2HAKA

Catalytic and ubiqutin-associated domains of mark1/par-1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
309
Chain Sequence
b'PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase MARK1
publication title Structural variations in the catalytic and ubiquitin-associated domains of microtubule-associated protein/microtubule affinity regulating kinase (MARK) 1 and MARK2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
total genus 100
structure length 309
sequence length 317
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2hakA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hakA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hakA01
1SVGA 2JKQA 3W32A 3ZCLA 4QT1A 4RWIA 2QODA 3EZRA 1UU3A 2UZUE 2XEYA 1XWSA 3T3UA 2C6LA 2QHOB 4ANSA 5BVNA 2XIXA 4YTIA 4C7TA 3HV6A 4FTCA 4PUZA 4WUNA 3LFFA 1YI3A 4XLIA 2W1EA 3MFRA 4FYNA 4W4VA 5ANIA 3OEZA 3PRFA 4GVJA 3KULA 2XVDA 3DK6A 1ZMVA 1UU7A 2QQ7A 3Q4CA 4FKPA 1GY3A 3L8SA 4M68A 3E5AA 4BDKA 4XEYA 3MPMA 1FINA 2PE0A 3OTUA 3L9LA 3CD8A 2OU7A 4FT9A 4J1RA 3TN8A 4A9YA 4GFGA 2R3RA 4IBMA 3LFCA 4NUSA 4OAUC 2EWAA 3R63A 5BYYA 2X4ZA 4O1PA 3GCVA 1K9AA 4UMQA 2GU8A 4EQCA 5M4FA 2VTJA 4RT7A 5J87A 4DA5A 3F2NA 3E87A 4OUCA 4FKSA 4MCVA 3DKCA 1H1WA 4LUDA 3CGOA 2NPQA 2WEVA 4NT4A 5D41A 4KIOA 2HXLA 5DHJA 4H39A 3GFWA 4IAFA 4YUQA 4HCVA 5DI1A 2X2LA 2JLDA 4IFGA 4E3CA 4IVBA 4TYJA 4D2SA 2IW8A 5KBRA 5ANKA 1Y6BA 1BYGA 4XYFA 4C8BA 2PMLX 4ZS0A 4IIRA 1OBDA 3ZUTA 3ZFYA 3A61A 3QXOA 4EOJA 3BYVA 1H07A 2WHBA 5ANGA 4G3EA 4MD8E 4PL3A 4BFMA 2CGXA 1S9JA 4JBOA 4KWPA 4QMTA 4B8MA 3KB7A 4EK4A 5JFXA 2QI8A 5L6OA 1YW2A 1XH8A 2X9EA 2X8DA 2ZB1A 2BAKA 3A7GA 3MW1A 3MDYA 2E9VA 4M84A 4NU1A 2R0UA 3IONA 4O6LA 3LZBA 4DEGA 1OKWA 3GVUA 4Y5QA 5FP6A 5HIBA 2F9GA 3QLFA 4Q7JA 2OIQA 4Y5HA 4IZAA 3N9XA 4FR4A 4ID7A 3PFQA 3IHPA 2W4OA 3PP1A 5ANDA 3ZLSA 4TL0A 3U6JA 1VYWA 3NUPA 1WBPA 5DGZA 5H3QA 1PMEA 5D7VA 3G9NA 5EI8A 2ACXA 5HNIX 4NIFA 5BQ0A 1OIUA 2VTNA 2QU5A 3AC1A 5AV4A 5A9UA 3BGPA 1UNLA 4L67A 3FPMA 3KA0A 5E7RA 3D2KA 5FD2A 3R7YA 5AR4A 4FIFA 2CN8A 5AR5A 2R3LA 5F4NA 1WIVA 4KBKA 4L44A 4Y85A 2QOBA 4YBJA 3WZJA 3A60A 1RDQE 3E46A 3D14A 4I20A 3U6IA 2ITNA 1M14A 1FQ1B 1WVWA 5LWMA 4PTCA 5AV2A 5LXMA 4C61A 4O7WA 4JIAA 2UZOA 2JDOA 3FZ1A 3FJQE 5AUTA 4IM0A 1V0BA 4HOKA 3OCSA 3FZPA 3QC9A 2QOQA 4I5MA 5TT7A 4IB0A 2GHLA 5HBEA 3UQFA 3CSVA 1O6LA 3R1NA 2L2DA 3PXFA 4APCA 5TO8A 4ERWA 3ANRA 3FI2A 3AC4A 2VZ6A 4EKKA 4L53A 2WZJA 5AR2A 3QHWA 3OTVA 3PSBA 2OWBA 4RGJA 3UO6A 2HOGA 2YERA 1H1RA 2X2MA 4E5BA 4BCHA 5JGBA 3OBGA 3A8XA 4NM0A 2BAQA 1CM8A 2C6OA 1KE8A 2XEZA 3C4FA 3MV5A 4W8DA 4WSQA 4FC0A 2OK1A 4RVTA 4EK8A 4ITJA 2GNJA 3LAUA 5HLWA 5HICA 3UZTA 2RFEA 2BCJA 3ZUVA 2PVLA 4ZZNA 1B39A 3OBJA 5HCXA 4BHNA 2FSOX 3ZBFA 3UTOA 5CSWA 1G3IA 3BWFA 2OZAB 1DS5A 3TZMA 1EH4A 2VTTA 4FSZA 5DWRA 3V5TA 3GGFA 5JMSA 1F4IA 3CTQA 3D0EA 3QQUA 4O38A 4AGUA 4V01A 2HW6A 1UWJA 5M4CA 4EK5A 4D2TA 1IRKA 4FOBA 4LRKA 3ZONA 5AFVA 4XRJA 3LM5A 1H4LA 3KCFA 3TI1A 1H0WA 3R8UA 3ATTA 3AD6A 3MVMA 5M4UA 3QKMA 2W1DA 3VAPA 1OQYA 2R64A 3A8WA 4CFFA 2OOAA 3WILA 3S0OA 3V5LA 2JBOA 2FB8A 4DF3A 2LVPC 3QKKA 3P9JA 4IVAA 3HP5A 3PXQA 4O7YA 4BZOA 2FSLX 2OF4A 4HGTA 4ZP5A 3AMBA 3DZOA 3TG1A 1BI7A 2OJGA 3HECA 3PVBA 4C3RA 4DFYA 2F7ZE 5IQBA 4XJ0A 2YM6A 3G2FA 3OFMA 4MXAA 5TF9A 3WF7A 3MIAA 4MNEB 2C4GA 4YLLA 2Z60A 4BB4A 3EYGA 2IVVA 5F94A 3E8EA 4FKJA 3E3PA 4MHAA 5A4CA 3FRIA 1U54A 1ZYLA 4ZSLA 3ZMMA 1Q61A 4CRLA 5HORA 4O7VA 2CPKE 3NYXA 2QO7A 4DGGA 2GNGA 4C35A 1BX6A 2OF2A 4C38A 3HRFA 3DOGA 4TYGA 5EKOA 4LM5A 2WEIA 1WCCA 3ET7A 1OITA 5JI2E 5CU3A 3FHIA 5CLPA 4Z7GA 2C6IA 3F7ZA 3G0FA 4YZ9A 2J5EA 2P55A 3PE2A 4FSUA 5HG8A 2J0MB 4EOPA 4RX5A 1UNHA 2REIA 3KRJA 3FMDA 3NVKI 1KE7A 4FYOA 4IMYA 1SNXA 3Q3BA 3AT3A 4CTCA 1V0PA 1ZXEA 3FMEA 2W1FA 4JXFA 4BBMA 1IA8A 4PPBA 2DAMA 1JBPE 3P5KA 3QTUA 4OTGA 1OTRA 5C26A 2L4EA 3OOMA 1HCKA 1QL6A 4L3PA 4D5KA 4F9YA 4TW9A 4FTRA 2BTRA 4QPMA 5JT2A 4L42A 5HKMA 5LQFA 3OWJA 3ATSA 3MESA 4MNFA 4U45A 1Q41A 1KV2A 2BDFA 3S3IA 1M7QA 2BUJA 3KKVA 4DC2A 2BPMA 2WTWA 2C6TA 1HT1E 3ORPA 2C5XA 4L43A 4HZRA 4AN3A 5HTBA 4I92A 3DQWA 4D9UA 3U4WA 3T9IA 5IKWA 5GJFA 3Q9YA 5HZNA 2JY5A 2J90A 2UW7A 5AP5A 3SC1A 2BIKB 2C5VA 4C4JA 5KKRC 3LJ1A 3PXYA 4QQJA 2OH4A 5BVOA 3CQEA 3QC4A 4OLIA 4QMVA 2I0YA 4RA5A 5CT7A 2O63A 4BDEA 5J1WA 4BKYA 4YGAA 4FEQA 4E5AX 4F6WA 3OW4A 5AV0A 2QOCA 3B2WA 1M52A 3ZDIA 5CS6A 4GUBA 3GCUA 3LXPA 4RA4A 1REKA 2UVYA 4EOIA 2PVJA 4F99A 2BWBA 2PULA 1Q8YA 4YU2A 5KUPA 2ZV2A 5K5XA 3DGKA 3A7JA 3BQRA 4CCBA 1U46A 3PXRA 2GPHA 5DT4A 1T6OA 4CD0A 2B0QA 2YCQA 2OZOA 3MB7A 3W2CA 4Z3VA 3DAKA 2QG5A 2YWPA 1Q4LA 4DGLC 4IX4A 1AD5A 4BHZA 4S34A 5GJDA 1XH4A 3OROA 4WBOA 1PXIA 2VTIA 3RWPA 5GHVA 3NNUA 4GUEA 1WHCA 5HD4A 3TWJA 4EH2A 4YZNA 1ZARA 1FVRA 3GB2A 3ZM9A 2I0HA 1ZV1A 2XP2A 3F82A 1OPJA 2VD5A 3ID6C 3LVPA 1RJBA 4ZZMA 3CC6A 2XNMA 3MVLA 2CCHA 1MQ4A 5IQHA 3JY0A 5L2QA 4F70A 4AAAA 3QHRA 2F57A 3RPSA 3LXKA 3HNGA 5CI7A 1UKHA 4ACDA 4F0IA 2FSMX 2QONA 4FSTA 4FSNA 2VTOA 3FKLA 4TN6A 4U3ZA 2B53A 4BKJA 4HNFA 1YDRE 4QQTA 3KGAA 2KNVA 3ACKA 4FIJA 4APPA 2VO3A 3PYYA 5IMXA 3MVJA 3H30A 3UQCA 1P2AA 2V7AA 5DFLA 3ORTA 3PIYA 2FYSA 3M2WA 4XX9A 4ZJIA 2XIRA 3PVWA 3UIUA 5JKGA 1GZNA 3AGLA 1QCFA 2WMSA 2ZV8A 3GCPA 4FX3A 2OXYA 4F9WA 4H05A 2W9ZB 3VRYA 4TNBA 4BY9E 4UWBA 4BDDA 3NUUA 2B7AA 5BPYA 2ZOQA 3ZDUA 4F9BA 3M42A 1GZOA 3RZFA 4DEEA 4I0TA 1YHWA 3TJCA 3I60A 2R2PA 4J99A 4LQMA 4DTKA 1MRYA 2UZLA 4J97A 4JDIA 5HVJA 1Z5MA 5TOZA 3DXPA 4HGLA 4QP1A 2IVTA 4FV3A 4WBBB 3EQGA 3QGWA 5KE0A 3P23A 5H9BA 5B2LA 2QU6A 4YNOA 4DGNA 2E9OA 1T45A 4BDIA 2HWPA 5I9UA 4HEOA 4H3BA 4MVFA 2UW8A 4RJ5A 4XP2A 5EM7A 2C6MA 2PUUA 2ZAZA 4KINA 4JT3A 3UVRA 4XV2A 5CEPA 1OVEA 3B89A 3LLTA 5AA8A 1UU9A 2P33A 2J7TA 2QKWB 3NZ0A 4G6NA 1XBCA 3NX8A 4KD1A 4BC6A 1NXKA 1WBTA 2UZWE 3PSDA 2JAVA 3VS5A 4CCUA 4EYMA 2WTKC 4DTAA 1REJA 4R5YA 4JDKA 5I9WA 3KXZA 3OY3A 5BVWA 1ZYCA 3V5PA 3R9RA 2WTCA 2KTYA 5F95A 4DH8A 5HIEA 2Y6MA 4NIFB 3NCGA 3PVUA 3KXNA 4X2JA 4XV9A 1CUKA 4XHKB 4BGQA 4KA3A 3F5GA 2ITVA 3MBLA 4FTKA 1J91A 5HBJA 4FTNA 5KMKA 3UC3A 4AW0A 3GFEA 4CNHA 4MQ2A 3VVHA 4TWOA 4AS0A 4TNDA 4GVAA 2HZ0A 1XH7A 3RBWA 2XKCA 4AF3A 5FTOA 3R83A 4NWMA 1VDLA 5IA5A 5L6WL 5IMEA 1XH6A 3BGQA 3HZTA 1ZOHA 4FKWA 4FMQA 4AQCA 3VC4A 2W1GA 4C2WA 5EH0A 3IPHA 2OJJA 4PP9A 2O65A 1LEWA 3DJ7A 3UPXA 2YM3A 3BLRA 2GNFA 4QQCA 1OUYA 3DFAA 3ZYAA 2O64A 4E4XA 3K3JA 3UOJA 3I5ZA 4BDCA 1M17A 1AGWA 2C5OA 2Y0AA 5LVPA 5DRBA 4JDHA 4XH6A 2VAGA 3R22A 2WQMA 4XG3A 5FTQA 3LQ8A 1YXVA 5AUVA 2ERKA 2OFVA 3EIDA 3KXHA 3TNHA 2J0IA 5ICPA 3KFAA 3PG3A 3VW8A 3ROCA 3E8NA 4C37A 2JIVA 2QVSE 2XK4A 4QTDA 4O2PA 1NT2A 4J8NA 4L3LA 5A54A 2F2CB 3FWQA 2VWXA 4HGEA 5DT3A 4PDOA 1PXOA 3DB8A 3N51A 3QAME 4FKRA 3UMWA 5EQYA 4M8TA 2XK8A 5I9VA 3CKXA 2F7XE 2VWYA 3ORNA 4HYUA 4LRMA 4N70A 3KF4A 4U0IA 3D7TA 5HNBA 4XS2A 2PUPA 3ZRKA 2RKUA 4I21A 2B3TA 4K6ZA 5HHWA 1T46A 3SVVA 3BI6A 5DOSA 4FZDB 2XCHA 1OIYA 1YI6A 2GFCA 3RNYA 4CYIA 2XK9A 2RFNA 2X9FA 1M2QA 1FPUA 1W7HA 3TTJA 2XA4A 3OCGA 3MPTA 2MR9A 4EOSA 4H36A 4HCUA 4CZTA 2IG7A 5EHOA 2VX0A 4FT0A 4UN0C 5ACKA 4BGHA 5KO1A 4TYIA 3N4UA 3V5QA 3QFVA 2XKDA 5L3AA 2W96B 5DE2A 2ITTA 3MB6A 4TTHB 1DO0A 4WG4A 5AR8A 2UZEA 3ZHPC 4F4PA 4KKGA 3OMVA 4BICA 3WI6A 1KE9A 3FDNA 3VJNA 2XH5A 4PMSA 5D1JA 3QCSA 3ZO3A 3DQXA 5L2WA 1KWPA 2X7GA 3OCTA 4LUEA 1H01A 4DBNA 5A4QA 2X1NA 4C4IA 2JDTA 3JPVA 4L8MA 5A6NA 3SG8A 4AXAA 1U54B 4IWQA 5HO7A 2W9FB 3UZRA 4MXOA 4DYMA 2YM7A 2SRCA 5B2KA 1PXLA 2P0CA 2JY8A 2VTAA 2X6EA 2QOLA 2WQOA 3R02A 5FP5A 3F69A 5IH6A 4ZMFA 4L46A 4GEWA 3EQHA 5DN3A 4EYJA 1JKLA 3FZTA 1XXHE 3PY0A 4RJ4A 5CU4A 5K3YA 1OL7A 2X39A 3O23A 4RJ8A 2BKKA 1TKIA 2B55A 2ETMA 3MIYA 1R78A 5KKRB 3CCNA 4OR5A 3ZOSA 4Y72A 4FVRA 3OVVA 3NYNA 3ORZA 3HKOA 4ZTNA 1EFUB 4YPDA 3BYUA 4WG3A 5EI6A 3VNTA 4AZWA 3BELA 3LFNA 2P2IA 1IR3A 2LTUA 3NW6A 2GNHA 2VTHA 3ORMA 4FSQA 4G34A 4RMZA 5CNOA 2ITPA 1OKYA 3NNVA 4EEVA 1YI4A 1U59A 2G2IA 4GT5A 4KKHA 2CWBA 5AAFA 5F1ZA 4AX8A 4PPCA 4FV7A 3UYSA 2ITZA 4U41A 4GJ2A 3BBWA 3PZHA 1Q3WA 4EOMA 4RX8A 4TYHB 3GLGE 2WIHA 4C62A 4ZY6A 5A4LA 2JEDA 4ANQA 3SX9A 2XZSA 3DTCA 4WSYA 4JBQA 2R7IA 5T68A 2BFXA 5BNJA 2EKKA 3GU6A 4DH1A 4R6VA 2CN5A 3D83A 4PL4A 2LVOC 2PVHA 5AP3A 2YITA 3CJGA 3EL7A 5CEMA 2W99B 2YDKA 1OIQA 2VO0A 3RPYA 1Q62A 4EOOA 1YOJA 5BUEA 4M3QA 3PWYA 4TZRA 2XIYA 2V0DA 3TZ8A 4NCTA 1YXSA 2DWBA 2W06A 3BQCA 2HWJA 3QL8A 4EOQA 3I6UA 3TIYA 3RAKA 3MTLA 5EOBA 4F1OA 3ERKA 2YCRA 1KUTA 5K0XA 5CTPA 2QHNA 5JFWA 4NFMA 3O7LD 2A4LA 4PMTA 3VBXA 3ANQA 4OW8A 4EHEA 3UE4A 3RK9A 3ORLA 3LE6A 5BUJA 3QD3A 2EKFA 2QG7A 1LP4A 4Y46A 3CD3A 2X81A 4V0GB 1PGYA 1J7LA 3E63A 3G33A 3PG1A 3Q04A 4F63A 3NLBA 4U44A 4CMTA 4Y83A 4USFA 4FGRA 2DNAA 2HAKA 4JOAA 3LOKA 4CLIA 3QZHA 4UZDA 2VWWA 4G1WA 1J7UA 2JITA 4ALUA 3L9PA 3W2RA 4EH3A 3VUMA 5CASA 2VWUA 1P3QQ 5CY3A 2IJMA 3F3TA 4A4XA 5IPJA 4NCTC 2OSCA 4OTRA 3D9VA 2B9FA 3QRKA 3SOCA 4YC3A 5H8EA 4DBXA 4ZLOA 3GCSA 4BCKA 5M51A 2WAJA 2CDZA 3NS9A 4XG8A 5BVKA 3C5IA 4F9AA 3ALNA 1H26A 3GI3A 4N6ZA 1XR1A 5FEDA 4ASEA 4IDTA 4O22A 5BVEA 3TEIA 3F3ZA 5E8WA 4AFJA 1KSWA 4AE6A 4M97A 3QRJA 3Q60A 2CNUA 2XYUA 4YO4A 4LGDA 2WTKB 2DAEA 2J6MA 5HE1A 3P79A 3W55A 2J5FA 4G9RA 5GZAA 4XCUA 2PVFA 4IJPA 3SAYA 3VN9A 1ERKA 1H24A 3BEAA 2OOBA 3G6HA 3W8LA 3VS7A 1H1SA 1WJ7A 3H0ZA 4WT6A 1YWRA 1H27A 3GP0A 3Q32A 1Y8GA 4FTMA 4IZ5A 4QP8A 4X2NA 3G0EA 4P90A 1Q24A 4BCMA 5A46A 1GO5A 2GS2A 3DKGA 3MWUA 3MA6A 5CENA 2BZHB 3MJ1A 2Y9QA 4ZSJA 4QMXA 1Q97A 1JKSA 2J9MA 2WQNA 2W4KA 3MVHA 5DH3A 2Z7QA 3R8ZA 4YSMA 3R2BA 1MRVA 4ZZOA 5M57A 4RIOA 4GK3A 3DKFA 4B7TA 3HMOA 4AOTA 3QRIA 5ETCA 3O96A 3AQVA 2PZPA 3RAWA 3UQGA 3KVXA 5CXHA 2NRUA 2UW6A 4CV8A 1JKTA 4PTGA 2ERZE 1RQQA 1H1QA 4EJNA 4BI0A 4IZ7A 3DJ5A 4GU9A 4YZBA 4FEUA 1OM1A 1SNUA 4E6CA 2I0VA 4O7SA 1FGIA 3FV8A 4XOYA 2XBJA 4WD5A 3C50A 2WFYA 3LQ5A 4G31A 4MXZA 4XMOA 4DINA 5FWKK 5LVMA 1OZ1A 2PU8A 5HG9A 1I09A 5JK3A 3IS5A 3MYGA 3PP0A 4FUYA 4P7EA 4R5SA 4UXLA 4OTQA 4LGGA 3D5XA 3F7WA 4PP7A 4QMQA 4I93A 3UMXA 3CQWA 2PTKA 4JG7A 3LFEA 5CEQA 4O1OA 3DAJA 4QYFA 3VQUA 4YMJA 3PJ1A 4U3YA 2BDWA 5CEKA 1W8CA 2VGOA 2VWZA 5IU2A 5IF1A 4NL0A 2F4JA 4YHTA 3RAIA 5E8XA 3IW5A 4C4HA 2BRNA 3HA8A 3LFBA 4HVIA 4CGAA 3DBDA 4D28A 4EZ7A 3BGZA 4QTBA 1TTEA 3LXNA 3UGCA 5E9EA 1R0EA 2IO6A 4DLIA 2JAMA 4J52A 3PRIA 5DPVA 2XJ1A 4I6FA 4OTHA 5ETIA 4D0XA 3FMLA 3TUDA 1Q8ZA 4KB8A 2JNHA 2WIPA 4GIHA 4YHFA 5ANEA 3I0QA 5AUXA 5HOAA 4PDPA 2V7OA 1IG1A 3B8QA 4H1MA 5CWZA 2G2FA 4BI1A 4R78A 4ORKA 5I9ZA 3K54A 4FEXA 4J8MA 3GENA 3OT3A 1FGKA 5F20A 3KRLA 1VEBA 5CVHA 2CMWA 4E1ZA 1JOWB 3V5WA 1CTPE 4F7LA 3OZ6A 3HV7A 4HNIA 4BYIA 4D4RA 3RPOA 2OJ9A 3IOPA 4FKIA 4G6OA 3SOAA 2X8IA 3KXXA 4YHJA 4EL9A 3WF6A 1WGNA 5J9ZA 3R00A 5HLNA 5FM3A 5HQ0A 3G9LX 5EM5A 4YP8A 4ERKA 2PE2A 3D7TB 3T6PA 1R3CA 2QCSA 4O21A 3RKBA 5FUTA 3R8LA 2EXMA 3UVPA 2GQGA 4EH6A 2XUUA 5HX6A 2VWBA 2PVKA 2JY7A 3FHRA 3WIGA 2ZJWA 2V55A 4YJOA 2CJMA 3QTXA 3DV3A 3HV4A 5AP0A 3Q52A 1JVPP 2R3MA 4U80A 3E8CA 4H58A 3GC8A 4AZSA 4CKIA 5CXZA 2WMBA 4QMSA 3NMUF 4CG8A 3OD6X 3NCZA 5EW9A 2JP7A 2W1ZA 2C0IA 1SMHA 4MEDA 3A7HA 5ACBC 5IA2A 1NV9A 4EOLA 3LCUA 3PZEA 1UU8A 1IASA 3OUNB 5K0KA 4F64A 2ZM4A 2Q83A 4D4SA 4A9SA 3PA5A 3TNQB 4D1XA 5EM8A 4FKQA 4ENYA 2JIUA 4NM7A 3FXXA 3DFCB 5DG5A 3V8SA 2X7FA 2O8YA 4EC9A 1K3AA 3I4BA 3VS4A 1VEJA 2UZVA 3NW7A 5I3RA 2FVDA 2RRUA 4C33A 4EQUA 4QMNA 5JZJA 2CGWA 3OWPA 4XNEA 4FI1A 3O51A 2UZBA 3FQEA 5KMLA 4RIWA 3MFTA 2RFSA 3OUKA 4DFBA 3BHUA 1PMNA 1OL5A 4CV9A 4W4WA 4FV6A 2XJ2A 4FL3A 4O91A 5DEYA 1YHSA 4R1YA 3VBWA 3F2RA 5C9CA 2GTNA 5CT0A 1GIIA 3ZZWA 3VF9A 4KS7A 3SXFA 3C4XA 1IXSA 3BHHA 4PTEA 2BRBA 4FV8A 1AQ1A 4IE9A 4TXCA 5AIRA 4YJPA 3ZFMA 4GYIA 3RP9A 3O8TA 3DK3A 3QF9A 4O7LA 1H00A 1VEGA 4WKQA 3BEGA 1OKSA 3H10A 4EZ3A 2ZV7A 1LEZA 4JAJA 5L8JA 1GJOA 4YJSA 2JZ0A 1ZY4A 3EQIA 3IG7A 5GNKA 3SA0A 4FTQA 4M0YA 4GW8A 1WGLA 5HGIA 2E9PA 4J96A 2EVAA 3DS6A 5HI2A 3LHJA 4QPAA 4K33A 4ZIMA 3RM6A 4OGRA 1JSUA 1ZYSA 5DMZA 4ZLYA 4TWNA 3TZ9A 5JH6A 1MRUA 3GQIA 4PNIA 2UZNA 1DI9A 1JLUE 1MQBA 3KF7A 3QCQA 4XV3A 1YQJA 1JKKA 3C7QA 4IAKA 4J98A 5FBNC 4QP7A 5TE0A 4BDHA 4F65A 3UVQA 3Q9XA 4FVQA 4IADA 5L2IA 3HMPA 3RTPA 1G3NA 2A19B 3DBCA 4OBOA 1VG5A 4BBFA 5C4KA 3TZ7A 4I94A 5K5NA 1Q3DA 2UW5A 3PPJA 4R8QA 5J7HA 5DEWA 4FG8A 4IACA 5EHLA 1G5SA 5HIDA 5T3QA 1IEPA 3FAAA 4CFVA 4IAZA 3QUEA 4FNXA 2PVMA 3F88A 2W05A 3SXSA 4GKHA 4J95A 5FG8A 3SD0A 3BYOA 4A07A 4N57A 2YZAA 4D4VA 4IM2A 3V3VA 4IEBA 2Q0NA 5FM2A 4CMUA 3EYHA 2XBAA 4AWIA 4ZXTA 1BL7A 1PXMA 4WNKA 4ACGA 2W4JA 2GQRA 3CE3A 3FL4A 3JR1A 4BDGA 1KOAA 4FSYA 4LRJA 3TL8A 3NRMA 4ZTMA 1H8FA 4DTBA 4F7SA 3MJ2A 1S9IA 4N0SA 1YHVA 5CSXA 3E92A 3HX4A 3ZBXA 2QO9A 2WQEA 4RIXA 4RWLA 1BKXA 3AC2A 5IQIA 2VWIA 1XHAA 1PF8A 4IWOA 4QYHA 4C02A 3P0MA 2VU3A 4JQEA 3R1YA 2KNZA 3MGYA 4BWKA 4HVGA 5DR9A 3C4WA 3BV2A 4RJ7A 3RCDA 2XRWA 3RPRA 5HX8A 3GU5A 5HESA 4GH2A 3KMMA 3BLHA 5A4TA 4V04A 2B9JA 3LJ0A 4DHFA 2NO3A 1P4FA 3II5A 4MF1A 5IEXA 2EB3A 3ZTXA 1FVVA 3C0GA 4DH5A 5BYZA 4GFOA 3QYWA 3TV7A 3F5XA 4ASZA 4ZJVA 4KBCA 3Q9ZA 3H9FA 4G3DA 3FC1X 1CDKA 3LFDA 2W5HA 3QD4A 3CLYA 3ZSIA 2C1BA 4I4EA 2ZM3A 2R3HA 2OJIA 2R3NA 4RIYA 5LMAA 3TNIA 2GNLA 2YLEA 1JQHA 2R3PA 3BU6A 3FXWA 4YTHA 5AMNA 3L8XA 4FGBA 3O8PA 1BMKA 3KL8A 4U97A 4CZYB 1F3MC 3NAXA 4CLJA 3NUYA 3I1AA 1ZYJA 3E88A 1VEKA 4LFIA 3WF8A 3S4QA 4ZTRA 3QCYA 3DNDA 4BCPA 4FVPA 5LVLA 2UVZA 3BCEA 1JWHA 3R01A 4W4XA 3ZO1A 3BU3A 1YOMA 4FSMA 4J53A 1LR4A 3ITZA 2BIYA 4FZ7A 4XBUA 3PVGA 2OLCA 3P4KA 4RC3A 1GZ8A 3QWJA 4IDVA 3QA8A 4BDAA 5J95A 3FSKA 2R4BA 4DFNA 1KE5A 4MKCA 2B1PA 4UMTA 4WNPA 2WB8A 2ZM1A 1UA2A 1UWHA 4L45A 4UB7A 4X2FA 4OT6A 1JSTA 3JUHA 4FKTA 5GZ8A 3HVCA 4M66A 1TVOA 1Q99A 2DQ7X 2XNOA 2YM4A 3PA4A 3Q96A 1TQPA 3K2LA 4EKLA 3VUGA 4UEUA 4ZTHA 4OTIA 1MUOA 2C0TA 2XIZA 3D2IA 3EN6A 4LL0A 3VBQA 2X8EA 3UIMA 2VTMA 3TV4A 3ZC6A 5CI6A 2ITXA 3K9OA 4EWQA 4IH8A 4BIBA 5I9YA 1HCLA 3FMMA 1U4DA 3Q4UA 4QMUA 3BZ3A 5HG5A 4R3CA 2A0CX 4AE9A 3GOKA 3CKWA 2J0LA 3FLWA 4MAOA 5HG7A 3D7ZA 1VR2A 4ITHA 3W16A 3KULB 2QHMA 3ZU7A 4AT3A 2CLXA 4RC4A 4TWCA 3WIKA 2VTQA 1H08A 1E9HA 3EQFA 4FICA 4QYEA 4S33A 1PXJA 1SYKA 4AZTA 2CCIA 3IO7A 4NH1A 5H2UA 2DS1A 2WMWA 4AA5A 3E3BX 3H3CA 3VUIA 3E93A 5FXRA 4RFYA 3BLQA 4YTCA 5BMMA 3QWKA 2H9VA 3PJ8A 4FZAB 4L68A 2X7OA 1O6KA 4FE2A 5FEQA 2A1AB 4RJ3A 3T9TA 3W2QA 4QMOA 4L52A 4F08A 2XNGA 2W1CA 3R71A 3H9RA 4U9AA 3W10A 3WE4A 2G2HA 4GT4A 2KHHA 4FIEA 3VBTA 3DB6A 5M4IA 4OAVB 3EQPA 4NJDA 4EQMA 4Z7HA 2JC6A 5JQ8A 2XM9A 3E8DA 3ZSHA 4O7TA 2MROB 2JD5A 2UZDA 4S31A 3NDMA 4YJRA 3S95A 2WMRA 1Y91A 3QTWA 4MTAA 2BROA 3V5JA 2RFDA 2YISA 4R71A 3AGMA 4A9RA 1QPJA 2XK7A 3B8RA 4IAIA 4JQ8A 4M15A 2R3OA 1URWA 1MP8A 2YIWA 5K4JA 2RG6A 3R73A 3QYZA 3VUTA 2IPXA 4ZS4A 3I81A 3CPBA 5E92A 4QMZA 4C3FA 4EH5A 4U81A 5HD7A 1QZEA 2C30A 3K5VA 3LCKA 4PY1A 4BBEA 4E4LA 5KMOA 4JG8A 2KULA 4QYGA 4FV1A 2YJSA 3C1XA 3F3VA 1AIPC 4YTFA 3TKUA 3VHKA 4O84A 3MFSA 2PMOX 2R3KA 3G15A 4BI2A 3FMJA 2K0BX 3IQ7A 4I5HA 4Q5HA 4EH4A 1TQIA 2J4ZA 3TTIA 4R77A 2CSNA 3A4PA 4IFCA 3Q2JA 5CU6A 2JBPA 3BPRA 3MH0A 2WTIA 4JQ7A 3ZC5A 5B2MA 4FIIA 2YLFA 4XRLA 2BKZA 2J2IB 3NYOA 5JGAA 4O82A 2KNAA 2GNIA 4X2GA 3OXZA 3MH2A 3PUPA 3VS3A 4JVGA 1ZWSA 3IGGA 3ZUUA 3TACA 4GU6A 4LMNA 4LGHA 4X3FA 1W98A 4GKIA 3VW6A 4KIPA 4CFNA 1PMVA 3D5WA 3KRWA 2VNWA 3FUPA 4R1VA 5FEEA 3EOCA 4UWCA 2RG5A 1GIJA 2J0KA 5CSPA 4CQEA 2WNTA 5AUZA 4DITA 1TR8A 3R7OA 3CIKA 3U9NA 2YIRA 1J3HA 2DAIA 1R4GA 4F09A 4UX9A 4MWIA 2J0JA 4FV9A 2GS7A 4W9XA 1XQZA 1PXPA 5G6VA 4HGSA 4KS8A 1SZMA 4I22A 4YZDA 3AOXA 3VS0A 1PKDA 1OPKA 3SW7A 2PVRA 2EXEA 5GIPE 2CLQA 4E20A 2IVUA 4EK3A 3RINA 5IG1A 1W0XC 4G3CA 3EN4A 3PE1A 1OUKA 4QD6A 2YWVA 3F61A 2R3FA 3E21A 3JVRA 3BHTA 4G9CA 5IQFA 1E94E 1J1BA 4QNYA 3QALE 5IISA 4YLKA 3BHVA 2UUEA 3BHYA 1NVSA 4G16A 4XG7A 1L8TA 2ESMA 3P78A 3P08A 3IW6A 3SLSA 4MBIA 4BZNA 1GIHA 4QO9A 4ZY5A 4UMPA 4AG8A 4XG6A 5D12A 3QZGA 4C34A 2WO6A 1VZOA 3LLAA 2L4FA 2CP8A 3SXRA 3TDWA 3HEGA 5IDNA 4ZJJA 2NNWB 5M06A 3ZH8A 2V62A 5I9XA 5IH5A 3UOHA 1IFYA 1KV1A 4WRSA 5CAPA 3LW0A 1Z9XA 3F3WA 1K2PA 4FKOA 4LI5A 4X6QC 2HZNA 5ANOA 2HCKA 3HRBA 3QZFA 4ZTSA 4D2VA 4DEHA 5JRQA 5FRIA 2CNQA 4IWDA 5EDRA 4Z16A 4E8AA 4CKJA 3CQUA 4G2FA 3IGOA 4H3QA 3PJ3A 2PZIA 4L7FA 4AZEA 3FL5A 1Q5KA 2E9UA 4FV5A 4BKZA 2XB7A 4OTDA 1R0PA 3QXPA 4D9TA 4FEWA 4I6QA 3E7OA 5K9IA 3IDCA 1ZLTA 3EN7A 1YDSE 5L8KA 3RHKA 3VHEA 4DFZE 2WMVA 5LCKA 2HZ4A 2C69A 2G9XA 2IZRA 2OH0E 3GLFE 2VX3A 4EH7A 2V5QA 2BAJA 5M44A 2W1IA 4JX7A 5ITAA 2B54A 5AJQA 5AR3A 3ZEPA 2A27A 3R7GA 4NM3A 4HCTA 5FDXA 2QOHA 3CTJA 3DXNA 1UFZA 3ORXA 4BYJA 1VJYA 1NA7A 3NNWA 2WGJA 3HMIA 4YC6A 4FV0A 3ZRLA 4B8LA 4C4FA 3R9OA 3K3IA 4Q9SA 4GMYA 3WARA 3GU7A 4EUTA 4PMPA 2UW4A 2AUHA 3FRHA 1KYIA 1UVRA 1YWVA 3BE9A 4AT4A 1CKIA 4F0GA 1OB3A 3Q4ZA 3UOLA 2QD9A 4IB1A 2P2HA 3LJ2A 3O71A 1WR1B 4K9YA 5CQWA 3KK9A 4LL5A 2F2UA 5AV3A 2CHLA 5EYDA 3MH3A 5AAGA 3FQHA 3OHTA 4I0RA 2XMYA 4UWYA 4YC8A 5KMIA 3DDPA 1DO2A 5AP6A 4CMOA 4YLJA 4PV0A 1OKZA 4N4SA 4EBVA 1URCA 3TM0A 3EHAA 5AUYA 3ZXZA 5EDQA 2CKPA 4GCJA 4DN5A 3QKLA 4XG9A 4DEAA 3DZQA 3RHXA 4XP0A 3PY3A 4PRJA 3KN6A 3C4EA 5CU0A 4GG7A 2NRYA 3A99A 4XUFA 5H8BA 3VO3A 4ARKA 4UN2B 4RLLA 3U54A 2YABA 3DDQA 4RQVA 4RIYB 2ZB0A 4B6LA 2I40A 1A9UA 2EU9A 3MY5A 2VGPA 2YJRA 2DENA 4I6BA 1ZMUA 1LPUA 2YCSA 5CQUA 3SHEA 3GC9A 5IDPA 4NK9A 3O50A 4P4CA 3WZEA 4ITIA 2QR8A 2YM5A 4UZHA 2HZIA 3VULA 4JL9A 1W84A 1PMUA 3DY7A 3U87A 5J9LA 4IW0A 2HXQA 5CZHA 1OKVA 2H5XA 2VV9A 1XO2B 3U9CA 4ENXA 1V0OA 5D11A 4NTTA 5BYLA 2IW6A 3C4CA 4AOJA 2JDRA 3OXTA 5AX3A 4JDJA 3Q53A 4QRCA 5IUHA 5HE3A 3R7UA 5AWMA 4HZSA 2BWEA 3UO5A 1OBGA 3ZM4A 3HDMA 4U6RA 5CNNA 2GFSA 3BV3A 4FEVA 4C36A 3QX2A 2JKOA 3BWJA 4LOQA 5IEVA 2YA9A 2WELA 4ALVA 1M2RA 5JQ5A 2YHVA 1PW2A 4D1ZA 4IB3A 2VUWA 2O2UA 4R7HA 4FZFB 2XCKA 4JAIA 2X4FA 3RWQA 4EOKA 3IDPA 3G6GA 4ANNA 3SG9A 2I7QA 1Z57A 2ITQA 1QPDA 2R3QA 3EWHA 3Q9WA 4JS8A 3WYXA 2FH9A 3R7VA 3U6HA 1FOTA 4MF0A 4I23A 4FIGA 3ULIA 3MSSA 3ZO2A 3IK3A 2P3GX 3FI4A 1U5RA 2Z02A 5KHXA 1UNGA 3LPBA 4FV2A 5AM6A 2CNVA 2YM8A 2CGVA 3OXIA 4FTJA 3TXOA 2OFUA 1Q8WA 4K77A 1A5TA 4JIKA 4MH7A 3UIBA 2PE1A 3EH9A 4O96A 1Y6AA 3R9DA 2YZLA 2YAAA 2Z2WA 3D94A 4MNEA 1R1WA 4YSJA 1HJPA 2GQSA 4FK3A 4RVLA 4BTJA 4FK6A 4MWHA 2QLUA 4MXYA 2WMQA 4RG0A 2Z7LA 3R8MA 4RC2A 4BDFA 2ZVAA 4GG5A 3U51A 3MA3A 3HUCA 3E64A 3WZUA 4O0VA 4BTKA 4CFUA 2YIQA 4D55A 1OMWA 2X0GA 3Q4TA 4U40A 3F66A 3DBEA 3OCBA 1B6CB 4LOOA 4TWPA 4NKAA 5DR6A 1OGUA 2AC3A 5AAEA 3O7LB 5J9YA 1WBNA 3COKA 2HY81 3CR0A 2VWVA 3M1SA 3P7BA 4HYIA 5E8TA 2EUFB 4X2KA 4DG2E 2C3LA 3M11A 2O25A 4KKEA 5E8SA 3SQQA 4F7JA 3IW4A 4YO6A 5E91A 4NTSA 4EZ5A 5E1EA 1C7YA 3OT8A 5KMMA 3AMYA 1QPCA 3HL7A 4YBKA 2PPQA 1H1PA 4O0UA 4O0TA 4I0SA 1YXUA 2QOOA 1E1XA 3NYVA 3R04A 3WZDA 4I5PA 4GV1A 3GC0A 5EM6A 5GIOE 2RGPA 4MBJA 3EN5A 4MX9A 3DTWA 5IA3A 2Y4PA 1TQMA 2WQBA 4CRSA 4BIDA 5DLSA 4CG9A 1Q8UA 1XH5A 3C5UA 5DFPA 1JR3E 2BRHA 4IB5A 5L8LA 1A48A 4ZK5A 3MI9A 3CTHA 3R0TA 2VN9A 2C6KA 4EBWA 2WMAA 2PUNA 3NNXA 4ZTQA 2WKMA 4MD9E 4Y73A 3GLHE 5CAOA 1H28A 4FA2A 3EFLA 5BX0A 1CSNA 4GYGA 4L00A 3AT4A 4GS6A 4FTLA 1JNKA 2GHGA 4FSWA 4BVUA 2B4SB 2WOTA 4W4YA 3U8WA 1WZYA 2VO7A 4FKVA 4K1BA 4L7SA 1FBNA 4FG7A 3REPA 3V8WA 4AGWA 4O2ZA 4O83A 2BVAA 1XJDA 2Y4IC 4GJ3A 4YPSA 5CF8A 3ZRMA 3LCSA 1O9UA 3U4UA 2K9DA 2BZJA 5JEBA 2ETRA 3RPVA 5CSVA 2CKOA 2J51A 4E93A 4F2LA 4AP7A 4CSVA 3DPKA 3ENHA 3ZSGA 2H6DA 2ITUA 3PLAE 1UV5A 3IKAA 4I24A 4NFNA 2XF0A 3G90X 4G6LA 2CGUA 4EWHA 1ZY5A 2XK6A 3LKMA 4DFUA 4JG6A 4D0WA 1DV0A 1YDTE 1ZZ2A 5IEYA 1G8AA 2VNYA 4A9TA 1YXXA 5FDPA 1SVEA 3TNWA 3IW8A 4FNWA 5J1VA 4A06A 1P14A 5KBQA 2C6DA 4ASXA 5KX8A 3IDBA 3CY3A 3DNEA 3A62A 2XNPA 4KABA 4ONAA 4WOVA 4XLVA 5LWNA 4U7ZA 3DA6A 4LMUA 2QKRA 4Q2AA 4QYYA 2FO0A 4AN9A 4AZVA 5J5TA 2B52A 1HQYE 4R7BA 3V01A 2C0OA 4JRNA 4XG2A 3QRTA 1RE8A 2Y8OA 3UP2A 2XKEA 4PWNA 4R7IA 2ZDTA 3R21A 2ETKA 5FTGA 2PY3A 4RLKA 4RX7A 3VBYA 2QOIA 1WVYA 3LIJA 5DBXA 5DT0A 5AUUA 3PDTA 5E4HA 2PL0A 2WD1A 3EQCA 2DHYA 4QPSA 4C4EA 4G17A 4ZEGA 4D2WA 3F5PA 5EQEA 5HLPA 3LFQA 3F92A 4J7BA 5FLFA 5KZIA 4L01A 4FIHA 4D4YA 4G3FA 4K8AA 4QNAA 3I6WA 4FTAA 3ODYX 4DFXE 3PPKA 2ITWA 3QQLA 1APME 3D15A 3FMNA 4S2ZA 4U5JA 5G1XA 4O0XA 4U43A 2C47A 3AXWA 2UW0A 4BWPA 5I4NA 3F5UA 2VX1A 3NUAA 1JSVA 5J8IA 4A4OA 3QLGA 4LYNA 3TKIA 1OL6A 1Y57A 4D2PA 2O5KA 4EH9A 4HVDA 2IZSA 5KHWA 4NW6A 2OGVA 3BIZA 1JPAA 4NZWB 4P5QA 5D9HA 5EYCA 4O7ZA 2ZV9A 4AW5A 4QP9A 3RM7A 3W2OA 4BCOA 5AADA 2J50A 3PJCA 4S30A 2OO9A 1KE6A 5CSHA 2BRMA 5HO6A 5C1QB 4AA4A 4DEIA 2ZYBA 4NEUA 4RWKA 3CXWA 4DEDA 3I0OA 3QX4A 3ZEWA 5IUGA 4IC8A 4BN1A 1XH9A 2B9HA 2IZTA 5CF5A 2H34A 4OTFA 3R2YA 2UW3A 3I7BA 2BFYA 5CYIA 4I1ZA 2IWIA 3AT2A 3MS9A 4Y8DA 5DYJA 4C3PA 3ZLYA 4YURA 2QR7A 4XV1A 4QP6A 3GCQA 4QMMA 3R28A 4LG4A 5LVOA 4E73A 2PSQA 3COHA 4RZWA 3POZA 5HBHA 3OY1A 4DLJA 5JFSA 3RALA 3U55A 4IANA 4G5JA 4FTTA 4IAAA 4BWXA 2OICA 3BU5A 4FKLA 4UY9A 5AEPA 2XKFA 2XS0A 3BRBA 3F2AA 5J79A 5IQCA 3ETAA 2QC6A 4NSTA 4XG4A 3PY1A 1YWNA 2VTSA 4FTIA 5HNGA 4ALWA 4ZLZA 5I5ZA 2OBJA 5L2SA 4GT3A 2YDIA 4CZUA 5KCVA 5LARA 2JIIA 4EHVA 1XKKA 3Q2MA 3CY2A 1PKGA 2OKRA 2PYWA 3R1SA 2JKMA 2WU7A 2C1AA 4KSPA 3GT8A 4QP3A 4ACMA 2JUJA 3WBLA 2C3KA 4RFMA 1NVRA 3NPCA 2W0JA 5IZFA 1NV8A 1YKRA 3UJGA 3E62A 4FSRA 4QMLA 5CANA 4X3JA 2DZLA 2C5YA 3GBZA 5A3XA 4KSQA 4O0YA 4YR8A 2HENA 3ODZX 3A7FA 4DT8A 3FYJX 4QTAA 3TKHA 3FEGA 1WFCA 4RPVA 3TUBA 3Q6UA 4WG5A 2MGWA 1Q8TA 1W83A 5L4QA 5C4LA 3QD2B 3RMFA 2UW9A 1XBAA 3ALOA 4RWJA 4L9IA 1ZMWA 3GUBA 3COMA 4RSSA 4DBGB 2QURA 4LV8A 2JY6B 3GEQA 4KRDA 3WOWA 1IAHA 3DLSA 3ELJA 4O0WA 4CTBA 4AGDA 2BZIB 3KXMA 3FQSA 1PYXA 3GLIE 3OW3A 5C01A 4PQNA 5IUIA 4ZAUA 1WVXA 1R39A 3CBLA 5EDPA 3FBVA 4FF8A 5ETFA 3ZLXA 4D1SA 4I6HA 4FZ6A 4R3PA 2EJSA 4GL9A 1DM2A 5FQDC 4I4FA 3UNKA 4I5CA 2LAVA 4D5HA 2OI4X 3HMNA 3BE2A 2W5AA 3ZO4A 3EQDA 4BDJA 3QTSA 5E8ZA 3R7IA 4AA0A 1PXNA 3TIZA 3PXZA 3ORIA 4XP3A 3KCKA 5IQAA 3UNJA 2R0IA 3QQKA 2RSVA 2R7BA 3R1QA 4DGMA 4F6SA 2PZRA 3OS3A 3PIZA 5CF6A 2UVXA 3UC4A 3UBDA 2JKKA 2C68A 4JNWA 4ANOA 3FKOA 3P86A 4FT7A 4X7QA 2HK5A 4UALA 3GU4A 3KRRA 4EI4A 3VIDA 3SW4A 1WBOA 3CJFA 3NSZA 4O0SA 3D4QA 1KOBA 1IM2A 5CVFA 1OL1A 5HE2A 4FODA 4L6QA 2E2BA 2JFLA 3KMUA 3HLLA 5D10A 1VYZA 4O0RA 4QMPA 5EYMA 2LVNC 3FE3A 4N6YA 3ENMA 5IA1A 2HWOA 3UYTA 4UXQA 1BVSA 3EMGA 3K9PA 5BVDA 1JAMA 2GSFA 2ZTCA 4MYGA 3EQRA 3FC2A 2DKLA 3FLZA 3MMPA 4CT2A 4YJTA 1O6YA 3EKKA 4GIIA 2HYYA 3R9HA 3QCXA 2OG8A 3JS2A 4DG3E 1GZKA 3TJDA 5AUWA 4M7IA 3C0HA 5JRSA 2OIDA 2YEXA 3NIZA 2W7XA 3OWKA 4DEBA 4EC8A 5M53A 2XJ0A 4HW7A 2W1HA 2BHEA 3NAYA 1J1CA 4U42A 3QRUA 4FV4A 3AC3A 4KIKA 5EYKA 3RAHA 5CF4A 2BMCA 4UV0A 1WAKA 4BCJA 5IQGA 3AC5A 4YZCA 4AZFA 2XNNA 4WA9A 2H96A 3HDNA 3QQHA 4IZYA 1BL6A 1WBVA 3OF0A 4DCEA 2Y4IB 2R9SA 2YDJA 4F1IA 1ZAOA 5EG3A 5EOLA 3PPZA 3W1FA 3WF9A 4AOIA 2LVAA 5C8MA 4FOCA 4G3OA 3MH1A 2AYPA 2ZDUA 1QPEA 3NEWA 3HMMA 1ZZLA 4ZOGA 5GJGA 4ANBA 4HVHA 3THBA 4O7RA 3QTQA 3EZVA 2GS6A 3P7AA 4TYHA 2VTLA 2A2AA 2PUIA 3DK7A 3QUDA 3QD0A 4P2KA 4CQGA 3I5NA 4RJ6A 3V8TA 4QMWA 3W2PA 5JFVA 1BI8A 3ACJA 4O7NA 3KK8A 4XOZA 4F9CA 4LV5A 4B9DA 4WNMA 2R3JA 4AUAA 3E7VA 3PA3A 4FT3A 3TDVA 3V6SA 3DXQA 1X8BA 4E4MA 3O8UA 1NY3A 3C51A 4F1MA 3RVGA 4WIHA 5E8YA 5HTIA 4JR3A 3C4ZA 4TRLA 4X6RA 4XBRA 3COIA 2C3JA 2BZKB 3OG7A 4KRCA 1E1VA 5EW8A 1MN3A 3LFAA 4OTWA 2WTDA 3P1AA 4QP2A 3O17A 3EKNA 3KQ7A 2Y7JA 1YOLA 5DNRA 3VQHA 5BUIA 2RL5A 4E7WA 4M13A 5HTCA 5FGKA 3LM0A 3G51A 4M67A 4CKRA 4ZSAA 3O2MA 5CVGA 4V0GA 3KN5A 1YLAA 4WRGA 1H25A 3QTRA 2JDVA 3SDJA 2YN8A 4CT1A 4CVAA 5HCZA 3EQBA 3V6RA 3FI8A 4U79A 3HA6A 2WOUA 4BCQA 3NUNA 2EXCX 1W82A 3TUCA 4BCGA 4BIEA 3HAVA 4PL5A 4GEOA 3CEKA 4MXXA 5LJJA 4K18A 4B99A 5CEOA 4FL2A 3S2PA 3GQLA 2H8HA 2YACA 4A9UA 2G1TA 3S00A 2G15A 5M56A 3FI3A 3MY1A 4GSBA 4TT7A 3C0IA 4GK2A 1F5QA 4QTEA 4RVKA 2LGCA 3SRVA 2QLQA 4AFEA 3Q5IA 3NWWA 4QTCA 3UNZA 4FUXA 2C3IB 3G5DA 3VS2A 1DI8A 5JZNA 3WZKA 1ZOGA 2WU6A 5A6OA 5M07A 3NIEA 4BCIA 3QQGA 1OL2A 4G5PA 5J5SA 3L9MA 3GXLA 3FZRA 3UG1A 1WMKA 4IVCA 3UP7A 2W5BA 2WMUA 4IJ9A 4WUAA 1IAJA 1HT2E 2BR1A 3OOGA 3GU8A 3KC3A 3FKNA 4M69A 1PHKA 3W18A 3SGCA 5D7AA 3BYSA 3OWLA 4EONA 4LOPA 3AD5A 3QUPA 1GAGA 3HV3A 2GDOA 5DRDA 4EUUA 3FLSA 4NJ3A 5AM7A 5AP4A 3Q5ZA 1V1KA 3DAEA 2QOKA 2PMNX 1PY5A 2ZMDA 3VRZA 5CALA 1BUHA 3AMAA 4WP2A 3RI1A 5CAVA 2XK3A 2FSTX 2O3PA 4I41A 4C57A 2GMXA 3FLQA 3FLNC 2X2KA 4RZVA 1GOLA 1LUFA 4F6UA 2G01A 3PJ2A 3Q6WA 3QU0A 4L3JA 4UMUA 3EFKA 1OECA 4EHGA 2WPAA 4JJRA 4MQ1A 4AW2A 1GNGA 4EJ7A 4PPAA 5AP2A 5FBOA 3IOKA 5C8NA 2UZTA 4TKSA 4YJUA 1G8SA 4CFXA 4OTPA 3C13A 3EFWA 4QOXA 4X21A 5E90A 3MY0A 1NVQA 3FMKA 5LOHA 4CEGA 4W9WA 2E9NA 3ZLWA 2DUVA 3A4OX 4FNYA 3T8OA 4F0FA 5AIKA 4V05A 2F49A 3CS9A 4RIWB 3EJ1A 5L2TA 2VTPA 4DAWA 4AGCA 1CMKE 3MFUA 3WE8A 2C5NA 3FZOA 4OBQA 1FVTA 2IVSA 5CZIA 4PF4A 3IW7A 4IHPA 5M55A 4JX3A 3N4TA 5HU3A 4PDSA 2GCDA 3QA0A 5EHYA 5B0XA 3RJCA 4DH7A 1NW1A 3B2TA 4J71A 4DCAA 2MJ5B 1STCE 3UIXA 4IQ6A 3ZFXA 3L8VA 4R3RA 5GZ9A 2LBCA 4O86A 4IXPA 4RBLA 4X3FC 1B38A 1DAWA 4BR3A 2HY0A 2VTRA 3EB0A 3PLSA 2QSFX 3DLZA 2X6DA 1ZOEA 3EFJA 4H3PA 3UPZA 5EQPA 4DG0E 2O0UA 1CKPA 3KREA 1Q02A 3IECA 1PXKA 4JBVA 4Q5EA 1RW8A 4A7CA 4ZY4A 3HAMA 5AR7A 3VUKA 3JYAA 4GK4A 4BZDA 3QTZA 4EHZA 2PWLA 4C2VA 2LVQD 2OW3A 4D58A 3F6XA 5HU9A 3GC7A 1OI9A 3VF8A 1H0VA 2YCFA 4FTOA 4C4GA 5CAUA 1PRYA 3PXKA 4BF2A 1FMKA 2GTMA 5E1SA 4BTFA 1ATPE 1SM2A 3KU2A 4NW5A 3QBNA 3H0YA 4MBLA 5LMKA 3FXZA 3ULZA 4PMMA 4KBAA 3NW5A 1T43A 4UYNA 4HVSA 5JN2A 1ND4A 5L6PA 1Y8YA 4CXAA 2JZ1A 3LMGA 4PDYA 5EFQA 3FYKX 4O6EA 1OAIA 4BGGA 3PSCA 5TKDA 1A06A 5J7BA 4RRVA 4TYEA 2YIXA 4HJOA 3VBVA 4FNZA 5AP1A 3QTIA 4RFZA 2B9IA 2OXDA 4USEA 3HV5A 2WTJA 3KXGA 4C58A 4HYHA 5HO8A 2ZMCA 4IC7A 3WYYA 5KNJA 5C27A 3SKCA 3BKBA 3EN9A 4P5ZA 2OXXA 2OJFE 4YNEA 3UG2A 4QQ5A 3D5UA 3DU8A 4NYEA 3FSFA 3LFSA 5DA3A 4FG9A 3DJ6A 4JRVA 4RIXB 3R7EA 4IVDA 5EW3A 2RIOA 4U8ZA 1CKJA 5A14A 5IQDA 1V92A 5M09A 2PZYA 1P5EA 3ZXTA 1M7NA 2Z8CA 4JI9A 5LMKC 3SV0A 3TNPC 3LCOA 2G3QA 2FUMA 3UDBA 5BMSA 1SG9A 4E6AA 2I6LA 3GNIB 3K5UA 4IAYA 5I3OA 3CP9A 5HCYA 3H9OA 4TPTA 5I0BA 4UBAA 3P7CA 4S32A 1DAYA 3NGAA 2OIBA 4HPTE 3TV6A 5BVFA 2XNEA 3DCVA 4E6DA 2FA2A 3QQJA 4BRXA 4AN2A 4DFLA 2XYNA 4K2RA 3BX5A 4USDA 4B4LA 4WO5A 4F7NA 3VUHA 2YFXA 4KNBA 3HGKA 4KIQA 1BLXA 2IW9A 3PTGA 4RX9A 1WBSA 5CX9A 3TT0A 4W8EA 5KZ0A 3LXLA 2VO6A 4FBXA 3F3UA 2ITOA 3NR9A 4EK6A 2JGZA 2P4IA 4GRBA 4WHZA 1I44A 3BBZA 2ONLA 3NVMB 5ETAA 2BALA 3N4VA 2IN6A 3KVWA 1XB2B 4MXCA 3VS6A 4KIKB 1L3RE 3LCVB 4DGOA 4HPUE 4EORA 1U5QA 4IWPA 5IH4A 5CEIA 2BHHA 3MTFA 3FMHA 2PVYA 4AACA 3BBTB 3RK7A 4FKGA 4YJQA 5B7VA 4II5A 4BTMA 3FY0A 1VQ1A 2WXVA 3KRXA 5DIAA 4G3GA 3R8PA 3EL8A 3AG9A 1F0QA 4O81A 3A7IA 4M14A 4AU8A 3VUDA 2BILB 4E5WA 1IA9A 2XNBA 4Y95A 3R30A 2DAGA 3VS1A 3MN3A 3I7CA 3LCDA 4BL1A 2Z7RA 4D2RA 2JDSA 4MK0A 5ANJA 4H1JA 4Q9ZA 5A4EA 2OZAA 3R9NA 2QNJA 2HIWA 3D5VA 4K11A 4ACHA 3DKOA 3L9NA 5AA9A 2OO8X 5E8VA 2UV2A 1G4AE 4E26A 2PHKA 4YJVA 3NUSA 4O27B 2WMXA 5AV1A 1OPLA 2HELA 3ZS5A 3POOA 4ZMEA 2C6EA 3AD4A 2FGIA 4QMYA 1ZYDA 2DI0A 1FMOE 2ONLC 3FLYA 1YRPA 5E8UA 2RF9A 4BCNA 5K4IA 2IZUA 5EI2A 5HE0A 3PIXA 3KEXA 2GHMA 5JSMA 2W17A 4B0GA 2VRXA 4RVMA 3LQ3A 2XM8A 1ZRZA 3O0GA 4Z9LA 2CKQA 5AX9A 3W2SA 5IA4A 2YIYA 1YVJA 2CKEA 2WTVA 3QZIA 5DR2A 5TR6A 3R8VA 5CU2A 3TCPA 3OP5A 4IX5A 4IM3A 3BYMA 4C59A 3A2CA 4AT5A 5T6KA 3LMHA 4PX6A 5HEZA 3L1SA 4M0ZA 5HVYA 2QOFA 4X0MA 4DE4A 2JFMA 5GINE 2Q0BA 3F9NA 4JBPA 4CFWA 5HVKA 3UZPA 3OC1A 3H4JA 5KMNA 3MPAA 3ROYA 4ASDA 3NUXA 4FL1A 3FZSA 4FKUA 4RQKA 2EB2A 4KAOA 4UYAA 4E4NA 4F1TA 4QP4A 5AP7A 3V51A 5M08A 5LMBA 1XBBA 4IX3A 1WBWA 3PWDA 2PMIA 3DBFA 2I1MA 3CGFA 3T3VA 4CFMA 4HYSA 2PVNA 4JR7A 3I79A 4IX6A 2ZTDA 2DAKA 5EK7A 4CYJA 3JXWA 2V22A 3VJOA 3OEFX 1OIRA 3W33A 3ORKA 4JLCA 2BRGA 5LVNA 3QQFA 3HYHA 3SRVB 4OBPA 3ZZEA 1P4OA 4DT9A 3JY9A 4YJNA 2R5TA 3AC8A 2QO2A 4FT5A 3UO4A 4MD7E 4YZMA 2PK9A 2F7EE 2XRUA 4M12A 4A4LA 2WMTA 5IQEA 2R3GA 3WF5A 2Z7SA 1YXTA 3FPQA 3LCTA 5FXSA 3QGYA 3L8PA 2DYLA 4ZSGA 1M2PA 3RNIA 3S1HA 4ANMA 4FTUA 5FXQA 4PNKA 5JGDA 3CPCA 5F9EA 4UMRA 4ZTLA 4AW1A 4M69B 4ANLA 5DVRA 2I0EA 2AC5A 2Y6OA 4C0TA 4EH8A 4Z55A 5EKNA 3DBQA 4DH3A 3V04A 5IA0A 2YAKA 3RK5A 1PJKA 1J7IA 3HRCA 3GOPA 4GFMA 2PZ5A 1PYEA 3C9WA 3HUBA 2R3IA 3W8QA 1HOWA 1SVHA 3KMWA 3LMIA 3HP2A 4NKSA 5CAQA 4KUJA 3UOKA 2XIKA 3RZBA 5KMJA 4ACCA 3KY2A 4OT5A 2BDJA 4X3FB 3RGFA 4WNOA 5C8KA 2BTSA 4BDBA 2ITYA 2NP8A 2HW7A 4TY1A 1G41A 3R6XA 5H8GA 3UODA 5LCJA 1QMZA 3DT1A 4NM5A 3FY2A 4ZSEA 4BCFA 3JVSA 4E6QA 4I3ZA 5C03A 4K0YA 3VWAA 3RCJA 1UKIA
chains in the Genus database with same CATH superfamily
1SVGA 3ZCLA 2QODA 2UZUE 4ANSA 2XIXA 4YTIA 4C7TA 3HV6A 4QHTA 4FYNA 1D0LA 3GPUA 4FKPA 2QQ7A 1GY3A 2PE0A 2OU7A 4FT9A 4A9YA 4IBMA 3LFCA 3R63A 2X4ZA 1PJTA 3CGOA 2WEVA 5DHJA 5ITYA 4YUQA 3U6EA 4IFGA 3SMSA 4TYJA 5KBRA 5ANKA 1BYGA 4PD2A 4IIRA 4ZS0A 1OBDA 3ZFYA 1H07A 4NRWA 4BFMA 4JBOA 1S9JA 3U6LA 3KB7A 3HJSA 2QI8A 1YW2A 2X9EA 3A7GA 4DEGA 4Q7JA 4Y5HA 4LJ4A 4ID7A 2W4OA 4TL0A 1E9SA 3NUPA 5DGZA 1IQPA 5EP3A 5BQ0A 5AV4A 5A9UA 1UNLA 5E7RA 5AR4A 2CN8A 2DXIA 3WZJA 3E46A 4IM0A 4HOKA 5TT7A 4IB0A 5HBEA 1O6LA 3GLFB 5TO8A 4ERWA 3ANRA 4L53A 3OTVA 3PSBA 2OWBA 3UO6A 2HOGA 4PDIA 1CM8A 2C6OA 3MV5A 3C4FA 4W8DA 4WSQA 2OK1A 4ITJA 3LAUA 4BHNA 2FSOX 5CSWA 1OAOC 1EH4A 5JMSA 4O38A 1IXRC 4V01A 5M4CA 4LRKA 3QKMA 4CFFA 2C96A 2OOAA 2JBOA 2KEBA 4DF3A 2X0PA 3FYCA 4HGTA 3AMBA 3TG1A 2OJGA 2F7ZE 4QEBA 3G2FA 2FE8A 3MIAA 2Z60A 3EYGA 3CGWA 2IVVA 4FKJA 4MHAA 2L7IA 2V1CA 5HORA 3U6MA 2DZNB 1BX6A 3HRFA 4LM5A 4Z7GA 2J5EA 3PE2A 2J0MB 1UNHA 4FYOA 3SATA 1SNXA 4PPBA 2DAMA 1JBPE 5C26A 4FTRA 3OWJA 3ATSA 4MNFA 1KV2A 3S3IA 1M7QA 2WTWA 2BJVA 3ORPA 2C5XA 5HTBA 4I92A 3U4WA 2I7PA 5IKWA 3Q9YA 2BIKB 4C4JA 4PT5A 3PXYA 4QQJA 5CT7A 4QMVA 4RA5A 3TQSA 4BDEA 4E5AX 5AV0A 5CS6A 3GCUA 3LXPA 2UVYA 4EOIA 3W0MA 4YU2A 2ZV2A 3A7JA 3TYKA 2CHGA 4CD0A 2OZOA 4BB9A 4DGLC 1AD5A 4BHZA 3OROA 1PXIA 3RWPA 5HD4A 4YZNA 3ZM9A 1PJJA 2I0HA 4M0WA 3U6CA 2XNMA 5IQHA 3JY0A 4F70A 4AAAA 3RPSA 3LXKA 3HNGA 1UKHA 2QONA 4FSNA 4O4FA 4U3ZA 3ACKA 4FIJA 3I4VA 1ST4A 3MVJA 3UQCA 3ORTA 4XX9A 2XANA 4ZJIA 3UIUA 1QCFA 2WMSA 2OXYA 2W9ZB 1GZOA 4I0TA 3TJCA 2R2PA 4J99A 4JDIA 4J97A 5HVJA 4QP1A 4FV3A 2QU6A 2UW8A 5JEBA 2C6MA 3UVRA 5CEPA 3LLTA 2J7TA 2QKWB 3NZ0A 4KD1A 3ILKA 5BVWA 3R9RA 3W0PA 2WTCA 2Y6MA 3PVUA 3U5ZA 4BGQA 5HBJA 3UC3A 4AW0A 4MQ2A 4TWOA 1RU3A 4AS0A 2HZ0A 5FTOA 1XH6A 2W1GA 3DJ7A 3BLRA 4QQCA 2CUZA 3UOJA 1M17A 2WQMA 3LQ8A 5AUVA 2ERKA 3PG3A 2XK4A 4QTDA 3FWQA 4PDOA 1PXOA 5EQYA 3QAME 2UXCM 4M8TA 2XK8A 2F7XE 2VWYA 2ZM6M 3GP1A 4XS2A 3ZRKA 2RKUA 4K6ZA 5DOSA 2X9FA 1FPUA 4EOSA 5EXTA 2QQ8A 2VX0A 5AR8A 3WI6A 3VJNA 3QCSA 2VQFM 2Z7JA 2X7GA 5A4QA 2KRUA 3UZRA 4DYMA 2P0CA 3R02A 5FP5A 4MM3B 3R9XB 5DN3A 4RJ4A 5CU4A 4IBFA 2X39A 2BKKA 1TKIA 3MIYA 1R78A 5KKRB 3CCNA 4FSQA 1IR3A 4G34A 3CSVA 3ORMA 4GT5A 5AAFA 4U41A 4EOMA 4TYHB 3GLGE 2WIHA 4ANQA 3SX9A 4WSYA 2R7IA 1D0MA 3GU6A 3VK8A 2CN5A 4PL4A 3CJGA 3EL7A 5CEMA 2W99B 4USEA 3RPYA 3QL8A 3I6UA 3TIYA 3RAKA 3MTLA 4GHAA 2A4LA 3ANQA 3UE4A 3RK9A 2EKFA 2QG7A 2X81A 4V0GB 1J7LA 3PG1A 4USFA 4FGRA 4DHIB 4EH3A 3VUMA 3ZQJA 3J2PB 3F3TA 4A4XA 4OU7A 4YC3A 5H8EA 4AW4A 4IDTA 4AFJA 3Q60A 2WTKB 2J6MA 4X65M 5GZAA 1H24A 3G6HA 1H1SA 3Q32A 5E6JA 4BCMA 2GS2A 3DKGA 3FTFA 2Y9QA 4ZSJA 4EHZA 3R8ZA 4YSMA 4RIOA 4B7TA 4AOTA 3HX3A 4CV8A 1JKTA 4CHTB 1OM1A 4E6CA 3FKEA 4XOYA 4G31A 2PU8A 5LVMA 2FNAA 1I09A 3IS5A 4P7EA 4LGGA 1PJSA 4I93A 4QMQA 3UMXA 3CQWA 5CEQA 4YMJA 3DAJA 5IU2A 3PJ1A 2LHCA 4IIWA 1W8CA 2VGOA 5IF1A 5E8XA 3IW5A 4C4HA 3HA8A 4HVIA 4D28A 4EZ7A 3BGZA 2QZ4A 2IO6A 4DLIA 4OTHA 5ETIA 4D0XA 2JNHA 4YHFA 1ZQ9A 5HOAA 2G2FA 4ORKA 1VEBA 4E1ZA 1JOWB 4LFCM 3RPOA 4FKIA 3SOAA 3LVVA 5HQ0A 5EM5A 4ERKA 3D7TB 3T6PA 3RKBA 3VKGA 2PVKA 2JY7A 3WIGA 2V55A 3HV4A 4AZSA 4CKIA 3E8CA 4QMSA 1NVMA 2JP7A 3A7HA 1NV9A 3LCUA 4F64A 3TNQB 3FXXA 3DFCB 2O8YA 3WHLA 1VEJA 3NW7A 4C33A 4EQUA 4XNEA 2RFSA 3BHUA 4FL3A 5DEYA 1YHSA 5CT0A 3VF9A 1IXSA 3GQ5A 3BHHA 4IE9A 4TXCA 5AIRA 1H00A 2ZV7A 1GJOA 4YJSA 2JZ0A 3IG7A 3SA0A 3HHWA 4DV6M 2EVAA 5HI2A 4OGRA 5DMZA 3GQ3A 1DI9A 1YQJA 3C7QA 4QP7A 4F65A 3Q9XA 3K92A 4OVZB 2QCUA 4OBOA 2XZUA 2HKJA 1PJQA 5J7HA 4FG8A 5HIDA 4FNXA 2PVMA 4GKHA 4A07A 3V3VA 3EYHA 2XBAA 3VK7A 4AWIA 4ACGA 1KOAA 4LRJA 3NRMA 1H8FA 4DTBA 1S9IA 4RKUF 3E92A 1I4WA 2WQEA 4RIXA 4JI4M 2VWIA 1PF8A 3BV2A 4V04A 1YUBA 2B9JA 3LJ0A 5IEXA 3ZTXA 4DH5A 4GFOA 4ASZA 3TNIA 5AMNA 4CLJA 1F3MC 3NAXA 1ZYJA 3S4QA 1JWHA 3BU3A 4XBUA 4FZ7A 1GZ8A 4BDAA 4MKCA 4WNPA 1UWHA 4L45A 4UB7A 4OT6A 4FKTA 5GZ8A 4M66A 3W67A 2YM4A 2M5ZA 1TQPA 3K2LA 4LL0A 3VBQA 3ZC6A 3EN6A 4O84A 4EWQA 5CI6A 4IH8A 4BIBA 3Q4UA 2UXBM 3FLWA 2CLXA 4TWCA 4AA5A 4RFYA 4L68A 2X7OA 1O6KA 2NYAA 3T9TA 4QMOA 4L52A 3H9RA 5M4IA 3DB6A 3M6AA 4Y28F 3E8DA 2JD5A 2UZDA 4S31A 3S95A 3SASA 2BROA 4R71A 4M15A 3R73A 3VUTA 4MUQA 4QMZA 5HD7A 3K5VA 4FV1A 3C1XA 3F3VA 4L4UA 2PMOX 3FMJA 3TTIA 2JBPA 3ZC5A 2KZSA 4FIIA 4XRLA 4O82A 2KNAA 2FOIC 3OXZA 3MH2A 1ZWSA 4GU6A 4JI8M 4KIPA 4CFNA 1PMVA 3KOYE 4DITA 1TR8A 4QNRA 3CIKA 3U9NA 1J3HA 2JXNA 2J0JA 4FV9A 2GS7A 4DV2M 4I22A 1TFFA 2CLQA 3EN4A 3DA1A 3JVRA 3BHTA 4QNYA 3QALE 4G16A 1L8TA 2ESMA 4BZNA 4ZY5A 1DGGA 2WO6A 1VZOA 3SXRA 4ZJJA 2V62A 5I9XA 3UOHA 5CAPA 2YNMD 3HKPA 4ZTSA 5I0BA 5JRQA 5FRIA 2CNQA 3L29A 3CQUA 2PZIA 4BKZA 1R0PA 4I6QA 3EN7A 1YDSE 3LQ3A 3RHKA 5LCKA 2HZ4A 2IZRA 3GLFE 2BAJA 2W1IA 5AR3A 4NM3A 4HCTA 5FDXA 3HJQA 4BYJA 3NNWA 1PM5A 4YC6A 3TWLA 4B8LA 4LGYA 4O4EA 4Q9SA 3GU7A 3FRHA 3BE9A 3GPYA 2P2HA 3LJ2A 4K9YA 5CQWA 5EYDA 4BJJB 2XMYA 5KMIA 1DO2A 4PV0A 1OKZA 4N4SA 3TM0A 5EDQA 3PY3A 3C4EA 5CU0A 4GG7A 2WSEF 4ARKA 3U54A 3DDQA 4RQVA 1IXZA 4RIYB 2I40A 4L78A 4I6BA 1LPUA 2YCSA 3SFZA 4P4CA 4ITIA 2QR8A 2YM5A 4UZHA 3VULA 3DY7A 3U87A 5CZHA 1XO2B 4ENXA 1NY5A 5AWMA 4P16A 4FEVA 4U6RA 3BWJA 2YHVA 2O2UA 4FZFB 3Q9WA 2FH9A 4MF0A 4I23A 3TE6A 3W0LB 4FIGA 3MSSA 3Q8XA 3FI4A 5KHXA 1UNGA 4AAYA 3LPBA 5AM6A 2CGVA 4FTJA 1Q8WA 1SXJB 4K77A 4O96A 3GPPA 2Z2WA 3D94A 4MNEA 4RVLA 4BTJA 4RG0A 2Z7LA 4RC2A 3HUCA 3E64A 4D55A 4U40A 4NKAA 1OGUA 5J9YA 4DR4M 4IBGA 4G4NA 5E8SA 1C7YA 4O0UA 1YXUA 4MBJA 3W0SA 2WQBA 4CRSA 3C5UA 3CTHA 3NNXA 3GLHE 4FA2A 5BX0A 4GS6A 4FSWA 4BVUA 4L7SA 4FG7A 4AGWA 1XJDA 4GJ3A 5CF8A 1L1ZA 3LCSA 2K9DA 2ETRA 2J51A 3DPKA 1UV5A 3IKAA 1ZY5A 4DFUA 4JG6A 4A9TA 3KP1E 3TNWA 3IW8A 4FNWA 5KX8A 3A62A 2XNPA 4KABA 4ONAA 4AG6A 4LMUA 2QKRA 4JRNA 3QRTA 2Y8OA 3UP2A 2XKEA 2ZDTA 3R21A 5AUUA 3UDTA 2WD1A 4QPSA 3F5PA 4J7BA 4FIHA 3ODYX 1APME 3KS8A 3AXWA 2VX1A 3SBJA 5J8IA 5DYGA 3A98B 4A4OA 2I7NA 2IZSA 4NW6A 4P5QA 1JPAA 4O7ZA 4AW5A 4QP9A 3PJCA 4S30A 4JN6A 5CSHA 4RWKA 3CXWA 3QX4A 5IUGA 4OTFA 3I7BA 2BFYA 2Q2EB 5CYIA 4I1ZA 3UJNA 3FYDA 4QP6A 4QMMA 2PSQA 3OY1A 4R3DA 5AEPA 5J79A 3BRBA 2OBJA 4CZUA 4EHVA 1XKKA 3R1SA 4RFMA 4HL4A 2C5YA 4YR8A 3Q6UA 4L9IA 2L7HA 3AKZA 4RSSA 4O0WA 2BZIB 1WVXA 3CBLA 3FBVA 5BV3A 2OI4X 3HMNA 3TIZA 3ORIA 5IQAA 3UNJA 1N75A 3PIZA 3FKOA 2HK5A 3VIDA 3SW4A 3NSZA 4O0SA 3D4QA 5CVFA 5HE2A 4L6QA 1VYZA 3PFYA 4O0RA 3FE3A 3ENMA 5IA1A 2HWOA 2V1UA 3UYTA 3K9PA 5BVDA 1JAMA 2O5RA 3FLZA 3MMPA 4CT2A 2HYYA 2OG8A 4DG3E 2YEXA 4DR2M 3OWKA 3TMOA 3GLIA 3AC3A 4BCJA 4AZFA 4WA9A 3HDNA 3QQHA 1BL6A 2R9SA 3WF9A 4AOIA 4G3OA 4ZOGA 3HMMA 1ZZLA 4ANBA 3QTQA 3EZVA 2GS6A 3DK7A 2OQ4A 4CQGA 3I5NA 4A3VB 4QMWA 1Q3BA 5JFVA 4LV5A 2R3JA 5E8YA 4TRLA 4KRCA 5EW8A 3O17A 2XSZD 3KQ7A 5DNRA 3VQHA 5HTCA 3G51A 4LRTA 1YLAA 3UZUA 2JDVA 3SDJA 4CT1A 4CVAA 3CEKA 4MXXA 5LJJA 3S00A 2G15A 1QAOA 2LGCA 4AFEA 4QTCA 4FUXA 3WZKA 3G5DA 1DI8A 3NIEA 4BCIA 3QQGA 1XMLA 1WMKA 3UP7A 2W5BA 4WUAA 1IAJA 2FH0A 1HT2E 4EONA 4LOPA 2GDOA 4NJ3A 3Q5ZA 3VRZA 5CAVA 3HHXA 4I41A 4C57A 2K6BA 2X2KA 1LUFA 4L3JA 4EHGA 4JJRA 1G8SA 3SAWA 4X21A 3MY0A 4JI2M 5LOHA 3ZLWA 2DUVA 5AIKA 4V05A 2F49A 5L2TA 2VTPA 4AGCA 3WE8A 1FVTA 3IW7A 3N4TA 5HU3A 2GCDA 5EHYA 5B0XA 1NW1A 4DCAA 3UIXA 4NSRA 4R3RA 5GZ9A 1B38A 4QNMA 4TUWA 1HQCA 1TH3A 5EQPA 2O0UA 4ZY4A 4A7CA 2XF3A 4YY3M 5HU9A 4FTOA 1PRYA 5CAUA 3PXKA 4BTFA 1ATPE 4MBLA 3FXZA 1T43A 1ND4A 1Y8YA 4CXAA 4DR1M 4HJOA 3VBVA 4C58A 4HYHA 4IC7A 2DWLA 4P5ZA 3D5UA 3DU8A 4JRVA 4IVDA 5EW3A 2RIOA 5A14A 3ZXTA 4KT0F 3TNPC 2FUMA 4E6AA 2I6LA 5I3OA 3CP9A 4S32A 1DAYA 3NGAA 5BVFA 3DCVA 4AN2A 4K2RA 4B4LA 3VUHA 4KNBA 3HGKA 4KIQA 4W8EA 5KZ0A 3F3UA 3NR9A 2QPAA 2P4IA 4GRBA 2DWMA 3N4VA 1L3RE 5IH4A 1U5QA 4IWPA 4B3RM 3FMHA 4GH9A 3I4YA 2RGHA 4LGMA 4O81A 3A7IA 4AU8A 1IA9A 2XNBA 3MN3A 3I7CA 3LCDA 4BL1A 2Z7RA 2JDSA 4MK0A 4H1JA 4NRVA 5AA9A 2UV2A 1XWIA 2PHKA 4GMQA 2HELA 3FLYA 1YRPA 5K4IA 2IZUA 5EI2A 3PIXA 3KEXA 2GHMA 2L09A 2XM8A 1ZRZA 3O0GA 5IA4A 4MH0E 1GL7A 2YIYA 4AT5A 3LMHA 1GLNA 4X0MA 3NUXA 3FZSA 4RQKA 4UYAA 4E4NA 5AP7A 3PWDA 3T3VA 2PVNA 3JXWA 3HYHA 4YJNA 2R5TA 2QO2A 3UO4A 4MD7E 4YZMA 2F7EE 4M12A 2R3GA 3WF5A 2Z7SA 3FPQA 2VIIA 3QGYA 3I51A 1M2PA 5FXQA 5DVRA 3AL0C 4EH8A 5IA0A 4GHLA 4G6ZA 4GFMA 2PZ5A 3C9WA 3FTDA 2R3IA 4X3FB 3R6XA 1QMZA 2YFQA 4E6QA 4I3ZA 3VWAA 3RCJA 3W32A 4QT1A 4RWIA 3EZRA 4AKGA 5ANIA 3OEZA 1ZMVA 1UU7A 1XHBA 1D2NA 4XEYA 3MPMA 4Z6YA 3L9LA 3TN8A 2X8AA 4GFGA 2R3RA 3MJ5A 4UMQA 2L6OA 2VTJA 1W5SA 4OUCA 3DKCA 1H1WA 4NT4A 4KIOA 4HCVA 2X2LA 4E3CA 4C8BA 2PMLX 3ZUTA 4IBEA 4EOJA 5ANGA 4MD8E 2CGXA 4RF1A 4QMTA 5L6OA 2VF7A 4LCBA 3MDYA 2E9VA 4O6LA 3IONA 3LZBA 1DGFA 4FR4A 3IHPA 3ZLSA 2XAOA 3G9NA 4MGYE 3HU2A 3R7YA 4XBOA 1WIVA 4L44A 2QOBA 3D14A 3B7NA 3THGA 1M14A 5DYIA 5LXMA 4O7WA 2UZOA 3FZ1A 5IREB 3OCSA 2QOQA 2L2DA 4APCA 3FI2A 1Q39A 2WZJA 1IY0A 5JGBA 3OBGA 2XEZA 2AHMA 4RVTA 2BCJA 2C99A 3OBJA 3UTOA 3DZDA 1D0KA 3CTQA 3QQUA 4EK5A 3ZONA 1H4LA 3ATTA 3MVMA 3A8WA 3S0OA 2FB8A 2LVPC 3P9JA 3HP5A 5IQBA 1BI7A 3PVBA 4XJ0A 3WF7A 2A5YB 4YLLA 3E3PA 5A4CA 2X0OA 1Q61A 5EP1A 4O7VA 2CPKE 2QO7A 2OF2A 4BLCA 3VFDA 3GQ4A 3ET7A 1OITA 5JI2E 3FHIA 4B7HA 2QP9X 5KO1A 3NVKI 1KE7A 4IMYA 1GJTA 5FTLA 2W1FA 1IA8A 3QTUA 5KPTA 1QL6A 3V76A 5JT2A 4L42A 5LQFA 3MESA 5KO3A 1Q41A 2BPMA 2C6TA 4L43A 4HZRA 3DQWA 5HZNA 4GIPA 2J90A 3SC1A 5KKRC 1IY1A 3CQEA 3QC4A 2I0YA 1R5LA 2O63A 4F6WA 4FEQA 3B2WA 1M52A 1REKA 5KUPA 3DGKA 3BQRA 4CCBA 5DT4A 1T6OA 2YWPA 5GJDA 2VTIA 5GHVA 4GUEA 1WHCA 4EH2A 1KSFX 1ZV1A 2XP2A 1OPJA 3ID6C 1XNRM 3MVLA 5C18A 4F0IA 2FSMX 2VTOA 4TN6A 4QQTA 3KGAA 5IMXA 1TZDA 1P2AA 5DFLA 3NBIA 1GZNA 3VRYA 1NNUC 4BDDA 5BPYA 4LQMA 2UZLA 1Z5MA 4DR5M 4WBBB 4YNOA 3A42A 2E9OA 1T45A 4BDIA 4HEOA 4RJ5A 1OVEA 3B89A 5AA8A 1WBTA 4CCUA 2JAVA 2WTKC 3I01M 3KXZA 2KTYA 4X2JA 1CUKA 4FTKA 1J91A 4FTNA 5KMKA 3T1YM 4CNHA 3VVHA 4GVAA 4AF3A 5L6WL 4QHSA 4AQCA 3VC4A 4C2WA 3IPHA 4PP9A 3UPXA 1J5EM 1OUYA 3K3JA 4BDCA 1AGWA 4LJ6A 5DRBA 4XG3A 5FTQA 3TNHA 4C37A 2JIVA 2XFSA 2QVSE 4O2PA 4J8NA 2VWXA 5I9VA 4LRMA 4N70A 3KF4A 3D7TA 2PUPA 4AG5A 2Y0TA 1OIYA 4CYIA 2UUCM 2MR9A 4LJ8A 4TYIA 3N4UA 2D7HA 2XKDA 5L3AA 2ITTA 3MB6A 4KKGA 3HZJA 4BICA 3ZO3A 1KE9A 3SHGB 3UGJA 4PMSA 3DQXA 5L2WA 1KWPA 3SG8A 1U54B 2SRCA 5B2KA 1PXLA 2JY8A 4L46A 3O23A 4RJ8A 2B55A 2ETMA 5ITTA 4OR5A 3ZOSA 4Y72A 4FVRA 3NYNA 1ZAEA 3VNTA 1EFUB 4WG3A 4AZWA 3LFNA 4DLJA 2GNHA 2VTHA 2ITPA 4EEVA 1YI4A 4KKHA 5FTJA 5F1ZA 4AX8A 4PPCA 4FV7A 4GKJM 3BBWA 5A4LA 2JEDA 2XZSA 1TH4A 2PVHA 1IN6A 4M3QA 2V0DA 3BQCA 3ERKA 1KUTA 4B3SM 1XXHA 2G8LA 1LP4A 4Y46A 3Q04A 4F63A 4U44A 4CMTA 4JOAA 4G1WA 2JITA 4ALUA 3L9PA 5KPZA 5CASA 2VWUA 3QRKA 4DBXA 4ZLOA 4BCKA 3PNYA 3ALNA 3GI3A 5FEDA 5BVEA 3F3ZA 4AE6A 3QRJA 4LGDA 2DAEA 3W55A 4G9RA 4XCUA 2FS1A 2OOBA 4WT6A 1H27A 3GP0A 4X2NA 4P90A 1Q24A 5A46A 3MWUA 5CENA 3MJ1A 3MVHA 4ZZOA 3QRIA 5ETCA 2PZPA 3RAWA 2R18A 3KVXA 5CXHA 2UW6A 4PTGA 3FUWA 3L28A 5ITRA 4BI0A 3DJ5A 4YZBA 4EJNA 3B7ZA 1FGIA 4DV0M 2WFYA 4MXZA 4DINA 5HG9A 3AKLA 1V34A 4OTQA 1NJFA 4JG7A 1W2DA 3VQUA 4U3YA 5CEKA 4YHTA 3RAIA 2EUCA 3LXNA 3UGCA 1R0EA 2JAMA 4J52A 5DPVA 4I6FA 3FMLA 3TUDA 3I0QA 2V7OA 3B8QA 4BI1A 4R78A 5I9ZA 1FJGM 3GENA 5CVHA 3V5WA 1CTPE 4F7LA 4BYIA 4D4RA 2OJ9A 2X8IA 3KXXA 3R00A 4LF8M 5FUTA 3R8LA 4IBDA 2GQGA 2ZJWA 3DV3A 5AP0A 5CXZA 3NMUF 5IA2A 3PZEA 5K0KA 3OUNB 2Q83A 4D4SA 4A9SA 3PA5A 2JIUA 2X7FA 3I4BA 2UZVA 5LMUM 5JZJA 2FVDA 4QMNA 4FI1A 3O51A 4RIWA 1PMNA 4CV9A 4R1YA 4KS7A 2BRBA 4FV8A 3ZFMA 3RP9A 3O8TA 3QF9A 3KOWE 2F5QA 4WKQA 5EP2A 3H10A 4JAJA 5L8JA 5GNKA 4FTQA 5HGIA 2E9PA 1ZYSA 4ZLYA 5JH6A 3GPXA 1JLUE 4FVQA 1TH2A 4IADA 5L2IA 2A19B 5C4KA 1Q3DA 2UW5A 3PPJA 4R8QA 1N36M 4IACA 1IEPA 3FAAA 3SXSA 4J95A 3BYOA 4D4VA 2CHVA 4IEBA 3KP0E 4CMUA 4WNKA 2GQRA 3FL4A 3JR1A 2G5GX 4N0SA 1BKXA 5IQIA 4IWOA 4QYHA 4JQEA 3R1YA 2KNZA 3MGYA 4HVGA 5HX8A 3KSXA 4GH2A 3KMMA 4DHFA 2NO3A 3II5A 4MF1A 3GLGB 2EB3A 3QYWA 3TV7A 1QUSA 4G3DA 2W5HA 3QD4A 3BXWA 2R3HA 2OJIA 4RIYA 5LMAA 2GNLA 3BU6A 3FXWA 3L8XA 4FGBA 3O8PA 3KL8A 4CZYB 3NFGB 1VEKA 3DNDA 4BCPA 4FVPA 3AJIB 1DGHA 3R01A 4W4XA 2BIYA 4UMTA 4G4OA 1UA2A 4GKKM 4B3TM 1DGBA 3SAUA 1JSTA 2F5OA 1TVOA 2XNOA 3D2IA 2X8EA 3K9OA 5I9YA 4G4RA 3NFFB 4R3CA 3UDZA 2J0LA 3D7ZA 1VR2A 2QHMA 4AT3A 1H08A 4O7SA 3EQFA 4FICA 4QYEA 1SXJA 3IO7A 5H2UA 3E3BX 3VUIA 3BLQA 5BMMA 5FEQA 2A1AB 4RJ3A 2W1CA 3WE4A 3VBTA 3EQPA 4EQMA 2JC6A 4EIWA 3L26A 1EIJA 3NDMA 1Y91A 3J27B 3AGMA 1QPJA 2XK7A 4IAIA 1MP8A 2YIWA 2RG6A 4ZS4A 3CPBA 4C3FA 1SXJC 3B74A 4PY1A 4BBEA 2YJSA 1AIPC 3VHKA 2YQZA 4BBAA 1G59A 4I5HA 1IY2A 3Q2JA 3A4PA 3BPRA 2VQEM 2WTIA 2ERCA 2J2IB 3PUPA 3IGGA 4LMNA 1W98A 4GKIA 3RFWA 4X64M 3KRWA 2WNTA 5AUZA 3R7OA 1G71A 4UX9A 2DAIA 4MWIA 4W9XA 5G6VA 3VS0A 2PVRA 5GIPE 4E20A 4EK3A 3PE1A 4QD6A 2YWVA 3BLAA 2Z3XA 4G9CA 1E94E 5IISA 4YLKA 3BHYA 3P08A 3SLSA 4QO9A 5D12A 3LLAA 2L4FA 3HEGA 4I81A