP4A 4W4YA 4E5AX 1OL1A 2XJ0A 4ITIA 4FV3A 4NJ3A 4QP6A 5EQEA 2J0LA 4S33A 4M67A 1GZKA 4HNIA 4IVDA 3KB7A 4GU9A 2DS1A 2G3QA 2J4ZA 4FSQA 1RJBA 4DH1A 3QQUA 4F1IA 2QU6A 2P0CA 5E91A 1OPJA 2I40A 4HVHA 5FWKK 3E93A 3AT2A 5D41A 3F7ZA 3A7HA 4IAIA 4TYGA 3GT8A 3PJ3A 4NU1A 4BFMA 3HDMA 5EDRA 4D4YA 5TOZA 4CV8A 4AXAA 4QP3A 1UVRA 4BDKA 3FZSA 5IU2A 2B9FA 3PXYA 3W2OA 2IZRA 2OJJA 4ANOA 4V0GA 4O91A 5L2TA 2JIIA 1U4DA 2XNNA 3ANQA 3QFVA 5EG3A 3V01A 4BZDA 3ZLSA 3ENHA 3Q6WA 2BMCA 2XKDA 3IW8A 4GG5A 3GCVA 2XNGA 2WTWA 1QZEA 2C6MA 3OXTA 1WBVA 3HLLA 3BPRA 3LFBA 1PXPA 4O84A 5F94A 4F9CA 2A2AA 2BWBA 4ENXA 2QNJA 3DKOA 4O6EA 5HO6A 2CHLA 4GVAA 3DXQA 5ANDA 2JD5A 1VG5A 3S2PA 2XBAA 2GFCA 2C3JA 4GG7A 3NUAA 5HICA 2WQEA 2JY7A 1QPEA 4AE6A 2C47A 4FTLA 1BVSA 1H1SA 2XYNA 4KABA 4YC8A 3VBQA 4GEOA 2WTJA 5EKNA 3BELA 3QQFA 5DT4A 4WT6A 3HP5A 2GNJA 3A60A 4YLJA 3RWQA 4YU2A 4IQ6A 1H0VA 4FC0A 4C34A 2C3LA 1YXSA 4NUSA 4MX9A 3U8WA 1T46A 1Z5MA 2W99B 3DTWA 4C59A 2O2UA 4L44A 3BYVA 4ZLZA 2KTYA 3V5WA 4BWKA 2G1TA 2LVOC 2XZSA 3LQ3A 3KVXA 4YZMA 2R7IA 3RM6A 4EJNA 4I5CA 5DH3A 5FTOA 3WOWA 5AWMA 5IDNA 5M08A 3CY2A 4EOLA 3TDWA 2WQNA 2R3KA 3ZYAA 4BDCA 3CS9A 5GZ8A 5J8IA 3LFCA 4C57A 4ZMFA 3KXNA 4FICA 3QQGA 3LMHA 3EQBA 5FM2A 5F95A 1T43A 1WBNA 3DQXA 4J96A 2CN5A 3OEFX 3K3IA 3UE4A 5AAGA 3AGLA 4CZTA 5IH6A 3MS9A 4IACA 3CJFA 4E20A 4CT1A 1OECA 3KRRA 1FQ1B 1JKLA 2UUEA 2YLFA 4EOJA 5B2MA 2ZMCA 3FLYA 3OFMA 3PA4A 1OUKA 1RDQE 1P2AA 1J7UA 5HESA 3DK7A 2B0QA 3PVWA 4QPMA 2OH0E 3KEXA 4AFEA 3PG3A 5AV1A 4PWNA 3WIKA 4EK8A 4D55A 3ZTXA 3W2PA 4EC9A 3BHHA 1QPDA 3NW5A 3LCSA 4PQNA 3PRFA 1K2PA 2F57A 2P55A 1ZYLA 3RCDA 4F9AA 3JR1A 4XHKB 3SV0A 4YLLA 2WMQA 3MFSA 2UVYA 5D7AA 2YIYA 3RPRA 3BU3A 4IVAA 3WBLA 2YWPA 3B8QA 1LEZA 2OXXA 4DCEA 4DFBA 1P14A 3G90X 4R71A 4BCKA 4FNWA 2QR8A 1F5QA 5K0KA 4RZVA 2EU9A 2Z7SA 3LE6A 5CAPA 4FTNA 3ZXTA 4AP7A 1R3CA 3COHA 4RA4A 5J5SA 3A7IA 1WVXA 4FV1A 5LMBA 4R1YA 3AGMA 4DTBA 3RAWA 5M4UA 4CV9A 3UBDA 4FSMA 4FG7A 4IM2A 4X2KA 3AT3A 3CTQA 3G6GA 2BFXA 4QTAA 3VVHA 3NYOA 3PVBA 3DY7A 4CYJA 1H24A 2W5BA 4Y8DA 1JSVA 2C3KA 3SG9A 3QQLA 4NM3A 3JS2A 4CXAA 4ZTQA 1JQHA 4D1XA 1DAWA 4UMQA 3S3IA 5BNJA 2P2HA 4BR3A 2UZVA 3EOCA 2HYYA 2ZM3A 4IH8A 2IO6A 4YBKA 5JFWA 2OF4A 3UQGA 1UU3A 3OUNB 1DM2A 2CMWA 4FUXA 3QTZA 3W8LA 4JG6A 1OL5A 4D58A 4QP2A 3E8EA 2GHGA 4PL3A 2ONLA 2J7TA 3I7CA 4FX3A 2JIVA 3E63A 1BL6A 2C0IA 4PNIA 4XG9A 4OBPA 1MRUA 2JKQA 3RTPA 4FVRA 2I0YA 4PMPA 3F2AA 4FSNA 4C4HA 5L2SA 5M06A 5J79A 3D0EA 3P86A 3R1YA 4JAIA 3GENA 3PLAE 4WIHA 2BROA 5HQ0A 3EWHA 2PZPA 3Q3BA 3U9CA 3WZEA 4ALWA 4BIEA 3CC6A 1W7HA 3VS0A 4U7ZA 5FTQA 4O83A 1NT2A 3KXHA 3DAKA 3OCTA 1E1XA 1FVVA 3AC4A 3NWWA 4WNOA 5FEDA 4DHFA 4UWYA 2NO3A 4FR4A 4C7TA 3FBVA 1XH7A 2BCJA 3QHRA 4BCOA 5DEYA 4RX8A 2GS6A 1Q8YA 1PMVA 3OUKA 4L67A 4V0GB 3PA3A 3EFJA 3L9MA 3ZUVA 2JGZA 3OC1A 4C2WA 1NXKA 2XIKA 3SVVA 4E93A 4WG4A 3BEAA 4QT1A 4FSUA 4CT2A 1OPKA 1NA7A 3TZ9A 4E5WA 3BYOA 5HE1A 4KS8A 4DFYA 1F3MC 2C6KA 3WE4A 3E88A 4FL2A 4NTSA 4TTHB 3AMAA 3OWLA 2XJ1A 2WTDA 4IJPA 4DG0E 3VW8A 5FBOA 1AQ1A 3D9VA 5AR2A 4BL1A 2CP8A 4B8MA 4PPAA 2X2KA 3KL8A 4UXQA 4QMNA 2UV2A 5CX9A 2J6MA 3EFWA 3U87A 5DMZA 1M2PA 4YHFA 2O3PA 1E9HA 5HCXA 3U9NA 2BUJA 2EVAA 1YOMA 3W10A 3D83A 2QOFA 3BE2A 2F2CB 3F88A 2QOCA 4H1MA 1ZWSA 4MNEA 3TKHA 2R4BA 4D5KA 3UIXA 5JFSA 1J7IA 3R6XA 2AC5A 3CKXA 2AC3A 3RPOA 3U6JA 2W4KA 4RJ7A 4EK3A 5KE0A 2HWOA 4M69B 4HNFA 4O27B 3IS5A 3BGQA 1ATPE 5AUVA 3OW3A 2E9PA 4BHZA 4D2VA 4FG9A 4ZZOA 4LMUA 3PWYA 4IB1A 1R0EA 3I60A 3R2BA 4FT5A 4JR7A 3EQIA 2WTVA 2WKMA 4Z7GA 2YCFA 5BYLA 3LCDA 4QNYA 2J9MA 2QSFX 2J51A 3ORPA 3MPAA 4PL4A 5CF6A 5FM3A 2VO7A 5EHYA 1FBNA 3ZFYA 5JFXA 4FZAB 4HCUA 3QQKA 4YURA 1O6YA 1OIRA 2AYPA 2VTAA 2BRMA 3JUHA 4JQ8A 2GNHA 4Y73A 5CAQA 5KMKA 2G2FA 3TNPC 4HGLA 2UW0A 3O8UA 5H3QA 3HP2A 2FSLX 4JL9A 3JY9A 3BZ3A 2Z7QA 5E1SA 3OWKA 4F09A 5K4JA 2PYWA 3OOMA 2JDOA 3DFAA 1DV0A 5I9UA 3R73A 5H8GA 3ZONA 5A3XA 3HUCA 2ERZE 4JDJA 3KKVA 1H26A 5JEBA 3GQIA 3QRJA 4FTTA 4JQ7A 5IEYA 3FL5A 2E9UA 4ACHA 2XRWA 4AF3A 2XRUA 4CG9A 3F3TA 1GAGA 3POZA 3W33A 2R5TA 2GS2A 5A4QA 3OOGA 2ETKA 2IVTA 2IVSA 2MJ5B 2A4LA 4L53A 1GZNA 4RZWA 4O6LA 5IQDA 4NM0A 4DBNA 4G3GA 4FNZA 5JH6A 3UO5A 2VTPA 2YLEA 3GFWA 2QOOA 1MQBA 3IONA 4I23A 4KINA 5CU4A 4PV0A 5E8ZA 5EDQA 1JPAA 3IKAA 3U55A 4KD1A 3NDMA 5ETFA 1XBBA 3NNVA 3C4XA 5DWRA 4B0GA 3PDTA 3QZHA 2DAKA 1BMKA 2HWJA 1ZLTA 4FT9A 4KWPA 4EOSA 5JKGA 5FEQA 1H07A 3FXZA 5I5ZA 1Q02A 4MYGA 1YOLA 4A4XA 3ORMA 1XJDA 3UNJA 4FSYA 1Q3WA 1IM2A 4GYIA 3FLWA 2OICA 2VRXA 4JAJA 4QMZA 5HNGA 4D2SA 2ITXA 4D9TA 1M17A 3SGCA 3OS3A 5J9LA 5K9IA 2O64A 1BYGA 3R21A 2GPHA 5E92A 2A27A 2NRUA 1XO2B 4FK6A 3L8XA 2W9ZB 1S9JA 3MTFA 4IB0A 2I6LA 1TQIA 2X8IA 2WIPA 4CSVA 2JY8A 5EHOA 3DZQA 4MKCA 2DNAA 2C0TA 3LM0A 2C5YA 1K3AA 3MH2A 5E8WA 3Q32A 1SM2A 4W8DA 2OZAB 3F61A 3OBGA 1ZARA 2PMIA 4PL5A 1GIJA 2X8DA 3R22A 1AIPC 1Y57A 4GIIA 3BGPA 5BVWA 3MA6A 4GL9A 2GHLA 4UMPA 1OIUA 3BYUA 4WRGA 4APPA 4FT3A 5EW8A 3IG7A 5HHWA 4KAOA 2WTKB 3PSDA 3PG1A 5HG8A 5JK3A 2OKRA 4FG8A 2HAKA 4JVGA 3W2SA 5AUXA 2H9VA 1OKZA 3F5XA 4HCVA 4LOQA 4E4LA 4E73A 1Q99A 2WHBA 4FV7A 4Z55A 5C9CA 1FVRA 4RFYA 4FIIA 5EDPA 4DEHA 4WNKA 4C35A 3FLSA 2UW8A 1BX6A 4N6YA 4U80A 3L9PA 3E21A 4XRLA 1O6LA 3R8LA 3FRIA 2KULA 3D2IA 2WPAA 3UJGA 4ZY5A 3LJ0A 4BDDA 4IDVA 1PRYA 3F5GA 4L52A 4WO5A 3HECA 4KRDA 3QCYA 2V7OA 5IUGA 4AA5A 3AT4A 3GQLA 4GH2A 5J95A 3FC1X 5C4LA 2H8HA 1HOWA 4MXXA 4FSRA 4JX7A 4DEAA 3ZZWA 2VV9A 2WOTA 5E7RA 1OAIA 3PP1A 5KNJA 3MVMA 4WP2A 4LGHA 1PXNA 4TW9A 3RI1A 4I92A 4CFMA 2YITA 3V8SA 3OXIA 5CZIA 1G3NA 4J95A 2PE1A 1REKA 5AR5A 5CU0A 5M4IA 1LEWA 5BQ0A 2OFUA 1V0PA 5ANIA 1VYZA 3DQWA 3TCPA 5CSWA 4NEUA 4BCNA 3NZ0A 4Q5HA 3T3UA 2C4GA 3EFKA 1KOBA 3DK3A 4PRJA 4ZZNA 3A62A 3HMMA 3LFDA 3BHTA 3C50A 3W18A 4A7CA 4BCJA 2ZB1A 3GNIB 2E2BA 3KMMA 4DLJA 3P23A 3CSVA 3O2MA 5I3OA 3PY0A 4O7NA 4MF0A 2FUMA 2JKOA 3BI6A 5DRDA 4CRSA 4OLIA 2HIWA 1SZMA 1T6OA 4GT4A 3NIZA 3ZZEA 2X81A 3MFUA 2XM8A 2XNPA 3GCUA 4GUEA 4ANQA 4EH3A 4FKUA 4K1BA 4EOQA 4L45A 3PE1A 3H9FA 4X2GA 3ATSA 2ITZA 4K77A 4XJ0A 5AUZA 1UFZA 4RSSA 3RAHA 5E4HA 1WZYA 2OW3A 4FV5A 2P2IA 4O0SA 4FMQA 4XBUA 3WF7A 4QMMA 1SNUA 2QLQA 4AFJA 4LUEA 1DI9A 4EL9A 5AUUA 4EJ7A 1OUYA 4FF8A 3PJ1A 1OITA 3F7WA 4I20A 2V22A 4DITA 3PVUA 5C26A 3WZDA 3SXRA 4AZEA 4CQEA 4MWIA 2HZIA 3PXZA 5GJGA 4HYIA 4QOXA 3R8VA 2G2IA 3VF9A 5HBEA 2CNQA 4XG3A 3FV8A 2PVLA 3G2FA 1NW1A 4EKLA 2F49A 4E6DA 3O51A 1SVGA 4AN3A 3GLFE 1FMOE 4RRVA 1OB3A 3ZDUA 4CMUA 1WBPA 1OQYA 2Z8CA 5GHVA 4HYHA 4DG3E 4OTHA 3IGOA 1C7YA 3KFAA 3MPTA 4CLJA 2OBJA 3QD2B 2JDTA 3EQGA 4G6NA 2FGIA 3NYVA 3ZM4A 4WG3A 2NP8A 1J91A 3BBZA 1M14A 4KUJA 5KHWA 4TWNA 2CKOA 4JQEA 3I6WA 3CE3A 3WZUA 3QLGA 5FTGA 5DRBA 4ALUA 2MR9A 3C0IA 4ERKA 5IH5A 4QYEA 4CCUA 3NNXA 3F2NA 5M4CA 2ZDTA 3HRFA 2XA4A 5HGIA 5M55A 4UN2B 5DHJA 2QONA 5FXRA 1JKSA 4XS2A 2ZTCA 2EB2A 2Q0BA 4KSQA 2RRUA 4K11A 3ORLA 2L4FA 3QF9A 5AP6A 1ERKA 4MXYA 3DBQA 2HOGA 4RWIA 2K0BX 2W1EA 3OY1A 4C58A 3SG8A 3FAAA 3MFTA 3QZFA 1PMEA 2F4JA 5DPVA 2B4SB 5K3YA 3R83A 3ZCLA 3MVLA 4AOIA 3DJ5A 4IM0A 5K5NA 4FSWA 4IX5A 4UMTA 3B89A 1MRVA 3COIA 4GFMA 1PMNA 5CS6A 3V5QA 3R71A 2VWZA 3DAJA 3RCJA 2UZWE 3HGKA 3QBNA 4PTCA 3BU6A 3DAEA 3PUPA 4O7LA 3KN5A 2FSTX 3NNUA 2VX0A 4FV2A 5IA4A 3GC7A 4FKOA 3UIUA 2EWAA 4HZRA 4A9UA 4BDIA 4RIWB 3WF8A 5DE2A 4PY1A 4EEVA 1OIYA 2OGVA 1WGLA 1APME 4I1ZA 3S1HA 4TWPA 4O7TA 1ZY4A 3UPZA 2R64A 4KIPA 5JGDA 3HVCA 1FINA 3DA6A 3NR9A 4FTRA 3AG9A 2BR1A 2WMSA 4G5PA 4D2TA 3IECA 5EW3A 3UOHA 2B9IA 4XRJA 1HQYE 2R3MA 3P7CA 5ACBC 2QURA 5LMKA 5M56A 5T68A 3KXGA 5IA1A 5HI2A 5IQBA 3I5NA 2XMYA 5LCKA 5A54A 4TYIA 4TXCA 1ZYCA 2C5NA 4FTQA 3GLGE 4D28A 2O8YA 2XCKA 2PZIA 1DS5A 2WMWA 3KRXA 4UN0C 5JMSA 4CKJA 2PVNA 4U3ZA 3SW7A 4CCBA 3COMA 4K9YA 3TTIA 3AC3A 4O7SA 2GTMA 1OI9A 4PTGA 3EN6A 4QTCA 5CEIA 3SHEA 4ZTRA 3HA8A 1KE9A 3MESA 1H01A 2BHHA 2XVDA 4C8BA 5KZIA 4DT8A 2C0OA 3GFEA 4YJPA 5HX8A 3C5UA 3ZO1A 3KMUA 3BBWA 4OT6A 5L2IA 3ORIA 5HD7A 3V5TA 1URCA 2BRBA 3GOPA 4BBMA 2I1MA 3ORKA 4ZSGA 4FZFB 1ZMUA 3ORZA 4NH1A 2PPQA 4TY1A 1P5EA 1Y8YA 2PY3A 4XG4A 4E4XA 4O7ZA 3VUGA 3QRKA 4ZAUA 4W4WA 4Q5EA 1TR8A 4MNFA 4L9IA 3UYTA 2P3GX 3MFRA 3HL7A 2W1FA 4PMMA 4OGRA 4I5PA 2DUVA 3QGWA 4FEQA 4IB3A 4JRNA 5H8EA 3ZC6A 4AUAA 2C6TA 3CPCA 4H3BA 5JRQA 4O96A 4IX3A 3SKCA 1VEBA 3TZMA 4D0XA 3Q4ZA 2BZJA 5EQYA 3MVHA 2FB8A 4QMTA 4BDFA 2V0DA 2BZKB 5HKMA 4LMNA 3OBJA 4WUAA 1UKHA 2PMNX 2IG7A 2YEXA 1I44A 1DAYA 4I41A 3ID6C 2VZ6A 5AA9A 2QOLA 3DBFA 3N9XA 2E9OA 3OW4A 2QG7A 2WO6A 4CVAA 4U3YA 2IPXA 3CQWA 1O9UA 4EUUA 4PP9A 3O7LB 4Z9LA 3TXOA 3E62A 3FYJX 1YI6A 2W7XA 4GYGA 4LRMA 5EFQA 1M2QA 3OD6X 3IW7A 2DAEA 3ZU7A 4DEEA 4AG8A 1RE8A 4HGEA 3UZTA 3OZ6A 4K2RA 2WU6A 4G17A 2J0MB 3ZM9A 4MD7E 3H9RA 4BTMA 2CN8A 4ITHA 4IWPA 4YJVA 2PZYA 4K18A 2ITPA 5L2WA 1IA8A 5L6OA 2HCKA 3GCSA 3R7YA 3GLHE 2BHEA 5HE2A 4C33A 2BILB 3DKCA 1W84A 4AT4A 3KCFA 5GIPE 3OEZA 2ZV2A 4IZ7A 2LTUA 4W9XA 1KE8A 3PE2A 4XYFA 4AE9A 4ASEA 3R9RA 3QZIA 1Y8GA 2ESMA 3Q4TA 4GK4A 3F3VA 1FOTA 2CKQA 3QX2A 5EM6A 3VS2A 4FKVA 2VGPA 1XXHE 3W16A 2I0EA 5CT7A 3ZBFA 3KULB 1RQQA 2HENA 5IUIA 3DBEA 3IDPA 5J9YA 4KKGA 4YHJA 2NRYA 4QO9A 3ERKA 4Y5HA 2ETMA 1H08A 2CCIA 2JLDA 1Q8WA 3HNGA 3IOKA 2R3QA 4QMWA 4FGRA 3QRUA 3L8PA 4QTDA 3E8NA 5CNNA 2YDKA 3CD3A 3LVPA 1K9AA 3NUNA 5LARA 4ASZA 3LOKA 5M53A 3QXPA 4N0SA 3VS1A 2UVZA 1UU9A 3VAPA 2QR7A 3UGCA 4B6LA 5EQPA 4MBLA 1R0PA 4DEDA 3EQDA 5LWNA 5JQ8A 2Z7LA 4F63A 2VTNA 5KMLA 2GMXA 3A7FA 4H3PA 4MQ1A 4P2KA 2YABA 4BI2A 2RIOA 3K5UA 4IAZA 3VUIA 4C2VA 1WAKA 4KBKA 1EFUB 2QVSE 4QP1A 4X21A 3NYXA 5DLSA 3WF6A 5CSXA 4BDHA 5AAFA 5LVMA 4R7BA 2OIDA 4DFZE 2FYSA 3DV3A 1KV1A 1FMKA 4XV1A 4AGWA 4E1ZA 5EK7A 2W1ZA 1JR3E 2WMAA 3I6UA 5CVGA 4RT7A 4UMRA 4USFA 2B9JA 2W5HA 4BF2A 5DFPA 2I7QA 4NIFA 1YWRA 4XLIA 4C61A 4RIYB 3LXLA 3GEQA 5EYCA 2YJSA 4XEYA 1STCE 2JFLA 4GK3A 4BN1A 2XK3A 1R78A 4DEGA 5AP2A 3M42A 3KK9A 3QAME 4FZ7A 4JG7A 4W8EA 5DR6A 2GS7A 4EHGA 3BIZA 5EOLA 3K5VA 2JUJA 3S00A 2YZLA 1UWJA 2QHNA 4WBBB 3UMWA 2R9SA 3BE9A 3POOA 4EOIA 3MJ1A 3KF4A 3RK9A 3C9WA 3R9DA 3S95A 2CGXA 2WZJA 3QA0A 4IVCA 4RWKA 5HG9A 3UVQA 3D5XA 3QTRA 3WYXA 4HW7A 5BVFA 4Y46A 4IAYA 3Q60A 2QCSA 3C51A 5AP5A 3P5KA 4DH8A 4MK0A 4ANNA 5F1ZA 2R0UA 3AC1A 3A8WA 5JSMA 2ITVA 3EQPA 2JFMA 2VTSA 4M68A 4F7JA 2C6OA 4B8LA 2NNWB 1XH9A 4YJRA 2BAJA 4C02A 4EZ5A 1JWHA 4KKHA 4PPBA 1MQ4A 3MTLA 3ZRLA 3FHRA 2I0HA 2DHYA 1PKDA 3NUSA 2FVDA 3KQ7A 5K4IA 4DGNA 1SG9A 3HX4A 5ANGA 3QUDA 5HVYA 4ZLYA 4ACCA 3FKOA 4Z3VA 2R3NA 4FTKA 2WTKC 3DK6A 4RPVA 3V8WA 3R8PA 1HT2E 4GCJA 1KE6A 2WNTA 4FTIA 2WTCA 3W32A 4NYEA 1IXSA 3IHPA 2R3GA 3PPKA 1Z9XA 5CSHA 1V0OA 1OGUA 3H0YA 2IZUA 4FV8A 1PXLA 3DCVA 2JZ1A 4OAVB 2F7ZE 5M4FA 4AGCA 1ZOGA 3CCNA 2B53A 2VTLA 3GC0A 4MBIA 5ETIA 4MVFA 4FIFA 4O21A 5A6OA 4PNKA 1I09A 3PZHA 5AADA 4AT5A 5EH0A 4L3PA 4OR5A 4I6QA 3UIBA 5CF8A 5IDPA 1REJA 4RQKA 3RP9A 2DKLA 3SRVB 5HORA 2WQBA 4ACGA 3VO3A 3ZDIA 4DEBA 4DGLC 5IF1A 3ENMA 2YACA 4O38A 1P4FA 4AGUA 4RC3A 2BFYA 4XLVA 1W98A 4LV8A 4JR3A 2JP7A 1XH4A 4EYJA 1H0WA 4ZXTA 4BDBA 4CRLA 4F64A 1YW2A 4R7HA 2WXVA 3MIAA 5AX9A 4FEUA 4M69A 4BCPA 4X3FB 2XEYA 3LMIA 2VWYA 2RFSA 2O65A 3KREA 2L4EA 5ETCA 1NVSA 3K9PA 2KNVA 2HY0A 5DR9A 2ZM4A 5HO7A 4DA5A 2PZ5A 3R1SA 3DS6A 5A4EA 3AOXA 4F6SA 2XIZA 2LGCA 3QA8A 4QTBA 5DIAA 4X7QA 2DAIA 1MP8A 5IKWA 5HVJA 4F9WA 3UG1A 5LXMA 2FSOX 2UZUE 3I4BA 4NSTA 3UNKA 4FT0A 4RX7A 5DBXA 5LOHA 3LXPA 1H25A 2A19B 2W4JA 4QPSA 3T3VA 2J5EA 1UA2A 4FK3A 3P08A 4S31A 3BV2A 4KKEA 4WA9A 1G8SA 1KYIA 1J3HA 1AD5A 1U46A 3QYWA 4J8NA 4RIOA 2BDFA 5B2KA 3FE3A 5IQCA 1YDSE 3ETAA 4CFVA 5LMKC 4NFNA 5FD2A 5JQ5A 3HKOA 3UP2A 4YJUA 5CU6A 2O0UA 1SNXA 3F9NA 5IA5A 3LFQA 4IZAA 5BUJA 3ULIA 4DGOA 1R4GA 4RLLA 3FXXA 4PX6A 2MROB 3FMJA 3E64A 1A5TA 3UP7A 5B0XA 5EW9A 4NW5A 2GNFA 4IAAA 4F65A 3ZUUA 4BI1A 5B2LA 5ICPA 4M3QA 2VO3A 5EI6A 4C3PA 2PUIA 4ZMEA 3MY0A 1J7LA 1WBWA 4ITJA 4QMYA 3C4WA 4RGJA 5FXSA 1R1WA 5IZFA 3BLQA 3H3CA 5IEXA 1NV8A 3VQHA 5IEVA 1UWHA 4YZCA 2WMXA 1ZZ2A 4RWLA 4FOBA 4BIDA 3QTQA 4JG8A 4RC4A 4DFXE 2YZAA 5CEQA 2B3TA 4PUZA 5JI2E 2UW5A 5AX3A 4L68A 2K9DA 2GSFA 3RHKA 4ZS0A 5HVKA 1H1WA 3COKA 4DF3A 3H10A 4K8AA 4GUBA 4Z16A 3ORNA 4BICA 4UZDA 5F20A 3RGFA 2R7BA 3D5UA 3FRHA 3JVSA 3PPJA 4O0VA 4ZOGA 4JI9A 3DDPA 1TVOA 4DGGA 3VN9A 5AEPA 4EK6A 3I0QA 4QQTA 5J5TA 3KY2A 5CZHA 5KMOA 1CSNA 3O71A 3GB2A 4QMXA 5BVEA 4O1PA 3ZC5A 4Y83A 5G6VA 2V5QA 3IQ7A 3DXPA 3GC8A 2ZOQA 3C1XA 4N70A 3KA0A 4LFIA 5H2UA 4CFNA 3OVVA 5TO8A 4IEBA 4F4PA 5AP4A 4L6QA 3Q53A 1FGIA 3HMNA 3QD0A 4UX9A 1WVYA 5JRSA 3F66A 2UZDA 4FV9A 3TN8A 4JRVA 3TV4A 3MY1A 2UZNA 4AX8A 5HX6A 4FKTA 2X6EA 4KIKA 1JKTA 4II5A 3R30A 4YTFA 4F1OA 2X9EA 4FTUA 5AV3A 1ZMVA 3O7LD 4QNAA 1H4LA 2UVXA 2OH4A 3R9HA 2DZLA 2CGWA 4HPTE 4EUTA 1QL6A 2VTTA 3BV3A 4IX4A 3U6IA 4JT3A 3DBCA 4F1MA 4C4JA 4I22A 4KIOA 1X8BA 4IBMA 1GY3A 2ZMDA 3E3BX 4IDTA 3SQQA 4AZFA 4ZJVA 3FI4A 2BWEA 1LPUA 3D94A 2CSNA 3IOPA 4MAOA 4F08A 3R1QA 3R00A 3ANRA 3HV3A 4NKSA 3V5PA 2OF2A 2XCHA 2BTRA 3FMKA 5IA0A 5IG1A 5BUEA 4WNPA 2GNLA 2VAGA 4NTTA 5DT3A 4DG2E 2OFVA 3KXXA 2WMUA 4B4LA 3MY5A 4X3FC 4IWOA 5HU3A 1JOWB 2PVYA 2PK9A 4J7BA 3DU8A 3QX4A 4IVBA 4DTKA 2W4OA 3GUBA 3DXNA 3G9LX 4G9RA 4IAFA 2W0JA 4WOVA 4OTQA 1VEGA 4RIXA 5FDXA 5A4TA 2X39A 3EHAA 3NUYA 2XH5A 5AUTA 4FNYA 2VX3A 2VWXA 3KU2A 4AW0A 3T8OA 2J0KA 2QLUA 3IDBA 3O96A 3G6HA 4R5YA 5FDPA 4YGAA 3PVGA 4YZ9A 3RAIA 3FMMA 5DR2A 1M7NA 3HRBA 3G0EA 5LVLA 3TUBA 4AA4A 3WYYA 1ZMWA 3KGAA 5E8VA 1URWA 2J50A 4AZSA 4OTFA 4QD6A 1GNGA 4HVDA 3THBA 1AGWA 3NUXA 3P9JA 4HGTA 4WD5A 1JSUA 4XNEA 4FA2A 2R3LA 3R7GA 2L2DA 5AP3A 2Q83A 3GU4A 3PJ2A 5KZ0A 5A14A 1VDLA 3DOGA 3QC4A 2Z7RA 4ACDA 3HAVA 4ARKA 1V92A 3R2YA 4O2PA 3RHXA 3AXWA 3VRZA 5J1VA 2PUNA 2QOIA 2VUWA 4F70A 3PSBA 1UNHA 4YSJA 4TYHB 5HIBA 1U54B 4GT5A 5GJFA 3R8UA 3LFFA 5AJQA 4DLIA 5E8XA 5J7BA 2IZTA 1BL7A 3JVRA 3FZTA 3LFNA 3V6SA 4ASDA 1PYEA 2JEDA 4QQJA 4F9YA 2IVVA 4XG6A 1XR1A 5EYMA 5HTBA 3AC2A 4YTCA 3I7BA 3CR0A 5CT0A 2VWIA 4TL0A 1EH4A 2FO0A 4GFOA 2O5KA 4UALA 2X4ZA 4HYSA 3QTWA 3NAYA 2C6IA 4JS8A 2YISA 4M13A 3HV5A 4I0TA 1NY3A 1JSTA 4QP7A 3F6XA 4B99A 4IANA 4I93A 3ZRMA 4FT7A 2BKKA 2PVRA 4Y5QA 3R02A 3WIGA 4O22A 4PF4A 1CKPA 4X3FA 2GFSA 4HVIA 2EKKA 4RJ4A 3SXFA 4FL1A 2IW8A 2J0JA 5AA8A 3EN7A 2H5XA 4JNWA 4H1JA 4CFXA 3QYZA 3P4KA 5HZNA 4ZZMA 5A4CA 2LVAA 1WVWA 4ZY6A 2WMTA 3VRYA 4ZTNA 4LQMA 3L1SA 2JAMA 2PL0A 2X4FA 4FKIA 4D4RA 1G8AA 3HYHA 4I6BA 4U44A 1F0QA 2LVQD 4JBQA 3LXKA 4QMPA 2ERKA 3C4EA 5AP7A 3KK8A 3KMWA 3VBXA 4CD0A 4P90A 4TRLA 3VQUA 4BYJA 4NM7A 1L3RE 1OTRA 3KVWA 4USEA 1OL7A 3BRBA 2XIXA 4GVJA 5CXZA 4OW8A 4R3PA 4FIGA 4HZSA 2HW7A 4WNMA 3FMDA 5GZ9A 3GCPA 3G15A 4BY9E 4BKJA 3AC5A 3K9OA 1KE5A 3C0HA 4O0RA 3BCEA 3NX8A 3OP5A 4UEUA 3BHUA 5CENA 4ANMA 3LQ5A 2XKEA 4UZHA 3LPBA 2W5AA 4XMOA 5EM7A 3FWQA 3R7EA 2YAKA 2Y7JA 2GQSA 3HV6A 4EH7A 2Z02A 4LL0A 4FVPA 5AR3A 4RFZA 2ZJWA 3FXWA 4XV3A 5D7VA 2PZRA 4O86A 4BCIA 2LVPC 1JVPP 4X6RA 2GTNA 3LCOA 4ANSA 4FZ6A 3WI6A 3F69A 4EHVA 5EYKA 5DEWA 5HIEA 4DGMA 3VUMA 3NSZA 2EXCX 1LP4A 4PMSA 3E92A 3VULA 3P0MA 2UW9A 2X7GA 3E8CA 3FZPA 4QRCA 3DFCB 4B7TA 4F0GA 4MWHA 4AZWA 3CP9A 3MB6A 3HV7A 2X0GA 3NIEA 4M0ZA 4XCUA 5KMIA 4I0RA 4LG4A 2XF0A 5I9XA 1A9UA 1CM8A 5L2QA 2JKMA 4G5JA 3FMNA 2JDVA 5J9ZA 4F7NA 2OIQA 4XOZA 3QXOA 5DI1A 2GNGA 1KV2A 1TKIA 5DYJA 3OF0A 3QUPA 4YNEA 3LFSA 5EKOA 3WF9A 4I24A 3R28A 3VBWA 2YCQA 2XB7A 1Y91A 3WILA 4TNBA 2ITYA 2RFEA 4FZDB 3KF7A 4D5HA 2YIRA 4CEGA 4F6WA 2BVAA 3KRJA 4MD8E 4U9AA 4YC6A 3PXRA 3MPMA 5ANJA 2ZTDA 3OCBA 5IISA 5HNIX 3O8TA 3U6HA 4L7SA 4JJRA 1T45A 3G5DA 3KXMA 2VU3A 3R8ZA 4BCQA 4L42A 2WEIA 4NWMA 4YLKA 5FQDC 5HIDA 5HE3A 3MA3A 5BYZA 2WMBA 4GU6A 3QD4A 5HE0A 3NW7A 4OTGA 5AR7A 5AV2A 2JBOA 2YAAA 5DVRA 2WTIA 4I5MA 4AZTA 1F4IA 3JY0A 5L4QA 2KHHA 2W05A 1GO5A 3KXZA 2VD5A 3NS9A 4FEXA 4XX9A 3R9NA 5CEKA 3AMBA 5DNRA 4CZYB 2R3HA 4IMYA 4J8MA 1L8TA 1YWVA 2W06A 3FLQA 3K54A 3VBYA 2VWUA 3GOKA 5ITAA 4J99A 2BZIB 3PSCA 4GIHA 4CFFA 4D9UA 3MIYA 4DE4A 4LYNA 4E6CA 5KO1A 3FI2A 2PWLA 2XNBA 4W4VA 4FYNA 4E5BA 3G33A 4ID7A 2CPKE 2VN9A 5EM8A 2XK7A 4BCGA 5K0XA 3LJ1A 4OTDA 3TACA 3ZFXA 3DPKA 3VJNA 4DH3A 5IUHA 3F2RA 4ZS4A 4H39A 2PVJA 4V05A 1OKYA 2GQGA 4RJ5A 5CU3A 4RJ6A 3VS7A 5KCVA 5KMMA 3GU8A 4DN5A 5LQFA 5HLPA 5KMJA 3QGYA 4EH4A 4G3DA 4FE2A 3ELJA 3GBZA 4FBXA 5HG5A 3VHKA 2PTKA 4MEDA 3P7BA 3Q52A 3FI8A 3TKUA 2Z2WA 1G4AE 1V0BA 2ZV8A 1YHVA 3QD3A 5ANEA 3ZLWA 1W0XC 3WF5A 1HCKA 3UC4A 3ODZX 2XK9A 1G41A 4G31A 4I6FA 5LMAA 5G1XA 1KSWA 2Q0NA 3BX5A 3TZ8A 1M2RA 3DZOA 4PDSA 1LUFA 3ALNA 3NGAA 3RBWA 3GI3A 4LGDA 3TV6A 4L3JA 4BKYA 4XG8A 2WFYA 3Q9ZA 2VX1A 5ANOA 5I4NA 5M51A 4QMLA 3ZMMA 1OIQA 5HLNA 4GMYA 4I5HA 4WKQA 4K33A 1R39A 4FV4A 4DYMA 4PPCA 5CU2A 4NM5A 4EH9A 1XQZA 2LBCA 3DDQA 3PY3A 1H28A 3UOKA 2UW3A 3AC8A 2R2PA 3MV5A 4K6ZA 3R8MA 4IJ9A 3EN5A 3LQ8A 4OBOA 5BUIA 4TNDA 4BC6A 4WUNA 4LOOA 1M7QA 3LM5A 1HT1E 3A8XA 3F3UA 3VUTA 4BBEA 2YN8A 4LM5A 4NZWB 1UKIA 3GVUA 3A99A 1OKWA 2QOBA 4A4OA 1H1QA 2HZNA 1YDRE 4QYHA 4C3RA 4J98A 1YI3A 4TKSA 4ZK5A 2VO0A 2XIRA 4RWJA 3C4FA 2QOHA 2HZ0A 4BYIA 2W9FB 4AQCA 2XJ2A 1W82A 4PDOA 4ZTLA 1QMZA 2BALA 2EUFB 3QCSA 1ZV1A 2VTQA 3FLZA 4U8ZA 2Y8OA 3IW5A 4C38A 2YIWA 2XEZA 5HU9A 3R7IA 5D11A 4LOPA 4J52A 1WGNA 3QHWA 4BI0A 5HBJA 3FEGA 5KMNA 2Y0AA 4P7EA 4QMOA 2C1BA 4FVQA 2YM6A 2Y9QA 3GGFA 4MCVA 4NKAA 4S30A 4X3JA 4YPDA 4QQ5A 2Z60A 3UYSA 3V6RA 1CKIA 3TL8A 3UVPA 4EWQA 1U5QA 3MWUA 5IQEA 2OSCA 1LR4A 4IHPA 4RVKA 4HEOA 4L3LA 1HCLA 2PVFA 1A06A 2WU7A 1UNGA 4EH6A 1SYKA 2GU8A 1OBGA 4GKIA 4R78A 2PE0A 3VC4A 4CTCA 2XP2A 4L8MA 3BQRA 3FQSA 5CYIA 5DGZA 5IMEA 2V7AA 3D5WA 2X2LA 3Q9XA 2YHVA 2O25A 4QYYA 1J1BA 4AA0A 5L6PA 4UYNA 3LCKA 2RSVA 3IPHA 3ZEPA 4IFCA 4U79A 3ODYX 4Q9ZA 2J5FA 3OMVA 4B9DA 4GRBA 2CNUA 3VUDA 1S9IA 5CASA 2YJRA 3WE8A 3H4JA 4P4CA 4EH2A 3SRVA 2CWBA 4IWQA 4GK2A 3RALA 4YR8A 3TG1A 2H6DA 1PHKA 2PULA 3HA6A 4FTCA 2LAVA 2ETRA 3TEIA 5L8LA 2BDWA 1PGYA 2R3FA 5HCZA 2UZBA 3QQHA 5C27A 3EQRA 1UV5A 3SD0A 3D2KA 1OKVA 5GJDA 2RFDA 2XYUA 4FKJA 4BTKA 1Q97A 4CLIA 3HDNA 3EN4A 3JPVA 1JAMA 3MDYA 3E87A 4G6LA 3EYHA 3FDNA 1H8FA 4TYEA 1DO0A 5HOAA 2WQMA 3CTJA 3EQFA 1DI8A 3DLSA 2WELA 3Q5IA 3AD6A 2EXMA 4X0MA 4E4NA 1XKKA 5EYDA 3V51A 1GZOA 2ONLC 3O50A 3RPYA 4G3CA 4XP3A 5CNOA 3I1AA 1WHCA 4ZSJA 5L6WL 1BI7A 5F9EA 5FP6A 5AV4A 2R3RA 4AS0A 3OCGA 3B2TA 4BVUA 2XS0A 4JDHA 3SXSA 2BDJA 1H1RA 4FTJA 4XV9A 1YQJA 2NPQA 3PIZA 2B1PA 4WHZA 2RL5A 2B52A 4YJSA 5T3QA 4M7IA 1H00A 3REPA 1YXVA 2YIXA 4A9TA 2E9VA 4FOCA 4EKKA 3BLHA 4F99A 2YM8A 3D7TA 3O8PA 3R0TA 4YZNA 3TZ7A 4CKIA 3EL8A 1IA9A 1Q8TA 4MBJA 3W2RA 2UW7A 3I81A 4ZTMA 4UB7A 2UZLA 2X7FA 3QKLA 4FTOA 5L8JA 5IH4A 1XBAA 4C4GA 4ZEGA 5M07A 4LGGA 3BYSA 1WBOA 2YM3A 3RVGA 4KB8A 3ZRKA 3PXFA 3QC9A 5HG7A 4D0WA 3MBLA 4J1RA 5HEZA 3VBTA 2XNOA 4IB5A 2PMOX 3KN6A 2OO8X 4I6HA 2C6LA 1IFYA 1JNKA 1GJOA 4R3RA 4U45A 3TIZA 3UQCA 5E1EA 4USDA 5AV0A 2UZTA 2B55A 1GOLA 1XBCA 3DJ7A 3TI1A 4ACMA 4BDEA 3CKWA 5I9VA 5C8NA 4I3ZA 4RA5A 4C37A 2HXLA 4U41A 2WGJA 2BRHA 2P33A 3LZBA 4EOKA 4MQ2A 2VTHA 2WB8A 4KBAA 2V62A 1SVEA 3C13A 4MXOA 2JDSA 2ITOA 3Q5ZA 2X6DA 2BTSA 4HOKA 4JBPA 4KIKB 4P5QA 3ZEWA 4AN9A 3MYGA 2C5VA 5DG5A 5GNKA 3NCZA 1G5SA 3QRIA 4ZLOA 4J53A 1E1VA 2R3IA 3EMGA 2W17A 3IW6A 3T9TA 1NVRA 4Q9SA 4RX9A 3NEWA 2ZM1A 5AP1A 3RPVA 4PDPA 5D12A 1U5RA 2VTMA 3FQEA 4O0XA 5LCJA 3N4VA 3DNDA 4UV0A 3U54A 3EKNA 3HV4A 5DA3A 4O81A 1IASA 4EH8A 3EN9A 4FTMA 4D2RA 1FPUA 2OOAA 4FTAA 1OPLA 1OM1A 3A4OX 1Y6AA 3C7QA 3EYGA 3L9NA 3L8SA 4Y95A 1TTEA 3F92A 1PMUA 3R9OA 4G16A 4IFGA 5C8KA 1RW8A 3E5AA 1MRYA 2FA2A 2I0VA 1OKSA 2OI4X 4YZDA 2BRNA 3HUBA 3TJDA 2W1CA 3FUPA 3CGOA 1XB2B 3MB7A 1WFCA 2QU5A 3FHIA 3PJCA 2JDRA 4LV5A 5FEEA 4FIEA 2KNAA 4DBGB 4E7WA 4XUFA 3LJ2A 5EI2A 3Q9WA 1PYXA 1Q3DA 3P7AA 5IQFA 4F7LA 3FY0A 3S4QA 1Q8ZA 3ZHPC 4U6RA 1BI8A 2JY5A 4UWCA 3QTIA 5HLWA 2Y6OA 4YJNA 4GT3A 3RMFA 5CEMA 3TUDA 3OXZA 1A48A 2VNYA 5C4KA 5FG8A 5A4LA 3EB0A 2JZ0A 3CY3A 3FQHA 4D4SA 2OJFE 5JZJA 4ANBA 2QO7A 3RJCA 2RF9A 4R7IA 5FRIA 3SOAA 2RKUA 3QQJA 2ITNA 5K5XA 3CQEA 5BX0A 4RIYA 5JN2A 3V5JA 2R3JA 4JDKA 2W1HA 4V01A 3B2WA 3D14A 4C3FA 3E46A 4NT4A 3P1AA 5IQIA 2W1IA 2V55A 4C4IA 3GCQA 5JGBA 4AACA 5F4NA 3RWPA 3FY2A 5FLFA 3Q9YA 3HZTA 4BGGA 5TF9A 3E8DA 2DI0A 4LUDA 3VJOA 5I9ZA 3BWJA 5M09A 4TN6A 1UU8A 3AMYA 3VIDA 1GZ8A 4CFWA 4IIRA 4FI1A 2YIQA 1H27A 1OVEA 4CMTA 5M57A 4APCA 2WEVA 2VO6A 4BGHA 5CALA 5EHLA 3IK3A 3K3JA 3TT0A 4DH5A 3FJQE 5AIRA 3BWFA 2YM5A 3IO7A 3EIDA 3OCSA 3DGKA 4YJOA 1FVTA 3I79A 2ZDUA 2VWBA 4TT7A 5ANKA 4EOPA 4HCTA 3TUCA 1XHAA 4G3FA 4DBXA 2QO9A 2C5XA 3DJ6A 2XKCA 3C0GA 1YHWA 1DO2A 4W4XA 3R7UA 5B7VA 3LCUA 4EI4A 4MNEB 3ZO3A 3OG7A 1H1PA 4U97A 3I5ZA 3FZOA 1VJYA 2XK4A 5AIKA 2ITUA 3QLFA 1M52A 1Q4LA 4U5JA 5BVDA 3BBTB 4OUCA 4YMJA 4DC2A 4O7RA 4E6QA 1Q41A 3O17A 2VTIA 5A9UA 4JBOA 2WAJA 4JLCA 3WZKA 4CMOA 3ACJA 4D2WA 5CAOA 4ZSAA 3UVRA 3FKNA 2HK5A 3QTUA 5ACKA 4BTFA 3RK5A 4C4FA 3Q96A 2ZAZA 3GLIE 5FBNC 4ZJJA 5AM6A 3ZSIA 5ETAA 5HTCA 2CDZA 4MH7A 4M14A 4QP8A 4QMSA 5CWZA 3RINA 3UOLA 4ORKA 2GCDA 4EZ3A 4DT9A 2P4IA 2XNMA 3RZFA 3UNZA 2C69A 4BZNA 4FIHA 4FKRA 1IAHA 2O63A 4ZSEA 4UMUA 4GKHA 4YJQA 3V04A 3QCQA 2YCSA 3FLNC 3TTJA 3EFLA 5CAUA 4YHTA 3TNHA 2CGVA 3S0OA 4D1ZA 3PP0A 3UC3A 4BCFA 1YXXA 4HVGA 5DFLA 3E7OA 3I0OA 4GW8A 3ZUTA 4BKZA 2YM7A 4D1SA 4DFNA 3N4UA 3PTGA 5LJJA 4Y85A 3TM0A 4EHEA 2BAQA 4RVLA 2WMRA 2A0CX 4LI5A 4AZVA 5FUTA 5JGAA 4BDGA 3QRTA 1B6CB 2DYLA 3PIYA 3PYYA 4FIJA 3OT3A 1JKKA 3T9IA 5JFVA 3HAMA 1W8CA 4I94A 5L3AA 3CPBA 3FL4A 4D4VA 4EYMA 4IM3A 4MXAA 4DEIA 1YWNA 5BPYA 3VBVA 2W96B 4GSBA 4PP7A 1W83A 2PE2A 4UYAA 1QCFA 4V04A 4EK5A 1Z57A 4Q2AA 4YC3A 1JBPE 4BBFA 1XH6A 2QKWB 4E4MA 5TE0A 2F7XE 4FV0A 4KSPA 4CFUA 1UU7A 3ET7A 4YSMA 5GZAA 1KE7A 4BDJA 4E8AA 1PW2A 3DBDA 4XG7A 1XWSA 2QC6A 4FGBA 2QOQA 2OZOA 4BWXA 1XH8A 2OO9A 1YVJA 5I9YA 1IAJA 1QPCA 4RIWA 4F9BA 3BKBA 2BPMA 5TR6A 3SA0A 3LIJA 2ITWA 4MD9E 2X9FA 2QHOB 3Q4CA 1BUHA 4JIAA 5CI7A 5E9EA 2XM9A 4YTIA 3LHJA 2C3IB 1WCCA 3Q04A 4I0SA 4IZYA 5EM5A 3NUPA 4O2ZA 4R77A 2XUUA 3NLBA 3PY1A 3ALOA 4NJDA 5J87A 3W2CA 3C4ZA 3H9OA 3NCGA 4O7WA 4A07A 5E8TA 5E8SA 4RJ3A 1YXUA 4FUYA 4KRCA 4HPUE 4X2NA 5J7HA 4D2PA 2C30A 3MH0A 4X2FA 3NVKI 4JX3A 3HEGA 4EQMA 2VNWA 4CTBA 3QZGA 3PA5A 3LFAA 4IZ5A 5CY3A 2F2UA 5CQUA 1YI4A 4EBVA 5LWMA 2EXEA 4KBCA 3SLSA 3BLRA 3AD4A 4H58A 2UW6A 3RNYA 2G01A 2PUUA 5FXQA 3QKMA 4FKSA 1IEPA 4PTEA 2PUPA 1GIIA 4CGAA 3VS6A 2Y4IC 4FV6A 3D7TB 2XKFA 2JKKA 1YKRA 3OY3A 2HY81 4ZY4A 4M15A 3TJCA 3ORTA 1CUKA 4ZIMA 3OT8A 5T6KA 1WJ7A 1V1KA 2F9GA 2ZVAA 3DB8A 4QMUA 4G3OA 3GU5A 5KKRB 5CVFA 2C5OA 3ZOSA 3CQUA 4IADA 4F1TA 3ZXZA 2BAKA 4EC8A 4BDAA 1Q61A 3ZSGA 4PMTA 4WSQA 4DCAA 4FNXA 3ULZA 3VUHA 3UQFA 3FMLA 3W55A 2X1NA 4AN2A 3SC1A 5AAEA 3QTXA 5CF4A 2RG5A 2DAMA 3BHYA 4FEVA 1HJPA 3VS5A 2QQ7A 3MJ2A 3NVMB 2EKFA 1PXIA 2FSMX 4G9CA 4GV1A 4CG8A 4IAKA 2CNVA 3E7VA 4A9SA 4CKRA 1SVHA 4HVSA 2QOKA 2DWBA 4JIKA 3CXWA 4QMVA 5DT0A 3HMPA 4GS6A 1QPJA 2RGPA 3EJ1A 3GU7A 4UXLA 2Y4PA 3ZSHA 3DB6A 4BHNA 4BTJA 3RM7A 3FSKA 3SDJA 2QODA 5M44A 2HZ4A 5D1JA 2XBJA 2W1GA 3IDCA 4R5SA 4S2ZA 4KA3A 4NIFB 2QKRA 2XIYA 3MMPA 3LCVB 2OK1A 4G34A 2BZHB 4EH5A 5HBHA 4HJOA 1P4OA 4BCHA 3RPSA 1IRKA 3BEGA 3A7GA 3MVJA 5J1WA 4GJ2A 4DINA 3FPMA 4R8QA 1XH5A 2GNIA 2YM4A 4I4FA 4L46A 4OTIA 4WBOA 5DN3A 3RNIA 4C62A 1ZAOA 4MXZA 2DAGA 4DFLA 4F0IA 1B38A 4RX5A 3ZLYA 4HGSA 3VS3A 2BRGA 2VTRA 5L8KA 4J97A 5CI6A 4ZJIA 2ITTA 4TWCA 5BVNA 5LVNA 1YXTA 3B8RA 3M1SA 5DOSA 2HELA 2QI8A 2R3PA 3U4UA 4BIBA 5KBRA 3EQCA 3VUKA 5BVOA 1WIVA 2CCHA 3NYNA 4DAWA 3BHVA 2VWWA 3QU0A 4F7SA 2CGUA 3UMXA 5AMNA 1ZYJA 3CLYA 4RVMA 5CEPA 2VTOA 2OJGA 2C68A 1PF8A 1VEKA 3FMEA 3KC3A 5I9WA 3T6PA 2XK8A 4XP0A 3UOJA 4CQGA 4FYOA 2WD1A 3Q2JA 5CLPA 4WSYA 3V3VA 3NRMA 5GIOE 2PSQA 4EOOA 4FKPA 3D7ZA 3UG2A 3NPCA 3PJ8A 4H3QA 2JC6A 2X2MA 4XG2A 3W8QA 4LRKA 5BYYA 4YPSA 5CTPA 5AM7A 4EWHA 1YLAA 5BMMA 3RKBA 3HRCA 1TQPA 1PJKA 3FI3A 4XBRA 3ATTA 4X2JA 4RIXB 2JNHA 2SRCA 3AD5A 2J0IA 2B7AA 3A2CA 3LFEA 4C36A 4G1WA 5CSPA 1PXOA 4KS7A 3L9LA 3V8TA 4EOMA 2OXYA 3TDVA 2B54A 4O0UA 4MHAA 4N4SA 2GQRA 3DLZA 3ZBXA 3VS4A 3L8VA 1BKXA 3LCTA 2EB3A 2YWVA 4XV2A 1GIHA 2VTJA 5IQAA 4BCMA 2LVNC 2EJSA 4WRSA 3FPQA 5KUPA 2BIKB 2PVHA 1NV9A 3F5UA 3GXLA 3FMHA 4S32A 1Q62A 3IGGA 4G6OA 4L7FA 3GP0A 4M84A 4YNOA 3F3WA 5FGKA 4AOJA 5IQHA 4IX6A 4R6VA 1CDKA 3H30A 4RJ8A 3UTOA 3F82A 3WZJA 4GJ3A 2BIYA 1Q8UA 4QYFA 3U4WA 4C0TA 1ZXEA 5HO8A 4O82A 3JYAA 3LMGA 2PHKA 3MH3A 2ACXA 3NW6A 5IPJA 4O0YA 4E3CA 1OMWA 3PWDA 5LVOA 4UY9A 1ND4A 2C1AA 2YDIA 3ZO4A 4NCTA 4R1VA 3ZLXA 4A06A 3V5LA 2H96A 4J71A 4JOAA 3SOCA 1ZZLA 1UNLA 5A46A 2HW6A 4AW2A 1FGKA 4JBVA 3CBLA 2UZOA 3FC2A 1Q5KA 1CTPE 2H34A 3ZO2A 2PVKA 5C1QB 3D4QA 3ITZA 3M2WA 4Q7JA 5I3RA 1CKJA 4I21A 2HXQA 3R7OA 3FYKX 3SW4A 3K2LA 2ITQA 3P78A 3BYMA 4GEWA 3MN3A 4A9YA 1G3IA 3OWJA 4O7YA 5CF5A 2ZB0A 4IE9A 3CGFA 3D15A 4FKLA 5AR8A 1O6KA 5LVPA 4FKQA 1ZOHA 2C6DA 2Y6MA 3MGYA 3A4PA 5E90A 2G2HA 4ZTHA 5AP0A 1WBTA 3QKKA 4OTPA 5D10A 4QMQA 3O23A 2XK6A 2E9NA 2QO2A 3EZVA 3BGZA 3FKLA 1VR2A 3C5IA 1PXJA 4OT5A 5CAVA 4E26A 3OTUA 4AGDA 3C4CA 4L00A 4Z7HA 3PIXA 3CJGA 3U51A 3JXWA 4TYHA 4QTEA 3UODA
chains in the Genus database with same CATH superfamily
3EZRA 4KNBA 3AL0C 2RFNA 4RLKA 4IC7A 4AW5A 2X8EA 1IN7A 2UUBM 3QWJA 4RBLA 4ZP5A 2UU9M 3DKGA 2CLXA 4K0YA 1WMKA 4FSTA 4W9WA 3RZBA 3ROCA 3SAYA 5CANA 3ROYA 2B9HA 4AWIA 1WR1B 1PKGA 3VHEA 3PXKA 4RQVA 3UO4A 3PXQA 3A61A 2REIA 4O0TA 2AQXA 5GINE 4XH6A 2YERA 4EK4A 1B39A 2VGOA 2Y4IB 2OXDA 3F5PA 4QYGA 3TPZA 4G2FA 2WIHA 3TKIA 3P79A 3FSFA 3TWMA 1J1CA 3KRLA 4YO4A 1J5EM 4YZBA 4EONA 1RU3A 2JAVA 4DFUA 4C4EA 3G0FA 3EL7A 5HTIA 3DT1A 4U43A 3M11A 5EI8A 2ZV7A 4FKWA 4YTHA 3R63A 4AKIA 4RC2A 1G8JA 3LKMA 4YBJA 2J90A 1Z6TA 3FZRA 1W2DA 1IR3A 3Q6UA 4KIQA 1E32A 3VNTA 3UZRA 5EP1A 4QP9A 4N6ZA 5AR4A 2KA6B 5CXHA 3W68A 3CEKA 2QG5A 3NUUA 4IJEA 2FH9A 4IWDA 1P3QQ 2CKPA 3N51A 4OTWA 1XMMA 4MGYE 4AT3A 2X7OA 1Y6BA 3Q4UA 3EH9A 2IN6A 2OZAA 2YCRA 3F3ZA 3LW0A 3TNQB 3QTSA 2QHMA 1PY5A 2GDOA 3PPZA 4BZOA 3R04A 4M66A 4FD2A 4YO6A 5BVKA 4M8TA 5AFVA 4FEWA 4O4DA 2IW6A 4MTAA 5CVHA 5C01A 4TWOA 4D80A 3R7VA 5A6NA 5BMSA 5IQGA 2CJMA 2W1DA 2WOUA 4EZ7A 2YFXA 1VYWA 2JBPA 4IW0A 2UW4A 3QCXA 5H8BA 2QPAA 2LHGA 4X65M 4ERWA 2QD9A 4L43A 4TPTA 4U40A 4ONAA 2IZSA 3BU5A 5FTMA 4ANLA 2D7EA 1HR0M 4I4EA 4OTRA 2OJ9A 5C8MA 1MJGM 4BB4A 4BWPA 4FL3A 3R01A 3UO6A 3UDBA 2VF8A 2OIBA 2PU8A 3TWJA 2HWPA 4GITA 2OU7A 3PNVA 4KODA 4OVZB 3QALE 3D5VA 3Q2MA 3EQHA 3O0GA 4RKUF 5CSVA 5HCYA 3ZS5A 1YDTE 3GU6A 4YP8A 4OAUC 3VK8A 3KULA 2OWBA 3TV7A 1OL6A 4RVTA 4RG0A 1VQ1A 4DR6M 5E8YA 1U59A 3MSSA 3NFFB 3HJQA 5TKDA 2Z4RA 1PM5A 3NAXA 4FKGA 3GC9A 4H05A 4OBQA 2WQOA 2X49A 3HMIA 2MGWA 2VWVA 4RMZA 4O1OA 4NL0A 2IW9A 1TQMA 4BRXA 3G51A 2IJMA 1ZY5A 3BLAA 3RAKA 4JI1M 4JDIA 3A46A 4TZRA 3FUTA 1JLUE 5IA2A 4PDYA 4DHIB 3FKEA 2CLQA 5HNBA 4UWBA 2EA0A 1OBDA 3VF8A 2FH0A 1BLXA 3G9NA 3PLSA 4MF1A 4NCTC 4UBAA 2R3OA 4GH9A 5C03A 1PXKA 1IXZA 4MGIE 3OWPA 1YRPA 3FYDA 4ALVA 4AOTA 3LLTA 3W2QA 2UZEA 4EIWA 2IWIA 4R3DA 4XP2A 2J2IB 4CZUA 5JT2A 2BKZA 3SX9A 5KX8A 3IW4A 3ZFMA 2JY6B 2AUHA 3AQVA 3SHFA 4YJTA 2GHMA 3VWAA 1QYRA 2G15A 2YDJA 3E3PA 3DTCA 2XZFA 1ZOEA 3ACKA 3OROA 3VW6A 4F6UA 4OW0A 2OG8A 1PXMA 2G9XA 2OJIA 5AUWA 5KKRC 4FODA 2A1AB 3W0PA 4H36A 4ASXA 5E8UA 3EKKA 4G3EA 4X6QC 4NFMA 4MGKE 1SMHA 4E6AA 5EJCA 1OL2A 2PMLX 3FZ1A 3OTVA 4LL5A 5CEOA 1YHSA 4P5ZA 4QQCA 4O7VA 2OLCA 3NMUF 2RG6A 4FSZA 4AAAA 4M12A 3KRWA 4WG5A 5H9BA 3UZPA 1MN3A 3H0ZA 1JR3D 4NRVA 2YA9A 3LAUA 3OHTA 5EOBA 2C6EA 3TIYA 3CIKA 4BLCA 4HYUA 4LRJA 4EQUA 4MXCA 5JZNA 5E6JA 5TT7A 2ZV9A 3ORXA 1VEJA 3TNWA 3QWKA 2DQ7X 5AUYA 5FP5A 1YOJA 5IA3A 2CV1A 5DYGA 1U54A 1VZOA 3NNWA 5KHXA 3WARA 1GL7A 4M0YA 3HMOA 3UIMA 5IMXA 4A9RA 3SHGB 4CYIA 2R0IA 4NK9A 3DNEA 2DENA 2JITA 3PZEA 4NW6A 2CKEA 4TYJA 4EBWA 1NVQA 3LLAA 3II5A 2OOBA 2JIUA 2F7EE 3DKFA 3MH1A 1UM8A 3CF2A 4ENYA 4LRTA 4U81A 1OZ1A 3UPXA 4CNHA 4EQCA 4S34A 4RFMA 1KWPA 3BQCA 2KNZA 1Q24A 4DTAA 4Y72A 5ITQA 5HD4A 1IG1A 3R1NA 4R3CA 1KUTA 4IC8A 4AW1A 4M97A 4QPAA 4BGQA 5CQWA 3CTHA 3MW1A 4F0FA 5I0BA 3QL8A 1CMKE 2ZYBA 1ZYSA 2PVMA 4B7GA 4BBAA 3KCKA 3MI9A 4IXPA 4LGYA 4O0WA 4XOYA 4ZSLA 2IVUA 3CD8A 5KBQA 3HU3A 4L01A 1T3TA 4JXFA 5D9HA 4AU8A 1LV7A 4YUQA 3TWKA 1KOAA 3LXNA 4DH7A 4GFGA 4F2LA 1WBSA 1ZRZA 3PRIA 3A7JA 4U42A 1YE9A 3N4TA 4N57A 1DGHA 1ZYDA 4U0IA 2WMVA 3QUEA 3RK7A 4EORA 4A4LA 2XNEA 1MUOA 1E94E 4ZTSA 3PFQA 4QP4A 4W4YA 4E5AX 1OL1A 2QQ8A 2XJ0A 4ITIA 2J7OA 4FV3A 4NJ3A 4QP6A 2XALA 5EQEA 2J0LA 4S33A 4M67A 1GZKA 4HNIA 4IVDA 3KB7A 4GU9A 2DS1A 4LDTA 2G3QA 2J4ZA 4FSQA 4R7GA 1RJBA 3QQUA 4DH1A 4F1IA 1FJGM 3U5ZB 2QU6A 2P0CA 5E91A 1OPJA 2I40A 4HVHA 5FWKK 3E93A 3AT2A 5D41A 3F7ZA 3A7HA 4IAIA 4TYGA 1L8QA 3GT8A 3PJ3A 4NU1A 3HDMA 5EDRA 4BFMA 4D4YA 5TOZA 4CV8A 4AXAA 4QP3A 1UVRA 2OQ4A 4DR3M 4BDKA 3FZSA 5IU2A 2B9FA 3PXYA 3W2OA 2IZRA 3J2PB 2OJJA 3KDSE 4ANOA 4V0GA 4O91A 5L2TA 2JIIA 1U4DA 4JI6M 2XNNA 3ANQA 3QFVA 5EG3A 3V01A 2CUZA 3ZLSA 3ENHA 1QAQA 3Q6WA 2BMCA 2XKDA 4L8RC 3IW8A 3GCVA 4GG5A 2XNGA 2WTWA 1QZEA 2C6MA 5FLXS 3OXTA 3GLHB 1WBVA 3HLLA 2DZNB 3BPRA 3LFBA 5KO3A 1PXPA 4O84A 5F94A 4F9CA 2A2AA 2BWBA 4ENXA 2QNJA 3DKOA 4O6EA 4AG6A 1OIPA 2CHLA 5HO6A 4BN1A 4GVAA 3DXQA 5ANDA 2JD5A 1OIZA 1VG5A 3E9SA 2XBAA 2GFCA 2C3JA 4GG7A 3S2PA 3NUAA 5HICA 2WQEA 2JY7A 1QPEA 2Z4SA 8CATA 4AE6A 2C47A 3EIEA 4FTLA 1BVSA 2V6ZM 1H1SA 2XYNA 3U61A 4KABA 4GEOA 2WTJA 4YC8A 3VBQA 5EKNA 3BELA 3QQFA 5DT4A 4WT6A 3NWLA 3KOWE 3HP5A 2GNJA 3A60A 4YLJA 3RWQA 4YU2A 4IQ6A 4DHJA 1H0VA 4FC0A 4C34A 2C3LA 1YXSA 4NUSA 1GABA 4MX9A 3U8WA 1T46A 1Z5MA 2W99B 3DTWA 4C59A 2O2UA 4L44A 3BYVA 4ZLZA 2KTYA 3V5WA 4BWKA 1NY6A 2G1TA 2LVOC 4AI6A 2XZSA 3LQ3A 3KVXA 4YZMA 2R7IA 3RM6A 4EJNA 4I5CA 5M4IA 5DH3A 3ILKA 5FTOA 3WOWA 5AWMA 5IDNA 2C9CA 3CY2A 3S95A 4EOLA 3TDWA 5M08A 2WQNA 2R3KA 3ZYAA 1QAOA 3SASA 3CS9A 4BDCA 5J8IA 1IBMM 3LFCA 4C57A 5GZ8A 3KXNA 4FICA 3QQGA 3LMHA 4ZMFA 3EQBA 5FM2A 5F95A 1T43A 1WBNA 4BZDA 3R8FA 3DQXA 4J96A 2CN5A 3OEFX 3UGJA 3K3IA 4Y28F 3UE4A 5AAGA 3AGLA 4CZTA 5IH6A 3MS9A 4IACA 3CJFA 4E20A 4CT1A 1OECA 3KRRA 1FQ1B 1JKLA 3DOAA 2UUEA 2YLFA 4EOJA 5B2MA 1PJSA 2ZMCA 3FLYA 4LJAA 3OFMA 3PA4A 1OUKA 1RDQE 1P2AA 1J7UA 1XNQM 4B7HA 5HESA 2UXCM 3DK7A 2B0QA 3PVWA 4QPMA 3PVSA 4M9SA 2OH0E 1QZMA 3KEXA 5LMNM 3PG3A 4AFEA 5AV1A 4PWNA 3WIKA 4EK8A 4D55A 3ZTXA 3W2PA 4EC9A 4I8OA 1QPDA 3BHHA 3NW5A 3LCSA 4PQNA 3PRFA 1K2PA 2F57A 2P55A 1ZYLA 3RCDA 4F9AA 3JR1A 4XHKB 3SV0A 4YLLA 2WMQA 3MFSA 2UVYA 5D7AA 2YIYA 3RPRA 3BU3A 4IVAA 3HHWA 2YWPA 3B8QA 3L28A 1HNZM 3WBLA 1LEZA 2OXXA 4DCEA 4DFBA 1P14A 2ZFYA 3G90X 4R71A 4BCKA 2W82A 4FNWA 2QR8A 1F5QA 5K0KA 4RZVA 2XZUA 2EU9A 2Z7SA 3LE6A 5CAPA 4FTNA 3ZXTA 4AP7A 1R3CA 3COHA 4RA4A 5J5SA 3A7IA 1WVXA 4FV1A 5LMBA 4R1YA 3KSJA 3AGMA 4DTBA 3RAWA 2CHVA 5M4UA 4CV9A 3UBDA 4FSMA 4FG7A 4IM2A 4X2KA 3AT3A 3CTQA 3G6GA 2BFXA 5ITRA 1PJIA 4QTAA 3NYOA 3VVHA 3FTFA 3PVBA 3DY7A 4CYJA 1H24A 2W5BA 4Y8DA 1JSVA 2C3KA 3SG9A 3QQLA 4NM3A 4FJVA 3JS2A 4CXAA 4ZTQA 4QHTA 1JQHA 4D1XA 1DAWA 4UMQA 3S3IA 5BNJA 2P2HA 4BR3A 1IN4A 4L16A 2UZVA 3EOCA 2HYYA 2ZM3A 4IH8A 2IO6A 4YBKA 5JFWA 2OF4A 3UQGA 1UU3A 3OUNB 4KT0F 1DM2A 2CMWA 4FUXA 3QTZA 3W8LA 5GKNA 4JG6A 1OL5A 4D58A 4QP2A 3E8EA 2GHGA 4PL3A 2ONLA 2J7TA 3I7CA 4FX3A 2JIVA 3E63A 3SFZA 1BL6A 2C0IA 4PNIA 4XG9A 2Z7JA 1IBKM 1MRUA 1QAMA 4OBPA 2JKQA 3RTPA 4FVRA 2I0YA 4PMPA 3F2AA 3GPUA 4FSNA 4C4HA 5L2SA 5J79A 5M06A 3SYLA 2UXBM 3D0EA 3P86A 3SMPA 3R1YA 4JAIA 3GENA 3PLAE 4WIHA 2BROA 3I51A 3EWHA 5HQ0A 2PZPA 3Q3BA 3U9CA 3WZEA 4ALWA 4BIEA 3CC6A 1W7HA 3VS0A 1L2BA 4U7ZA 5FTQA 4O83A 1NT2A 4FRFA 3KXHA 3DAKA 3OCTA 1E1XA 5KQDA 1FVVA 3AC4A 3NWWA 4WNOA 5FEDA 4JV5M 2ZANA 4UWYA 1JB0F 4DHFA 3LQQA 2NO3A 4FR4A 3VK7A 4C7TA 3FBVA 1XH7A 2BCJA 3QHRA 4ANRA 4BCOA 5DEYA 4RX8A 1DGBA 2GS6A 1Q8YA 5IWAM 1PMVA 3OUKA 2KDLA 1N32M 3PA3A 4L67A 1XNRM 4V0GB 3EFJA 3L9MA 3ZUVA 1J09A 2JGZA 3OC1A 4C2WA 1NXKA 2XIKA 3SVVA 4E93A 4WG4A 3BEAA 4QT1A 4FSUA 4CT2A 1OPKA 1NA7A 3TZ9A 4E5WA 3BYOA 5HE1A 4KS8A 4DFYA 4G4NA 1F3MC 4AKGA 2C6KA 3WE4A 3E88A 4FL2A 4NTSA 4TTHB 3C3EA 3AMAA 2XJ1A 2WTDA 3OWLA 2F5QA 4IJPA 4DG0E 3AV0A 3VW8A 5FBOA 4IBGA 1AQ1A 3D9VA 5AR2A 4BL1A 2CP8A 4B8MA 4PPAA 2X2KA 3KL8A 4UXQA 4QMNA 4D82A 2UV2A 5CX9A 2R46A 3D8BA 2J6MA 3EFWA 3U87A 5DMZA 2Y21A 1M2PA 4YHFA 2O3PA 1E9HA 5HCXA 3U9NA 1W2FA 2BUJA 2EVAA 3K1JA 1YOMA 3D8LA 3D83A 3W10A 2QOFA 3BE2A 2F2CB 3F88A 2QOCA 3B7QA 1ZWSA 4H1MA 2XLJA 2R4BA 4MNEA 3TKHA 3UIXA 4D5KA 5JFSA 1TGUA 3R6XA 2AC5A 4K0KM 2AC3A 3CKXA 3RPOA 2W4KA 3U6JA 4RJ7A 4EK3A 5KE0A 2HWOA 4AKHA 4HNFA 4M69B 2EUCA 4HL4A 4LG2A 3IS5A 3BGQA 1ATPE 4O27B 5AUVA 3OW3A 2E9PA 4BHZA 4D2VA 4FG9A 3DFZA 4ZZOA 4LMUA 3PWYA 4IB1A 1R0EA 3I60A 3R2BA 4FT5A 4JR7A 3EQIA 2WTVA 2WKMA 4Z7GA 2YCFA 5BYLA 3LCDA 3A45A 4QNYA 2J9MA 2QSFX 2J51A 3ORPA 3MPAA 4PL4A 5CF6A 5FM3A 2DWLA 4BB9A 2VO7A 3RHKA 5EHYA 1FBNA 3ZFYA 5JFXA 4FZAB 4HCUA 3QQKA 2YR0A 4YURA 1O6YA 1OIRA 2AYPA 2VTAA 2BRMA 3JUHA 4JQ8A 2GNHA 4Y73A 3VBYA 5CAQA 2G2FA 5KMKA 3TNPC 4WW0A 2UW0A 3O8UA 4HGLA 1K82A 5H3QA 3HP2A 2FSLX 4JL9A 3JY9A 1I4WA 3BZ3A 2Z7QA 5E1SA 3OWKA 4F09A 5K4JA 2PYWA 3OOMA 4NSRA 2JDOA 3DFAA 1DV0A 2L7IA 3GLIA 3R73A 5H8GA 3U6DA 5I9UA 5A3XA 3ZONA 3HUCA 2ERZE 4DV4M 3KKVA 4JDJA 1H26A 5JEBA 3GQIA 3QRJA 4FTTA 2O01F 4JQ7A 5IEYA 3FL5A 2E9UA 4ACHA 1GVNA 3GLFB 2XRWA 4AF3A 3NFGB 2XRUA 4CG9A 3F3TA 1GAGA 3POZA 3W33A 3SAUA 2R5TA 3WHLA 2C99A 2GS2A 5A4QA 3OOGA 2ETKA 2IVTA 2IVSA 2MJ5B 2A4LA 4L53A 1GZNA 4RZWA 4O6LA 5IQDA 2UUAM 4NM0A 4DBNA 4G3GA 4FNZA 4JMQA 5JH6A 3UO5A 2FS1A 2VTPA 4DUYM 2YLEA 2QOOA 1MQBA 3GFWA 3IONA 3KS8A 4I23A 4KINA 4O4CA 4PV0A 5CU4A 5E8ZA 5EDQA 1JPAA 4TUWA 3HJSA 5FTJA 3IKAA 4KD1A 3NDMA 3U55A 4LY6A 4NXNM 4JI2M 1XBBA 3NNVA 3C4XA 5DWRA 5ETFA 4B0GA 3PDTA 2IPXA 3QZHA 2DAKA 1BMKA 2HWJA 1ZLTA 4FT9A 4KWPA 4B3SM 4EOSA 5JKGA 5FEQA 1H07A 3FXZA 5I5ZA 1Q02A 4MYGA 1YOLA 1D2NA 4A4XA 3ORMA 1XJDA 3UNJA 4FSYA 1Q3WA 1IM2A 4GYIA 3FLWA 2OICA 2VRXA 4JAJA 4QMZA 5HNGA 4D2SA 2ITXA 4D9TA 1M17A 3SGCA 3OS3A 5J9LA 5K9IA 2O64A 1BYGA 3R21A 2GPHA 5E92A 2A27A 2NRUA 1XO2B 4FK6A 3L8XA 4KLNA 1S9JA 2W9ZB 3MTFA 2I6LA 1TQIA 4IB0A 1L2CA 2X8IA 3M7GA 2WIPA 2JY8A 4II7A 5EHOA 4CSVA 3DZQA 4MKCA 2DNAA 2C0TA 3LM0A 3TE6A 1K3AA 2C5YA 3MH2A 5E8WA 3AJIB 3Q32A 1SM2A 4W8DA 4ZPXA 1R7RA 2OZAB 3F61A 3OBGA 1ZARA 2PMIA 4PL5A 3IG8A 1GIJA 2X8DA 3R22A 1AIPC 1Y57A 4GIIA 3H4MA 3BGPA 5BVWA 3MA6A 4GL9A 2GHLA 4UMPA 1TFFA 1OIUA 3BYUA 4WRGA 3KFUG 1GLNA 2JA2A 4APPA 3ZH9B 4FT3A 5EW8A 3IG7A 5HHWA 4KAOA 2WTKB 4QNMA 3PG1A 3PSDA 5HG8A 4ZJVA 2OKRA 4FG8A 2HAKA 4JVGA 3W2SA 5AUXA 2H9VA 1OKZA 3F5XA 4HCVA 4LOQA 4E4LA 4M9ZA 1Q99A 2WHBA 4FV7A 4E73A 4Z55A 5C9CA 1FVRA 4RFYA 4FIIA 5EDPA 1QDTA 4DEHA 4WNKA 4C35A 1X37A 3HX3A 2UW8A 1BX6A 3FLSA 4N6YA 3L9PA 1QVRA 3E21A 4U80A 4XRLA 2DWMA 1O6LA 3R8LA 3FRIA 3QWLA 2KULA 3D2IA 2WPAA 3UJGA 4ZY5A 2ZM6M 3LJ0A 4BDDA 3SARA 4IDVA 1PRYA 3F5GA 5ITXA 4L52A 4WO5A 3HECA 4LFAM 4KRDA 3QCYA 2V7OA 5IUGA 3KOZE 4AA5A 3AT4A 3GQLA 4GH2A 5J95A 3FC1X 5C4LA 2H8HA 1HOWA 4MXXA 4FSRA 4JX7A 2HL7A 4DEAA 3ZZWA 2VV9A 3QYBA 2WOTA 5E7RA 1OAIA 3PP1A 5KNJA 2J7NA 3MVMA 3K92A 4WP2A 1PXNA 4LGHA 4TW9A 4I92A 3HZJA 3MHVC 3RI1A 4CFMA 5EXTA 4NC6A 2YITA 2XSZA 3V8SA 3RGSA 3OXIA 5CZIA 1G3NA 4J95A 5A2QS 2PE1A 1REKA 5AR5A 2DHRA 5CU0A 1LEWA 5BQ0A 2OFUA 1V0PA 5ANIA 1VYZA 3DQWA 3TCPA 5CSWA 4NEUA 4BCNA 3NZ0A 4Q5HA 3T3UA 2C4GA 1YSYA 1KOBA 3DK3A 3EFKA 4PRJA 4ZZNA 3A62A 3HMMA 3LFDA 3BHTA 3C50A 3W18A 4A7CA 4OX9M 4BCJA 2ZB1A 2X4AA 3GNIB 2E2BA 3KMMA 4DLJA 3P23A 3CSVA 3O2MA 5I3OA 3PY0A 4O7NA 2ZAMA 4MF0A 2FUMA 2JKOA 3BI6A 5DRDA 1Q39A 4OLIA 2HIWA 4CRSA 1SZMA 1T6OA 4GT4A 3NIZA 3ZZEA 2X81A 3MFUA 2XM8A 2XNPA 4GC9A 3GCUA 4GUEA 4ANQA 4FKUA 4EH3A 4K1BA 4EOQA 2C96A 4L45A 2R18A 3H9FA 3PE1A 4X2GA 3ATSA 2ITZA 3E4RA 4K77A 4XJ0A 5AUZA 1UFZA 4RSSA 3RAHA 5E4HA 1WZYA 2OW3A 4FV5A 3GQ3A 2P2IA 3VLFB 4O0SA 4FMQA 4XBUA 3WF7A 4QMMA 1SNUA 2QLQA 2X0QA 4LUEA 1DI9A 4M9XA 4AFJA 4EL9A 5AUUA 4EJ7A 1OUYA 4FF8A 3PJ1A 1OITA 3F7WA 4I20A 4LF8M 2V22A 3PVUA 4DITA 3WZDA 3SXRA 4AZEA 4CQEA 2F5NA 2WSFF 4MWIA 3FUUA 2HZIA 3PXZA 4HYIA 5GJGA 4QOXA 3R8VA 2G2IA 3VF9A 5HBEA 2Q2EB 2CNQA 4XG3A 3NBIA 3FV8A 2PVLA 3G2FA 1NW1A 4EKLA 2F49A 3KXEC 3O51A 2DWNA 4E6DA 3VKGA 1SVGA 2C9OA 3GLFE 1FMOE 4RRVA 1OB3A 3ZDUA 4AN3A 4CMUA 1WBPA 1OQYA 2Z8CA 5GHVA 2M5ZA 4HYHA 4OTHA 3IGOA 1C7YA 4DG3E 3KFAA 3MPTA 4CLJA 2OBJA 3QD2B 2JDTA 3EQGA 2X0PA 4G6NA 4PT5A 2FGIA 3NYVA 4WG3A 3ZM4A 3NBXX 1J91A 3BBZA 1M14A 2NP8A 4KUJA 5KHWA 4TWNA 2CKOA 4JQEA 4F78A 3I6WA 3CE3A 3WZUA 1XXHB 3QLGA 5FTGA 5DRBA 4ALUA 4CIZA 2MR9A 3C0IA 4ERKA 5IH5A 4QYEA 4CCUA 3NNXA 3F2NA 4M0DA 5M4CA 2ZDTA 3HRFA 2XA4A 5HGIA 5M55A 4UN2B 3W0QA 5DHJA 2QONA 5FXRA 1JKSA 4XS2A 2ZTCA 2EB2A 2Q0BA 4KSQA 2RRUA 4K11A 3ORLA 2XGNA 2L4FA 4I5SA 3QF9A 1NJFA 1ERKA 5AP6A 3JR5A 4MXYA 1YUBA 2HOGA 2R45A 2K0BX 2W1EA 1IY1A 3DBQA 3OY1A 4RWIA 4C58A 5IA4A 3FAAA 3SG8A 2XAOA 3MFTA 3QZFA 3K8ZA 3QAUA 1PMEA 2B4SB 2F4JA 5DPVA 5K3YA 3MVLA 3R83A 4AOIA 3GRRA 4QDEA 3DJ5A 4IM0A 4RF0A 5K5NA 4FSWA 4IX5A 2PUPA 4UMTA 3B89A 1MRVA 3COIA 4GFMA 1PMNA 5CS6A 3V5QA 3R71A 2VWZA 3A42A 1L1ZA 1QUTA 3DAJA 2UZWE 2F4VM 3HGKA 3QBNA 3RCJA 4PTCA 3BU6A 2J5YA 1R2YA 3DAEA 3PUPA 4O7LA 3KN5A 2FSTX 3NNUA 2Y20A 2VX0A 4FV2A 3GC7A 4FKOA 3UIUA 2EWAA 4HZRA 4JI5M 4A9UA 4BDIA 4RIWB 3WF8A 3UZUA 2R6FA 4PY1A 5DE2A 1OIYA 2OGVA 4EEVA 1WGLA 4CGYB 1APME 4I1ZA 4TWPA 3S1HA 4O7TA 1ZY4A 3UPZA 2R64A 4DDIA 4KIPA 5JGDA 3HVCA 1FINA 3DA6A 3NR9A 4FTRA 3AG9A 2BR1A 2WMSA 4G5PA 4D2TA 3IECA 5EW3A 3UOHA 2B9IA 4XRJA 1HQYE 2R3MA 3P7CA 5ACBC 2QURA 5LMKA 5M56A 5T68A 3KXGA 5IA1A 5HI2A 5IQBA 3I5NA 2XMYA 5LCKA 5A54A 2Z8YM 4LCBA 4TYIA 4TXCA 1ZYCA 1QQWA 3HU1A 2C5NA 4FTQA 3GLGE 4D28A 2O8YA 2PZIA 2WMWA 1DS5A 2XCKA 3KRXA 4UN0C 5JMSA 4CKJA 2PVNA 4U3ZA 3SW7A 4CCBA 3COMA 4K9YA 3TTIA 3AC3A 4O7SA 2GTMA 4LV7A 1OI9A 4PTGA 3EN6A 4QTCA 5CEIA 3SHEA 4ZTRA 3HA8A 1KE9A 3MESA 1H01A 2BHHA 2XVDA 4C8BA 3W0SA 5KZIA 4DT8A 2C0OA 3GFEA 4YJPA 5HX8A 3C5UA 3ZO1A 3KMUA 3BBWA 2I7PA 4OT6A 3ORIA 5L2IA 5HD7A 3V5TA 1URCA 2BRBA 1H6UA 2XEPA 3GOPA 4BBMA