2HAKA

Catalytic and ubiqutin-associated domains of mark1/par-1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
309
Chain Sequence
PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase MARK1
publication title Structural variations in the catalytic and ubiquitin-associated domains of microtubule-associated protein/microtubule affinity regulating kinase (MARK) 1 and MARK2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
total genus 100
structure length 309
sequence length 317
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2hakA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hakA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hakA01
3C4CA 3GC9A 3T9IA 4EK6A 2XJ0A 3VBXA 3LM0A 5EOBA 4I5CA 4Y95A 4C62A 4EH5A 1TR8A 4O2ZA 3R28A 3TZMA 5LVNA 3ZBXA 4KA3A 2PUUA 2VWUA 4XP2A 3C0IA 3HP2A 4F0IA 3VUGA 4FNYA 5JZNA 5M4FA 5GINE 3RWQA 4B9DA 3FDNA 1PKGA 1IFYA 2A0CX 3WF5A 4JBQA 4QP1A 3AMYA 4EOOA 3VBQA 5FBOA 4LOQA 4UWCA 1YW2A 4PMTA 5EI8A 3E88A 3MH2A 5A3XA 4DGLC 4E5AX 4CMTA 4XUFA 3VRYA 3FLSA 4FV4A 2C0IA 2Q83A 2VTIA 3Q60A 1WBOA 4M97A 5E90A 3R7UA 2ONLC 2BHEA 3UMWA 3HUBA 3QQKA 4I5MA 4AGUA 4E1ZA 5DOSA 4XG9A 4F63A 1K3AA 1ZMVA 4EHEA 2LVPC 2A19B 5BUIA 5DR2A 4XLIA 4DFXE 4I0SA 4U9AA 3CD3A 2VO6A 2QG5A 4RJ8A 3EQGA 3RZBA 4BTMA 5K4JA 4DEAA 2A2AA 4BZDA 1IEPA 4QYYA 5A4EA 1P4FA 1ZAOA 3BEGA 2YITA 1Y57A 4IB3A 4FZ7A 5CU2A 2PULA 4A4LA 1NY3A 3FLNC 3R8LA 5AP2A 2VWWA 3MVMA 3PRIA 3LE6A 4QMYA 5F1ZA 1HT2E 1ZLTA 3LPBA 2GNIA 3W10A 1VEBA 3E92A 3F3UA 5DE2A 1FQ1B 3ZUVA 4ANMA 4D2RA 5DH3A 3E7VA 3QZIA 4IQ6A 5IDPA 5M56A 4ANQA 3UVQA 2C4GA 2OXDA 5EYKA 2WOTA 3HV6A 3RAIA 4HGSA 3V5JA 3E21A 4RLKA 4QD6A 2F9GA 2C5VA 4CFVA 2WQOA 3F5GA 4L43A 3TZ7A 3BBZA 2JDVA 3KMUA 3O17A 3R02A 4RZVA 3RZFA 4ALWA 1OBDA 4UALA 3WILA 4JG7A 4Y73A 3HV3A 4PV0A 3DJ5A 5FM2A 2F57A 4R71A 3Q32A 2YZLA 1H1PA 4OTGA 3I81A 5CANA 3TV4A 2UZEA 4Q7JA 4R7HA 3LQ8A 3AXWA 3I7BA 2BFXA 5I9ZA 3NYOA 2QOCA 5CNNA 3FC1X 3RI1A 5LVMA 4FV6A 4FYNA 2HELA 3FQHA 1J3HA 5A9UA 2P4IA 5ETCA 2UUEA 5ANEA 4E6QA 1DV0A 4WD5A 3PVWA 5ANIA 3R8MA 4AA4A 4D2TA 4WO5A 2HWPA 3IGGA 4D0WA 3HMOA 4YC6A 4JX7A 4ID7A 1V92A 4ASDA 1WBTA 2HK5A 1QPDA 4ENXA 2PZIA 5IG1A 1Z57A 3QUEA 3HAMA 3Q52A 3UQGA 4RC4A 4BF2A 5I9VA 4G3FA 4ACHA 1URWA 2BIKB 2OJGA 2RFNA 5CEMA 5BMMA 5GZ8A 3ZM9A 5M06A 3F3WA 4QYEA 3R8VA 3AC4A 3LCDA 4IDVA 4NKAA 4NYEA 1XH4A 3KF4A 3HX4A 4JXFA 4F0FA 2RRUA 3NRMA 4BCIA 4KRCA 4EH3A 5CQUA 4J96A 5M51A 4USDA 3I0QA 4R3PA 3W2SA 5LVPA 1OTRA 3GOPA 4IVBA 1H26A 3ZXTA 3C5UA 3DLZA 2RG6A 2YJSA 3HDNA 3W33A 1V1KA 2YLEA 3LZBA 3FZ1A 1H1SA 4GMYA 5EW8A 4F7NA 5CAVA 5GIOE 3OFMA 5ANKA 4IM0A 2XNMA 4GK3A 1UV5A 4UMQA 1Y8GA 4HCTA 4LUEA 1YWVA 3DAKA 3PG1A 3OF0A 4DT8A 1PGYA 1JR3E 4R5SA 1SMHA 2WO6A 4X3FA 3CS9A 5ANDA 1IR3A 3ZRKA 1H0VA 4R7BA 3OEZA 2YM5A 2PL0A 5L6OA 1H8FA 3FKLA 2QNJA 3DQXA 4HOKA 3RPSA 2K0BX 2ZTCA 2R3IA 3SLSA 2JBPA 2CKOA 2HZ4A 4H58A 4D4SA 3W1FA 2ACXA 2W96B 2WQNA 2WTDA 3WARA 4ASXA 4G3CA 3FSKA 3BPRA 2BTRA 5H2UA 3BWFA 4WOVA 3FEGA 3HMMA 4JS8A 4O91A 2GTNA 3AD6A 2VTRA 4U8ZA 2VWVA 1WGLA 3GU5A 1VJYA 3KY2A 4FK3A 2PE0A 4IZYA 4S30A 4BL1A 5JSMA 3QZFA 4YLLA 5LVLA 2PVHA 1IM2A 2B7AA 3V5QA 4CKJA 2WFYA 4NM5A 2OGVA 3FMDA 3MS9A 4FTTA 2Z7LA 1T46A 3KXNA 3ZC6A 4DGMA 2GTMA 1ZYCA 2Y6OA 3E46A 5DIAA 4BKJA 2O25A 4F7LA 4GKIA 2W4JA 3WE4A 5HG9A 4ANLA 4XV3A 4XS2A 3VBTA 2I6LA 5JQ5A 4O7LA 5AAFA 2XRUA 3PZEA 5CU0A 2AC3A 3TZ9A 4C58A 4JL9A 3DXQA 4ZS4A 2OJJA 1F4IA 3BQRA 1VEGA 4YZ9A 3ZH8A 4YP8A 3TUCA 3RWPA 2Y4IC 5IQGA 5IQDA 3GC7A 4QP3A 4P7EA 3U87A 3ULIA 2VX0A 4IDTA 1YOLA 3DK3A 3PG3A 2W99B 4YJTA 4HGLA 4YHTA 5DLSA 4LYNA 1GAGA 3MGYA 4BI2A 1C7YA 4BCGA 3M1SA 5E8XA 1CUKA 3C0GA 4IWQA 4GFGA 5DEYA 4OTRA 4BZOA 4EYJA 3LXLA 1YI4A 4CTBA 2J5EA 5AUWA 1NXKA 4MWHA 3GU4A 4DA5A 3F2NA 3Q4TA 3NCZA 2XJ1A 3MDYA 2XEYA 5HESA 4D9TA 3F2AA 3DTWA 2JIVA 2G3QA 2FYSA 4GK2A 3ZS5A 1VEJA 1XHAA 3SXFA 1IXSA 2WELA 3C13A 2B9HA 3QF9A 3U6IA 3TNWA 4KBKA 5HVYA 4FKGA 4FIIA 4RGJA 4ZEGA 4Z7GA 4NU1A 5E92A 1YDRE 5CT7A 4C2WA 3HV7A 3ODZX 4FTAA 4E3CA 4U3YA 3RK7A 3GNIB 5IF1A 4E4LA 3EYGA 1XJDA 3N51A 2W17A 5BVEA 1G3IA 2ETRA 4TTHB 3QD3A 1B38A 2XS0A 4EBWA 5E7RA 4EK5A 1KOBA 5CZHA 3VVHA 3U6JA 3L8SA 2WMAA 1GZ8A 4BIDA 3QUPA 1NVQA 2V62A 3FKOA 4O27B 3RPOA 3OHTA 3GCPA 2W5AA 3LVPA 4AFEA 2OOBA 4JDIA 5AP5A 5E1EA 1T6OA 2VU3A 3NYNA 5TOZA 4CFNA 2EKKA 5J7HA 2XIKA 3K5VA 3TNHA 1G4AE 5JRQA 2P2IA 2XM8A 3ORIA 3TIYA 3ACJA 2IZTA 3D15A 1LP4A 5JFWA 2HZNA 1BLXA 2GSFA 4RBLA 5DGZA 5AUVA 2Z7RA 3F6XA 3ZDIA 4DBNA 3I1AA 2Q0BA 4XMOA 4RWKA 3VW8A 1WBVA 3ZZEA 3SV0A 5AFVA 3EJ1A 4TY1A 1R78A 5TO8A 3IW4A 4MXXA 5IA5A 2PK9A 3P9JA 5FDXA 4AGCA 2VTHA 4OBOA 5DT3A 4BDAA 3D5XA 4BGQA 1WFCA 3I6UA 3AT4A 2DAIA 4KIOA 2ERZE 4WA9A 3CQWA 2JIIA 3BGQA 3CBLA 2H6DA 3U55A 5C9CA 1YOJA 3RPRA 5AP7A 3ACKA 4FSZA 4K6ZA 4UB7A 5CEKA 4WG5A 2QO2A 4V04A 4UY9A 3RGFA 4EOKA 2C3LA 5HU9A 5G6VA 4CLIA 3GU8A 4MYGA 3L8XA 4BBFA 2C6KA 2GFSA 4X3FB 1HT1E 2GS7A 4B8LA 4ARKA 4AP7A 3QTSA 5D11A 1M7NA 4WKQA 4F6UA 3ITZA 4Y72A 4ZS0A 3UNZA 4FG9A 4LV8A 1VYWA 2C47A 4YGAA 4CMUA 5AUTA 5FDPA 5BVFA 1K2PA 3ROYA 1CKPA 3C4ZA 3MB7A 5B0XA 3GBZA 4NM3A 4QMTA 2DAMA 4NWMA 4DEDA 4BDJA 3B2TA 3QL8A 3DK7A 1Q3DA 2BRBA 3IK3A 4PUZA 4ZTHA 3MY0A 3SHEA 3ZBFA 5CALA 5I0BA 4GEOA 3PP1A 4QP9A 3PIZA 2ZV2A 1UFZA 3GOKA 3PY3A 4C61A 4E6CA 2ITPA 4IANA 4K8AA 4AT3A 3DAJA 1ERKA 3UIXA 2WU6A 4O0RA 4Z55A 4IX3A 3LCKA 2CCIA 3OCSA 2B9FA 3FE3A 3OT8A 4EKKA 1QCFA 2IWIA 5A4LA 5LMBA 2IVTA 4X0MA 3R71A 3T3UA 5K4IA 1TKIA 3WIKA 3WZDA 5DT4A 3VRZA 3PYYA 2O3PA 1ZZLA 4D1XA 4PQNA 2A1AB 3OS3A 4G16A 4AWIA 4DE4A 3O71A 1Q61A 2VRXA 3KXZA 3OG7A 4IZ5A 3SAYA 4EONA 4MD7E 4ACGA 4BDFA 1ZV1A 3TWJA 5EQEA 2J7TA 4FEWA 2XNBA 5M08A 4C2VA 2YABA 2WD1A 3VJOA 1XKKA 3SVVA 2HZIA 1BL7A 4GU9A 4FZAB 3OUKA 5AAGA 4TW9A 3R8ZA 4FTNA 2DYLA 3KRLA 1FVVA 1OIYA 5KZIA 3WZKA 2PVFA 1WZYA 1F3MC 3NNUA 3U4WA 1LPUA 4W4YA 5T6KA 3BLRA 2Y7JA 3WIGA 2BILB 4BI0A 2OKRA 2XK9A 5IDNA 3LQ3A 1H28A 2GPHA 4A9RA 1WGNA 3FHIA 3WE8A 5ICPA 5LARA 3DXNA 4PPAA 5L2IA 2C6MA 4DGOA 3ZSIA 3FZOA 3GB2A 4I4EA 4LGHA 3NR9A 4H39A 4RVMA 5DG5A 3VF8A 5KNJA 2ZM4A 4OTHA 2O64A 3LLTA 3QTQA 1M14A 1PY5A 4I20A 4EK4A 4C3FA 3DLSA 2VUWA 3OVVA 3P7AA 2NO3A 2NRYA 3QQFA 2X1NA 1SM2A 3PY0A 2G1TA 3DJ7A 2CLXA 2J0LA 5J5TA 5CI7A 4I92A 3RHXA 4BWPA 3G51A 4F65A 4BVUA 4ZLYA 4BDIA 4AS0A 2I0YA 3EQDA 3EIDA 5HEZA 3VUMA 4FT5A 3F3VA 3PVGA 1EFUB 2BKZA 2PTKA 2BUJA 4QOXA 2WZJA 1TQIA 4EK8A 4EOJA 1MQ4A 2YIQA 4FA2A 5HO7A 4EH9A 4FTJA 4ONAA 5CTPA 2ZJWA 4YPSA 3V01A 4ERWA 4UMUA 4G3OA 4G2FA 5DPVA 3JY9A 4YU2A 5DRBA 1U46A 3I4BA 3DFCB 4C4IA 1RJBA 5KX8A 4L53A 3FLZA 4F09A 2JY6B 1YHVA 3ZEPA 3G0EA 4QNYA 4AW0A 1TQMA 2WGJA 2UV2A 3FZRA 3KB7A 1QMZA 3I7CA 4U0IA 4WNOA 3LMHA 4YZCA 1BX6A 4UZDA 2YIXA 4WIHA 4CFWA 5EG3A 1J7LA 4JBPA 1W0XC 4BCMA 4HVSA 1G8SA 5BVWA 2PZPA 4YLKA 5CAQA 4FR4A 4LOOA 3EFJA 5JMSA 4ITJA 3MESA 2EKFA 5GNKA 4JBVA 4KIQA 3RMFA 5M07A 4G9CA 2WNTA 4CRSA 4ZIMA 4X2KA 3EN5A 2QOFA 3PE2A 5HX6A 1WIVA 1Q8TA 5A4TA 2X0GA 3SW4A 2KNAA 3QCSA 3SA0A 2ZAZA 1OL7A 2C68A 1JKKA 5IPJA 5IH5A 2B9JA 4DT9A 1YXSA 3QU0A 2QKWB 3EH9A 4OGRA 5D10A 4D28A 2CN5A 3FYKX 4IM3A 4QTDA 4O0UA 1M52A 2RFDA 3G9NA 4QMXA 5DFPA 1P2AA 4BDHA 4DH7A 3BHUA 1R0EA 4HW7A 2B3TA 2RGPA 4X3JA 3BV2A 3OBGA 3QD4A 4OW8A 3ZUUA 5JGAA 2FSLX 5DBXA 1YRPA 1M17A 5BVDA 3KRRA 2YCRA 1OZ1A 3DKCA 4CZTA 3MBLA 1P5EA 4D2WA 2VNYA 2HENA 3Q4CA 4QMOA 3EFLA 4EQUA 5B2MA 4Q9ZA 4JQ8A 4EI4A 3ANQA 3K3JA 1XQZA 4CKRA 4K9YA 4ZOGA 5EHYA 3FRIA 2F2UA 4FTRA 3M42A 3QYWA 4X2FA 1URCA 3IW7A 4ZSAA 3KULA 3OTUA 2C5XA 2UZVA 2QHNA 1P4OA 4JDJA 1P3QQ 4KIPA 4PP9A 3CD8A 4XV9A 5HKMA 3OW3A 2QKRA 2LVQD 2X7OA 2XK8A 3U6HA 1G8AA 3NUSA 3SOAA 4HVHA 1ND4A 3R01A 2V7AA 3VS0A 3C1XA 5JEBA 5CAPA 4M67A 1UNHA 2PUIA 4O83A 3SX9A 3RNIA 2LBCA 5AV4A 3GQLA 1JQHA 3MJ1A 3P79A 4PDOA 4CG9A 5IUGA 5ETFA 1OUKA 5A4QA 2C6IA 4DEBA 4C4JA 3UO5A 3P0MA 3QD2B 1JNKA 3RNYA 5A14A 4HYHA 1JSVA 3E64A 4JRNA 4YC3A 3N4UA 4U79A 3NEWA 4C35A 3C50A 3ENHA 4OTIA 1Q8UA 3A62A 5HICA 3O7LB 5JFSA 5KMJA 2JIUA 1OPKA 1PXKA 1SG9A 1U59A 3EN4A 1ZOGA 3FMEA 3HV4A 3ZO3A 4P90A 3H9RA 1ZYDA 3QQHA 3NNVA 4XBUA 4UZHA 5HTIA 4EK3A 4IAFA 3TV6A 4ZSEA 4QT1A 3WBLA 3FY0A 2WPAA 3SXRA 4AU8A 3PXKA 4QO9A 5FWKK 2FB8A 2GNJA 1OI9A 5A54A 2J9MA 4BDDA 4ZTQA 1SYKA 1H08A 3VWAA 1WHCA 2OG8A 1WBSA 2XIYA 3DS6A 3ZU7A 2VWIA 1YKRA 4DCAA 1JSUA 2XIZA 4J52A 4ZTSA 4E4NA 1OM1A 3C4XA 3Q5IA 4TT7A 4UWYA 3VJNA 4ASEA 4XLVA 4M0YA 2G2HA 2QONA 3MPMA 4QQ5A 3HRBA 4TYEA 4IWPA 2GHMA 5ETAA 3QRKA 3FUPA 2UW0A 4R77A 5FRIA 4XOYA 4AQCA 2BAKA 4DCEA 2UZNA 4BGGA 4HYIA 1YXXA 4BN1A 2Z7SA 2JDSA 4ZZMA 4AT4A 1M7QA 2CP8A 3PRFA 4TWCA 5G1XA 3QXOA 1LUFA 1WCCA 2ITZA 3VBYA 4JJRA 4B99A 5EQYA 5JZJA 3LMIA 1OKYA 5CSVA 2DUVA 4QPAA 4PP7A 4RJ4A 3S4QA 2WU7A 4FIJA 4W9WA 3VS4A 3OW4A 2C69A 1WVYA 3NUXA 3IG7A 5KCVA 5KHWA 4LV5A 3FZPA 2C0OA 4FSNA 4B7TA 2OFVA 4BFMA 3V6SA 4AN9A 1CKJA 2VGPA 2QO9A 4A7CA 4DH8A 3OT3A 1Y91A 4EHZA 3B8QA 4ZXTA 3SD0A 4PDYA 4Z9LA 5EYDA 2W1DA 2VO3A 3KXHA 4MVFA 4Q9SA 4O7SA 2CGUA 4EC8A 3E62A 1OL5A 3BHVA 4GG5A 4Z16A 4O7YA 3OWLA 4RX5A 1I44A 3ZONA 3BU6A 4I5HA 4MXOA 4AE6A 1OIUA 4R1YA 4GW8A 4JR7A 5JT2A 5HIBA 3GLHE 4ZMFA 2RKUA 3QA8A 5ACBC 3E93A 3D83A 2DAEA 4MQ2A 4RRVA 3BRBA 3MYGA 2BALA 2BRHA 4FV3A 3VIDA 3S3IA 3NCGA 4YZBA 2OW3A 3F66A 4MF1A 3V3VA 1OIRA 2NPQA 3OMVA 2YM6A 3NNXA 3OEFX 3SDJA 2QOHA 4IM2A 2QOQA 3LCVB 4CQGA 2VX1A 1IRKA 4ZLZA 1WBWA 3DOGA 2HW7A 4NCTC 3IW5A 3ENMA 3O2MA 1CMKE 1VEKA 1GIIA 4DGGA 4O0XA 1OL2A 3D2IA 3JR1A 3ZLYA 4GT4A 4BTKA 3LQ5A 5KKRC 2W1IA 4FSMA 4D4YA 3BHYA 4FT7A 2GNHA 2UW9A 4FSQA 1P14A 3ZFMA 2WB8A 4USEA 1NT2A 1MN3A 1G5SA 2JITA 2BZJA 4DEGA 3NX8A 2RSVA 5BX0A 2JUJA 1OPLA 3R2BA 2JBOA 4FT0A 1WR1B 5EM5A 5LQFA 3LCUA 4GUEA 2BHHA 1J1CA 1RW8A 2DI0A 3DB6A 4CRLA 2UW5A 3A4OX 1VYZA 2XIXA 3KULB 4OTDA 5E8ZA 2X4ZA 5KE0A 4DH1A 5J9YA 2CSNA 4XH6A 1NVRA 4CQEA 2WHBA 2W5BA 3FMLA 5J8IA 2B1PA 1BI8A 2J4ZA 3GFWA 4MKCA 2QR8A 4EUTA 3KN5A 3BLQA 3QYZA 3RPYA 1A06A 5HE1A 4RJ7A 1MRYA 3KL8A 3MH0A 3P5KA 4KS8A 4RIOA 4RQKA 4CGAA 5C4KA 3LJ0A 3K54A 3BYUA 3OTVA 3TCPA 2VWXA 1GZNA 1UNGA 2UVXA 3BE2A 2PU8A 2DENA 2W05A 3BZ3A 5KZ0A 3TZ8A 4F9WA 3K3IA 5E8SA 1HCKA 4DLJA 1PXLA 3NAXA 4QRCA 3VUDA 3EQRA 1PMVA 4IADA 4C37A 1GZOA 2FSTX 3B2WA 2I0HA 2I0EA 4R7IA 4O6LA 4BDKA 4PL5A 5IMXA 3HA6A 1UU8A 3E3PA 4DFBA 3MVHA 4F08A 3FQSA 2WTCA 2QD9A 5I9XA 3CPBA 4QYFA 2XZSA 2XYNA 3BGZA 4PPCA 5HTCA 5IU2A 3DBCA 4YLJA 4R78A 3QRUA 3QCQA 1HQYE 3NWWA 4FGBA 4FT9A 4GS6A 5AUZA 5CXZA 3I5NA 5DNRA 4NK9A 4DITA 4EQMA 2ZB1A 2XB7A 2C30A 4BYJA 3LLAA 1PXIA 2FA2A 5IQAA 2WQEA 4K77A 2W1GA 1XH9A 3I60A 3BE9A 3GP0A 5IEXA 4QMPA 1J7IA 2W1EA 3DV3A 3ZFXA 3NUUA 4RMZA 2YCFA 3VS3A 2IZUA 2IW9A 2REIA 3ORNA 2G2IA 3RALA 1L3RE 4OAUC 1OL6A 3ZO1A 2JDOA 2JZ0A 4HYSA 2Y6MA 4D5KA 2UW3A 2I7QA 4RJ5A 3R0TA 3V5PA 3KXGA 2F4JA 5TKDA 4F9YA 3MVLA 2F2CB 2WEVA 3IOKA 4I93A 5A46A 4FMQA 4FIGA 3QHRA 4FNXA 3GU7A 3LIJA 4F1MA 4KKHA 1ZOHA 2OXYA 1YXTA 3OXIA 3NDMA 5AWMA 3QCYA 2UZOA 2VZ6A 4JI9A 5FEEA 5JQ8A 4FTIA 4ERKA 4J99A 3NLBA 3TG1A 2GS6A 4C36A 3PXRA 2YAKA 5HNIX 4OTWA 4Z3VA 3O23A 3WF8A 4I0RA 5GHVA 3WZJA 2YWPA 3SG9A 2I40A 4YMJA 1OL1A 3L1SA 4QMSA 3O7LD 2J2IB 3N9XA 2IVUA 5A6OA 1PKDA 3ODYX 5KHXA 1PMEA 3IOPA 2X2MA 2IVVA 1QPEA 5CX9A 5AX3A 4L52A 3EN6A 4O7VA 4EZ5A 2R3JA 1KV2A 2W1CA 4W8EA 2QR7A 4CFFA 5DFLA 3AG9A 3K2LA 5FM3A 4O7RA 3DK6A 3DBFA 3LFNA 2YJRA 1UNLA 2W5HA 4LI5A 4QTAA 3TI1A 5DRDA 3TJDA 3C4WA 2X6DA 3D9VA 4G6NA 1UU3A 3PIXA 3BQCA 4RC3A 3RPVA 4XEYA 4HPUE 3MFRA 4DC2A 2OOAA 3QHWA 1FVTA 3VO3A 2VO0A 4IFGA 2WXVA 5LWMA 3VS6A 4MD9E 4BCNA 5ITAA 4X7QA 3UODA 5HE2A 2P55A 4I3ZA 5TT7A 2YERA 2ITXA 4LQMA 3UMXA 4FSWA 4F9CA 4M7IA 3CE3A 4MXAA 4AT5A 3LXPA 3R7EA 3F5XA 4ZTNA 5IMEA 1R1WA 3NW7A 4I22A 3W2PA 1OVEA 2EB3A 4FSYA 1O9UA 4CNHA 5AP6A 4DH5A 1UU7A 4YBKA 1A48A 4ZTLA 2UZTA 2QODA 4AZVA 3QTXA 5DR6A 5CQWA 2QSFX 2W9ZB 4UV0A 3KRJA 4KAOA 3H0ZA 2C0TA 3FI2A 4PX6A 4AG8A 4LMNA 4MHAA 3R7YA 3BHTA 1WVWA 2Y8OA 4EJNA 5KMMA 5L3AA 4U44A 2CKQA 2F7XE 2VWYA 3CTHA 4M13A 2A27A 5ANJA 4E5WA 2OXXA 4XV2A 3PA5A 1B39A 4MF0A 4FV0A 4I6BA 4O38A 2P3GX 2HAKA 4IAIA 2JKQA 4AZEA 2OJFE 5E1SA 2YN8A 4TYJA 4O7ZA 4LL0A 1W84A 2VTJA 3HVCA 5KUPA 3VQUA 4UMPA 3FLYA 3EN7A 3DTCA 5AV2A 2PWLA 1MRVA 3H30A 3OOGA 4GYGA 4I6HA 4EL9A 5BMSA 3EL7A 5L2QA 3SOCA 4TXCA 2GNGA 1QZEA 5AUUA 1TVOA 4IC8A 2OIDA 1KV1A 2CGXA 1OKZA 5J7BA 3R7VA 1MUOA 3MY1A 4EHGA 1YXUA 2WIHA 3EFWA 4UYNA 3LCSA 5CWZA 3LHJA 1PXNA 3TXOA 5IUHA 4USFA 3QKMA 5FLFA 1DS5A 5E8YA 2PVMA 4YJOA 4FV7A 4BTFA 4EOQA 4QPSA 4EZ3A 3IDPA 5IH4A 2GU8A 3Q6WA 3Q9WA 4K18A 2ZM3A 5AUYA 5T68A 3S2PA 3RKBA 2WTKB 5HNGA 3KCFA 3UJGA 1F5QA 2R3RA 3GUBA 4H3PA 2YDJA 2ZYBA 3KXXA 5CEIA 3IKAA 3F2RA 3UP7A 4CV9A 2WTIA 3QFVA 2YDIA 3WYYA 3LW0A 3CQUA 1JBPE 2YIWA 4L67A 3HDMA 3NVKI 3LJ1A 4RPVA 3BX5A 2XMYA 3FBVA 5HI2A 3KRXA 4C4GA 4F6WA 3AMBA 2HYYA 5HVJA 3VUIA 2OSCA 3EL8A 2HY0A 1JPAA 2QVSE 3C7QA 5I9UA 3VF9A 3CY3A 1FOTA 2QLUA 3D2KA 3HV5A 4TNBA 1CDKA 3ZLWA 4AX8A 5KMLA 5K9IA 4YNOA 4EOSA 1UWJA 2O63A 5CSXA 5DEWA 5GJFA 4HVDA 5LMKA 2QOIA 4F1TA 3OROA 4Q5EA 3U9NA 3IDCA 4CYJA 1W83A 2C1AA 4IVDA 3L8PA 3UYTA 2NNWB 4IW0A 4BDGA 1X8BA 4M14A 2JC6A 1IA8A 3M2WA 2HY81 4CFXA 5LVOA 1VDLA 2YEXA 5GZAA 1WVXA 2WMSA 4WUAA 4IEBA 5DVRA 3WI6A 4F7SA 3G9LX 2W7XA 3HKOA 3VS5A 3W2RA 1R4GA 2DS1A 2EXCX 2VTQA 2W06A 4LFIA 4O6EA 4AN3A 5M44A 1MRUA 4KKGA 5EH0A 4EOLA 4A4OA 2JAVA 4HZRA 3TUBA 1E9HA 5DA3A 4ZAUA 1V0BA 1RQQA 4GRBA 4U5JA 4N4SA 3MIAA 3ZRLA 4EOIA 3A7JA 5EW9A 2YLFA 2PUPA 3MSSA 2F49A 4JLCA 4YTFA 4GU6A 4O0SA 3DAEA 1VR2A 4XYFA 5CSWA 4FV5A 4R5YA 4AF3A 4YC8A 4LG4A 1Q8YA 4MK0A 5CU6A 4ZSLA 3NUAA 3R7IA 4XG8A 2ITUA 4IHPA 3DJ6A 4UX9A 2R0UA 4RVTA 2Z7QA 4Y5QA 5I5ZA 2JLDA 4O82A 4PL3A 1WMKA 3DDQA 3F61A 3Q2MA 4AZTA 3DA6A 4YTCA 4IWOA 1DAYA 2X8DA 4C34A 4IX4A 2ITYA 2HWOA 2EJSA 3V5WA 4Q5HA 4O22A 2JKOA 5IZFA 4WNPA 5TE0A 3QTIA 4QMZA 1VG5A 3BIZA 3CGOA 5HLWA 2FO0A 2ZV8A 4GT5A 3TIZA 3QC4A 4AXAA 4F9BA 1YOMA 4TPTA 4FL1A 4G31A 3B8RA 4LMUA 4PRJA 1PJKA 2YWVA 4EH7A 2IW6A 4CXAA 1BI7A 3NS9A 2HCKA 3K5UA 3JS2A 4S33A 3VBWA 2HZ0A 4FV2A 4O21A 4FTQA 4QP8A 1XR1A 4HYUA 3COMA 5IA3A 2X4FA 4WG3A 3TM0A 2J50A 4YO6A 1GY3A 2AC5A 4L46A 4I41A 1AIPC 4ACMA 5I3RA 2I1MA 3BGPA 3FJQE 4UXQA 3HLLA 3W55A 2C6DA 2BAQA 3KRWA 5T3QA 3PLSA 2GQGA 2X7FA 2HOGA 4FL3A 3UC3A 3MMPA 4Y5HA 1KUTA 3PSBA 4L3LA 3QALE 5CVHA 4JQ7A 3POOA 1KYIA 3O8TA 2Y0AA 3A7GA 2WTVA 4L3JA 3TDWA 3T6PA 5HVKA 1UU9A 2VTAA 4D55A 3PUPA 3QRJA 1H1RA 4FBXA 2YCSA 3ZRMA 3EYHA 4ZZNA 5KBRA 5C01A 4DLIA 5E8TA 4BDCA 2BFYA 3DB8A 4CZUA 2MR9A 4Y83A 5AX9A 2R7IA 2OJIA 5M4UA 3P23A 3EOCA 4G1WA 4A9YA 2GCDA 4O0TA 4KIKA 3BHHA 2IZRA 5EM6A 3GEQA 3TNPC 2CKPA 3D94A 3RTPA 2AUHA 3AQVA 2UW7A 2OO8X 3QAME 4QTCA 4UBAA 4J8NA 4OR5A 4UWBA 4HGTA 5K5XA 4MQ1A 3TTJA 3HL7A 4QQTA 3C5IA 2DWBA 4DBGB 3QKKA 2WMRA 1UA2A 2YM3A 3PSDA 1XBBA 3GCSA 5J9LA 4TRLA 4RFZA 2OF2A 4NL0A 3I6WA 4IH8A 2ZV9A 4GL9A 4A9UA 5CAOA 1GJOA 3RK5A 3FMNA 1S9JA 2CLQA 5EKOA 3UO6A 4IAKA 2BVAA 2X9FA 5BNJA 1O6YA 3DU8A 1M2RA 4YTHA 2IZSA 3CJGA 3KK8A 1U5QA 2KTYA 5CF8A 3NMUF 4S31A 2CMWA 2CHLA 1NA7A 2ONLA 2WMWA 5AR4A 2X9EA 3MA3A 4PDSA 4CYIA 3EMGA 4FE2A 2OLCA 5F94A 1XBAA 3UIMA 4GK4A 3G33A 5FP5A 3D0EA 4GIIA 3GFEA 4NT4A 3MFUA 4QPMA 5DI1A 3R9OA 4BBEA 4FTKA 3F7WA 1RE8A 4DTAA 2YISA 3JXWA 4HNIA 3EN9A 4FICA 5IA0A 4RWLA 4PY1A 2BPMA 4IB1A 5AIKA 4CZYB 1OMWA 5JGBA 4KSQA 3W2CA 4EHVA 2UZUE 3Q53A 2V5QA 5FUTA 3C51A 3PXFA 1OPJA 4BB4A 4LGDA 4BWKA 3NW6A 4MD8E 4CMOA 2JFMA 4IJPA 4K33A 4ZTRA 5ANGA 2VO7A 2R4BA 2FSMX 4M69A 2C1BA 5EYMA 4GG7A 3UGCA 3DCVA 4APPA 3TDVA 3VNTA 3V51A 3Q3BA 4M15A 4WT6A 4GH2A 2KNVA 1I09A 3VBVA 3VUHA 2XF0A 2O2UA 3NW5A 4TYGA 3RAKA 4BKYA 2KHHA 2YHVA 3ZMMA 3VHEA 3PTGA 2CGVA 4J97A 4BGHA 2BDWA 2BZKB 3CTJA 3KQ7A 2FH9A 1JVPP 4FSRA 4ITHA 4ZP5A 4F1IA 3QXPA 3MI9A 4E93A 2X2LA 5DN3A 1U54A 2W1ZA 4KD1A 1NW1A 3Q4UA 2B9IA 1BUHA 4H36A 1U4DA 2VTPA 4RWJA 4YJPA 3Q4ZA 2PVKA 4M0ZA 4RSSA 5AP1A 5HG8A 4XNEA 1FGKA 2BTSA 4GT3A 2E9NA 5L8KA 3VS2A 1PXOA 4L01A 2IPXA 2OK1A 4JG8A 5TF9A 2UW8A 1SNUA 5E8UA 2PMIA 5CF6A 2ZDUA 4U97A 3WZUA 5FXSA 4FTCA 4D9UA 1GNGA 5BUJA 1UWHA 3FKNA 4YJQA 5HORA 2GNLA 4I6QA 4HCVA 3ZYAA 4DFNA 3S95A 4ZSJA 2XM9A 3MY5A 5J87A 5BVOA 4S2ZA 3C4EA 3GCVA 2LAVA 4F99A 3ZOSA 1KOAA 2QHMA 1HCLA 1M2QA 3REPA 5AAEA 3GLIE 4FVQA 5D7AA 4NFNA 5JKGA 5KMOA 1HOWA 2JNHA 3ERKA 3R83A 3VN9A 3ORMA 3UNJA 3LJ2A 3D14A 4XX9A 2EWAA 2BZHB 3BWJA 3I5ZA 3HZTA 4WNKA 1EH4A 1OKVA 1FINA 2C3IB 3V5LA 5C8MA 4DG0E 5LXMA 1OBGA 4OTPA 4YUQA 3Q2JA 3W16A 4FKTA 3HMNA 1KE9A 4JG6A 4BY9E 3V8TA 3DXPA 3R2YA 3QC9A 2CNVA 3HP5A 4QMWA 3HUCA 3Q5ZA 5DMZA 4AN2A 2CKEA 3HGKA 2QCSA 4I21A 5EYCA 3PXZA 3PLAE 3HECA 4L45A 4QYGA 3D5VA 4CV8A 3LXNA 5CY3A 5AR7A 4YPDA 4C8BA 3V8SA 4NKSA 1PHKA 3E8CA 4FX3A 2VGOA 4QTBA 5EDRA 1Q8WA 3MFTA 2RFSA 3THBA 5L8LA 3K9OA 5M4CA 2MJ5B 5AV1A 5JI2E 1WJ7A 5EW3A 4B0GA 4X6QC 5HTBA 3D4QA 2XYUA 2ZV7A 2JY7A 4RT7A 3A60A 3EFKA 2YIRA 4FKWA 2CWBA 2H5XA 4PF4A 5HG5A 4EOMA 3TJCA 2XKFA 3NGAA 4FZ6A 3PY1A 3ZDUA 2ETKA 2QO7A 4IXPA 3U9CA 4BBMA 4DEEA 1DAWA 2DQ7X 1ZY4A 1H4LA 3HRCA 4KIKB 4JX3A 4ZJVA 4O7NA 2P33A 3ELJA 3ZO4A 3AT3A 3UNKA 1OECA 3AC2A 5I3OA 4E8AA 4IX5A 4X3FC 4YHFA 2X6EA 4C3PA 3H9FA 5GIPE 3T9TA 2YACA 2B4SB 3NPCA 4R8QA 3E8DA 5LJJA 2DKLA 3DQWA 4XCUA 2BROA 1XH6A 5L4QA 3JVSA 4BCKA 2CJMA 3QRIA 4CKIA 2RIOA 2G01A 3FL5A 2QURA 3PWDA 3QQGA 4XJ0A 4CSVA 1KSWA 2UZDA 3QWKA 4V0GA 2BKKA 4D58A 2QOBA 4YSJA 5FBNC 1CTPE 3FMKA 3A7FA 4MBLA 3OXZA 5D1JA 4BICA 1ZYLA 3EWHA 1R39A 2X7GA 4PPBA 3K9PA 3LFSA 2C3JA 4ZSGA 5CSHA 5FTGA 2ITTA 4EH2A 3OWJA 1BVSA 2GFCA 5C03A 2R3HA 3MWUA 4PTGA 4U6RA 2W0JA 4WRSA 4YHJA 4BHNA 2R7BA 1G3NA 4BTJA 4ALUA 4FV9A 4ZZOA 2UVYA 1XH8A 4K1BA 1JAMA 3COKA 4DFZE 5CF4A 4XRJA 3S0OA 1TTEA 5F4NA 5L8JA 3V04A 4J53A 4LRMA 4C59A 1BYGA 4V05A 3BBWA 4F0GA 3CSVA 3HAVA 1XH7A 4GJ2A 4D2PA 2R0IA 2C6EA 2CNUA 3QUDA 1R0PA 4GFOA 4UMTA 5EOLA 5FG8A 4XBRA 4EWHA 1TQPA 5H8GA 1CKIA 4TN6A 4FUYA 5DWRA 2OZOA 3ALNA 3PJ2A 4QQJA 3KA0A 4KRDA 4ITIA 4DGNA 4R3CA 2ERKA 3GCQA 4ZJIA 2IW8A 3W8QA 4BDEA 4FKJA 4O86A 5FGKA 4ENYA 3R9DA 5M55A 1Q97A 3UZTA 2XNPA 4KWPA 3PVBA 4L8MA 2K9DA 2YZAA 4P5ZA 4A4XA 4RJ6A 2BWEA 2XH5A 4QMLA 3WYXA 3RK9A 2VTTA 4L7SA 3EZRA 1U54B 3FV8A 4TL0A 3UPZA 3AGLA 4Y85A 5JN2A 4H1MA 3ZTXA 4EYMA 4BWXA 4IZAA 4I24A 3QTRA 2ITQA 4M66A 5IA2A 2Y4PA 2J6MA 2PMOX 3PXYA 4WSYA 4D1SA 4ANBA 4XP0A 4ASZA 4II5A 4K11A 3P86A 5BYYA 4YJNA 4YJRA 5HBEA 3V5TA 4U80A 1A5TA 3FAAA 5E8WA 2GQSA 2ZMDA 4FL2A 4D5HA 4H1JA 4LL5A 4C02A 4BCOA 3PPJA 4B6LA 2W4OA 2UZWE 4YZMA 1GIHA 3FZTA 4GCJA 4N6ZA 4BCPA 3NUPA 4WHZA 5I9YA 4F9AA 2BZIB 4N0SA 4D2VA 3CPCA 4BIBA 1PMNA 3UZRA 4FSTA 3FI4A 3PJ3A 3LFEA 3F3ZA 1W8CA 4J95A 4X2GA 3PIYA 3QX2A 2JAMA 5EHLA 1MP8A 3UC4A 5CXHA 3P1AA 4OT6A 4P5QA 3H4JA 1DI8A 5JRSA 4FKSA 3ROCA 2R3QA 4IACA 4AE9A 4FEUA 4KBCA 3DGKA 1S9IA 1KWPA 3OY1A 3R9NA 3TNIA 3ALOA 3AMAA 4AAAA 3VW6A 1ZYJA 4A9TA 2ZDTA 3G6HA 4JT3A 5IA1A 5IQBA 4CG8A 5HD7A 2B55A 2XVDA 5L2TA 2H96A 4JOAA 4FTMA 4O1OA 4QP2A 2QLQA 5FQDC 4EWQA 5AV0A 1YWRA 4XP3A 4IB5A 3AC1A 4QP6A 3CJFA 4IAAA 3O96A 3UBDA 3N4VA 2R9SA 1H0WA 2XK4A 5EDQA 2BDJA 4CD0A 3F82A 2R64A 2X8IA 4D0XA 4F2LA 3GCUA 3OWPA 4PMPA 3QTZA 1Q02A 4WP2A 1BKXA 3EHAA 2R3FA 2OBJA 1M2PA 1T45A 4JDKA 2X81A 3PA4A 4FEQA 5JH6A 4EH8A 3GLGE 1E1XA 2R3LA 5HZNA 4IJ9A 3FPMA 4F70A 2JY8A 3IHPA 2J51A 4RQVA 1Q62A 4O81A 3R9HA 4N70A 3MFSA 2BMCA 4XHKB 1ATPE 4FG8A 4NSTA 1GOLA 1FVRA 1JSTA 2EVAA 4NEUA 1ZOEA 3R6XA 1FMKA 4F1OA 5BYLA 3CIKA 4I0TA 5AA9A 1H1QA 2WQMA 2RG5A 2WQBA 2G9XA 5CVFA 3GU6A 2E9OA 1ZARA 4V0GB 5DT0A 4C3RA 3JYAA 4TYHA 2R3OA 2R2PA 3JUHA 4RIWA 4U3ZA 3ET7A 2R5TA 4WBBB 5AR5A 3UOKA 3CP9A 2OIBA 2BRGA 3GVUA 4FT3A 4JIAA 2Y9QA 2BRMA 1JKLA 2OZAA 3C0HA 1DI9A 4I4FA 2CNQA 4RVKA 5AV3A 5HO8A 2WMQA 4IIRA 4BC6A 3QTUA 3RJCA 1ZWSA 5D12A 5CNOA 4XG3A 3GT8A 2XNEA 2H34A 3FYJX 3H0YA 4FI1A 4HJOA 3P7BA 3ZO2A 2HXLA 3D7TA 3EQFA 4XG4A 4IC7A 2E9VA 3PJ1A 5K0KA 4F64A 5IA4A 4QQCA 2QU6A 3LCTA 3E63A 2Y4IB 2OO9A 4BCJA 4U7ZA 2XBAA 4WNMA 3KVXA 2L2DA 4F6SA 5BVNA 4YJSA 1Z9XA 4AZSA 4CTCA 5FXRA 3HEGA 3UG1A 4C38A 3DKFA 4GVAA 4JVGA 3E5AA 3A4PA 1Q8ZA 4RLLA 3PJCA 4FKIA 2J0KA 5LWNA 1E94E 1H00A 1BMKA 4L9IA 4OTFA 4L7FA 3DNEA 3QQJA 1H25A 3QTWA 4KKEA 4M68A 4U42A 5D9HA 5HX8A 1W82A 4EKLA 3OC1A 4MWIA 4NM7A 3UE4A 1UVRA 4CCBA 4O84A 4G5JA 4MNEA 3QZHA 4R6VA 4S32A 3JY0A 5JK3A 5CASA 3Q9XA 3FI3A 4IZ7A 3NYVA 3BYVA 5I4NA 3ORTA 3R63A 5LOHA 2XCHA 1YVJA 2YIYA 3MTFA 5L6PA 1OAIA 3BYMA 2EXMA 3F9NA 5HBHA 4Q2AA 4JNWA 2C6OA 4APCA 3CC6A 3JVRA 2PVLA 4BR3A 3R00A 2OH4A 3KCKA 2FGIA 1OKWA 3RINA 2ZTDA 4A9SA 4C7TA 3R7GA 4FIHA 4AW1A 5C8NA 1XB2B 3H3CA 4HCUA 1SVHA 2XKEA 4AOJA 4RG0A 3CXWA 3LAUA 5BPYA 1VQ1A 2PZYA 3GC8A 4E26A 5M57A 5ANOA 4FYOA 3FHRA 4E6DA 2RF9A 4ZMEA 2HW6A 4FZFB 4W4WA 2JGZA 4ZY6A 1G41A 4FKRA 5HQ0A 3GI3A 3SQQA 2VV9A 3MVJA 5J1VA 1K9AA 1UKHA 3CKXA 4FV1A 4QMUA 3EQCA 4CCUA 4DHFA 5F9EA 3MTLA 5EM8A 1LR4A 3UOLA 3KMMA 1FGIA 3ZXZA 3L8VA 5BUEA 4PWNA 4X2JA 4WG4A 1E1VA 1WAKA 2ETMA 4E4XA 3HA8A 2CPKE 2G2FA 2YCQA 5HD4A 4PNKA 3TEIA 2WOUA 5AP4A 2G15A 3P08A 1ZXEA 2QOLA 3DPKA 3CEKA 2L4EA 2JP7A 3FQEA 3MB6A 5CF5A 5GZ9A 4LRKA 5HO6A 2O0UA 3WF9A 5AR3A 2WMUA 4YNEA 4MXCA 4WRGA 4AOTA 3F5PA 1Y8YA 1YWNA 3PZHA 5EI2A 3AT2A 2Q0NA 5ACKA 5CI6A 5AIRA 1YHSA 3QGYA 1YLAA 4PDPA 3IO7A 1W7HA 4IX6A 4Y46A 5HE3A 3R04A 2XEZA 2C6LA 3AC5A 4HNFA 5FP6A 3AC8A 5C27A 2JZ1A 4AFJA 4KB8A 2O5KA 3IECA 1Q3WA 1R3CA 3DBQA 1AD5A 2DHYA 4NTTA 5E4HA 1IA9A 4G17A 3PSCA 2YM7A 4NZWB 2SRCA 3NZ0A 1REKA 1H1WA 2J5FA 5AP3A 4FOCA 1CM8A 3ZC5A 2VD5A 4A07A 4C4FA 2P2HA 2ITNA 5EK7A 3FXWA 5J5SA 2XNNA 4J71A 4P4CA 1JOWB 3ZUTA 3NIEA 2DAGA 2LVNC 4EJ7A 3FWQA 4E73A 2B53A 5E91A 5AR2A 3GLFE 5HHWA 3VC4A 3ETAA 1FPUA 3NUYA 1Y6BA 1A9UA 1SNXA 3KXMA 4TYHB 3CKWA 4RIWB 3DKGA 3SXSA 5IQHA 2P0CA 3UPXA 3FXXA 3UTOA 3LCOA 5HCXA 3WOWA 3Q9ZA 3TV7A 4ZK5A 3T3VA 3QGWA 4Z7HA 2CGWA 2B52A 4AGDA 3EQPA 2OZAB 2VWZA 5EM7A 5C1QB 2PMNX 3CQEA 1IASA 2QI8A 3IONA 3QLFA 4IFCA 4O2PA 4AACA 4AZFA 4AZWA 1Y6AA 4BCQA 5J9ZA 4FEXA 3D7TB 2ZMCA 3GXLA 4F4PA 3BU5A 2B0QA 4X2NA 5HCZA 2EU9A 3Q9YA 5IISA 2EB2A 3NYXA 2GMXA 4IAYA 4WUNA 1OB3A 5F20A 2XJ2A 4FK6A 4XRLA 1STCE 4IWDA 5DHJA 3R21A 2IG7A 3SKCA 3WZEA 3CR0A 1PXMA 1AGWA 3LOKA 3TNQB 2J0MB 3LKMA 1ZY5A 3OCGA 4X21A 2WMTA 4PMSA 3QQUA 3ORPA 2JFLA 4TWOA 3PWYA 4DN5A 1GO5A 4C33A 1YI6A 2BAJA 3LFDA 2ZOQA 3UZPA 4V01A 5LCKA 4F7JA 5A4CA 4MNEB 2W1FA 3EKKA 1U5RA 3NAYA 2XNGA 3PP0A 4K2RA 4RIYA 4QP4A 3R9RA 4GEWA 4ACDA 2C3KA 3UG2A 1QL6A 3VS7A 3BYOA 4JQEA 4E20A 1FBNA 3ATTA 4DF3A 2OIQA 4KBAA 3UQFA 5LCJA 1LEWA 4KS7A 1DO0A 3H10A 1Q5KA 2OI4X 4JDHA 3R8UA 2UVZA 2JDRA 3VULA 3UP2A 3W2OA 1ZZ2A 2W4KA 2ZM1A 4FGRA 3VS1A 3BEAA 5IUIA 3U4UA 3QCXA 5AADA 3CGFA 4RA5A 5FEQA 5CS6A 4CT2A 5IH6A 4B4LA 5FTOA 4ZLOA 3VHKA 3IGOA 3ZLSA 4D1ZA 2GHGA 2VAGA 3QZGA 4J8MA 4CVAA 2EXEA 4U41A 2B54A 2BR1A 4UN2B 3D7ZA 3F7ZA 3TACA 1SVEA 4AUAA 2R3KA 4OBPA 4RVLA 4JIKA 4U45A 2OWBA 1PYEA 5HLNA 4ORKA 2PVRA 3ID6C 3N4TA 3UO4A 2UZLA 3AOXA 2ITOA 1PMUA 4G3DA 3ZLXA 2PY3A 1JKSA 3EZVA 3O50A 5D7VA 4D4RA 4BKZA 2X39A 2GS2A 3IQ7A 3LFCA 3CTQA 2HXQA 5AUXA 3MW1A 3ZZWA 2GDOA 4KSPA 5EKNA 2Z2WA 3S00A 4FNWA 2PVJA 3IW8A 5CENA 2JD5A 3KEXA 4MXYA 1GZKA 2ZVAA 2RL5A 3UOJA 4RX8A 2BRNA 4H05A 4PL4A 1JKTA 3BCEA 3MPTA 3PFQA 3TKHA 4GIHA 3ZFYA 4OUCA 4K0YA 5J1WA 4BYIA 4D4VA 2J90A 4L42A 4YR8A 2PE2A 4E5BA 4DG2E 3DY7A 5M53A 5FTQA 4OAVB 4G34A 1Z5MA 2XK3A 3MV5A 4X6RA 3QQLA 4P2KA 3DT1A 2IO6A 1YQJA 4HEOA 5L2SA 5BQ0A 4JAJA 4WSQA 1OKSA 3V6RA 3ORKA 3OUNB 3TL8A 2OFUA 2JKKA 3UYSA 1KE8A 3BELA 4E4MA 3FRHA 3GQIA 4HVGA 3R30A 4FUXA 4NCTA 1NVSA 4FTLA 5CZIA 4AA5A 3EQHA 4U43A 4HVIA 3SW7A 4ZJJA 4BHZA 3UDBA 1ZYSA 1T43A 3FPQA 2XRWA 3A8XA 4D2SA 4ANSA 4RX7A 4BCFA 2AYPA 3CCNA 3PE1A 4J7BA 4BCHA 4ANNA 4RJ3A 4M12A 1UKIA 3E8NA 4GSBA 4ANOA 3DBDA 2IN6A 3FSFA 4NW6A 4O96A 4OTQA 4DEHA 3MA6A 5IQEA 5HOAA 3Q6UA 4NTSA 5JFVA 3RBWA 5KMNA 3A61A 3L9PA 1J7UA 3RAHA 4BI1A 5JGDA 5D41A 3A99A 5HNBA 1KE5A 1XO2B 4UN0C 4FKQA 5AM7A 4AOIA 4FTUA 3KK9A 4FG7A 2J0JA 5HIEA 1CSNA 5C8KA 2LVOC 3QKLA 5BYZA 2KULA 4C0TA 1OGUA 4BDBA 2WEIA 4KUJA 1MQBA 2VN9A 3EKNA 3TT0A 4DTBA 4JBOA 5HBJA 1Q4LA 4FNZA 2BIYA 5HE0A 3ZSHA 5E8VA 5HLPA 4DYMA 2OJ9A 5AR8A 3GENA 2XCKA 3O0GA 4GVJA 4YBJA 4PMMA 4YZNA 4DTKA 3NUNA 4WBOA 3MPAA 3OBJA 3OP5A 3RCJA 4DG3E 5M4IA 2DNAA 4RIXA 5B2LA 4NUSA 2GHLA 4FF8A 4ZTMA 4GUBA 2QG7A 3SC1A 2JY5A 3LMGA 2A4LA 3E8EA 1H27A 3VQHA 4U40A 3P7CA 4FTOA 3U8WA 3G0FA 1IAHA 2XK6A 2VX3A 1DM2A 2JDTA 4AGWA 5IQIA 5KO1A 4PNIA 4EOPA 3FL4A 3OWKA 3FLQA 3CY2A 3LFFA 3D5WA 3R73A 2Z8CA 4I5PA 4FKUA 2XA4A 4RIYB 2QQ7A 3UOHA 3HMIA 2BWBA 3FZSA 4IBMA 3BYSA 4PTEA 3A8WA 3ANRA 4FKPA 4QMNA 2WIPA 5CEOA 2WTKC 4HGEA 3SRVA 1RDQE 4QP7A 2YDKA 1XXHE 5IQFA 2WAJA 2PVNA 3IDBA 4FKLA 4G5PA 4U81A 2ITWA 3R1YA 5FEDA 1XBCA 3BV3A 3JPVA 3QX4A 5EI6A 4GYIA 5AP0A 1GIJA 2IJMA 4NJDA 3ULZA 4YJUA 5KBQA 4M3QA 4IVCA 2LVAA 4B8MA 1Q24A 3UVRA 4ACCA 3A7IA 5M09A 3GGFA 4QMQA 3LXKA 4TZRA 4JRVA 1KE7A 3IS5A 3DNDA 4EORA 3G6GA 2BDFA 2H8HA 4IB0A 1APME 5FXQA 5IEYA 3OCTA 5B7VA 2YAAA 4BZNA 3VUKA 5CAUA 5L6WL 5H8BA 4OLIA 2YFXA 4MXZA 3R1NA 4R3RA 5GJDA 1JWHA 5B2KA 1J91A 2GNFA 2WKMA 4FC0A 4N6YA 5CSPA 4G3EA 4ZY4A 3EQIA 1PW2A 1SVGA 5CLPA 2UZBA 5EHOA 3C9WA 3OOMA 4FOBA 2VNWA 2NRUA 3QA0A 3NNWA 4OT5A 1Q41A 3OCBA 1QPJA 4EH4A 3WF6A 3OY3A 4TYIA 3RVGA 4C4HA 4FVRA 4C4EA 1AQ1A 4N57A 4NH1A 5AMNA 3ZHPC 2L4FA 4XV1A 4FV8A 4AA0A 5L2WA 3RP9A 4XG2A 5AEPA 1ZRZA 5K0XA 5HCYA 4I23A 1PYXA 5HG7A 4XG6A 4FEVA 3COIA 4FZDB 3AD4A 2V22A 2LTUA 4EBVA 4M84A 4FODA 3PJ8A 2HIWA 5AA8A 4DFYA 5CVGA 3ORZA 4H3QA 3BBTB 4DINA 4FIEA 2GQRA 3TN8A 1YI3A 3AGMA 5ETIA 3MH1A 2VTMA 3W32A 2V55A 2CDZA 2I0VA 3OD6X 4NIFA 3UQCA 1REJA 3QRTA 1KE6A 3L9LA 1LEZA 2WMBA 3PPKA 2RFEA 4CEGA 2VTLA 5IQCA 4R1VA 4W9XA 4DAWA 4MH7A 5KKRB 2DZLA 4IVAA 3UIBA 2XBJA 4YO4A 5H3QA 3ZEWA 1HJPA 3E87A 3O51A 4PTCA 2UW6A 3AC3A 2O65A 1V0PA 3PXQA 4J98A 1OUYA 4I1ZA 3R7OA 2V0DA 4YTIA 3DDPA 2JKMA 2ITVA 3KMWA 3COHA 4G3GA 1F0QA 2O8YA 3VAPA 2OF4A 4G6LA 2PZ5A 4KABA 2WTWA 3VUTA 4GV1A 2CN8A 2PHKA 3KFAA 4FKOA 4NW5A 3SGCA 5IEVA 3L9NA 4GFMA 3G90X 4G9RA 5C4LA 2F7EE 5A6NA 3F88A 4RWIA 2R3GA 4O0YA 2LGCA 4J1RA 5J95A 2PYWA 3B89A 5J79A 2OU7A 3F69A 1YHWA 5HGIA 4O0VA 3KN6A 3UVPA 3TKUA 3NIZA 4BRXA 5AJQA 1YDTE 2C5OA 2WMXA 3II5A 4NFMA 1QPCA 2XKDA 2XNOA 2F7ZE 4LUDA 4RC2A 4RFMA 3SG8A 3F5UA 3FY2A 2J0IA 4IMYA 4L44A 2VTNA 2MGWA 2PSQA 2QOKA 3MN3A 4YJVA 5IKWA 3QBNA 3DFAA 2IVSA 2QC6A 4S34A 4MCVA 1H07A 3MJ2A 2YM4A 4RIXB 3QWJA 4EQCA 2W1HA 2R3NA 4JAIA 4O1PA 3FMJA 2FUMA 4UEUA 4FVPA 4FKVA 1XWSA 2Z60A 5CT0A 4LOPA 5AM6A 1NV8A 3TTIA 2YM8A 3PPZA 4AW2A 3AD5A 4FSUA 3PA3A 3E7OA 5CEPA 5I9WA 3CLYA 1V0OA 5K5NA 4HZSA 4LRJA 4RFYA 3KVWA 5E9EA 4YSMA 3UIUA 1IG1A 2H9VA 4MAOA 4L3PA 2E9PA 2R3PA 3R22A 3G15A 3BLHA 3PDTA 5KMKA 4EC9A 1L8TA 3W8LA 5EDPA 4UYAA 3KREA 1H01A 5CU4A 3EB0A 1SZMA 4O7WA 4MBIA 4M69B 4QMMA 5CYIA 4L6QA 3HMPA 4CFUA 3SRVB 4NM0A 2MROB 4L00A 3KGAA 3G5DA 4NJ3A 1PRYA 4IAZA 3Q04A 5EFQA 3LFAA 2NP8A 5H8EA 1XH5A 4DEIA 3GC0A 3O8UA 3NVMB 1OIQA 1YXVA 4LM5A 3MIYA 4DFUA 5CEQA 3ATSA 1PXPA 1H24A 2HWJA 3HYHA 4XOZA 3ORLA 1O6LA 2PZRA 4EZ7A 2QU5A 4MBJA 4JR3A 2YA9A 1J1BA 4H3BA 3R8PA 1WBPA 4W8DA 3V8WA 2E2BA 1BL6A 5K3YA 2VWBA 3A2CA 4TWPA 4MNFA 5CU3A 5HIDA 3LFQA 3RM7A 3RHKA 5HU3A 5LMKC 4CLJA 1WBNA 2C5YA 3FC2A 4QMVA 4RX9A 3U51A 4CT1A 4ZY5A 1O6KA 3FI8A 5LMAA 5H9BA 2PVYA 2Z02A 4KNBA 2R3MA 2UW4A 4DH3A 2PPQA 4E7WA 3A7HA 2QHOB 3NSZA 1YDSE 2FSOX 5BVKA 3ORXA 4W4VA 2OH0E 3BKBA 3E3BX 3W18A 2C5NA 1VZOA 3KU2A 3WF7A 2XUUA 3QLGA 5TR6A 4RZWA 2WTJA 3DKOA 2X2KA 3P4KA 4QTEA 4W4XA 3FMMA 4BIEA 4EH6A 4I6FA 2W9FB 2ZB0A 4TKSA 1W98A 4DFLA 3POZA 4LGGA 2VTSA 1JLUE 3F3TA 1NV9A 4DBXA 2PE1A 4QYHA 3TUDA 4EUUA 4IE9A 3T8OA 3BI6A 3I79A 3KC3A 3ZM4A 3DBEA 4KINA 4L68A 3ZCLA 3IW6A 3KF7A 4NIFB 4MTAA 4AW5A 3I0OA 4OBQA 2OICA 1ZMWA 2QOOA 3D5UA 3L9MA 2XIRA 3QD0A 1ZMUA 1B6CB 5C26A 5JFXA 3RAWA 1OQYA 2CCHA 3LM5A 4TNDA 3HRFA 3PVUA 2XKCA 3RCDA 3M11A 4FIFA 2XK7A 3U54A 4CFMA 3H9OA 2V7OA 3RM6A 5KMIA 4G6OA 2EUFB 1PXJA 4QNAA 1FMOE 3G2FA 4M8TA 4YURA 4GJ3A 3R1QA 1OITA 5EQPA 3FMHA 3R1SA 5GJGA 3F92A 3FXZA 2PUNA 2BCJA 5F95A 3ZSGA 4E6AA 2E9UA 3LFBA 3FLWA 4TWNA 4I94A 5DR9A 3O8PA 3Q96A 2C6TA 1Q99A 2PMLX 3TKIA 4RA4A 4UXLA 2VTOA 4EEVA 2ESMA 3S1HA 1DO2A 3DZQA 1IAJA 2KNZA 4A06A 2JEDA 2X8EA 3KKVA 2WMVA 3EQBA 4O0WA 4MEDA 3DZOA 5DYJA 3BU3A 4ALVA 4GKHA 3P78A 3OZ6A 2DAKA 4UMRA 4C57A 3IPHA 1PF8A 5FD2A 3HNGA 2FVDA 4MX9A 3OXTA 4HPTE 3MH3A 3W2QA 3C4FA 4O7TA 4YZDA 2XP2A 4Y8DA 4XG7A
chains in the Genus database with same CATH superfamily
3C4CA 3VBXA 4I5CA 3ZBXA 4XP2A 1IFYA 4NC6A 3VBQA 4LOQA 4PMTA 5A3XA 4CMTA 3Q60A 3QQKA 5BUIA 4DFXE 4RJ8A 3QYBA 4BZDA 5A4EA 2PULA 5AP2A 2GNIA 3F3UA 3HJSA 4ANQA 2C4GA 5EYKA 1IBLM 2F9GA 4CFVA 2WQOA 4L43A 3TZ7A 3TL4X 1OBDA 3O17A 3RZFA 4PV0A 3DJ5A 5FM2A 2F57A 4R71A 2YZLA 4OTGA 3I81A 3TV4A 2UZEA 4R7HA 1DV0A 4AA4A 4D2TA 4WO5A 2HWPA 4JX7A 3M0EA 3U6QA 5IG1A 3RE8A 3HY5A 4G3FA 5GZ8A 3F3WA 3AKLA 4KT0F 4NYEA 3HX4A 4XBOA 2RRUA 4EH3A 3UK6A 4J96A 4IVBA 3W0MA 1XWIA 3HDNA 3W33A 3LZBA 1R5LA 5ANKA 2AEGA 4IM0A 4HCTA 3PG1A 2PL0A 3FKLA 3SAVA 2CKOA 2HZ4A 4DV5M 4D4SA 2WTDA 3SATA 4G3CA 4JS8A 4O91A 4S30A 1IM2A 2B7AA 4CKJA 4NM5A 3FMDA 1T46A 4GKIA 1ZYCA 4F7LA 4XV3A 2I6LA 5CU0A 2OJJA 1F4IA 3BQRA 3RWPA 3LVWA 2W99B 4YJTA 1GAGA 4BCGA 1XMLA 3M1SA 3C0GA 4IWQA 2J5EA 1NXKA 3F2NA 2Y21A 3NCZA 5HESA 3C13A 3QF9A 3TNWA 3UDTA 4FKGA 4RGJA 3KS8A 5CT7A 3ODZX 4E3CA 4U3YA 3GNIB 4E4LA 1XJDA 4Z8XA 1GKIA 4M0WA 4K0KM 5BVEA 3UDSA 2ETRA 4TTHB 4EK5A 5CZHA 3VVHA 3U6JA 3L8SA 4AFEA 4JDIA 5E1EA 4CFNA 1L8QA 3TNHA 3K5VA 4AXCA 5JFWA 4ITQA 4RBLA 2Z7RA 3F6XA 1MU5A 4RWKA 1FJGM 4OBOA 5DT3A 3FTCA 4BGQA 1WFCA 3I6UA 2LHCA 1YOJA 5AP7A 3ACKA 5CEKA 2QO2A 5G6VA 4FJVA 4X3FB 4B8LA 5D11A 3A42A 3ITZA 2CUZA 5AUTA 3ROYA 1CKPA 2DAMA 4NWMA 4BDJA 4PUZA 3ZBFA 5I0BA 4GEOA 4PDGA 4QP9A 4E6CA 3BXWA 2C9CA 4IANA 3DAJA 2B9FA 1QCFA 4X0MA 3T3UA 5K4IA 4NOOB 3WZDA 1E9RA 4AXFA 3OG7A 3SAYA 1ZV1A 5EQEA 2J7TA 4FEWA 4C2VA 2WD1A 5AAGA 1Q3BA 4FTNA 2DYLA 1FVVA 1OIYA 2ZANA 1F3MC 4W4YA 3BLRA 2BILB 2OKRA 3LQ3A 1H28A 5L2IA 4I4EA 4RVMA 1PY5A 4EK4A 3HKPA 2VUWA 2X1NA 3DJ7A 4L78A 5J5TA 3G51A 4BVUA 4ZLYA 5HEZA 5KQDA 3F3VA 3PVGA 2BKZA 2ZJWA 4ERWA 3JY9A 1U46A 3I4BA 5KX8A 4F09A 4QNYA 4AW0A 2R65A 3KB7A 4YZCA 1BX6A 4BCMA 3U6LA 2PZPA 5JMSA 5M07A 2WNTA 2R4JA 4OX9M 4ZIMA 4X2KA 5A4TA 2KNAA 3QCSA 4S12A 3VDUA 2C68A 2ZAZA 4OGRA 2QKWB 4DR1M 2RFDA 5DFPA 4DH7A 4BDHA 3BHUA 3CSVA 1YRPA 5BVDA 3MBLA 3Q4CA 4QMOA 4EI4A 3K3JA 2OQ4A 2F2UA 5BPVA 3OTUA 2UZVA 1P4OA 3CD8A 2QKRA 3SOAA 4HVHA 3C1XA 3SX9A 3RNIA 2LBCA 7CATA 4XGIA 4BBAA 5ETFA 3EIHA 3UO5A 3QD2B 3RNYA 3E64A 4OTIA 3MJ5A 3EN4A 1U59A 3HV4A 4EK3A 3WBLA 3SXRA 5FWKK 4QO9A 1L2DA 2OG8A 2VWIA 1JSUA 4J52A 3AKJA 3Q5IA 4XLVA 3PNVA 4TYEA 4IWPA 2GHMA 5ETAA 3FUPA 2UW0A 5FRIA 2FE8A 1TGUA 2UZNA 4HYIA 2JDSA 4ZZMA 2CP8A 3PRFA 5EQYA 5CSVA 4PP7A 4RJ4A 2QP9X 3VS4A 4B3SM 1NNUC 4BFMA 1Y91A 4ZXTA 4Z9LA 4O7YA 1I44A 2ERCA 1IBMM 4ZMFA 2BNKA 3D83A 3BRBA 4YZBA 2OW3A 3V3VA 3SDJA 2VX1A 3PUFC 3ENMA 1OL2A 3D8BA 3ZLYA 2UW9A 5BX0A 2JUJA 3R2BA 2BHHA 3DB6A 2DI0A 2UW5A 2W5BA 5J8IA 2B1PA 3GFWA 1ORYB 4RJ7A 4KS8A 4RQKA 3LJ0A 2VWXA 1GZNA 3BE2A 2W05A 4F9WA 5E8SA 4DLJA 4LCBA 3HA6A 1PJTA 5I9XA 3CPBA 2XZSA 2XYNA 3BGZA 5HTCA 3DBCA 3QRUA 4FT9A 3GLIB 3I5NA 5DNRA 4DITA 4EQMA 2ZB1A 2XB7A 4ANRA 3LLAA 1N77A 4K77A 1XH9A 3I60A 3BE9A 1J7IA 3NUUA 4RMZA 2G2IA 3ZO1A 2JZ0A 3V5PA 3KXGA 2F4JA 2F2CB 3IOKA 5A46A 4FMQA 3GU7A 3LIJA 3J7AS 2VZ6A 4ERKA 3TG1A 1OL1A 3O7LD 2IVUA 4GRIA 1DGGA 4O7VA 3K2LA 3DBFA 2QQ8A 3LFNA 2X49A 2UXBM 2VO0A 4BLCA 3VS6A 2XAOA 4MD9E 4LQMA 4FSWA 1VDDA 3W2PA 4I22A 1OVEA 2EB3A 4DH5A 1A48A 4ZTLA 2UZTA 4AZVA 5CQWA 2W9ZB 3FI2A 3R7YA 2APLA 4EJNA 2FNAA 2CKQA 2VWYA 2LWXA 2OJFE 4TUWA 4TYJA 3HVCA 5KUPA 3FLYA 2PWLA 3OOGA 4GYGA 4I8OA 3SOCA 5AUUA 4TXCA 4IC8A 5ITXA 2CGXA 4UYNA 2PVMA 4YJOA 4BTFA 4EOQA 4QPSA 4EZ3A 5T68A 3UJGA 3GUBA 4H3PA 2ZYBA 3QFVA 2YDIA 3WYYA 4RPVA 2XMYA 3SFZA 3AMBA 4AKIA 3VUIA 3EL8A 5I9UA 2QLUA 5GJFA 4D80A 2NNWB 3L8PA 4M14A 2JC6A 3M2WA 2X0QA 2YEXA 2WMSA 4F7SA 3G9LX 2EXCX 2VTQA 4LFIA 5M44A 3GLGB 3O5AA 1E9HA 4ZAUA 4N4SA 3ZRLA 4EOIA 2YLFA 3MSSA 2F49A 3DAEA 1VR2A 4IIWA 4R5YA 4AF3A 4YC8A 5I5ZA 2JLDA 1WMKA 1N34M 3Q2MA 4IWOA 2HWOA 5IZFA 4Q5HA 2JKOA 4WNPA 1QAMA 5TE0A 3QTIA 3CGOA 4PRJA 2IW6A 1BI7A 3VBWA 4HYUA 5IA3A 1XMQM 3TM0A 3BGPA 2Y0AA 2R62A 3A7GA 4L3JA 5HVKA 1UU9A 4D55A 3PUPA 4DLIA 2BFYA 2MR9A 2R7IA 5M4UA 4G1WA 4A9YA 2KRUA 4KIKA 3GEQA 2OO8X 4HGTA 3HL7A 3C5IA 3PSDA 4RFZA 2OF2A 4NL0A 4IH8A 1GJOA 3FMNA 5EKOA 3UO6A 4QOSA 2BVAA 1O6YA 3DU8A 3KK8A 3NMUF 4S31A 2X9EA 4CYIA 1XBAA 4GK4A 4GIIA 4BBEA 1RE8A 4DTAA 4RWLA 4PY1A 2BPMA 4CZYB 1OMWA 3W2CA 3Q53A 4BB4A 1OPJA 4CMOA 5ANGA 3W0LB 2FSMX 1W5SA 3DCVA 3TDVA 1XC8A 3V51A 4WT6A 1I09A 3VBVA 2O2UA 3PTGA 2BZKB 3KQ7A 2FH9A 1JVPP 4F1IA 3MI9A 1NW1A 4H36A 4XNEA 2E9NA 5L8KA 1PXOA 2OK1A 4B7HA 2PMIA 5FXSA 4D9UA 5HORA 4YJQA 4I6QA 4HCVA 4ZSJA 2XM9A 3GCVA 4F99A 2IF8A 2QHMA 3REPA 3GLIE 4FVQA 3HZTA 2ZM6M 1OBGA 5C8MA 4OTPA 3Q2JA 4FKTA 3HP5A 2QCSA 5EYCA 4L45A 4QYGA 5AR7A 3V8SA 5L8LA 3W67A 3K9OA 5AV1A 2XYUA 2JY7A 4PF4A 2H5XA 3TJCA 2XKFA 3PY1A 4BBMA 2ETKA 2QO7A 4IXPA 4PD2A 4JX3A 3ZO4A 3ELJA 1OECA 5I3OA 4IX5A 5GIPE 2YACA 3NPCA 4XCUA 2QURA 3OXZA 3LFSA 1BVSA 2GFCA 1QUSA 4WRSA 4BHNA 4ALUA 4ZZOA 1XH8A 4K1BA 3COKA 5CF4A 1TTEA 5F4NA 3V04A 1BYGA 4F0GA 1R0PA 4GFOA 5FG8A 1CKIA 2WSEF 3ALNA 3PJ2A 4QQJA 5GKNA 3KA0A 4R3CA 3W8QA 3GQ3A 4ENYA 3R9DA 5M55A 1Q97A 4L8MA 2XH5A 3MHVC 3ZTXA 4I24A 2Y4PA 3PXYA 4YJRA 1A5TA 2ZMDA 4FL2A 4D5HA 4LL5A 2CV0A 2YR0A 4B6LA 1GIHA 3FZTA 4GCJA 4N6ZA 4BCPA 2BZIB 4D2VA 2Y0TA 4FSTA 3QX2A 4LF9M 3P1AA 4OT6A 2R3QA 3OY1A 1ZYJA 5HD7A 4JOAA 4EWQA 5AV0A 3T1YM 3AC1A 3CJFA 3UBDA 1H0WA 5EDQA 2X8IA 3A45A 3QTZA 1Q02A 4WP2A 3EHAA 2OBJA 2X81A 3PA4A 5JH6A 4O4EA 3GLGE 4EH8A 4F70A 2JY8A 3J7BA 4O81A 1XXHB 4FG8A 1FVRA 1JSTA 2EVAA 4NEUA 3R6XA 5BYLA 3GU6A 2E9OA 3K8ZA 4V0GB 4TYHA 4RIWA 4U3ZA 3ET7A 5AR5A 3CP9A 3C3DA 3C0HA 5AV3A 2WMQA 4IIRA 3QTUA 3GT8A 2XNEA 3M6AA 2H34A 3FYJX 4HJOA 5K0KA 3LCTA 3E63A 4FD2A 2XBAA 5BVNA 4AZSA 2QCUA 3E5AA 3A4PA 4RLLA 3U61B 4IJFA 1BMKA 4L7FA 4KKEA 5JK3A 3JY0A 3Q9XA 3NYVA 1YVJA 2YIYA 2EXMA 4JNWA 3R9XB 2FGIA 4A9SA 4C7TA 3H3CA 2XKEA 5BPYA 1VQ1A 3SQQA 3FUVA 3MVJA 5J1VA 1UKHA 3MTLA 3UOLA 1FGIA 5BUEA 4PWNA 2ETMA 5C1BA 2CPKE 2G2FA 3U6CA 1ZXEA 3CEKA 3F5PA 5CI6A 1YHSA 5HE3A 5FP6A 4M0DA 3DBQA 2DHYA 5E4HA 4G17A 2YM7A 2SRCA 4AQYM 3GQ5A 2VD5A 5J5SA 2XNNA 3NIEA 4E73A 5HHWA 3DKGA 3SXSA 2P0CA 5HCXA 3TV7A 3T3VA 3EQPA 3CQEA 4BCQA 4IFCA 4GC9A 4F4PA 3BU5A 3LQQA 2B0QA 5HCZA 2EU9A 3Q9YA 4IAYA 5F20A 2GMXA 1V33A 1OB3A 4IWDA 5DHJA 3R21A 1OJLA 3CR0A 1PXMA 3U5ZA 3LOKA 3TNQB 4X21A 2WMTA 4PMSA 3QQUA 2JFLA 4TWOA 4PDIA 3PWYA 4DN5A 3I4VA 2BAJA 5LCKA 5A4CA 2XNGA 3PP0A 2C3KA 1QL6A 1FBNA 2OI4X 3VULA 2ZM1A 3VS1A 4CT2A 5IH6A 3VHKA 3ZLSA 3D7ZA 3TACA 1SVEA 4RVLA 2OWBA 2PVRA 3ID6C 3N4TA 1JKSA 3O50A 3ZZWA 2GDOA 4KSPA 5EKNA 2Z2WA 3IW8A 4CGYB 4JV5M 3KEXA 1QUTA 4MXYA 2BRNA 4PL4A 3PFQA 3MPTA 4GIHA 2J90A 3U6DA 3DY7A 5M53A 2G5GX 4G34A 2XK3A 4P2KA 3DT1A 1YQJA 4JAJA 4WSQA 3TL8A 3UYSA 3R30A 4NCTA 4U43A 3SW7A 4ZJJA 3CCNA 4RJ3A 5IQEA 4NTSA 3RBWA 3RAHA 4BI1A 5D41A 5HNBA 1KE5A 4UN0C 4I4LA 3KK9A 2J0JA 4C0TA 4KUJA 3EKNA 4DTBA 4FNZA 2BIYA 1GL6A 3EIEA 5E8VA 4DTKA 4YBJA 5M4IA 2DNAA 4RIXA 4ZTMA 2A4LA 3U8WA 5IQIA 5KO1A 4PNIA 1W2CA 4I5PA 3CY2A 3GPPA 4LFAM 2WTKC 1OAOC 1XXHE 3TWKA 5IQFA 3IDBA 4FKLA 5FEDA 1XBCA 5EI6A 2IJMA 1Q24A 5IEYA 3TMOA 3R1NA 5B2KA 4FC0A 4G3EA 5EHOA 1SVGA 2UZBA 2VNWA 2NRUA 3QA0A 4OT5A 4EH4A 3OY3A 4DHJA 4FVRA 4C4EA 4NH1A 3RP9A 3L25A 5K0XA 2JWSA 4I23A 5HG7A 4FEVA 3AD4A 3B7QA 8CATA 4DINA 2GQRA 3AGMA 5ETIA 2CDZA 1LEZA 2RFEA 2VTLA 4R1VA 4DAWA 3UIBA 2VQEM 5H3QA 2UW6A 2O65A 1V0PA 2V0DA 3DDPA 2JKMA 3VAPA 4GV1A 2PHKA 4NW5A 3L9NA 5C4LA 2F7EE 5A6NA 2LGCA 2C99A 5J79A 4DR5M 1YHWA 4O0VA 3KN6A 3UVPA 1SXJD 3TKUA 3IG5A 1YDTE 2C5OA 3II5A 2XKDA 4RC2A 3FY2A 1Q39A 4IMYA 2VTNA 2MGWA 2PSQA 2QOKA 2I7PA 2QC6A 4S34A 1H07A 3FMJA 4FKVA 3TTIA 2YM8A 4AW2A 3AD5A 5I9WA 3E7OA 2F4VM 3CLYA 1V0OA 5K5NA 4HZSA 4LRJA 5E9EA 1IG1A 3R22A 4EC9A 5CU4A 4M69B 4QMMA 4CFUA 3KGAA 3TQSA 3Q04A 5H8EA 5CEQA 4XOZA 3ORLA 1O6LA 4D82A 2QU5A 4MBJA 4JR3A 3R8PA 5HIDA 3LFQA 4RX9A 2C5RA 5H9BA 2YNMD 4E7WA 2QHOB 3NSZA 1YDSE 3W18A 1VZOA 4RZWA 2WTJA 2X2KA 4EH6A 4I6FA 3POZA 4DBXA 3TUDA 4IE9A 3T8OA 3BI6A 3I0OA 1ZMWA 2QOOA 3QD0A 5JFXA 3RAWA 2CCHA 3LM5A 5EXXA 4P17A 4FIFA 2XK7A 3U54A 2RGHA 1IN7A 2EUFB 3AKKA 4M8TA 4GJ3A 3R1QA 4GIPA 2P5TA 2CFOA 1IBKM 3TKIA 2ESMA 3DZQA 4A06A 4ALVA 2RGOA 4GKHA 4UMRA 2JXNA 4MX9A 3MH3A 3C4FA 4YZDA 4Y8DA 2XJ0A 1NHWC 4C62A 4EH5A 3R28A 3TZMA 1D2NA 2PUUA 3HP2A 4FNYA 4JMQA 4B9DA 3FDNA 1PKGA 4LRTA 4EOOA 1YW2A 5EI8A 2Z7JA 4E5AX 4XUFA 2VTIA 4M97A 3R7UA 2BHEA 3UMWA 4FVMA 4F63A 1K3AA 2A19B 5DR2A 4U9AA 3CD3A 3RZBA 2A2AA 1IEPA 4QYYA 4FZ7A 5CU2A 4A4LA 1NY3A 3R8LA 2VWWA 4QMYA 1HT2E 1ZLTA 5DE2A 1FQ1B 3ZUVA 4ANMA 3E7VA 4IQ6A 2YQZA 3HV6A 4HGSA 3E21A 4QD6A 2C5VA 3BBZA 4B7GA 1NO1A 3LQ8A 3I7BA 3FC1X 4FV6A 2D7GA 2MH8A 3PVWA 5ANIA 3R8MA 1V92A 4ASDA 4ENXA 1Z57A 3HAMA 5I9VA 4BF2A 2BIKB 5M06A 3R8VA 4NKAA 3KF4A 4JXFA 4KRCA 5M51A 4USDA 3GOPA 1IXZA 2YJSA 2YLEA 3KOZE 4GMYA 5CAVA 4BJJA 1Y8GA 4LUEA 3OF0A 1JR3E 2WO6A 3ZRKA 5L6OA 4HOKA 2JBPA 2ACXA 2W96B 3FSKA 2GTNA 3AD6A 4U8ZA 2VWVA 3KY2A 4BL1A 2PE0A 2CEAA 5JSMA 4YLLA 5LVLA 2Z7LA 4X66M 2Y6OA 5DIAA 5HG9A 4XS2A 3VBTA 5JQ5A 4O7LA 2XRUA 4C58A 4ZS4A 3ZH8A 5IQGA 1D0MA 3U87A 2VX0A 3PG3A 1JQJC 4BI2A 4BZOA 1YI4A 4QNRA 4CTBA 4DA5A 2BJWA 3SXFA 2WELA 4C2WA 3HV7A 4FTAA 3RK7A 3N51A 2W17A 1G3IA 4EBWA 5E7RA 2WMAA 4BIDA 4O27B 5AP5A 3NYNA 1G71A 2XIKA 2IZTA 2GSFA 5AUVA 3ZDIA 2Q0BA 3VW8A 1WBVA 3ZZEA 3SV0A 5AFVA 1R78A 4AGCA 4GITA 3AT4A 3CQWA 2JIIA 2HKJA 4WG5A 4EOKA 5DYGA 5HU9A 2C6KA 1HT1E 2GS7A 3QTSA 2QENA 4F6UA 3UNZA 5B0XA 4NM3A 2E5LM 3B2TA 4HL4A 3QL8A 3DK7A 3W68A 3MY0A 3PP1A 1QVRA 2ZV2A 1UFZA 2ITPA 4K8AA 3UIXA 4O0RA 4IX3A 4KHPM 2IVTA 5DT4A 3VRZA 4PQNA 2A1AB 4ACGA 4BDFA 3TWJA 3VJOA 4FZAB 4NSRA 3OUKA 3R8ZA 3KRLA 3WZKA 2PVFA 1WZYA 3NNUA 5T6KA 2Y7JA 2GPHA 4A9RA 3WE8A 4DGOA 3FZOA 5DG5A 4H39A 4OTHA 3LLTA 3HHWA 1M14A 4I20A 2R45A 3OVVA 2NRYA 2CLXA 2J0LA 5CI7A 4I92A 4IBEA 2X4AA 3EQDA 3EIDA 1EFUB 2PTKA 2BUJA 2WZJA 4EK8A 4FA2A 5HO7A 5FTKA 4YPSA 5CTPA 4G2FA 1TZDA 4L53A 4AQKA 4WNOA 4UZDA 1W0XC 5CAQA 4LOOA 3EFJA 3RMFA 4JBVA 4KIQA 4CRSA 3EN5A 3PE2A 1WIVA 1Q8TA 2X0GA 2B9JA 1OIPA 3EH9A 4IM3A 4O0UA 1P2AA 2B3TA 2RGPA 4X3JA 3BV2A 3ZUUA 2FSLX 5DBXA 2YCRA 1WXQA 1P5EA 4EQUA 3EFLA 5B2MA 3UJNA 4FTRA 3M42A 3QYWA 1URCA 4JDJA 1P3QQ 3AOGA 4JYAM 3OW3A 3NUSA 3R01A 2V7AA 5JEBA 3PFYA 5CAPA 1UNHA 3GQLA 1RU3A 3P79A 4CG9A 4PDOA 5IUGA 5A4QA 4C4JA 4JI0M 1JNKA 1Z5CA 5A14A 1JSVA 4JRNA 3N4UA 4U79A 1PJJA 3NEWA 3ENHA 2JIUA 3THGA 1SG9A 3KOWE 3WHLA 3H9RA 3QQHA 5HTIA 4IAFA 4AU8A 3PXKA 4DR6M 2GNJA 1H08A 3VWAA 2V6ZM 1WBSA 2XIYA 3ZU7A 3C4XA 4UWYA 3VJNA 4CJ6A 4AQCA 2BAKA 4DCEA 3FUXA 1LUFA 4JJRA 3IG7A 5KCVA 1Z5BA 1I94M 2QO9A 4DH8A 3B8QA 1XNQM 2W1DA 4MVFA 2QBYA 4GG5A 4AE6A 4JR7A 5HIBA 2RKUA 3QA8A 3UDZA 4FV3A 3VIDA 3NCGA 4MF1A 2NPQA 1GLNA 2YM6A 4GHAA 4O4CA 4DUYM 1WBWA 2HW7A 4NCTC 4GKKM 3JR1A 3D2IA 4D4YA 3BHYA 2WB8A 3FYCA 4I5SA 1JR3D 3VFDA 1G5SA 2JITA 4DEGA 3NX8A 5EM5A 1WR1B 3LCUA 1VYZA 5E8ZA 4DH1A 2CSNA 4XH6A 2WHBA 2QR8A 3BLQA 3QYZA 1YE9A 5HE1A 4RIOA 2VF7A 5C4KA 4LJ5A 3W0OA 2PU8A 2UVXA 2DENA 3VUDA 4AG5A 1PMVA 3B2WA 3MK6A 1YSYA 4DFBA 2WTCA 4QYFA 5IU2A 1R2ZA 1HQYE 3NWWA 5AUZA 5CXZA 1PXIA 2FA2A 5IQAA 3T1HM 2W1GA 3VS3A 2IZUA 1XHBA 2JDOA 4D5KA 2Y6MA 4RJ5A 3FTFA 5TKDA 3MVLA 4I93A 2N35A 4FIGA 4FNXA 5AWMA 4JI9A 3PXRA 2YAKA 5HNIX 5GHVA 2I40A 4YMJA 4QMSA 2J2IB 4XK8F 5A6OA 3IOPA 2IVVA 5AX3A 4L52A 1KV2A 2W1CA 2QR7A 5EP1A 3AG9A 5FM3A 2YJRA 2W5HA 4LI5A 3D9VA 1UU3A 4RC3A 3MFRA 1UM8A 5LWMA 2WXVA 4BCNA 2P55A 4I3ZA 2ITXA 4F9CA 3UMXA 4MXAA 4AT5A 3F5XA 3NW7A 1UU7A 4YBKA 5DR6A 2QSFX 3J2PB 3KRJA 4KAOA 4UV0A 4LMNA 1WVWA 2Y8OA 3CTHA 4M13A 2A27A 4XV2A 1B39A 4FV0A 5E1SA 4O7ZA 1NY6A 1W84A 2VTJA 3VQUA 4QHSA 1D0KA 4EL9A 4D81A 1QZEA 1TVOA 5J7BA 1TDZA 3LCSA 5E8YA 3S2PA 2WTKB 3KCFA 3F2RA 3UP7A 3CQUA 1JBPE 3BX5A 5HI2A 4C4GA 2HHHM 4X64M 3VF9A 3D2KA 5KMLA 4AX8A 4TNBA 3GPYA 4YNOA 2QOIA 3HU2A 4IVDA 4CFXA 2HY81 5LVOA 4WUAA 4IEBA 3WI6A 1R4GA 2W06A 4AN3A 1MRUA 3TUBA 4U5JA 3GRRA 3A7JA 4JLCA 4O0SA 4MK0A 3NUAA 2CV1A 3DJ6A 4RVTA 4O82A 3GLFA 4AZTA 3DA6A 4YTCA 1DAYA 4IX4A 3V5WA 1VG5A 3BIZA 5HLWA 2FO0A 4GT5A 3TIZA 4AXAA 4F9BA 1MJGM 2BJVA 4G31A 3B8RA 4LMUA 2XALA 1PJKA 2YWVA 3GRYA 3K5UA 3JS2A 4S33A 4FV2A 1XR1A 3COMA 2C9OA 5I3RA 1AIPC 3FJQE 3HLLA 2C6DA 2BAQA 2X7FA 3MMPA 4Y5HA 4NXMM 1KUTA 4JQ7A 1L1TA 3POOA 3O8TA 4II7A 3T6PA 5FTLA 3QRJA 1H1RA 2YCSA 3EYHA 1IY1A 5AX9A 2CE7A 2GCDA 4O0TA 3FYDA 3BHHA 2IZRA 5EM6A 2AUHA 3AQVA 2UW7A 3QAME 4UBAA 4J8NA 4QQTA 3JR5A 2DWBA 3QKKA 2YM3A 1XBBA 4GL9A 3RK5A 1S9JA 4IAKA 4AXDA 2KTYA 2CMWA 2WMWA 3MA3A 3KP0E 3EMGA 2OLCA 3UIMA 3GFEA 5DI1A 1G8KA 3F7WA 3JXWA 4HNIA 5JGBA 4EHVA 2UZUE 2V5QA 3PXFA 3HJQA 4K33A 4IJPA 4ZTRA 2VO7A 4M69A 2C1BA 5EYMA 4APPA 3Q3BA 4GH2A 2YHVA 3CTJA 5BR8M 4ITHA 4E93A 1U54A 2W1ZA 3LMMA 3Q4UA 2VTPA 2PVKA 1MX0A 5HG8A 2DVWB 1FGKA 4JI4M 4GT3A 4JG8A 5E8UA 2ZDUA 2GNLA 4S2ZA 2LAVA 1KOAA 5AAEA 1HOWA 1L2BA 4DR3M 4XX9A 5E26A 2BZHB 2EWAA 4WNKA 1FINA 4DG0E 3W16A 4JG6A 4BY9E 3DXPA 3R2YA 2CNVA 3HUCA 2NYAA 3PXZA 3D5VA 3WHKA 5CY3A