2HAKA

Catalytic and ubiqutin-associated domains of mark1/par-1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
309
Chain Sequence
PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural variations in the catalytic and ubiquitin-associated domains of microtubule-associated protein/microtubule affinity regulating kinase (MARK) 1 and MARK2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
molecule keywords Serine/threonine-protein kinase MARK1
total genus 100
structure length 309
sequence length 317
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2hakA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hakA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hakA01
3BELA 3ZC6A 4GT5A 4NWMA 1PF8A 4WBOA 2XEZA 2X9FA 2ZM3A 4HPUE 4TN6A 2G01A 3CCNA 2ETRA 4BKYA 3IKAA 2Y7JA 3LXKA 2VTIA 4IDVA 2UZEA 4G5PA 5GZ9A 3KN5A 4EH7A 1SNXA 5IQDA 3HLLA 3HAMA 4OTHA 4G3FA 4PUZA 2VTPA 4WUAA 2C0TA 4D1XA 2JDSA 4FSMA 5IQIA 4YZDA 3NRMA 4ENYA 4FTMA 4R7BA 4X3FB 2W4JA 4CG9A 5IUGA 3ZLSA 4EYJA 4JG8A 3UVRA 4RJ3A 3FZ1A 3EFWA 3FY0A 1UU3A 2ZVAA 2IW9A 2ITQA 3QGYA 5CU0A 2W17A 1JKSA 1G3NA 2ITWA 3V5PA 2C6MA 2QURA 2OO8X 3O8TA 5EHOA 4FTOA 5FTOA 1Y8GA 3RK7A 3LIJA 2W1EA 4MAOA 2WMSA 4R3RA 4BN1A 5AUZA 2XNNA 1ERKA 5C26A 4CLJA 4CFXA 5JEBA 2UV2A 5DG5A 2BHEA 4EH9A 2UZDA 1A06A 3ATSA 2R3HA 1ZWSA 2XJ0A 3P23A 1QPCA 4QP7A 2JDVA 3PYYA 4EUUA 5KX8A 5EG3A 4OT6A 3GCSA 5EI8A 5AX3A 3DPKA 5BX0A 1FVRA 2XCHA 4E4NA 1PJKA 5DFPA 3D14A 3LE6A 4CMOA 5HO8A 5BNJA 5DPVA 4KKHA 4QMWA 3C7QA 3LCKA 5CSWA 5J7BA 4DH3A 2G15A 3QLGA 4MHAA 1P5EA 5IA1A 3TUDA 3VQUA 5CWZA 3DOGA 3Q5IA 3KULA 1U46A 1NXKA 2OJJA 4LRMA 4USDA 5CF4A 4R3PA 2KNAA 2VWVA 5E8WA 3BHUA 3ZEPA 1EH4A 2GU8A 5EM7A 5DEYA 3ORMA 3DB6A 4IB3A 4EC9A 3QXOA 4EUTA 2Q0BA 4PTGA 2CN8A 3KXGA 4IM2A 3RNYA 2GS2A 5M4IA 4GEOA 3ZLXA 5IA2A 4OBOA 3EQIA 4ZZNA 2AUHA 3MFSA 4QPMA 3WARA 4CQGA 2VWWA 3PY3A 4UZHA 3GI3A 3FLWA 3QRKA 4NH1A 2Z02A 3MDYA 4QPSA 4C0TA 3FDNA 4CEGA 4XG9A 4D0WA 5HU9A 2HZIA 4R6VA 1HCLA 3NR9A 5HVJA 2BRBA 4U45A 3RI1A 2VRXA 1YI6A 1URCA 2X2LA 3DBCA 3BQRA 3WF6A 3RWQA 3IW5A 2HZ4A 3DDQA 4FK3A 4M8TA 4L8MA 5KKRC 2FVDA 1GJOA 3DKCA 3EZVA 4K9YA 4O0RA 4FV3A 2VTQA 1G8AA 2Y4PA 3QBNA 3UP2A 3VUHA 5J9YA 4Q2AA 4FKRA 4Z9LA 3ETAA 4RFMA 4CFMA 4X0MA 1ZMWA 2JIVA 4AWIA 3EL7A 4PPAA 4X6RA 2C1AA 3QU0A 4FKOA 2XRWA 2ZDTA 2XK9A 4Y8DA 5F20A 2J9MA 3I60A 2AYPA 4U6RA 5HE3A 4ASXA 4UYAA 4BCIA 2GTNA 4ZLZA 2UZWE 2P2IA 4ZOGA 2QLQA 4AU8A 3V5LA 4AE6A 4D9UA 3MSSA 4XUFA 3GLIE 4RIYA 1W84A 1MRUA 1PMNA 2XK3A 3OHTA 1STCE 5T6KA 4I3ZA 4BIEA 2PWLA 2OOAA 4EORA 3E3BX 5IEVA 2AC3A 1F3MC 2CPKE 4IVCA 3A8WA 1J91A 4N4SA 2VTNA 2H9VA 5E8XA 3C4FA 3QRJA 2OSCA 1M2PA 2QOQA 4FBXA 2RGPA 5JQ5A 4FEXA 4F6SA 5C1QB 3QZHA 4L3JA 4F1MA 5AJQA 4ACMA 4QYYA 3D5WA 4AFEA 5LMAA 4UXLA 3C4EA 5E9EA 3Q5ZA 3CQWA 5KZ0A 2JLDA 3CKWA 1RDQE 4UBAA 4DGNA 3FZPA 1JNKA 4D5KA 4CXAA 4A9SA 4TT7A 4JQEA 5L6OA 1JPAA 3RNIA 2XIXA 1BMKA 5ANJA 4X21A 3ORPA 2OBJA 1KE8A 1OMWA 3G0EA 2B9FA 4J96A 3UNZA 4PP7A 3G2FA 4C3PA 3FMJA 4D1ZA 5M09A 4NEUA 3GBZA 1G5SA 1H26A 1GAGA 3PXZA 1OI9A 3CQUA 3I7BA 4I1ZA 4BICA 4PDYA 4CMUA 3CKXA 4BY9E 4I0RA 1LUFA 5AP4A 4YPDA 1F5QA 4E6QA 2VTLA 4E5AX 3O2MA 4CKIA 2WTVA 3BPRA 2EXEA 4EOLA 2UZTA 3PVBA 3R1YA 5HX6A 3OEFX 3A4OX 3QC4A 4RVTA 5C27A 3HDMA 2LVQD 4F7NA 4O7VA 5JH6A 4XS2A 2VTSA 5HE2A 3BGPA 3UGCA 3PWYA 1NT2A 4L68A 4A4LA 3PLAE 1BLXA 4MQ1A 3HV4A 4FOCA 1Z57A 1JQHA 3BWJA 2PVJA 5BYLA 4ZJJA 3I0QA 4IZ7A 2BCJA 3DZQA 3QWJA 1U59A 2VWUA 3V8TA 4ZSEA 3R9NA 1YOJA 2YM5A 3B2TA 4KRDA 3SAYA 3UC4A 4C8BA 3OUNB 3GC0A 4D4YA 3I1AA 5E91A 3FLSA 4FKGA 3PXRA 4G9RA 2GCDA 2VX1A 2GNFA 4AGUA 4O0YA 3B2WA 2P2HA 5E8VA 4ZJVA 2V7OA 4ITJA 3RPYA 4FEVA 2R3LA 2QHOB 4O7SA 4IM0A 5JN2A 3AC1A 3GC7A 4M0YA 5K0XA 5KNJA 2ITXA 2YAKA 5HNGA 4QTDA 5BVNA 4HYSA 3MV5A 1KYIA 4GYIA 5CENA 1WHCA 1H25A 3QTIA 4BCOA 1HQYE 3PZHA 4W4XA 3C0IA 4U8ZA 4PDPA 3SV0A 3CBLA 3LFCA 2JFMA 4NK9A 3AC8A 3C13A 1XH5A 3ULIA 4BDKA 4NZWB 3HDNA 2R3PA 1M7NA 2YA9A 4M3QA 4FKUA 3DDPA 3G6GA 4C4HA 4WD5A 5HG8A 3ZHPC 4YMJA 3TDWA 3C4ZA 3JVSA 4IVDA 4FEUA 3LFDA 2ITYA 2PE2A 2V5QA 3DU8A 3NNVA 2OW3A 2C1BA 4EH5A 1UNGA 4RVMA 2IVSA 3TXOA 3CP9A 3PPZA 5FXSA 5K4JA 4Z3VA 2YFXA 5E8ZA 3V51A 3E21A 3P78A 2B54A 2QOOA 5EK7A 1MQBA 4YC3A 3GXLA 4TYHA 2VX0A 5AP0A 3EH9A 4BC6A 1HT1E 2PYWA 1F4IA 4JAJA 5AP1A 4CQEA 4EQMA 4ZZOA 2NRYA 4ONAA 4DTAA 3SA0A 2EU9A 3AD4A 3U54A 4DTBA 5HE0A 3RPOA 3FYJX 1FQ1B 4WSYA 4A06A 3O50A 4RIOA 4FV4A 2QOFA 2YIYA 1MQ4A 3OOMA 1ZLTA 3Q6WA 3H0YA 3G6HA 3QYWA 2WTKB 2ZB0A 4HOKA 3ZO1A 3QQHA 3EMGA 4I20A 1J7LA 4U40A 4XG8A 3VHEA 3CD8A 3JYAA 2O8YA 2ITZA 4BTKA 3WF7A 1LEZA 4NW5A 3LZBA 3GLFE 1DI9A 3FI2A 4IQ6A 4EK4A 1OKZA 1ZYDA 4PF4A 3D4QA 4F2LA 2PUIA 4G3OA 3ZSHA 5D11A 5IQHA 2ITUA 2R7IA 4DYMA 4E7WA 4XBUA 3GLHE 3MFRA 3MESA 2HZNA 4C4IA 5HTBA 5J95A 2P33A 5EM6A 2Z8CA 3P0MA 4TNBA 4GFOA 3VUDA 3PJCA 4AP7A 3C4WA 1V1KA 2PU8A 3H10A 3BGQA 3EQDA 4FTUA 4FV6A 4JBPA 1RE8A 3M11A 4L3PA 4FG8A 5L8LA 2QLUA 2QU5A 4MWIA 3QX2A 2DENA 1XWSA 2YCQA 2PVRA 1WR1B 3CJFA 3EKKA 3QRIA 4WRSA 4Y83A 5ACBC 4B99A 4CFUA 3PVWA 5HG5A 3AC5A 4E4LA 2BIKB 3TNIA 2BAQA 4HCVA 3PXKA 4HZSA 4MBIA 2EUFB 3QTQA 4U80A 5L8JA 2VD5A 4DEGA 3G15A 2CNUA 5GJGA 4DG0E 4DH8A 1JLUE 1Y57A 4ANMA 1XH8A 3GLGE 3UMXA 5JFVA 5HCXA 4FTRA 1XHAA 3GC9A 3AXWA 2WFYA 1TQPA 4JL9A 5C4LA 2WIHA 2OH4A 4AW1A 1WBSA 4BZDA 4IC7A 4JBVA 2WMRA 4WKQA 2JP7A 3NUPA 2QNJA 4G9CA 4ACGA 4CZUA 4LGHA 5H8BA 4XP3A 4G31A 3ZC5A 2DAEA 3NPCA 3Q6UA 3MS9A 4FV8A 5A14A 3BI6A 4D2RA 2DZLA 4FKSA 4NW6A 1WCCA 4CFWA 2PVNA 1E94E 3A4PA 3ORIA 4RA5A 5CY3A 3CE3A 4O7RA 1H1QA 3C51A 3Q3BA 2WTDA 2VNWA 3BHYA 4FUYA 1BL7A 5FP6A 4BRXA 4LOPA 4UMTA 4IX3A 3L8PA 4JJRA 4Y95A 3ZEWA 4ZS0A 3IK3A 4I0TA 5L2TA 4ZIMA 3RAKA 2X4FA 1YXUA 4IVAA 4MH7A 3NVKI 1Q24A 4X7QA 3AOXA 4FSUA 4Y46A 3DK7A 1OL7A 1FOTA 4KWPA 5A4TA 4H3PA 5KHXA 5ANKA 3ZBXA 4H39A 2DKLA 4L3LA 3SXFA 4ZSAA 4Q7JA 4APCA 4FX3A 5IUHA 2W1CA 3FQHA 4FEQA 4NUSA 4ZTNA 2YZAA 1I09A 4RFZA 1H1WA 5IH5A 3Q96A 1PY5A 3FL5A 3RK9A 3GENA 4O27B 1Y6AA 3VUGA 2W9FB 5AX9A 3ATTA 4BHZA 1OECA 4N70A 5I9VA 3LXNA 5AIRA 3DK6A 3PIZA 2I0EA 4S30A 4WG3A 4USFA 5LVOA 4AS0A 5ETAA 4MWHA 5D12A 4A4XA 3FUPA 3PP1A 3MH0A 5LMKC 1UNHA 2WMWA 3A62A 2V62A 4NKAA 4AW0A 5I9UA 4F08A 3CY3A 4P2KA 5HVKA 3F3WA 1H1PA 4QQTA 2R3JA 4FYOA 3RCDA 4RMZA 3VO3A 4CMTA 3KEXA 2VWIA 2O3PA 2R2PA 4O0UA 4OTIA 1ZY5A 5DRBA 5TO8A 3VJOA 5I9YA 4IIRA 2YWPA 2ZM1A 1R39A 5LXMA 3LMGA 4D9TA 4FTQA 1REJA 3ZRLA 4KNBA 5T68A 1GOLA 2XKFA 3C4XA 4RQKA 3CPBA 2GNGA 1WAKA 4U0IA 2EB3A 1ZOHA 3HUBA 3ZSIA 2WMBA 3BV3A 2IZUA 3MJ2A 4FVQA 5A6NA 4I6BA 2C6TA 5A4EA 1V0PA 3W55A 4FTTA 3THBA 4IAZA 2WTIA 1SYKA 5HQ0A 4IWPA 4F7SA 2CCHA 3VS0A 1FMOE 2WD1A 3LW0A 5GINE 4Q9SA 4ITIA 5D7VA 1YLAA 2I40A 3FKOA 4J1RA 4MNEB 2GPHA 4FGRA 5CNOA 3ZDIA 1CUKA 4X2GA 3F7WA 3UZTA 2REIA 3LM5A 3OY1A 1YHWA 3TJCA 2C3KA 3FKNA 4AQCA 1R4GA 1JKLA 1P4FA 4HGTA 4P4CA 1XH6A 3U4UA 4KAOA 3ZFXA 2WTWA 5IDNA 4FE2A 1UU8A 4BYIA 2WQEA 3IQ7A 4FSTA 3U6IA 5JFSA 1UU9A 4ANSA 2R0IA 5CI7A 4O2PA 3FLZA 5AR7A 4I5MA 3VHKA 1DV0A 1IG1A 3U9CA 1QPJA 3AC4A 4LOQA 5HO7A 2IJMA 3LKMA 5IQBA 4QMXA 2K9DA 4KSPA 3QQUA 4X2FA 1T45A 2GFCA 2Z7QA 4MQ2A 5F1ZA 3UIBA 4GFMA 2O0UA 2PUUA 1BX6A 1WVYA 3R1NA 2PMNX 4PL5A 3TTIA 2VGPA 1OUKA 5BMMA 5C9CA 3UZPA 4XOYA 4EYMA 1WVWA 2R3RA 3PRFA 1A5TA 2CLQA 1MP8A 2J5EA 4C3FA 5IZFA 3RZBA 3EOCA 2JKOA 5M57A 2ETKA 3NUNA 3KB7A 4NKSA 4RFYA 4UALA 5C4KA 2X2KA 5JI2E 3NIEA 4A4OA 2QKWB 3V5JA 3H9RA 4ZZMA 4CRSA 3PA5A 5CTPA 2ITVA 2OXYA 2OXDA 1RW8A 4QTAA 3QWKA 5DFLA 3S1HA 2XP2A 2PVHA 3CTHA 3ZM9A 2MR9A 3WF8A 1M7QA 3D5XA 1VG5A 3MH2A 4DEDA 3NW7A 2JY8A 4DBGB 2HYYA 4MXOA 3V6SA 3G33A 4DFYA 2UW0A 3FRHA 3C0GA 3RM7A 2XK8A 4PTEA 2WHBA 4TZRA 3TNQB 4AT3A 4EOQA 2OF4A 5CEOA 3PJ1A 3QLFA 2QOBA 3FYKX 3TNHA 3F61A 3D5UA 2G2HA 3F69A 3O23A 4FV5A 2LVNC 4OAVB 1WVXA 5JRQA 3SG8A 1FVVA 1FINA 4WBBB 1XBCA 3LCUA 2X4ZA 3QUPA 2Z7SA 1XQZA 3EYHA 2BDWA 3MB6A 1GZOA 4YJVA 4EBVA 2J51A 4ERKA 3UC3A 5E8TA 5BMSA 3HYHA 3F9NA 4GU9A 5FQDC 3NWWA 3EN9A 3OW3A 4WRGA 4JR7A 5ANEA 3ELJA 4YGAA 3D7TA 2CHLA 3MGYA 5CAVA 3DJ6A 2I1MA 2NO3A 3R0TA 3U55A 3TACA 4Z55A 4PWNA 3QYZA 4FK6A 3TDVA 1ZZ2A 3KC3A 4GV1A 2OZAA 4I21A 4TY1A 4A9YA 4CKJA 2WO6A 1DS5A 3R8VA 2GQRA 3ZMMA 2ZTCA 3MA6A 1Y91A 4BCPA 2W05A 4O7TA 1XKKA 4JT3A 3KK9A 3PXFA 2JKQA 2QG5A 4EOMA 3MW1A 2IW8A 3A60A 4O7ZA 4C2WA 4YJNA 4PPCA 4BI0A 1YI3A 5M51A 1YDTE 2W5AA 4ZJIA 5CS6A 5H2UA 3F6XA 2Y9QA 3G9NA 4IB0A 2Q83A 5HIBA 1OIRA 2QCSA 2B53A 3D2KA 2JDTA 4LGGA 4OT5A 2HK5A 5G6VA 5AM6A 4IACA 2JIIA 5EM5A 3MB7A 4B8LA 5JFWA 3PSDA 4U5JA 3ODZX 3OXZA 4MVFA 2WOTA 2B9HA 5IQEA 3QUEA 1XBAA 2X9EA 3BWFA 3V3VA 3KMWA 5M44A 2VX3A 5JK3A 2PHKA 3UNKA 3OROA 5B0XA 5CEQA 4QMSA 5BVDA 2ZMDA 4NSTA 2JFLA 4FL2A 1JBPE 1ZMVA 4I22A 3HMNA 4ACHA 4RIWB 2DAMA 3P5KA 2V7AA 4G6NA 3LHJA 4J53A 4QMZA 4BIDA 4I6QA 3R21A 5CNNA 4YSJA 4II5A 3K9PA 4ANQA 2DWBA 4DGOA 5GJFA 4ZY4A 3UVPA 3FHIA 2C3JA 4AAAA 4EHVA 4F09A 4EKKA 1R0PA 3BEGA 4CFNA 1WBVA 1YXVA 5FD2A 3IOPA 3K2LA 2OJFE 4LQMA 3VRZA 4RJ5A 2R64A 5HX8A 2JY5A 4G2FA 4LL0A 1YWVA 2XVDA 5EOBA 3R83A 1NW1A 2WEIA 3BYMA 3GQLA 2DAGA 5CEKA 3TZ9A 2OG8A 3MI9A 4UY9A 5JFXA 3LMIA 3SLSA 4FSQA 3FI3A 4FV9A 1WBTA 2XUUA 3NUAA 4EH2A 3AC3A 4IX4A 3QX4A 3CIKA 1UVRA 3T3UA 3ZO3A 3U87A 4R1YA 2QHNA 3ZM4A 2PVKA 4ZMEA 4NU1A 1VQ1A 4WNKA 3GU6A 4L44A 2UZLA 5FDXA 4QMPA 3DFCB 4N6YA 2F49A 3S00A 3PA3A 4GG5A 3NYVA 5CEPA 3DT1A 2OGVA 2EKKA 4N57A 4IAYA 1O6YA 3CXWA 1CTPE 4ZSJA 2W5BA 3LCOA 4XRJA 3LCVB 4R71A 1VYWA 3L9PA 4ACDA 4C59A 5JGAA 2X8EA 2WQBA 4RRVA 4C4JA 5AR3A 3L1SA 2YN8A 2QI8A 5LOHA 1QZEA 3BE9A 3ULZA 5IMEA 5L6PA 3DFAA 3VNTA 5DNRA 3OTVA 1KE9A 5LQFA 2R3QA 3UO4A 4QNAA 1ZYLA 3BGZA 3L9NA 4PDSA 4AOIA 2XKEA 2XYUA 4O1OA 2CJMA 1FBNA 4EOPA 2OOBA 5AM7A 4U43A 3AG9A 4NYEA 4R77A 2GQGA 3HAVA 2GNJA 3O7LB 3IGGA 4O84A 1W83A 5LMKA 1MUOA 3QCQA 4FKPA 1YXXA 4EH4A 2W1FA 3F66A 2WELA 3EKNA 4F0GA 4KBAA 3DKGA 4RSSA 3E92A 5JZJA 4RX8A 2Z7LA 3V04A 1FMKA 5CALA 5GIPE 4UWYA 2XJ1A 2IN6A 4EWHA 3M1SA 4O1PA 1KV1A 3R1QA 2XNEA 4LM5A 5EW8A 4PMMA 4R3CA 1DO2A 3NW6A 2F9GA 3SQQA 3LLAA 2C6IA 3R22A 2XEYA 1ZYCA 4RG0A 1PXJA 5FRIA 1T43A 4B9DA 3MPTA 4DGLC 1GIIA 2UZVA 5DEWA 3IS5A 3KCKA 2YM6A 2J0JA 2LBCA 3ZYAA 4NM3A 5M56A 4EC8A 2A27A 2GSFA 3CJGA 3MY5A 2PVYA 2WEVA 4NFNA 4CFFA 2VO0A 3JPVA 3QC9A 5FEQA 3F2NA 4H1MA 1J7IA 4ZAUA 4XBRA 5CZHA 5I5ZA 4DG2E 4FTJA 4OW8A 4V04A 1Y6BA 4RWJA 5H8GA 3W8QA 5HHWA 2H5XA 5CU2A 4W9WA 2ZTDA 4UEUA 2B3TA 1WGLA 2J90A 3KRWA 1DAYA 4P7EA 1LR4A 5JGBA 4DCAA 3I7CA 4W4VA 2XKDA 1RQQA 4XV3A 4KIQA 3R63A 3RWPA 2C5YA 5HNIX 1URWA 3OXIA 3NZ0A 4BBMA 4CYJA 3CEKA 3EQRA 4EOKA 5DR6A 2H34A 5FBNC 2XM8A 3SW4A 4YU2A 3S95A 4I93A 2RL5A 2O25A 3WOWA 3SW7A 3GQIA 3VUTA 2O5KA 4YJQA 4BZOA 4UMRA 5CF6A 4FTNA 4CKRA 4TKSA 1SG9A 3I4BA 3II5A 4LYNA 3GEQA 4YJRA 5AV3A 3TUCA 4AZTA 4IX6A 2LVAA 2WMAA 5HBEA 3V5WA 3BU6A 4NJDA 3NYOA 3A7FA 3FI8A 5HD7A 2HZ0A 4XJ0A 3VBQA 3QHRA 3R8MA 1WFCA 3OD6X 1UU7A 1CKPA 1H1RA 3QD0A 5D10A 4O86A 1Q3WA 4CNHA 4K77A 3CGFA 4FKLA 4CT2A 4J8NA 2Y8OA 4N6ZA 3BLRA 1H07A 5J79A 5CSVA 4ITHA 4NIFB 3Q32A 4EJNA 1AQ1A 4G3DA 2IZSA 3FY2A 3LAUA 4HGSA 4M7IA 5TF9A 1OIQA 2LVOC 2JBPA 4JOAA 4K11A 4MTAA 1PGYA 2BR1A 3TIZA 4ZSGA 1OPJA 1QMZA 2YISA 5DI1A 4M13A 1OQYA 2PZRA 3E46A 2C4GA 2XIYA 3GU5A 1PMVA 3BU5A 3N51A 5DBXA 2HY0A 2ONLC 5EYCA 2X1NA 3FLQA 5ACKA 4UMQA 4B4LA 5IH6A 5EQPA 3F82A 3KULB 3LCSA 4P5ZA 3EJ1A 2YDIA 3MIYA 4XEYA 3NLBA 5HOAA 2X7FA 1OUYA 4LRKA 3NS9A 3V8SA 4IEBA 5IU2A 2JDOA 4BCQA 2IG7A 1S9IA 3UODA 5FDPA 2J4ZA 5CSHA 3S0OA 4Y5QA 3G90X 4JQ8A 4YC8A 2QO9A 3GT8A 2XBAA 3GFWA 4KS7A 4ZTSA 4HVSA 3UOHA 1CSNA 2R7BA 3COMA 5GHVA 5K3YA 4OBQA 2B9IA 4IC8A 5HESA 4RZVA 5M55A 3BYUA 2Y0AA 3OWKA 3N4VA 4FZAB 4J7BA 3ORXA 2GHMA 5I4NA 4YHTA 4EKLA 2CLXA 3POZA 3VIDA 4CZYB 4DLIA 4TL0A 2YZLA 2GFSA 2W1ZA 4PQNA 2CGUA 2ZMCA 1R1WA 3F3ZA 4RA4A 3R8ZA 3TV4A 4BYJA 5B2LA 4MEDA 4LRJA 4EBWA 2C6KA 4QYHA 1HT2E 3NMUF 5B2MA 3HECA 1OM1A 1VEKA 1V92A 3HV3A 2HWJA 3GCQA 3UQCA 4YZBA 4D2PA 4FSWA 3W10A 2B0QA 3LFFA 1JVPP 5FLFA 1H08A 5EHYA 3ZO4A 5AUUA 4L7SA 4G3CA 5HD4A 3EN5A 1KE7A 2WKMA 4L9IA 4IXPA 1NVRA 2G2IA 4C02A 2QKRA 3NNXA 1NA7A 2Z2WA 5LVPA 2R3KA 4ANBA 1TVOA 4FI1A 4JDIA 3UTOA 2JKKA 5HICA 3AT3A 5DH3A 3E7VA 3WIGA 5GIOE 3IG7A 4BGQA 3QKLA 2BILB 4IZYA 2QOHA 5KKRB 3QCYA 4C36A 4MXZA 2WMXA 3K3IA 3ACJA 3FXWA 1LP4A 4F6WA 3KMUA 1AIPC 4XV2A 5LVNA 2E9PA 3TN8A 3TKIA 5HTCA 3FEGA 1H8FA 3KF4A 5D9HA 5FXQA 1UV5A 4FGBA 2GS7A 2XYNA 5K0KA 3MTLA 3QD2B 4DTKA 2SRCA 3EL8A 1UNLA 3TNWA 4QP4A 3Q4CA 4USEA 5CYIA 4MKCA 4MXCA 5K5XA 4ZEGA 4UXQA 3SDJA 3PXQA 4QQJA 1WBPA 5ETIA 3OCTA 4F4PA 2BPMA 1YHSA 3C5UA 3WE4A 4E5BA 4F6UA 2VTTA 3R9DA 2WZJA 4I94A 4LUEA 4MNEA 3KRRA 5T3QA 4Z7HA 2IW6A 3OT8A 1P14A 2BMCA 3E93A 4D28A 2EWAA 4TWPA 4F7LA 4Y85A 3IOKA 4YBJA 3G5DA 5BVFA 3FI4A 4I5CA 4C58A 2Q0NA 5F4NA 3MFUA 3KK8A 2PMIA 5FTGA 3PA4A 4J52A 4BKZA 4DH5A 5M4UA 2QVSE 5B2KA 5AP6A 4A07A 3KL8A 5ANOA 1M2QA 3VN9A 3T6PA 4YZCA 5LMBA 3Q60A 1Z9XA 3LLTA 1FGIA 2OZOA 1X8BA 2OZAB 4YLKA 3FLYA 4CV8A 1JWHA 2ERKA 2XZSA 3OOGA 4FTIA 5D1JA 4YZMA 3QRUA 4FT7A 2RFDA 1PXOA 4GUEA 3D7TB 2OWBA 3HA8A 4PX6A 4BKJA 4QTEA 2BZHB 2HCKA 3NW5A 3RCJA 2IVTA 3TM0A 1PXIA 2RG6A 3E63A 1Q5KA 3UJGA 4DEEA 1XH7A 2G2FA 4DINA 1JSTA 3DZOA 3I0OA 3MH3A 5D7AA 1AD5A 4I5HA 3CC6A 2CMWA 2UVYA 2J0IA 3ORZA 3OTUA 4GIHA 2ZM4A 1W0XC 4ZY6A 1ZOEA 4BZNA 3FSFA 1Q8ZA 3QXPA 4O6EA 3W18A 2BTSA 3CLYA 5AP2A 3ANQA 3QD4A 2R3OA 5DE2A 5A6OA 4D0XA 4F0IA 3NUXA 4D4SA 2BUJA 5E90A 4BR3A 5FTQA 2IO6A 1QPDA 4IM3A 4U9AA 4RWLA 4O82A 4D58A 1OL6A 3R30A 4B8MA 2C47A 1GZNA 1O6LA 5L2IA 3CSVA 4WSQA 4ZS4A 5HCZA 4XP2A 1ND4A 4ZTQA 2PZIA 4ORKA 2HW6A 4L00A 3F5PA 1XBBA 3ZO2A 3RHKA 3EFLA 4O96A 3QKKA 3Q4UA 2HXLA 5A3XA 5CF5A 5J87A 3RVGA 3W32A 1U5RA 4JQ7A 2P4IA 4IZ5A 2XF0A 4FKTA 2YABA 3O17A 2YLFA 4C7TA 5JSMA 5M07A 1WBNA 4RC2A 3OWPA 2GDOA 2JITA 4H1JA 3CR0A 2ZDUA 3QKMA 2BAKA 4NTTA 3UG1A 4BBEA 3JY9A 4IJPA 2XMYA 4J98A 2V22A 3N4UA 2NPQA 5IA5A 3MVLA 1CM8A 2WU6A 5TE0A 3JVRA 5JZNA 3U6JA 3DKOA 2X81A 3ODYX 4FG7A 4EZ5A 1YDSE 1PXPA 2KHHA 3EHAA 3R2BA 4ASEA 4D2SA 4E1ZA 5BUEA 2XS0A 3TKHA 4WT6A 4XX9A 2H96A 2E9UA 3U6HA 1BI8A 2I0HA 2CKOA 3FMEA 3ORNA 4G1WA 2R4BA 3A2CA 4QMUA 3TTJA 1Q99A 1WZYA 4X3JA 5J8IA 5F9EA 4FZDB 3UG2A 5IA3A 1OL5A 1OPLA 1R78A 2PPQA 3K5VA 3LXPA 5AV2A 4KS8A 1OKVA 1TKIA 4AW5A 1DAWA 3ZH8A 3KXHA 1Q8YA 3K9OA 4IAAA 4DBXA 3A61A 4AF3A 2C5OA 2O63A 4RC3A 2GHGA 3GCPA 5E8YA 3UVQA 2YDJA 3EYGA 4IW0A 5AADA 3EQFA 3SVVA 5I3RA 4QMLA 5AV1A 5E8UA 1IXSA 5CASA 5CAOA 4X2NA 1YDRE 2CDZA 3E3PA 4PPBA 5IQCA 4X6QC 4F0FA 2OIQA 4YHJA 5BVOA 3V5QA 4JNWA 1PXNA 4MBLA 5BVKA 5TOZA 4CTBA 4LG4A 3FAAA 4FTAA 2YM8A 3ROCA 4OTRA 3Q4TA 4AG8A 2UZBA 4BDDA 3GNIB 2XCKA 5HEZA 3M42A 4YHFA 3AMAA 3O0GA 1DM2A 3AD6A 4UMPA 3FQSA 4EK5A 4Z7GA 4EJ7A 4HPTE 1E1VA 5EKOA 5AR2A 4AT4A 4O0XA 4Y73A 4B0GA 4EH3A 4DT9A 3PRIA 3QFVA 1XH9A 2WOUA 3WI6A 5JT2A 4U42A 4UZDA 4W4WA 1CDKA 2DQ7X 1YI4A 3PTGA 1BI7A 3CTJA 3BYSA 4O38A 4ALWA 1WBOA 3ET7A 1ZY4A 3D15A 5DYJA 4C4FA 3I81A 2BKZA 3Q9YA 4IAFA 3QHWA 1MRYA 4G17A 1IEPA 2XIZA 4JRVA 4XHKB 4RBLA 5AV0A 4GEWA 5IMXA 3ZXTA 2H6DA 4TYJA 2BFXA 4G6LA 4L46A 4GSBA 1IRKA 1YVJA 5EFQA 1J3HA 1PXMA 4Z16A 3OG7A 3W2RA 1G41A 1UA2A 1F0QA 2DAIA 2BFYA 3UIMA 2YIQA 5FUTA 4OGRA 5FG8A 4AE9A 5BYYA 3OZ6A 2YIWA 3JR1A 2I6LA 3HRBA 3TV6A 2QSFX 5DT0A 5EQEA 4O0VA 4XLIA 4YZ9A 3ZCLA 4DLJA 2GTMA 3L9LA 4ZP5A 1Q8UA 3W1FA 4M68A 4CZTA 4E6DA 4YO4A 2OFUA 5HIDA 4D2WA 2CP8A 2QOIA 3JXWA 1KOAA 4FTLA 4IHPA 4QP1A 2BDJA 1W82A 3EZRA 4LOOA 3W2OA 4LGDA 5AUWA 3TL8A 1H28A 4WUNA 1PXLA 2FB8A 4WNMA 3U51A 4FMQA 4FEWA 1JKTA 5FM3A 4EOSA 5AR4A 3ID6C 2Y6OA 4U3YA 3UO6A 4CRLA 4NTSA 3VWAA 4IMYA 3PIYA 4JX3A 5BUIA 1PMUA 3EN4A 4ZTHA 4BHNA 3FC2A 4OR5A 1NVSA 1BL6A 2ETMA 3DS6A 3MPAA 3LQ5A 3VULA 4OTFA 4U3ZA 3C0HA 2JAMA 5K4IA 1ZMUA 3P9JA 4GCJA 2F7EE 4I92A 1E1XA 3T3VA 5HLWA 3COKA 3ALOA 4U97A 3POOA 2PTKA 5FEEA 4PY1A 3R01A 2FGIA 2JIUA 4P5QA 3ZLYA 5KMMA 5E4HA 4K0YA 3DBEA 3OMVA 1AGWA 4EK6A 5KMKA 3BLQA 4EI4A 3WZJA 3SOAA 3EWHA 3UOKA 5I9WA 1VEJA 3Q52A 4O2ZA 5IG1A 4HNIA 3FMHA 2YLEA 1T6OA 5AMNA 4MD7E 5L2SA 4R7HA 3QTRA 2UVZA 2B1PA 4U44A 2B9JA 2DI0A 2VWZA 4MF0A 4PP9A 5CQUA 4AA5A 4NIFA 4F7JA 3SG9A 2OO9A 3KKVA 4GUBA 4XH6A 3K54A 3PJ3A 3COIA 2CWBA 4I6HA 3DBQA 3LFEA 1P3QQ 1YWNA 2QO2A 3W16A 1O6KA 3RM6A 2NNWB 3BHVA 4AGCA 3W2PA 1PKDA 1JAMA 3DGKA 4MYGA 4WHZA 3VS7A 4ARKA 4FA2A 2RIOA 3QTXA 4QO9A 4MF1A 4RLLA 1M14A 2C6DA 4H36A 3W8LA 4E26A 3G9LX 2WQMA 2WQNA 4U81A 2OJIA 3R7YA 2A2AA 1PHKA 3WIKA 2VWYA 3H0ZA 2KNVA 4YJSA 3N4TA 2JEDA 4YTHA 4E5WA 2WQOA 4TYHB 4RIYB 3F5UA 4UX9A 2RSVA 3U4WA 5CX9A 4S32A 5GNKA 3ORKA 4C4EA 4UWBA 2VNYA 4MD8E 4QTBA 2A0CX 4QT1A 2NRUA 4DFBA 2HAKA 4RX7A 3HV5A 3LFBA 4BCMA 3P7AA 3MVJA 5GZ8A 3M2WA 4IWOA 4FSRA 4JXFA 3KQ7A 4L53A 4XP0A 1SM2A 3PE2A 4C3RA 3GOKA 5C8KA 4DFUA 1VDLA 3G0FA 4H58A 4IDTA 4KKGA 5EH0A 4EONA 4TW9A 1TQIA 2W96B 4F9AA 2JBOA 4JAIA 3UYSA 1B38A 3BX5A 3I79A 3IW4A 2WMUA 4NM5A 4X2KA 4IZAA 2DUVA 4G34A 1BVSA 4QQ5A 5IQAA 4OLIA 4K1BA 3KCFA 4XG3A 5KMOA 4S2ZA 2W4KA 4RWIA 2B55A 5HLPA 4GK2A 2XIRA 4BGHA 1QL6A 2B4SB 3FMNA 2OJGA 3WZUA 5DT3A 5CAUA 4LMUA 4FKVA 2IPXA 3P7CA 4OTGA 3LCTA 4GT3A 4EZ7A 1A9UA 1OAIA 3RMFA 1YKRA 2J0LA 4H3BA 4HYHA 2XA4A 5M53A 4AZFA 2BRHA 4IJ9A 3QAME 5I0BA 2VGOA 5KZIA 3W33A 3OWJA 2XRUA 4IH8A 4UN2B 1ZXEA 4QMYA 4QYGA 5CEIA 3WILA 3BHHA 3ERKA 3MH1A 1UKHA 2Z60A 3A99A 3UZRA 4BDEA 3A7IA 4CG8A 3HEGA 3ZTXA 5FEDA 3VUIA 1CKJA 3MMPA 3DTWA 3E8NA 3NUUA 3OEZA 5HKMA 4E73A 3DXQA 3QTZA 2FUMA 1KV2A 4F1IA 4R8QA 3LVPA 3TNPC 3VS3A 1K2PA 3OC1A 3QZFA 4YNEA 1DI8A 5HORA 2E9OA 4YR8A 5BQ0A 3BIZA 3CS9A 5HGIA 5A9UA 4FOBA 4HVGA 3F3VA 1WBWA 2B7AA 4FL1A 3RINA 1UFZA 3R7VA 1YWRA 1Y8YA 1JR3E 3ZRKA 2QR7A 4HEOA 4WP2A 2BDFA 3HL7A 4QMTA 4OTQA 1K9AA 4KIKA 2O65A 3N9XA 4YZNA 3ZONA 4E8AA 1PMEA 4FIIA 4QP3A 4LL5A 3GU8A 4AUAA 4D55A 3FMMA 4M66A 5F95A 3C1XA 2HELA 3D94A 2QR8A 4MXXA 3ZUVA 3BU3A 3DAEA 3LXLA 4WA9A 3HP5A 4R7IA 3DXPA 2ZOQA 4MX9A 3DNDA 3R8LA 5GJDA 3DLSA 3C50A 5KO1A 3B8RA 4FZFB 4E4MA 4O83A 1GO5A 2X2MA 3JS2A 3FZOA 1PW2A 2J0MB 3BV2A 4FSZA 4JX7A 4L67A 5IUIA 3RBWA 4EHZA 2OICA 1IAHA 3TZMA 3RPRA 5M06A 2R3FA 1IR3A 3QUDA 3OCSA 4I41A 3UDBA 4DH7A 4GJ3A 1BUHA 2WMQA 4I5PA 3UQGA 4XG2A 2CN5A 3E8DA 1ZV1A 2V0DA 2I0YA 2BZJA 2W7XA 4QP8A 4J8MA 4BL1A 4EK8A 3QQLA 2WTKC 3QL8A 4HGEA 5I3OA 4F9WA 2CSNA 3E8CA 3I6WA 3BQCA 3IO7A 3HMOA 5J9ZA 4E6CA 2L2DA 2ZV7A 5C8NA 5KUPA 4CFVA 5KMLA 4FV0A 3NYXA 4GRBA 3DLZA 2PE1A 3F2RA 5JGDA 3R7GA 2QC6A 2UW8A 4G16A 1Z5MA 4XG7A 3NGAA 2YCSA 3CY2A 4RIWA 4ASZA 5KCVA 3V8WA 2C69A 1RJBA 2JKMA 3QCSA 4TRLA 3E88A 3HRCA 4TWCA 3KXXA 4ZTLA 2JY6B 4FKWA 3VUKA 5CI6A 5I9ZA 4APPA 2BZIB 1UKIA 2E9NA 2WXVA 3IW7A 1UWJA 3FMDA 3A8XA 3QF9A 4DH1A 4ZLOA 4YJPA 1TTEA 4WO5A 4JIAA 5FGKA 4FODA 3MVMA 3C4CA 2R3IA 2O2UA 3T9IA 1BYGA 3HMPA 3KF7A 3VF9A 3FPQA 2WPAA 4GG7A 2BHHA 2R3GA 3ENMA 4UYNA 4JBQA 1GY3A 4EHEA 2ZB1A 4BCHA 2J0KA 2HIWA 3DV3A 3MIAA 2CNVA 4KIOA 5LWMA 4HZRA 2WMVA 3H9OA 4GKIA 1VZOA 2GS6A 5IISA 1OTRA 4GH2A 3F88A 4QNYA 4FTKA 4MK0A 1TQMA 3E5AA 4IWQA 3DK3A 5CU3A 2UW5A 4AACA 2QG7A 2NP8A 4W8DA 1NV9A 3DA6A 3E64A 4Q5EA 3BRBA 3GC8A 2BWEA 3KU2A 1IM2A 4XYFA 3GCVA 3VS2A 3Q9XA 5IH4A 1J1BA 4R1VA 1J7UA 3PZEA 2O64A 2CCIA 4TPTA 3UOLA 4JVGA 2JD5A 5EQYA 4F9CA 3VBXA 2RG5A 3FC1X 2FA2A 3SC1A 4GKHA 1GNGA 4A9UA 3D5VA 4ZLYA 4JDJA 4TTHB 5DN3A 3ZBFA 1YOMA 5L8KA 4QYEA 4R5SA 4OBPA 2IWIA 3O71A 4BCKA 4BVUA 5LARA 1VJYA 2MROB 4TYEA 1Q8TA 3UE4A 1V0BA 3PSCA 4TXCA 2OIDA 2QU6A 5AAEA 3EQHA 3NAYA 3KXNA 4M67A 3F5GA 1OBDA 3PFQA 2X0GA 2XK4A 1SVEA 3CD3A 4O6LA 2ACXA 3QD3A 5CANA 3QTUA 1OGUA 4BDBA 4DGMA 2XJ2A 4O0WA 4OTPA 3UYTA 5DRDA 4CGAA 1JSUA 2FO0A 4J97A 4Y72A 4DT8A 3Q9ZA 4HYIA 1IA8A 2YJRA 3MWUA 2VU3A 5BVEA 4FKQA 4TYGA 4TNDA 3UIUA 2KNZA 4A9RA 3OW4A 4PTCA 3R8PA 2FYSA 4I23A 4IB5A 5EDRA 4E4XA 2VV9A 2XB7A 2VWXA 5DA3A 1L3RE 2VUWA 4IWDA 1KUTA 2C6OA 3FZTA 3GGFA 5AR5A 5F94A 4XLVA 3UQFA 4LV8A 3SRVB 1XXHE 4PMSA 3R04A 2A4LA 5BUJA 2YCFA 2F4JA 2RF9A 1YRPA 2UUEA 4BCNA 3NVMB 2JUJA 3TUBA 2JC6A 4EK3A 3Q4ZA 4QTCA 3R6XA 3U9NA 2XM9A 4K33A 5AUTA 5IDPA 4M0ZA 4TWOA 4MD9E 2PE0A 2BWBA 5EYMA 3VW8A 3H4JA 3ALNA 2PMLX 4IAKA 5CSXA 2YJSA 4F9BA 2Y4IC 1G4AE 3R71A 4FV1A 5FWKK 3H3CA 2YERA 3TKUA 2PL0A 3NCGA 3TV7A 4CD0A 4AX8A 4DGGA 1Q02A 3ZFMA 4OTWA 1ZYJA 1HCKA 4HYUA 3BYOA 4AN9A 4CCUA 4QOXA 4L6QA 2C5XA 2YM7A 2DAKA 4DCEA 2IVVA 1M52A 3WF5A 4BWXA 3QA0A 3BE2A 4G3GA 4UV0A 4F1OA 4F99A 3ITZA 1TR8A 2LTUA 4DFXE 3DB8A 4EL9A 5CXHA 5L6WL 5L3AA 1U4DA 3ZDUA 1M17A 3PJ2A 4G3EA 3SXSA 4BB4A 3R9RA 4FV7A 1ZRZA 4XMOA 4ASDA 3QALE 2YEXA 1YXSA 2W06A 2X7GA 5HNBA 5IKWA 5LVMA 3LQ8A 1REKA 5CU6A 4AZSA 3FBVA 4F70A 4AN3A 3GFEA 3GP0A 4YURA 4RPVA 4U7ZA 1Q62A 5CZIA 3O96A 4L01A 5EDQA 3NCZA 2UW3A 4PRJA 3T9TA 4DITA 2Z7RA 2C30A 2RFEA 4RX5A 4O7YA 2EKFA 1U5QA 1OL1A 4NCTC 4KINA 5CQWA 2I7QA 3KA0A 4RX9A 3AD5A 5M08A 4QMVA 3KRJA 3VS5A 4A7CA 2J2IB 2YACA 4FG9A 5DHJA 4O22A 4X2JA 5GZAA 4CT1A 3PP0A 5AP5A 3ZS5A 1VEGA 2G3QA 2OFVA 5CVFA 4C37A 1O9UA 2R3NA 2W1GA 5TKDA 2QO7A 1KWPA 3NNUA 2UW9A 3BYVA 3RK5A 1P4OA 2OH0E 2YM3A 2HOGA 2MJ5B 5LCKA 2YHVA 3GU7A 3NSZA 5LJJA 1VEBA 5J9LA 4V05A 2F57A 1BKXA 1MN3A 4I6FA 5AIKA 3W2QA 1KE5A 5AA8A 3PDTA 4M84A 4RVKA 2XK7A 4DEAA 4FSNA 1GIJA 2DYLA 3LCDA 2OKRA 4BTJA 2ONLA 1FVTA 1PRYA 4AW2A 3UIXA 1DO0A 4M97A 4C38A 2P0CA 1OKYA 3I5NA 4C34A 3OCBA 3WYYA 4WG5A 4GJ2A 4QMOA 3KMMA 3REPA 3B8QA 3E7OA 3O8UA 1B39A 3DCVA 4GK3A 3RZFA 4ZMFA 3D9VA 2BKKA 4X3FC 2VTRA 2XKCA 3BEAA 3OFMA 2UW6A 4PNKA 3BBWA 1Q61A 3IW6A 3QRTA 3OT3A 3TZ7A 3VS6A 2LVPC 3NIZA 4RJ7A 1H0WA 3DQXA 3PVGA 3RGFA 4DEBA 1H00A 3NEWA 4QMQA 3QQKA 4GU6A 3RP9A 3F5XA 2C5NA 5DVRA 3U8WA 3ZUUA 5BPYA 1YHVA 5M4CA 4B7TA 2X8DA 3QQJA 5EW3A 3QTWA 4ANLA 3DTCA 2C68A 4YJTA 4UB7A 4EOOA 3H9FA 5CLPA 2QD9A 3FHRA 3LFAA 2XNBA 3OBGA 4L45A 4J95A 3KGAA 4PMTA 3V01A 5J1WA 5AFVA 4RWKA 4BCFA 3D83A 2W0JA 2FSTX 2JNHA 5HVYA 4RC4A 1V0OA 3QQGA 2YITA 4I4EA 1H0VA 1YQJA 4LFIA 3DKFA 2PY3A 4BDAA 4BIBA 5DLSA 4RJ4A 5KMNA 2JZ1A 1PYEA 5DR9A 2VWBA 4D5HA 1XO2B 4DC2A 4QP9A 3AGMA 5ITAA 3R7EA 4EHGA 4XV1A 4E3CA 4FT5A 3QGWA 5C03A 2W5HA 3VS1A 1S9JA 2GNIA 2W4OA 4F1TA 4KB8A 2ITTA 2QONA 2Y4IB 4E93A 4U41A 4F63A 5E7RA 3MVHA 3ZSGA 4GIIA 5ETCA 2KULA 3GUBA 3L8SA 4KUJA 3Q2JA 4F64A 2J6MA 2XIKA 3CGOA 3PLSA 4L52A 3LJ0A 2ZV8A 4JLCA 3FWQA 4V01A 5CF8A 3LJ2A 3MN3A 3RPVA 3ZFYA 4A9TA 1VYZA 4QQCA 5HE1A 4BCJA 5J7HA 2BZKB 4NCTA 2C6EA 3FZSA 3R2YA 3WZEA 5DMZA 4S33A 4M69A 2BRMA 4HGLA 3FV8A 4ZTMA 3UPXA 4FT9A 2RFNA 1KSWA 1SZMA 3LFSA 2WGJA 4RVLA 4DE4A 2ZAZA 2ITPA 2CGWA 4FTCA 4P90A 1OITA 5J5TA 2F7XE 5CVHA 3R02A 4YNOA 4AGDA 3MY1A 2WNTA 2VTHA 2HY81 4W4YA 4YTIA 4V0GA 2C0OA 5A46A 2FSLX 4Q9ZA 1U54B 3T8OA 5G1XA 4LV5A 2ZYBA 3EB0A 3RJCA 3OUKA 2VTJA 4EOJA 4D2VA 1H4LA 4FKIA 4TWNA 3MA3A 4KIKB 4YTCA 2JY7A 3OCGA 4BDCA 4Y5HA 4BGGA 5ANIA 2YDKA 3ROYA 3KN6A 4FNZA 3FPMA 2OI4X 4YJUA 5KHWA 2R0UA 3AT2A 4M15A 1IA9A 3EN6A 2G9XA 2QQ7A 4K18A 4CV9A 4E6AA 3KVWA 4BF2A 3VBTA 3OF0A 4IFCA 3SKCA 1Q4LA 4B6LA 5AA9A 3HZTA 4BBFA 4CTCA 1R3CA 2BRNA 3KRLA 3R1SA 3V6RA 3OY3A 2XK6A 2H8HA 4FT0A 4TYIA 3KRXA 2DNAA 1MRVA 3OS3A 2FSMX 4JR3A 4AA0A 1M2RA 4O0SA 4KSQA 5FXRA 2VO3A 5ANDA 1HJPA 3ZLWA 4F65A 2HENA 3QCXA 1IFYA 4IB1A 4EWQA 4UMUA 1W8CA 3E62A 5D41A 1WGNA 4DAWA 4FIHA 5B7VA 4EH6A 5IEXA 5KMIA 2XNPA 4BI1A 3KFAA 4M14A 3IHPA 4U79A 1NY3A 2OXXA 4IAIA 4FZ7A 4AFJA 4C2VA 1H01A 5J5SA 3OXTA 5K5NA 4O81A 2PZPA 3PUPA 3TCPA 4YC6A 3EQPA 1GZKA 1SVHA 2EB2A 3WE8A 3UOJA 3PG1A 2RRUA 4D4RA 3UPZA 3G51A 3HGKA 3PPKA 1ATPE 3BCEA 2E9VA 3Q04A 3KXMA 4L42A 1H27A 5DOSA 4C35A 3SOCA 3QTSA 2C5VA 3WYXA 1J1CA 4QYFA 4C62A 2VZ6A 4GVJA 4I0SA 2GMXA 2BAJA 4WNPA 5ANGA 2CNQA 3QQFA 3DBDA 5AP3A 2WTCA 3HV7A 4BDFA 4BWKA 4AOJA 3FXXA 2EXMA 5AR8A 3GU4A 4OTDA 4EQUA 2VTOA 1OIUA 2HWOA 1YW2A 4JRNA 3VQHA 4BFMA 2XH5A 4DFLA 4EH8A 2X8IA 3BZ3A 2PVFA 3B89A 4CVAA 4O0TA 4ALVA 3EFKA 1GZ8A 3R7OA 4R78A 2WIPA 1T46A 4PMPA 5AUYA 4G5JA 4Q5HA 2EVAA 4EEVA 3GB2A 2V55A 1JSVA 4ZXTA 4ENXA 3MYGA 5EW9A 3MY0A 1OVEA 2B52A 2OF2A 3L8VA 4YLJA 3ZOSA 2GQSA 4DEIA 5EKNA 2UZUE 5HZNA 2W1IA 4FVPA 2ITOA 2RFSA 4GT4A 4ANOA 1R0EA 3LFNA 3TI1A 5M4FA 1UWHA 1OZ1A 5C8MA 1EFUB 4XRLA 2IZTA 2J7TA 1SNUA 4O21A 5FBOA 5HIEA 4ACCA 4IBMA 4YBKA 2DS1A 4I4FA 5ICPA 5CT7A 3Q2MA 5LWNA 4HW7A 3VBWA 2P55A 4O91A 2C3IB 3EQGA 3ORTA 3O7LD 2VTMA 1OKSA 2DHYA 3W2SA 1Q41A 4DA5A 1G3IA 4AGWA 1Q8WA 3EQBA 4IADA 1JKKA 1IAJA 3A7HA 4L7FA 3HVCA 3DXNA 1U54A 3FMKA 5L2QA 1LPUA 3Q9WA 4NFMA 3ZRMA 4GL9A 3FSKA 1SVGA 3C9WA 4I24A 4D4VA 2JGZA 3KY2A 4XG6A 3O51A 4F9YA 4ZSLA 4DFZE 2QHMA 2YIRA 3HX4A 5CVGA 2VO7A 2PUPA 5EI6A 4FNYA 4M69B 5BYZA 4BDHA 3E8EA 4RZWA 4GW8A 4XG4A 4UN0C 1G8SA 1PXKA 4DEHA 2XNMA 3HMMA 2OLCA 1K3AA 3EQCA 4KBCA 5DIAA 5E1EA 3FLNC 3VVHA 2UW7A 2W1HA 4AT5A 4M12A 2JDRA 3W2CA 3HMIA 4HCTA 3WZKA 4PDOA 1ZYSA 2PK9A 2ITNA 4S31A 3RAIA 4DN5A 2P3GX 1KE6A 5HU3A 2GNLA 4FICA 3GVUA 1CMKE 4CSVA 2OK1A 3BKBA 3TEIA 3RTPA 4QD6A 1VR2A 3PIXA 2KTYA 4CLIA 3HV6A 4UWCA 4YPSA 3CQEA 4RJ6A 4KA3A 4MNFA 4DF3A 4DFNA 1W7HA 2VTAA 3AGLA 1OB3A 3NDMA 3OVVA 1I44A 2CGVA 4MXYA 4MXAA 4JDKA 4BI2A 2R5TA 1JOWB 2X6EA 4GVAA 4IVBA 4JG7A 4LUDA 2BIYA 3P79A 3PSBA 4MCVA 4OAUC 3FE3A 5EDPA 3ZZEA 1ZARA 2ERZE 4EZ3A 1LEWA 5J1VA 2EXCX 3MFTA 4QRCA 4MBJA 2LGCA 4WNOA 4RT7A 5EM8A 2MGWA 4BWPA 3UMWA 4HJOA 2VAGA 4FIGA 3EFJA 3PY0A 3VC4A 4ID7A 2WTJA 3AMBA 3IPHA 4JI9A 1E9HA 4JBOA 3C5IA 3DAJA 4ZY5A 4FV2A 4HVHA 5JQ8A 4O7WA 5HBHA 2YAAA 5KBQA 2YWVA 1Q97A 1SMHA 3R73A 5LVLA 3Q53A 4H05A 4IFGA 2GHLA 5IEYA 2L4EA 2K0BX 2WAJA 4WOVA 1QPEA 4HVDA 1A48A 2PVLA 4D1SA 5FP5A 3I5ZA 1OL2A 3VS4A 3WBLA 4EOIA 2F2UA 3LM0A 4IANA 5CT0A 3VBYA 3FRIA 3FXZA 3TJDA 2A1AB 5C01A 4NM0A 4XOZA 5CSPA 2AC5A 1W98A 1ZZLA 4QMMA 5JRSA 4YP8A 4O7NA 3SD0A 3GOPA 5AAFA 2G1TA 1C7YA 1XH4A 3V5TA 2XNOA 3HKOA 3R8UA 3UNJA 4PNIA 5HTIA 4D2TA 2OJ9A 5IF1A 4QPAA 2LAVA 3UBDA 3VAPA 2F7ZE 3R7IA 3VUMA 4BDGA 3KVXA 1OIYA 4FF8A 4FNWA 3PVUA 3AT4A 2ZJWA 3MPMA 3ENHA 2BROA 5DWRA 2C6LA 3BBZA 3KXZA 3PWDA 4RQVA 2CKEA 2YCRA 3AQVA 5DR2A 5AUXA 4OUCA 4ALUA 5KBRA 4V0GB 4C4GA 4DG3E 4BDIA 5IPJA 3QZIA 3VJNA 3A7GA 4X3FA 5CEMA 4C57A 3S4QA 3DY7A 2J50A 2PSQA 2F2CB 4FC0A 4AXAA 3HP2A 4R5YA 5CXZA 4FL3A 2IZRA 3DJ5A 3PG3A 3MJ1A 5JMSA 2BRGA 3PXYA 5IA4A 5ETFA 2JAVA 1QCFA 4CCBA 3P7BA 3WZDA 3F3TA 3S2PA 4FKJA 4PL3A 2IVUA 3KREA 4FIJA 4BTMA 4W9XA 5EHLA 4L43A 2PUNA 3PE1A 5EOLA 5HG7A 2PULA 5HO6A 4C61A 4FVRA 4NL0A 2J5FA 1XR1A 3P4KA 3QA8A 4NM7A 3AMYA 4FUXA 5KMJA 3O8PA 1B6CB 4PL4A 4XNEA 3NUSA 3HUCA 4DBNA 5CAQA 4FSYA 3L9MA 3ZZWA 3GCUA 4FT3A 3TWJA 4K2RA 3RALA 5AP7A 5IA0A 2CKQA 4KBKA 2VN9A 2X7OA 4AZVA 2WB8A 3NX8A 3ZUTA 3WF9A 3IDCA 3LMHA 4AN2A 4E20A 2L4FA 3DQWA 3F3UA 3F7ZA 4FYNA 5EYKA 2A19B 3DNEA 1HOWA 2C3LA 3BLHA 3S3IA 2C0IA 3P86A 3L8XA 4YSMA 4QP6A 3JY0A 4H3QA 3F2AA 2JZ0A 4BTFA 5AV4A 2X39A 4W8EA 3IONA 2UZOA 3MBLA 4N0SA 5HCYA 3R9OA 2I0VA 4FIFA 1APME 5AAGA 2YIXA 4DHFA 2HXQA 1OKWA 2PVMA 3H30A 2PZ5A 3LJ1A 4JG6A 3FQEA 1WMKA 3CPCA 5L4QA 1WJ7A 2RKUA 3SGCA 5EI2A 3IDPA 2QODA 5KE0A 3RPSA 1ZOGA 4ERWA 5JKGA 4RJ8A 3CTQA 4WG4A 3SRVA 2FH9A 4YO6A 4QMNA 4GMYA 2W99B 4AZWA 3VF8A 5E8SA 4K8AA 5AEPA 5DT4A 4QP2A 5L2WA 5K9IA 2ESMA 3DAKA 5HLNA 3R9HA 4XV9A 4KD1A 2HWPA 1FGKA 3PPJA 1KOBA 2GNHA 2UW4A 4PV0A 3R7UA 3SX9A 4CYIA 4BCGA 1YOLA 2PMOX 4G6OA 5HG9A 5TT7A 3F92A 3P1AA 3UO5A 4S34A 3DJ7A 3ACKA 3FKLA 1NV8A 2OU7A 4KRCA 3D7ZA 3FL4A 2PZYA 5E1SA 3LFQA 3VW6A 3HA6A 1XJDA 4HCUA 5A4LA 4RIXB 3COHA 2E2BA 3PY1A 4NJ3A 3K3JA 2FSOX 4YTFA 1GIHA 4WIHA 2CKPA 4O7LA 2QOCA 3FMLA 3K5UA 3IDBA 5H3QA 2UVXA 3I6UA 4ANNA 3LPBA 4RIXA 3AC2A 4AOTA 4BDJA 3JUHA 3LQ3A 1ZAOA 3R00A 5LCJA 1PKGA 3E87A 2XBJA 5EYDA 2BALA 3DBFA 4FNXA 4ZK5A 1FPUA 3P08A 4NT4A 4GFGA 4C33A 5A4CA 2QOKA 3QZGA 5FM2A 5AUVA 4GK4A 4XCUA 3RHXA 4AA4A 1OPKA 3NUYA 3OWLA 4HNFA 4J71A 3VRYA 3FJQE 3OP5A 3RAWA 5E92A 3IGOA 4FR4A 1H1SA 3A7JA 3NNWA 5H9BA 4KIPA 3D2IA 4RLKA 2W1DA 1P2AA 2UZNA 3MTFA 3FZRA 2Y6MA 4HVIA 4RGJA 2QOLA 4LI5A 5A54A 3IW8A 3UP7A 4JDHA 3RAHA 4KKEA 4FZ6A 1NVQA 4KABA 5HBJA 5IQGA 3R28A 4GYGA 4JIKA 5A4QA 5CAPA 4EQCA 5BVWA 1YXTA 3HNGA 3RKBA 3ZU7A 2R3MA 2BVAA 3NYNA 2XNGA 1PYXA 3ORLA 3SHEA 3NAXA 3EN7A 3BBTB 2HW7A 2EJSA 1H24A 3ANRA 4JS8A 4AZEA 3OBJA 4YJOA 2WU7A 4FIEA 2ZV2A 4IE9A 5HI2A 1IASA 2W9ZB 2BTRA 4ZTRA 4YUQA 3TZ8A 1OBGA 2CGXA 2VO6A 2YM4A 5AWMA 3ZXZA 5CU4A 2ZV9A 3TIYA 3IECA 1XB2B 2WMTA 4J99A 1WIVA 4YLLA 1Q3DA 3BHTA 5DGZA 3TT0A 3VBVA 3D0EA 4IX5A 3TG1A 3PJ8A 4LMNA 1CKIA 2X6DA 3SXRA 5IQFA 3HRFA 4GS6A 3LOKA 2OIBA 4K6ZA 5I9XA 2R9SA 5TR6A 1L8TA 3EIDA 5H8EA
chains in the Genus database with same CATH superfamily
3BELA 3ZC6A 2XAOA 4GT5A 4NWMA 2Z8YM 1PF8A 4WBOA 2XEZA 2X9FA 2ZM3A 4HPUE 4TN6A 3MK6A 2G01A 2ETRA 3CCNA 4BKYA 3IKAA 2Y7JA 3LXKA 2VTIA 4IDVA 2UZEA 4G5PA 5GZ9A 3KN5A 4EH7A 4MGIE 1SNXA 3HLLA 3HAMA 4JI6M 5IQDA 4OTHA 4G3FA 4PUZA 2VTPA 4EJNA 4WUAA 1GJTA 2EO2A 2C0TA 2JDSA 4FSMA 4D1XA 4YZDA 5IQIA 3SMPA 3NRMA 3VFDA 4FTMA 4ENYA 4X3FB 2W4JA 4R7BA 4CG9A 5IUGA 3ZLSA 4EYJA 4JG8A 3UVRA 5EQTA 4RJ3A 3FZ1A 3EFWA 3FY0A 1UU3A 2ZVAA 2IW9A 2ITQA 3QGYA 5CU0A 2W17A 1JKSA 1G3NA 2ITWA 3V5PA 2C6MA 2QURA 2OO8X 3O8TA 5EHOA 4FTOA 5FTOA 1Y8GA 3RK7A 3LIJA 2W1EA 4MAOA 2WMSA 4R3RA 4BN1A 5AUZA 1QAMA 2XNNA 1ERKA 5C26A 1DGHA 4CLJA 4CFXA 5JEBA 2UV2A 5DG5A 3FYCA 4M0WA 2BHEA 4EH9A 2UZDA 1A06A 3ATSA 2R3HA 3NWLA 1ZWSA 2XJ0A 3P23A 1PJIA 1QPCA 4QP7A 2JDVA 3PYYA 4EUUA 5KX8A 5EG3A 2QZ4A 3KP0E 3UJNA 2KW0A 3JR4A 4OT6A 1NSFA 3GCSA 5EI8A 3DPKA 5AX3A 5BX0A 1FVRA 2XCHA 4E4NA 1PJKA 5DFPA 3RGPA 3D14A 3LE6A 4CMOA 5HO8A 3TQSA 5BNJA 5DPVA 3L25A 4KKHA 4DV6M 4QMWA 3C7QA 3LCKA 5CSWA 5J7BA 4DH3A 2G15A 3QLGA 4MHAA 1P5EA 5IA1A 3TUDA 3VQUA 2D7EA 5CWZA 3DOGA 3Q5IA 3KULA 1U46A 1NXKA 4IBIA 2OJJA 4LRMA 4USDA 4ITQA 5CF4A 4R3PA 4XK8F 2KNAA 2VWVA 5E8WA 3BHUA 3ZEPA 1I94M 1EH4A 2GU8A 5EM7A 5DEYA 3ORMA 3DB6A 3R9XB 4IB3A 4EC9A 3QXOA 4EUTA 2Q0BA 5EP4A 4PTGA 2CN8A 3KXGA 4IM2A 3RNYA 3NBXX 4B3TM 2GS2A 5M4IA 4GEOA 3ZLXA 5IA2A 4OBOA 3EQIA 4ZZNA 2AUHA 3MFSA 3PNYA 4QPMA 3WARA 4CQGA 2VWWA 3PY3A 4UZHA 4HLQA 3GI3A 4LJ5A 3FLWA 3QRKA 1Q3CA 4NH1A 3MDYA 4QPSA 2Z02A 4C0TA 3FDNA 4CEGA 4XG9A 4D0WA 5HU9A 2HZIA 4R6VA 1HCLA 3NR9A 5HVJA 2BRBA 4U45A 3RI1A 2VRXA 1YI6A 1URCA 4NXMM 2X2LA 3BQRA 3DBCA 3RWQA 3WF6A 3IW5A 2HZ4A 2Y20A 3DDQA 4FK3A 5EXTA 4IJEA 4M8TA 4L8MA 5KKRC 2FVDA 1GJOA 3DKCA 3EZVA 4K9YA 4O0RA 4FV3A 2VTQA 1G8AA 2Y4PA 3QBNA 3UP2A 3VUHA 2CV1A 5J9YA 4Q2AA 4FKRA 3NFFB 1OFIA 4Z9LA 3ETAA 4RFMA 4CFMA 3ML1A 4X0MA 1ZMWA 2JIVA 4AWIA 3EL7A 4PPAA 4X6RA 2C1AA 3QU0A 4FKOA 2XRWA 2ZDTA 2XK9A 4Y8DA 5F20A 2J9MA 3I60A 2AYPA 4U6RA 1N36M 5HE3A 4UYAA 4ASXA 2GTNA 4BCIA 4ZLZA 3UDZA 4MB7A 2UZWE 4DV4M 2P2IA 4ZOGA 2QLQA 4AU8A 2A98A 3V5LA 4AE6A 3MSSA 4LFAM 4D9UA 4XUFA 4AQYM 3GLIE 4RIYA 1W84A 1MRUA 1PMNA 2XK3A 3OHTA 4NXNM 1STCE 5T6KA 4I3ZA 3FUUA 2PWLA 4BIEA 2OOAA 2XLJA 3MHVC 1NJGA 3E3BX 4EORA 5IEVA 3PUFC 2AC3A 1F3MC 4FCTA 2CPKE 3W0PA 1NVMA 4IVCA 3A8WA 1J91A 4N4SA 2VTNA 2H9VA 5E8XA 3C4FA 3QRJA 2OSCA 1IY1A 1M2PA 2QOQA 2RGPA 4FBXA 2HCBA 5JQ5A 4FEXA 4F6SA 5C1QB 3QZHA 4L3JA 4F1MA 5FTNA 3HX3A 5AJQA 4QYYA 4ACMA 3D5WA 4AFEA 5LMAA 8CATA 1IXRC 4UXLA 3C4EA 5E9EA 3Q5ZA 3CQWA 5KZ0A 4DV1M 2JLDA 3CKWA 1RDQE 4UBAA 4DGNA 3FZPA 4KT0F 1JNKA 4D5KA 4CXAA 4A9SA 4TT7A 4JQEA 5L6OA 2F5QA 1JPAA 3RNIA 2XIXA 1BMKA 5ANJA 1HNWM 4X21A 3ORPA 2OBJA 1KE8A 1OMWA 3G0EA 2B9FA 4JYAM 4J96A 3UNZA 4PP7A 3W0RA 3G2FA 4C3PA 4OX9M 4NOOB 3FMJA 4D1ZA 5M09A 4NEUA 3GBZA 1G5SA 1H26A 1GAGA 3PXZA 1OI9A 3CQUA 3I7BA 4I1ZA 4BICA 4PDYA 4CMUA 3CKXA 4BY9E 4I0RA 1LUFA 5AP4A 4PDIA 4DHJA 4QHTA 4GITA 4YPDA 1F5QA 4E6QA 2VTLA 2QPAA 3O2MA 4E5AX 4CKIA 2WTVA 3BPRA 2XEPA 3HY5A 4LGMA 2EXEA 4EOLA 2UZTA 3PVBA 3R1YA 5HX6A 3OEFX 4WURA 3A4OX 3QC4A 4RVTA 5C27A 3HDMA 2LVQD 4F7NA 4O7VA 5JH6A 4XS2A 2VTSA 5HE2A 3BGPA 3UGCA 3PWYA 1NT2A 4L68A 4A4LA 3PLAE 1BLXA 4MQ1A 3HV4A 4FOCA 1Z57A 1JQHA 3BWJA 2PVJA 1G8KA 4ZJJA 5BYLA 3I0QA 4IZ7A 2BCJA 3DZQA 3QWJA 1U59A 3L29A 3AKLA 2VWUA 3V8TA 3CF0A 4ZSEA 3R9NA 1YOJA 2YM5A 3B2TA 4KRDA 4D80A 3SAYA 3UC4A 3OUNB 3GC0A 4C8BA 4D4YA 5FTMA 3I1AA 4RF1A 4MGKE 1DGBA 3FLSA 1IN4A 3PXRA 2GCDA 4FKGA 4G9RA 2VX1A 2GNFA 4AGUA 4O0YA 3A45A 3B2WA 2P2HA 5E8VA 4ZJVA 2V7OA 4ITJA 3RPYA 4FEVA 2R3LA 2QHOB 4O7SA 4IM0A 5JN2A 3AC1A 3GC7A 4M0YA 5K0XA 5KNJA 4LJ6A 2ITXA 2YAKA 4QTDA 5HNGA 5BVNA 4HYSA 3MV5A 1KYIA 4GYIA 2XSZD 5CENA 1WHCA 1H25A 3QTIA 4BCOA 1HQYE 3PZHA 4W4XA 3C0IA 4U8ZA 4PDPA 3SV0A 3CBLA 3LFCA 2JFMA 4NK9A 3AC8A 3BLAA 4KLNA 3C13A 1XH5A 1NHWC 2EA0A 3ULIA 4NZWB 3HDNA 2R3PA 4BDKA 1M7NA 2YA9A 4M3QA 4FKUA 2X0OA 3DDPA 3G6GA 4C4HA 4WD5A 5HG8A 3ZHPC 3KOZE 4YMJA 4LV7A 3C4ZA 3TDWA 3JVSA 3AFHA 4IVDA 4FEUA 3U5ZB 3LFDA 2ITYA 2PE2A 2V5QA 3DU8A 3NNVA 2OW3A 2C1BA 4EH5A 1UNGA 4RVMA 2VIIA 2IVSA 3CP9A 3PPZA 5FXSA 3TXOA 5K4JA 4Z3VA 2YFXA 5E8ZA 3V51A 3E21A 3P78A 2B54A 2QOOA 4IBEA 1MQBA 4XGIA 5EK7A 4YC3A 3GXLA 4TYHA 2VX0A 5AP0A 3EH9A 4BC6A 1HT1E 2PYWA 1F4IA 4JAJA 5AP1A 4CQEA 3W0SA 4EQMA 4ZZOA 2NRYA 4ONAA 4DTAA 3SA0A 2EU9A 3AD4A 3U54A 4DTBA 5HE0A 3RPOA 3FYJX 1FQ1B 4WSYA 4A06A 1Z5CA 4DR2M 3O50A 2QOFA 2C9OA 1MQ4A 3DA1A 1ZLTA 2YIYA 3H0YA 3G6HA 3OOMA 2WTKB 2ZB0A 3QYWA 4HOKA 3QQHA 3EMGA 4I20A 1J7LA 4U40A 4XG8A 3VHEA 3CD8A 3JYAA 2O8YA 2ITZA 4BTKA 3WF7A 1QYRA 1LEZA 4NW5A 3LZBA 3GLFE 1DI9A 3GPXA 3FI2A 2Z3XA 4IQ6A 4EK4A 1OKZA 1ZYDA 4PF4A 3D4QA 4F2LA 2PUIA 4G3OA 4LRSA 5D11A 3ZSHA 5IQHA 2ITUA 4B7HA 4DUZM 2R7IA 1IBKM 1JR3A 2DHRA 4XBUA 3GLHE 1GJSA 4DYMA 1IY0A 3MFRA 3MESA 2HZNA 4C4IA 1IXSB 5HTBA 5J95A 2P33A 3KP1E 5EM6A 1GL7A 2Z8CA 3P0MA 4BLCA 4GFOA 4TNBA 3PJCA 3VUDA 3C4WA 1V1KA 4AP7A 2PU8A 3H10A 3BGQA 3EQDA 4FTUA 4FV6A 4JBPA 1RE8A 3M11A 4L3PA 4FG8A 5L8LA 2QLUA 2QU5A 4MWIA 3QX2A 2DENA 1XWSA 2YCQA 2PVRA 1WR1B 2CE7A 3CJFA 4GIPA 3EKKA 3QRIA 4WRSA 4Y83A 4B99A 3PVWA 5HG5A 4CFUA 3AC5A 4E4LA 2BIKB 3TNIA 2BAQA 4HCVA 3PXKA 4HZSA 4MBIA 2EUFB 3QTQA 4U80A 5L8JA 2VD5A 4DEGA 3G15A 2CNUA 5GJGA 4DG0E 4DH8A 1JLUE 2UUAM 1Y57A 4ANMA 1XH8A 3GLGE 3UMXA 5JFVA 5HCXA 4FTRA 1XHAA 3GC9A 3AXWA 2WFYA 1TQPA 4JL9A 5C4LA 2WIHA 2OH4A 4AW1A 1J7KA 1WBSA 4BZDA 4IC7A 4JBVA 2WMRA 4WKQA 2JP7A 3NUPA 2QNJA 4G9CA 1GKIA 4ACGA 4CZUA 3FTDA 4LGHA 4XP3A 5H8BA 4G31A 3ZC5A 2DAEA 3NPCA 3Q6UA 3MS9A 4FV8A 5A14A 3BL7A 4G6ZA 4LFBM 3BI6A 4D2RA 2DZLA 4GMQA 4FKSA 4NW6A 1WCCA 4CFWA 2PVNA 1E94E 3A4PA 3ORIA 4RA5A 5CY3A 3CE3A 4O7RA 1H1QA 3C51A 3Q3BA 3THGA 2VNWA 2WTDA 3BHYA 4FUYA 1BL7A 4AAYA 5FP6A 3GLIA 4LOPA 3HWSA 4UMTA 4BRXA 4IX3A 2X8AA 3L8PA 4JJRA 3EIEA 4Y95A 3ZEWA 4ZS0A 3IK3A 4I0TA 5L2TA 4ZIMA 1NHGC 3RAKA 2X4FA 3KS8A 2X0PA 1YXUA 4IVAA 4MH7A 2XARA 3NVKI 1Q24A 4X7QA 3AOXA 4FSUA 4Y46A 3DK7A 2GNOA 1FOTA 1OL7A 4KWPA 2LH0A 5A4TA 4H3PA 5KHXA 5ANKA 3ZBXA 4H39A 2DKLA 4L3LA 5ITRA 4X62M 3SXFA 4ZSAA 4Q7JA 3U61A 4APCA 4FX3A 5IUHA 4GKKM 2XFTA 2W1CA 1W2FA 3FQHA 4FEQA 4NUSA 4ZTNA 2YZAA 1I09A 3UO5A 4RFZA 4MGYE 1H1WA 5IH5A 1W5TA 3Q96A 1PY5A 3FL5A 3RK9A 2E5LM 3GENA 4O27B 4Y28F 1Y6AA 2W9FB 5AX9A 3VUGA 4BHZA 3ATTA 1OECA 4LF5M 4N70A 3LXNA 5AIRA 3DK6A 3PIZA 2I0EA 4S30A 4WG3A 4USFA 5LVOA 4AS0A 5ETAA 4MWHA 5D12A 2C98A 4A4XA 3FUPA 3PP1A 3MH0A 5LMKC 1UNHA 3T15A 2WMWA 3A62A 2V62A 4NKAA 4AW0A 5I9UA 2F5SA 3CY3A 4F08A 4B7FA 4P2KA 5HVKA 3F3WA 1H1PA 4QQTA 2R3JA 4FYOA 2CHQA 4RMZA 3RCDA 3VO3A 4CMTA 3KEXA 2VWIA 2O3PA 2R2PA 4O0UA 4OTIA 1ZY5A 5DRBA 5TO8A 3VJOA 5I9YA 4IIRA 2YWPA 2ZM1A 4AXEA 5ITXA 1R39A 5LXMA 3LMGA 4AI6A 3B74A 4D9TA 4FTQA 1REJA 4FV4A 3ZRLA 1HNZM 4KNBA 1GOLA 5T68A 5EXPA 2XKFA 3PFYA 4NRWA 3C4XA 4RQKA 3CPBA 2GNGA 1WAKA 4U0IA 4I4LA 2EB3A 1ZOHA 3HUBA 4O4EA 2WMBA 3SBJA 2IZUA 3BV3A 3MJ2A 4FVQA 4I6BA 5A6NA 1WXQA 2C6TA 4CYIA 3UK6A 1V0PA 3W55A 4G4NA 3DFZA 4LJAA 4AG6A 4FTTA 4IAZA 3THBA 2WTIA 1SYKA 5HQ0A 2F5OA 4IWPA 4F7SA 2CCHA 1J5EM 3VS0A 1FMOE 3FKEA 1XMQM 2WD1A 3LW0A 5GINE 4Q9SA 4ITIA 5D7VA 1YLAA 2I40A 3FKOA 4J1RA 4MNEB 2GPHA 1XMMA 5CNOA 4FGRA 3ZDIA 1CUKA 1QAQA 2J7NA 2QBYA 1EIJA 2REIA 3F7WA 3LM5A 3OY1A 1YHWA 4X2GA 2C3KA 3FKNA 3TJCA 4AQCA 1R4GA 1JKLA 1P4FA 4HGTA 4P4CA 1XH6A 3U4UA 4KAOA 3ZFXA 2WTWA 5IDNA 4FE2A 1UU8A 3SHFA 2WQEA 4BYIA 5ITQA 3IQ7A 4FSTA 5JFSA 1N78A 1UU9A 4ANSA 2R0IA 3U6IA 5CI7A 4O2PA 3FLZA 3HKPA 5AR7A 4I5MA 3VHKA 1DV0A 1IG1A 3U9CA 1QPJA 3AC4A 4LOQA 5HO7A 2IJMA 3LKMA 5IQBA 4QMXA 5I9VA 2K9DA 4KSPA 3QQUA 4X2FA 1T45A 2GFCA 2Z7QA 4MQ2A 5F1ZA 3UIBA 4GFMA 2O0UA 2PUUA 1BX6A 1GVNA 1WVYA 4LJ7A 3R1NA 2PMNX 1X37A 4PL5A 3TTIA 2VGPA 1OUKA 5BMMA 5C9CA 3UZPA 4XOYA 4EYMA 1WVWA 2R3RA 3PRFA 1A5TA 2CLQA 1MP8A 2J5EA 4C3FA 5IZFA 3RZBA 3EOCA 2R18A 3KS4A 2JKOA 5M57A 2ETKA 3NUNA 3KB7A 4NKSA 4RFYA 4UALA 5C4KA 2X2KA 5JI2E 3NIEA 4A4OA 2QKWB 3HU2A 3H9RA 4NC6A 4ZZMA 3PA5A 5CTPA 4NRVA 2ITVA 2OXDA 1RW8A 4QTAA 2OXYA 3QWKA 5DFLA 3S1HA 2XP2A 2PVHA 3CTHA 3ZM9A 2MR9A 3WF8A 1M7QA 3D5XA 1VG5A 3MH2A 1N77A 4DEDA 3NW7A 2JY8A 4DBGB 2HYYA 4MXOA 3V6SA 3G33A 4DFYA 2UW0A 3FRHA 3C0GA 2P5TA 3C58A 3RM7A 2XK8A 3KXEC 2WHBA 4B3RM 4PTEA 4TZRA 3TNQB 2OF4A 4LFIA 3PJ1A 3QLFA 2QOBA 3FYKX 5TT7A 3TNHA 5CEOA 2AHMA 3Q8XA 3TPZA 3F61A 4AG5A 1QVRA 3D5UA 2G2HA 3F69A 3O23A 4FV5A 2LVNC 5DNYA 4OAVB 1WVXA 5JRQA 3SG8A 1FVVA 1FINA 4WBBB 1XBCA 3JAMS 3LCUA 2XZUA 3U60A 2X4ZA 2Z7SA 1XQZA 3EYHA 2BDWA 3MB6A 1GZOA 4YJVA 4EBVA 2J51A 4ERKA 3UC3A 5E8TA 5BMSA 3HYHA 3F9NA 4GU9A 3UDSA 5FQDC 3NWWA 3EN9A 3OW3A 4WRGA 1OAOC 4JR7A 5ANEA 3ELJA 4YGAA 3D7TA 1OGYA 1XXHA 2CHLA 3MGYA 5CAVA 1DGGA 3K8ZA 3DJ6A 2I1MA 2NO3A 3R0TA 3U55A 3TACA 4P17A 4Z55A 4PWNA 3QYZA 4AW4A 4FK6A 3TDVA 1ZZ2A 3KC3A 4GV1A 2OZAA 4I21A 4TY1A 4A9YA 4CKJA 2WO6A 1DS5A 5BR8M 3R8VA 2GQRA 3ZMMA 2ZTCA 3MA6A 1Y91A 4BCPA 2W05A 4O7TA 1XKKA 4JT3A 2CHVA 3W67A 2N35A 3KK9A 3PXFA 2JKQA 2QG5A 4EOMA 3MW1A 2IW8A 3A60A 3SYKA 4C2WA 2CV0A 4YJNA 2L6OA 4PPCA 4BI0A 4O7ZA 3H4MA 1YI3A 4FRFA 3ZH9B 5M51A 3V5JA 1YDTE 1JB0F 2W5AA 5CS6A 5H2UA 4ZJIA 3F6XA 2Y9QA 3G9NA 2L7HA 4IB0A 2Q83A 5HIBA 1OIRA 2QCSA 2B53A 3D2KA 2JDTA 4LGGA 4OT5A 2HK5A 5G6VA 5AM6A 4DR1M 4IACA 2JIIA 5EM5A 3MB7A 4B8LA 5JFWA 3PSDA 4U5JA 3ODZX 3OXZA 4MVFA 2WOTA 2B9HA 5IQEA 3QUEA 1XBAA 2X9EA 3BWFA 3V3VA 3ZSIA 3KMWA 5M44A 2VX3A 5JK3A 2PHKA 3UNKA 3SC3A 3OROA 5B0XA 5CEQA 4QMSA 5BVDA 2ZMDA 3QYBA 2JFLA 4NSTA 4FL2A 1JBPE 4A3VB 1ZMVA 1J09A 4I22A 3HMNA 4ACHA 4RIWB 2DAMA 3P5KA 2V7AA 4G6NA 1IBMM 3LHJA 4J53A 4QMZA 4BIDA 2QCUA 3R21A 4DV7M 4I6QA 5CNNA 4YSJA 4II5A 3K9PA 4ANQA 2DWBA 4DGOA 5GJFA 4ZY4A 3UVPA 1Z5AA 3FHIA 2C3JA 4AAAA 4EHVA 4F09A 1L2BA 1R0PA 3BEGA 4CFNA 4EKKA 1WBVA 1YXVA 3QUPA 5FD2A 3IOPA 3ZCBB 3K2LA 2OJFE 4LQMA 3VRZA 2XSZA 4RJ5A 2R64A 2UXDM 5HX8A 2JY5A 4G2FA 4LL0A 1YWVA 2XVDA 5EOBA 3R83A 1NW1A 1VLRA 2WEIA 3BYMA 3GQLA 2DAGA 5CEKA 4MUQA 1AUAA 3TZ9A 2OG8A 3MI9A 4UY9A 5JFXA 3LMIA 3SLSA 4FSQA 3FI3A 1TDHA 1WBTA 4FV9A 2XUUA 3GRYA 1GLNA 3NUAA 4EH2A 3AC3A 4IX4A 3QX4A 3T1HM 3M0EA 3CIKA 1UVRA 2PPQA 5EXSA 3T3UA 3ZO3A 3U87A 4R1YA 2QHNA 3ZM4A 2PVKA 4ZMEA 4NU1A 1VQ1A 4WNKA 3GU6A 4L44A 2UZLA 5FDXA 1UM8A 2OPFA 4QMPA 3VKGA 3DFCB 4N6YA 2F49A 3S00A 1QUSA 3PA3A 4GG5A 1JR3D 3NYVA 5CEPA 3DT1A 2OGVA 2EKKA 3B7ZA 4N57A 4IAYA 1O6YA 3CXWA 1CTPE 4ZSJA 2W5BA 3LCOA 4XRJA 3LCVB 7CATA 4R71A 1VYWA 3L9PA 4ACDA 4C59A 5JGAA 2X8EA 3FUTA 2WQBA 4RRVA 4C4JA 5AR3A 4I8OA 3L1SA 2YN8A 2QI8A 5LOHA 1QZEA 3BE9A 3ULZA 5IMEA 5L6PA 3DFAA 3VNTA 3I4YA 5DNRA 3OTVA 1KE9A 4OVZB 5LQFA 2R3QA 3UO4A 4QNAA 2I7PA 1ZYLA 4EOQA 3BGZA 3L9NA 4PDSA 4AOIA 2XKEA 2XYUA 4O1OA 2CJMA 1FBNA 4EOPA 2OOBA 3U6DA 5AM7A 4U43A 3AG9A 3HZJA 4NYEA 2GQGA 4R77A 2ZBKB 5ITXE 2GNJA 3IGGA 3O7LB 3HAVA 1W83A 5LMKA 1MUOA 4O84A 3QCQA 4FKPA 1YXXA 4EH4A 2W1FA 3F66A 3RE8A 2WELA 3EKNA 4F0GA 4KBAA 3DKGA 4RSSA 1ZAEA 3E92A 4RX8A 2Z7LA 5IH4A 5JZJA 3V04A 1FMKA 5CALA 5GIPE 4UWYA 3PNVA 2XANA 2XJ1A 2IN6A 4EWHA 3M1SA 4O1PA 1KV1A 3R1QA 2XNEA 4LM5A 5EW8A 1J7UA 4PMMA 4R3CA 1DO2A 5EXXA 2F9GA 3NW6A 3SQQA 3LLAA 2C6IA 3R22A 2XEYA 1ZYCA 4RG0A 1PXJA 5FRIA 1T43A 4B9DA 3MPTA 4DGLC 1GIIA 2UZVA 5DEWA 3IS5A 3KCKA 3HJQA 2YM6A 2HKJA 1TH2A 2RGHA 2LBCA 4DR4M 2J0JA 3ZYAA 4NM3A 5M56A 4EC8A 2A27A 2GSFA 3CJGA 3MY5A 2PVYA 2WEVA 4NFNA 4CFFA 3AKJA 2VO0A 3JPVA 3QC9A 5FEQA 3W0QA 3L26A 3F2NA 4H1MA 4V01A 4ZAUA 1J7IA 4XBRA 5CZHA 5I5ZA 4DG2E 4FTJA 4OW8A 4V04A 1Y6BA 4RWJA 5H8GA 3W8QA 5HHWA 2H5XA 5CU2A 4W9WA 4FD2A 3B7QA 2J5YA 2ZTDA 4FWHA 4UEUA 2B3TA 1WGLA 2J90A 4MGZE 3KRWA 1DAYA 4P7EA 1LR4A 5JGBA 4DCAA 3I7CA 4P16A 3T38A 1RQQA 2XKDA 4KIQA 3R63A 4W4VA 2C5YA 4OW0A 4XV3A 5HNIX 1URWA 3OXIA 3NZ0A 4BBMA 4CYJA 3CEKA 3EQRA 4EOKA 4L8RC 4LG2A 5DR6A 4AT3A 2H34A 2YQZA 5FBNC 5LMUM 2XM8A 3SW4A 4YU2A 3S95A 4I93A 2RL5A 2O25A 3WOWA 4QOZC 3SW7A 3GQIA 3VUTA 2O5KA 4YJQA 1W2DA 4BZOA 4UMRA 4FTNA 5CF6A 4TKSA 1SG9A 3I4BA 4GC5A 3DOAA 3GEQA 3LQRA 3II5A 4LYNA 4YJRA 5AV3A 4AZTA 3TUCA 5IQCA 4RIOA 4IX6A 5FTKA 4G4RA 1L8QA 1MX0A 2LVAA 2WMAA 5HBEA 3V5WA 3BU6A 4NJDA 3BOSA 3NYOA 3A7FA 3U6PA 3FI8A 2JA2A 5HD7A 3ZQJA 2HZ0A 5FTLA 4XJ0A 3QHRA 2FE8A 3VBQA 1MJGM 1WFCA 4DV2M 3OD6X 3R8MA 1UU7A 1CKPA 1H1RA 3QD0A 5D10A 4O86A 1Q3WA 1DGFA 2QP9X 4CNHA 4K77A 3CGFA 4FKLA 4CT2A 4J8NA 2KRUA 2Y8OA 4N6ZA 3BLRA 1H07A 5J79A 5CSVA 5F3WA 4ITHA 2R44A 4NIFB 2L7IA 3QAUA 1AQ1A 3Q32A 4E7WA 4G3DA 2IZSA 4JI0M 3FY2A 3LAUA 4HGSA 4M7IA 4LRTA 5TF9A 3SATA 2LVOC 1OIQA 2JBPA 4JOAA 4K11A 3UIUA 4MTAA 1PGYA 3J81S 2BR1A 4ZSGA 3TIZA 1OPJA 1QMZA 2YISA 2ERCA 4M13A 5DI1A 1LV7A 1OQYA 3E46A 2C4GA 2PZRA 2XIYA 2Y21A 1PMVA 3BU5A 3GU5A 3N51A 5DBXA 4MGHA 2HY0A 2ONLC 5EYCA 5E91A 4E4XA 5KMIA 2X1NA 3FLQA 5ACKA 4UMQA 4B4LA 5IH6A 5EQPA 4CIZA 3F82A 3KULB 3LCSA 2BNKA 4YY3M 4P5ZA 3EJ1A 2YDIA 3MIYA