2HAKA

Catalytic and ubiqutin-associated domains of mark1/par-1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
309
Chain Sequence
PHIGNYRLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVHRDLKAENLLLDGDMNIKIADFGFSNEFTVGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural variations in the catalytic and ubiquitin-associated domains of microtubule-associated protein/microtubule affinity regulating kinase (MARK) 1 and MARK2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
molecule keywords Serine/threonine-protein kinase MARK1
total genus 100
structure length 309
sequence length 317
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2hakA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2hakA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2hakA01
2OO8X 2VO7A 4D1XA 2W06A 3MIAA 4IC7A 5HE1A 4F0FA 4IDVA 3LFNA 3L8SA 1O6KA 3LFSA 3P23A 5EM8A 4TKSA 2XBAA 5EG3A 3ORNA 3R2BA 1WHCA 3DNEA 4TN6A 1Q8WA 4DGGA 4D0WA 5AIRA 5GINE 4HEOA 4C37A 4FG9A 2A19B 2C6IA 4TYIA 5DWRA 2O64A 4DEHA 3OCGA 4S33A 4IB5A 4PTEA 4K77A 4Q5HA 3FSFA 4QTBA 2UUEA 3MDYA 4LUDA 4J53A 4QYEA 3UIMA 3OWJA 3IO7A 4BCKA 3EWHA 4RJ8A 1V92A 4LI5A 4FTCA 1XO2B 2QODA 4K9YA 3WZUA 4RIYB 4QP2A 4ZOGA 3QRTA 2GMXA 2J6MA 5HICA 1HT1E 1H24A 2PZ5A 1OIUA 2EJSA 4JRVA 3D83A 4FUXA 4TPTA 4N57A 4C57A 2HCKA 4KAOA 2BWBA 4DITA 4R71A 3CQEA 2Q0NA 4WSYA 2C0TA 2IVUA 3NLBA 4NJDA 5J79A 3SRVA 3FWQA 3Q4CA 4IZAA 4B9DA 5G6VA 4O7WA 2WZJA 3NUPA 3ZS5A 4RIWA 3WF5A 3FKNA 1PYXA 2YAKA 3EN5A 5AP0A 4AA5A 4KIPA 5I0BA 4O27B 2PE1A 3OS3A 3PPKA 4GU6A 4OTPA 4AGWA 3AMAA 2QG5A 1ZY4A 5IG1A 2XJ1A 5IU2A 2PULA 4PX6A 3RALA 4IBMA 5CNOA 5FEQA 3KRJA 1ZYCA 4AW5A 4D5KA 3AMBA 4BRXA 2XYNA 3AXWA 3COMA 1ZRZA 5HVYA 3GCSA 1H1SA 3FV8A 2VTIA 3I60A 3PDTA 2FSOX 5AEPA 4HYIA 4QPAA 4AT3A 2CNQA 3ZO3A 5EHLA 5CANA 3SAYA 2XRUA 3LJ0A 3Q5IA 4UN0C 5AP5A 1YVJA 4CLJA 3LXPA 3PXYA 4YHTA 2DAKA 1Q61A 3E46A 4XOZA 4RJ4A 2OH4A 5M4UA 1YOLA 3PXZA 4QMWA 4RJ5A 3EQHA 4HZRA 3EFLA 4H58A 4R1YA 3I7CA 4ZY5A 5BNJA 5DMZA 1PKDA 3QTXA 3NNWA 5DG5A 5BUEA 2ETRA 3CTHA 1H1PA 5DN3A 4FV2A 1ERKA 1GJOA 1YW2A 2BFYA 2QOHA 1GNGA 2PMOX 4XLIA 4ACCA 4BBMA 3BU5A 2L4EA 4I21A 4ERWA 5IH5A 1IA9A 3FYKX 2QG7A 1FVRA 3M42A 3WZKA 4JAIA 2RFEA 4G3EA 1YI6A 4J95A 4AZVA 1BYGA 1FQ1B 5FD2A 1J7UA 3MB7A 3UVPA 4FV6A 2CWBA 3VBTA 3R04A 2VD5A 5HBJA 3TDVA 3QU0A 2G3QA 1LPUA 2V7OA 3VRYA 4L45A 1FOTA 3MVLA 4FV4A 3CCNA 5FGKA 3ANRA 3ZUVA 3R9RA 2XNMA 2BKZA 1MP8A 3EQBA 4RLKA 3W8QA 5LQFA 2G01A 3EZVA 4FEQA 4MXAA 3QUEA 3PRFA 4V05A 2JIIA 3KRLA 1JKLA 4FV1A 1O6LA 2KTYA 4UYAA 3UMWA 5K5NA 2ESMA 4JDIA 4Z16A 2QSFX 2V55A 2HENA 3O50A 5LWNA 5I4NA 3TG1A 5F9EA 4NIFB 1VYZA 4PMPA 2PMNX 1QPJA 3R7GA 3A62A 4TYHB 2BUJA 5EQEA 4NYEA 4I0SA 2IVTA 4HNIA 3MFSA 3ZDIA 3ZFYA 3ZO4A 5KX8A 5AR4A 3IGOA 4L67A 5FRIA 4GH2A 4CSVA 4BVUA 4EJNA 1PMNA 4F1OA 2CDZA 3ZONA 5AR2A 2W1ZA 2UW6A 1M7QA 2OW3A 2WMWA 3FZRA 2PU8A 3QTZA 1U5RA 3CKWA 3ETAA 4X3FA 4LL0A 1DV0A 3FUPA 3DK6A 5CQWA 5AR7A 4CKIA 1L8TA 2NNWB 2PMIA 5H8EA 4X3FC 5HBHA 2BAQA 4AGDA 1VDLA 3GLFE 1TQIA 2F2CB 4M12A 1SYKA 4O0YA 4YJOA 2W17A 2E9UA 4RSSA 3ZHPC 2LVOC 2YM3A 2IVSA 3MY0A 4TRLA 3O7LB 2UZEA 4WRGA 1JLUE 1OPKA 4ZZOA 2C3KA 4QP1A 3CS9A 1KSWA 2FSLX 3GGFA 3ACJA 3MY1A 4KIQA 5IA5A 1R39A 2RRUA 2XKEA 3ZO1A 4QMNA 3MY5A 4MNEB 3LFAA 3N4TA 3PIYA 4K0YA 1C7YA 2MR9A 2DAMA 3FMHA 2YDKA 4IB0A 4M7IA 3WYYA 3KXNA 4ANQA 3UIUA 1Y57A 2JKOA 2IZUA 4KKEA 3OFMA 3P7CA 2ZTCA 4Y72A 1DAYA 1G3NA 2P4IA 3CTJA 4EOMA 1Q8YA 4D4RA 1WVWA 3BE2A 4UY9A 4EH4A 2KULA 1B39A 4GIIA 4R7HA 2WEIA 4IFCA 4K6ZA 3MMPA 1M2PA 3QFVA 1Y6BA 2WPAA 4G3FA 3EMGA 4KIOA 4RQKA 4U9AA 2VWIA 5EKOA 5JT2A 2CMWA 5CX9A 5CI7A 4C3PA 5CF5A 3DDPA 4GRBA 3ENHA 3ORLA 4OTFA 4BDBA 4BZNA 1VJYA 3F9NA 3TACA 3G9NA 3RWQA 4RIOA 4EYJA 2ITTA 3BHHA 4C4IA 3ZRMA 4YHJA 4J8NA 3LIJA 2QU5A 3OWKA 4HOKA 3NYXA 3LFBA 5BVOA 4PDOA 3SLSA 3F5XA 1OKZA 1ZYJA 2JLDA 2W7XA 4OT5A 3VF9A 3RVGA 2J5EA 3LE6A 4D2TA 2R3RA 2GS2A 3C0IA 4FKWA 5EK7A 3O23A 1LP4A 4EH3A 4U81A 4FZDB 4HPTE 3EQGA 3LXNA 1JR3E 3ZRLA 4LGGA 5F1ZA 5M53A 4O83A 3CGOA 3LFFA 3ROYA 2CGWA 2X7GA 1IAHA 3MB6A 3EQIA 4EOPA 3QYZA 4S34A 3ROCA 2YIQA 3LHJA 2XEZA 4OR5A 5CT7A 4RX5A 1YDRE 3UPZA 3IK3A 4AP7A 3C4FA 4ZY6A 1M52A 3KULB 3RAWA 4MX9A 4HVGA 4PNIA 5AR5A 4Q9SA 3LM0A 4I4FA 2ERZE 2CPKE 3V01A 3MN3A 2LBCA 1MN3A 1M7NA 4PQNA 5JGBA 3EJ1A 3UQCA 4F9CA 3BLRA 3HNGA 3MVJA 2G1TA 4QP3A 3Q9WA 4U41A 3R8UA 4UMPA 4L6QA 3H9RA 2XK4A 3U54A 4BDDA 1PXPA 3TJCA 3BZ3A 4WG4A 3VS5A 5ETFA 3OCTA 4F08A 4EJ7A 2CGUA 2J0KA 2OBJA 3H30A 5GZ9A 2PUPA 3W2SA 5EKNA 2WMUA 3DZQA 4M0YA 4JBPA 2VAGA 4OTRA 1BLXA 5EHOA 2OIDA 4BI1A 4L43A 3LXLA 2WMAA 4FL3A 3UNKA 3QGWA 5HIEA 2Z7LA 2BZJA 3EN9A 4L8MA 2JITA 4IXPA 5C4LA 2VUWA 4PUZA 4G6LA 3PXFA 2PHKA 3UPXA 5E1SA 4FIHA 4Q5EA 4USDA 2R7BA 4A4OA 2IN6A 5LVLA 1MRYA 2C6LA 4QTDA 2Y4PA 4CLIA 2XIZA 1QPEA 3DS6A 2BVAA 2B4SB 1NVSA 1LEZA 2Z60A 4FTLA 2NO3A 3IECA 1YRPA 4G3DA 4I5PA 4IACA 2PVYA 3QWJA 4ZTRA 5JQ8A 4ALUA 2SRCA 4HJOA 5ANKA 3A8XA 4J97A 4EC9A 3TNWA 3E21A 2X7OA 4L68A 4ANNA 4QTEA 5M4CA 2OSCA 2UZUE 2OXYA 4I23A 4A9RA 5CWZA 4C62A 4QNYA 3L8VA 4UXLA 3BYUA 5EM6A 5HZNA 1J7LA 1JSUA 2BPMA 2VX3A 3R1NA 5HNBA 3R7UA 3IW4A 3LFCA 2OICA 4Q2AA 5IUHA 2J0JA 4I41A 4WNMA 5E8WA 3RPSA 2OZAB 4NFMA 3TZ8A 1GIHA 2Y6MA 2OO9A 3R1SA 3FMLA 1YXUA 2WMVA 2QOFA 1OL6A 3IPHA 2JUJA 2GFSA 2W1FA 4TYJA 4AZEA 2XNGA 5HLNA 4YGAA 1UWHA 3EN7A 1DI8A 3E64A 1GZNA 2HOGA 3MFRA 5HEZA 2XVDA 2ITOA 3EB0A 4FV9A 3R8VA 3UNZA 4C4JA 4CZUA 4MWHA 5JMSA 2HW7A 3R8ZA 2RF9A 4M14A 3KMWA 4Z9LA 1A06A 5J95A 1H8FA 5I5ZA 2UW0A 5CAPA 1W0XC 4DBXA 5EM5A 4CXAA 3B8RA 4QMMA 1PGYA 3A7IA 4MBLA 3PY1A 5KO1A 3S4QA 4JS8A 4MVFA 3AT4A 4IAKA 4AQCA 2GPHA 5HE3A 4C4HA 1H0WA 2JBPA 3PYYA 2VZ6A 4MNFA 1EFUB 4XG8A 4UALA 3RKBA 4QYGA 2KNZA 3TV7A 5BVDA 1T46A 3W55A 4F1IA 2P55A 3ZUUA 2QO7A 4KKHA 2YABA 2UW3A 4G16A 3VS6A 4XV9A 5BQ0A 3NEWA 2BILB 2X6DA 4O2PA 2YDIA 1E94E 2HXLA 3D7ZA 3O96A 2BRGA 3Q9ZA 3D5WA 2C6EA 4DGOA 2BRHA 3UJGA 1KE5A 4O7RA 1OECA 3GCPA 4JRNA 3ZEPA 4WRSA 3M1SA 1G41A 4G6OA 4O0VA 5ETCA 3CY2A 1UFZA 3KXXA 2J50A 4FOCA 4O6EA 1UNHA 3K3JA 2R3PA 3FI3A 5HIDA 3RGFA 3D94A 2QC6A 3JXWA 5EOLA 5AM7A 4FZ7A 5J9LA 2CN5A 5AADA 2RFDA 2X2LA 4I6FA 5FQDC 4D58A 4DTAA 2JDRA 5AUUA 2W96B 3N4VA 4FR4A 4DC2A 1U54A 5IEYA 2YWVA 3RMFA 1OGUA 1PXMA 4FKPA 4L9IA 4WBOA 4YLKA 2O65A 4QQCA 5KMOA 2VNYA 3LCTA 4GG7A 3TL8A 4DEIA 4YZCA 3WZEA 1IFYA 4PNKA 1WMKA 4FYNA 3Q60A 3AD5A 5LVOA 3BBZA 3K5VA 4EI4A 3NYOA 4U45A 2CGXA 4A06A 2OLCA 4F1MA 5BPYA 4ZEGA 4IWDA 5H8GA 3QWKA 3UVRA 3EZRA 4YPSA 1KV1A 3OOMA 4AWIA 4EYMA 5KBQA 4OAUC 2QI8A 2E9NA 3R7IA 3QQUA 3DXPA 2QR8A 2ZMDA 3U9CA 4DGNA 4WO5A 5CS6A 4RFMA 3O8PA 1OB3A 3LW0A 3F69A 4FX3A 3OT8A 3MA6A 4D28A 2C6OA 1XH9A 2F57A 2PL0A 4FZ6A 2JY6B 4XG4A 2MGWA 1CSNA 2FYSA 3ANQA 3O71A 4XEYA 1CKPA 4DAWA 1OQYA 1PXNA 4NUSA 2YCRA 3WE8A 4MH7A 3IW8A 2IW9A 3A7FA 3HRBA 3R83A 5IQAA 3R73A 3ZUTA 4YJTA 4YZNA 2W9ZB 2R3LA 4I92A 2AC5A 4GT5A 2JBOA 3VC4A 3TDWA 3HYHA 3E5AA 5FTQA 5HCYA 3G90X 2PVLA 3B2TA 2XM9A 1LR4A 4J1RA 1JAMA 2XMYA 1H28A 3HMOA 3OD6X 4L42A 4W4WA 4HW7A 2WU7A 5D7AA 3V5QA 3VS2A 4RJ7A 3DXQA 3UOJA 4D9TA 1WJ7A 2EXMA 2JIVA 3QKLA 4GVJA 4P90A 1T6OA 4FZAB 3P9JA 3QD4A 5H2UA 5DYJA 1Q8ZA 5C8KA 3CR0A 4PPAA 4E4XA 5J87A 4XG6A 4YSJA 3PVGA 3R7EA 4FEXA 4IWQA 4FV0A 4YU2A 2YCSA 3FKLA 3QKMA 3V6RA 4GEWA 4IVBA 3W18A 1R0PA 5DOSA 4G6NA 4J99A 4BDIA 1B38A 5AX9A 2HZIA 2YM8A 2ZJWA 3PY0A 2ZDUA 5F20A 1U5QA 5BVWA 1MRUA 2BR1A 2OIBA 3C13A 3QGYA 4XP0A 2R3JA 3I4BA 4OTIA 4MD8E 3OG7A 4RRVA 4YJUA 4CEGA 4CV9A 2Z7SA 3R7OA 1H25A 4FT9A 1REJA 4JT3A 5ETAA 1UKIA 4D2PA 3CIKA 3KRRA 3LQ8A 3VAPA 5CEQA 1OBGA 1JBPE 2WQOA 4H36A 4ZS0A 3DTWA 5AMNA 2XK3A 4JAJA 2IO6A 5AR3A 2JAMA 3BYSA 3BGQA 4Y46A 4TNDA 3MTLA 5CSWA 2W5BA 4KNBA 5JH6A 2RFSA 3F3VA 4MCVA 5L2WA 5CEMA 3GP0A 4R5SA 4YMJA 5D11A 1GOLA 4HNFA 2I0YA 3BBWA 3ZSGA 3F5UA 3K9OA 5KHWA 2ONLA 2XKCA 5DT4A 3S3IA 2UVZA 4NTSA 1CDKA 4RZWA 5B7VA 3GU7A 2EU9A 2P0CA 2ZB0A 4IZYA 5CZIA 3ZRKA 4ENXA 3M11A 2OWBA 4NW6A 5LCKA 5EI2A 4BCIA 5LWMA 2QOOA 3A2CA 3HA8A 2BWEA 3I5ZA 2CNUA 2JP7A 2OOAA 3HL7A 4EZ7A 4F09A 1NA7A 4ZSAA 3G0EA 1FINA 2J4ZA 4LV5A 4NM7A 3NX8A 3BX5A 4WNPA 4RIWB 4HYUA 2VWBA 4I4EA 2JY7A 4XLVA 2R64A 4IZ5A 2I7QA 3DBQA 5A4EA 4EOIA 4TYEA 4FICA 3UDBA 1BKXA 1WBWA 3UP7A 2WOTA 2QD9A 4QRCA 3SXFA 1P14A 2JEDA 3QQLA 4HPUE 3WIGA 4NJ3A 2OJ9A 2F7EE 3ZLSA 1XQZA 3DJ5A 2BFXA 3ZC6A 3QZGA 3LJ2A 4CCUA 4FE2A 4IAIA 5GZ8A 5JN2A 3OBGA 3UZRA 3ZO2A 4DEEA 1WGNA 3NUAA 2ZOQA 3N9XA 4D1ZA 5AM6A 4DF3A 4QTCA 2OFVA 3VIDA 1FVTA 3P5KA 1UU8A 3QAME 4HCTA 1MQBA 5DRDA 2VTRA 4M66A 3VF8A 2X0GA 4BBFA 4QPSA 3NRMA 3O17A 2C47A 2F9GA 4YJRA 2Y9QA 4BBEA 4ERKA 3CKXA 1JQHA 4CQGA 4W4YA 4FIGA 2BHHA 5ETIA 5I9VA 3ZZWA 3GFEA 5L4QA 2QOKA 2GTNA 4J71A 2NRUA 5CF4A 2CKQA 2C0OA 2QOCA 3PIZA 4M8TA 5LVNA 2W1GA 5FDPA 3FQSA 2IVVA 4BDEA 3QQGA 3LFQA 3Q4ZA 4DH7A 4CTBA 3C7QA 3Q4TA 5K5XA 2JDVA 2W1DA 3CPCA 1GY3A 1B6CB 3NYVA 4CYJA 2XS0A 3MJ1A 2QKRA 3Q96A 4BC6A 1ND4A 4NCTC 3QXOA 4KBAA 5IA4A 2ZV9A 5CXZA 5M57A 1IRKA 2JD5A 2ZDTA 3QXPA 3KXGA 3IOPA 4D55A 3AC3A 2IZTA 4XP3A 2PE2A 3OMVA 3MA3A 3PJCA 3QRUA 2O5KA 2KHHA 3F3WA 4FIFA 4IWOA 4JX3A 3CPBA 3POZA 4GL9A 4L3JA 5E8VA 2OFUA 5C8MA 4IE9A 3R7YA 4O7ZA 4HCVA 2OI4X 2WMRA 3SKCA 1AD5A 2WKMA 3P78A 4RFYA 5EDQA 4DH8A 4YSMA 4QP8A 3R9HA 2YIYA 2QQ7A 2P2IA 3Q4UA 2JY8A 3P7BA 3RNYA 2BKKA 2C4GA 4CMTA 5EI6A 2OXXA 4PWNA 3EKKA 3NNUA 2B1PA 2NPQA 4BCQA 3KB7A 5JRSA 2NP8A 4UMUA 4CTCA 5ICPA 3M2WA 1Q8TA 1ZYDA 1OKYA 2VWZA 1HT2E 4FKTA 3ZMMA 1UU3A 4YZBA 3MSSA 4OBPA 2Z7QA 2VTLA 3P08A 4OUCA 5DH3A 3ZLXA 5HTIA 4AN9A 2GHLA 4FSYA 2BRNA 5CQUA 1APME 2WFYA 4L7SA 2QLUA 3L9PA 5HIBA 4AT4A 4F9YA 5GJFA 3NW5A 5I9XA 4EOOA 4QOXA 4EHZA 4PV0A 4M68A 4F7JA 4KA3A 5JEBA 3KFAA 3TUCA 5DEYA 2PVFA 4NH1A 1U54B 4MQ1A 4GUBA 4C38A 2XA4A 4HYSA 1UWJA 3VRZA 5I3OA 3FRIA 2FO0A 4JG7A 4RWKA 3ULZA 2G15A 3DU8A 4QMSA 2YWPA 4G2FA 1PF8A 1OL5A 2BALA 3E62A 3D7TB 4FMQA 4BKYA 5L3AA 3IW6A 4M3QA 5HU3A 2BDFA 3RPVA 1Q5KA 2GTMA 3L1SA 2DYLA 2BIKB 2OF4A 1YOJA 3GT8A 4UMQA 1ZYSA 3NWWA 2F2UA 3O8UA 4AN2A 4EK6A 4Z3VA 3TKUA 4B6LA 3ORKA 1NT2A 1H1QA 4J52A 4YJQA 4ZSGA 2REIA 2EUFB 4JOAA 1J7IA 4O7SA 5C26A 2HZNA 3VJNA 1OMWA 4EH5A 2X4FA 2DENA 2ZV2A 3DB8A 5TE0A 1VEKA 3A4OX 1RQQA 3WF6A 5J8IA 2WHBA 4FK6A 5HLWA 2PYWA 3NUSA 4FT5A 4QT1A 3W10A 3C0HA 3MS9A 4I94A 4DG0E 1MQ4A 4AGCA 4RX7A 4F9BA 3ACKA 2JGZA 4MHAA 2CCHA 2WTKC 3FC1X 3IW5A 1OUKA 3OC1A 2EKKA 5TT7A 4GG5A 5I9WA 5KMMA 2E9PA 3R8PA 5M07A 3LM5A 1PMEA 3O7LD 3ET7A 1OL7A 2WQBA 4F0IA 1YLAA 1OVEA 3E63A 2YIWA 3MPMA 3AC1A 3QA8A 3SOAA 3NIZA 3T3UA 3TT0A 3VBVA 4R3CA 3TM0A 3ID6C 4NT4A 3Q3BA 4TW9A 5KZ0A 2JKQA 2G9XA 4S30A 3ORZA 2LGCA 5AP6A 2LTUA 4U80A 2A2AA 3COHA 3GQLA 2C5VA 5KE0A 4ZSJA 4K8AA 3PJ1A 3FLSA 4AZSA 5D41A 3SDJA 3H9OA 4BDJA 4II5A 2VTTA 1XH8A 1W98A 1P2AA 4FGBA 4FV5A 3V8SA 4O7NA 3ATSA 4X2JA 1JSVA 4F4PA 4Y8DA 4QP6A 2HY81 1VQ1A 2FUMA 1BL6A 3SW7A 4EQCA 2GNIA 3DBCA 3MFUA 1FMOE 1ZZ2A 4FIJA 4KRCA 4Y5HA 4ALVA 3ELJA 1OKWA 1OAIA 3C4XA 2B53A 2XNPA 3KXHA 4E4MA 4G34A 2BDWA 3C0GA 5E8ZA 1H26A 4V04A 4GFOA 4O82A 4YURA 5J5TA 4LQMA 3HECA 5HI2A 3G0FA 2H8HA 4FKRA 3TUDA 3F92A 2JDSA 3K3IA 1A5TA 1P4FA 3QD3A 2WTKB 3K9PA 3DFCB 4WP2A 3FY0A 4BYJA 2XIXA 3VS1A 3IGGA 5JFVA 1IA8A 1GO5A 2XCHA 5DGZA 4DN5A 3QC9A 2ZV8A 4O7VA 4ZJJA 2W4OA 1BX6A 1WFCA 3QTRA 4NKAA 5CVFA 4H3PA 2MJ5B 4X3JA 3RZFA 5CYIA 5DEWA 4RJ3A 1Q3DA 4CZYB 3II5A 4F63A 2GNLA 3QRIA 4MBJA 4GIHA 1YXSA 2VV9A 2BAKA 3DY7A 4XG7A 5BYZA 4CT2A 4E7WA 4V01A 3KEXA 4D2WA 3FEGA 4YTHA 1H08A 5BVKA 4F9WA 3FZPA 2QNJA 4FKOA 2PSQA 3QTIA 4A9TA 1H27A 4D2RA 4ZLYA 4U5JA 5ITAA 3TI1A 4FIEA 3T8OA 4ZTLA 1W84A 1YWNA 4QNAA 4CKRA 4FV7A 4O0SA 2J0LA 2G2HA 5K4IA 4DINA 2EWAA 4EORA 5L2SA 2GNJA 4BY9E 2WMTA 4W8DA 2JZ0A 2CCIA 4QQJA 4FBXA 2VN9A 3H4JA 1OZ1A 3ZC5A 5BYLA 4RMZA 2YERA 4I93A 4PL3A 1TVOA 2QOIA 3KULA 5L6PA 5J1VA 2QKWB 3UO5A 3BQRA 3TTIA 3FDNA 4R7BA 3PG1A 4XP2A 3LCUA 4MKCA 4HGLA 2NRYA 2VTHA 2WELA 3OEZA 4RWLA 2BZIB 2ZTDA 5EYCA 1A9UA 4YPDA 4BCGA 3R1QA 5KHXA 3L8PA 4KUJA 3IDBA 3A7GA 3C4EA 5J7HA 5GIPE 4QMVA 4A9YA 3DKCA 2C5OA 3R01A 4JQEA 3BWFA 2HWJA 2XRWA 3OVVA 5E8SA 5IH6A 3LKMA 5EQYA 3MI9A 1WAKA 3CBLA 3SG9A 5FBNC 1P4OA 3MJ2A 2ACXA 2PVKA 3A99A 2BZHB 4JG8A 1E9HA 4JXFA 2HY0A 2GSFA 2V7AA 4RBLA 3DLZA 1PXOA 3MYGA 2YIRA 4MXZA 4P2KA 3MH1A 1R4GA 4MXXA 4U6RA 4BF2A 5FP5A 4CV8A 3GLIE 4EOLA 5IQFA 5HBEA 4AOJA 3RK5A 5AA9A 3CJGA 4GKHA 2W5HA 4DFLA 3R1YA 4IWPA 3LLTA 4CFVA 4MK0A 4ZXTA 3CGFA 4IMYA 3NNXA 3BHYA 4KSPA 2ZMCA 4CZTA 1Y8GA 2LVQD 2GHGA 4A4XA 2P2HA 3QHRA 3VVHA 4YJNA 2B55A 5TOZA 3FBVA 5IMXA 1V0PA 4QMOA 1J3HA 1YKRA 2YJSA 3LJ1A 5LCJA 4WIHA 1GIIA 3PWDA 2W5AA 3TKHA 2J90A 2OJIA 3OXIA 4QD6A 1URWA 3FLZA 2WOUA 1XBBA 5JSMA 4R5YA 2JFMA 4I6QA 4A7CA 3AD6A 5E1EA 1ZY5A 3OHTA 3GVUA 4BHNA 2YAAA 3V8TA 4ANMA 4IQ6A 1F3MC 5D7VA 3BYMA 3BPRA 3AT3A 3OUKA 5GNKA 1BUHA 3ZXTA 2H5XA 1U59A 2W1HA 1WBSA 3KXMA 4WBBB 2JKKA 2YIXA 1SM2A 5A54A 4OW8A 2WIPA 4H3QA 4BCJA 2Y6OA 4E4LA 5DRBA 4O81A 1XH7A 2JAVA 3I6WA 4CCBA 4JIAA 3IS5A 1H0VA 4BTKA 4AGUA 2W4JA 3FY2A 4ANBA 4BR3A 5I9ZA 1ZLTA 3VO3A 3ZSIA 2HIWA 5DHJA 1XKKA 4L52A 2JC6A 4RFZA 4KBKA 3OP5A 4RQVA 4RVMA 4OAVB 4HGEA 2C5NA 2VGPA 4ZIMA 5AP7A 2IJMA 4KINA 2RG6A 2YJRA 4FK3A 4PMTA 4UEUA 5A4CA 3DCVA 1KWPA 4WOVA 3I0QA 3KVWA 5EW3A 5IUIA 1UKHA 1UVRA 4G5JA 4GYGA 5A6NA 4BDAA 3F66A 5BYYA 3QCXA 4O0UA 2E2BA 4RA5A 4GJ2A 5AWMA 3QCQA 3BEGA 3KCFA 4PPBA 2CLXA 1J1BA 4P4CA 3WF9A 4IZ7A 3LCDA 4E6DA 5M09A 3HMIA 4KWPA 4W4VA 2BTRA 3EYGA 4EC8A 1YI3A 5EW8A 1CUKA 3C50A 3T3VA 5CAVA 4EOJA 1V0OA 2HYYA 3C4WA 4CFUA 3DK3A 4PMSA 4JJRA 4NCTA 2WGJA 3VW6A 4PL4A 4BI0A 4RLLA 2JZ1A 2C6TA 4O22A 1ZOGA 2ZM4A 5HVJA 3FYJX 3AMYA 1PW2A 3BV3A 5HD4A 3JY0A 4FNWA 4GS6A 4QMYA 4B0GA 1I44A 1TTEA 4L00A 4K33A 3JVSA 3OXTA 4RG0A 4TXCA 3NCZA 2X39A 3SXSA 4YHFA 3R8MA 4ZZNA 1KV2A 3VW8A 3K2LA 4H1JA 2ITVA 4FZFB 4K11A 3PP0A 4N6ZA 5CI6A 3UBDA 4ZMFA 4FC0A 1G8AA 3E92A 3R00A 3WIKA 4RT7A 3R71A 4EHVA 4QMTA 5D12A 3OTUA 4E5WA 5C4KA 3NNVA 2ZAZA 3SC1A 5ANDA 3NUYA 4BCMA 5EYDA 4EK4A 4ZLZA 4OBOA 1Q24A 4CVAA 3KRWA 5DVRA 1Q62A 1T43A 5GZAA 1FBNA 5J9YA 2QCSA 4OTWA 3R0TA 3EHAA 4WUNA 1QPDA 3A61A 5CAUA 3VS3A 3RM7A 2E9OA 2UVXA 5DNRA 3KVXA 4LRMA 2CP8A 2WTDA 4G9RA 1G4AE 3GQIA 3DT1A 4IVDA 2GNGA 1REKA 3HAMA 4CG9A 3H0YA 5CU3A 3FXXA 2HAKA 3BWJA 5LMAA 3TEIA 3ZEWA 5FTGA 2WB8A 4YTIA 1Q97A 1ZAOA 3FLWA 4FSMA 4PP7A 2OXDA 3B89A 4JQ8A 1Z9XA 3Q52A 3WZDA 2P33A 4CFXA 2XEYA 3RCDA 2C30A 5A4TA 2V0DA 2WNTA 5FM3A 1KE8A 1NV8A 3HX4A 4C58A 5IZFA 5JFXA 1NVQA 2PZYA 3PUPA 4I6HA 3HP5A 4IM3A 2UW8A 4QMQA 3MH3A 2DKLA 4X2GA 3VULA 5CXHA 2FSTX 5HO8A 3OEFX 2B9IA 3DKOA 3R02A 3E8EA 2K9DA 4ZJIA 1PY5A 4D4SA 2WQEA 4FTTA 3JVRA 5LOHA 2J9MA 1RJBA 4ZP5A 4FEVA 4AT5A 3BV2A 4AFEA 5CVGA 3FMJA 5D1JA 3GXLA 4JNWA 4EZ5A 5CF6A 3HV4A 1H07A 3QL8A 1M14A 3TV4A 2DUVA 2YCFA 3IKAA 4DFYA 3GCQA 4W9XA 5CSVA 4JI9A 4FTJA 2ZV7A 4DBGB 2RIOA 3UYSA 3WE4A 1FVVA 3CEKA 3KU2A 4AOIA 3C1XA 1BMKA 5DT3A 3VQHA 3QTQA 5E91A 4C61A 3S00A 4UZDA 3VBWA 4NKSA 5CSXA 5IMEA 1JSTA 4UBAA 4IX6A 1JOWB 4DEGA 1URCA 1XB2B 2W4KA 2VTQA 5JGDA 2FA2A 3R6XA 3UC3A 3TUBA 3UE4A 3E88A 3TIZA 1PRYA 5IQEA 2XJ2A 2PTKA 4QYFA 4MEDA 4QP7A 3HRFA 2X9FA 2X6EA 4M69A 4AE6A 4DHFA 1H00A 4AS0A 2R3FA 3T6PA 4YO6A 3POOA 4L53A 5EYKA 1Q02A 2AYPA 2GQSA 2P3GX 4K1BA 5CU0A 2H9VA 3UZTA 3KA0A 2GQRA 4IC8A 1NVRA 2E9VA 2H34A 3GU4A 4YLJA 3UO6A 4AZTA 3E3PA 2B9FA 4X2FA 4BI2A 1XHAA 5F95A 4O7YA 4R7IA 4TWOA 3RAHA 5LMKC 2B0QA 4MQ2A 4EBWA 3GLHE 3IDCA 5CEPA 1GIJA 3BCEA 2X8DA 4XBUA 4YC8A 4AW2A 1PYEA 3VUTA 2W1IA 3Q6WA 3CC6A 2PMLX 5AV2A 1TQMA 5DR6A 4IAAA 5KMKA 4QTAA 3WYXA 5LJJA 5E8TA 5M56A 3THBA 3VS0A 1VEJA 3FPMA 3P4KA 5M4FA 5KZIA 4C4GA 1JPAA 4FEWA 3OW4A 3QX4A 4FNYA 4MAOA 4EWHA 5KMJA 3NUUA 4AA4A 5IQHA 3QQJA 5C27A 4M84A 3S95A 4R3RA 5KKRC 3NAXA 3TZ9A 2IWIA 3NDMA 4EBVA 4M69B 5GIOE 5TO8A 3IW7A 2L2DA 3KF4A 4KIKB 2OF2A 2ZB1A 2R4BA 3QHWA 4FV3A 3ZU7A 5CASA 1JVPP 3D5VA 4IFGA 4I5MA 2VX0A 4YJSA 3I81A 2R3MA 5CENA 5IUGA 2WO6A 1KE9A 2Q0BA 3DOGA 1XH6A 3NPCA 3NUXA 3OXZA 4GEOA 1R78A 3W33A 4O84A 2R3KA 4FTKA 3HV7A 3ALNA 5BUIA 5E7RA 5E9EA 2C1BA 4FL2A 5FBOA 3VUGA 4ASEA 2I1MA 3OY3A 3PZHA 4FGRA 3FE3A 3OW3A 3PLAE 4EOKA 4TL0A 4FTRA 4DFNA 2XNEA 4GK2A 4BKJA 4L3PA 2Z02A 3RAKA 2WIHA 3P1AA 1OIYA 2CNVA 3MWUA 1SZMA 5D10A 3U4UA 2BRMA 2J0IA 3ZFXA 2GS6A 3KCKA 4YLLA 4UMRA 1ZMUA 1Q99A 5E92A 2QURA 4Y95A 5IA3A 3MH0A 2YZAA 4YNOA 1OM1A 3MIYA 1CMKE 3VUIA 2VO0A 1ZMWA 1WBPA 2R3NA 1BI8A 4GJ3A 5LMKA 3PE1A 4PDSA 3RPYA 4FEUA 3LMIA 2X9EA 5TR6A 5HE2A 3RP9A 5K9IA 5KKRB 5AP2A 3CD8A 2UZDA 3COIA 3QRJA 3QCSA 3E8CA 5KCVA 3KGAA 4DG3E 2VX1A 4IADA 2GNHA 3RJCA 5CLPA 4DA5A 4DFBA 1XH5A 2UW4A 5DLSA 4A4LA 3EN4A 3HMNA 4XG2A 2VNWA 2VTSA 3A4PA 4P5QA 4KRDA 4ACGA 5ACKA 2DAEA 3W2OA 2J5FA 5HU9A 3IQ7A 3QRKA 3WARA 5FM2A 1UNLA 1PXJA 1UU9A 3D7TA 2OJJA 5AP4A 4ACMA 4GK3A 3FL5A 3R7VA 3A60A 3W16A 3VBXA 4JVGA 4CG8A 2PZRA 2ERKA 4RC2A 5L6WL 2Y0AA 3CD3A 3FSKA 2ZM3A 4BHZA 4BCPA 4IX3A 5JK3A 2ZM1A 4F6SA 4B4LA 5JQ5A 1QL6A 3PVWA 1FGKA 2Z2WA 5B2MA 3ZM9A 5JZNA 2VO3A 3QTWA 2YISA 4ZK5A 2VWUA 2QO2A 3CY3A 4W4XA 4FG8A 2QOLA 3SW4A 3Q5ZA 2JIUA 4MYGA 3VN9A 4EONA 2PK9A 4JDHA 2HXQA 4YC6A 5IA1A 4GT4A 3LMHA 3BGZA 4MTAA 1E1XA 3LFEA 4U3YA 3VHEA 5L6OA 4LG4A 3LAUA 4OLIA 1JWHA 3UODA 3IG7A 3KMMA 3P0MA 4RWJA 3HUCA 4D4VA 2ETMA 5AJQA 2VU3A 3MBLA 3W1FA 3KK9A 4OT6A 4USFA 5HNIX 2F4JA 3RTPA 3QTSA 1RW8A 3WILA 4DCEA 2DAGA 2WTVA 5JI2E 4ITIA 3OBJA 1YHWA 2YN8A 3F6XA 3MTFA 4X21A 1IEPA 3H10A 4LMNA 2XP2A 4N70A 4EKKA 2V5QA 5IA2A 4NU1A 5E90A 4Z7GA 2R7IA 5AFVA 1YOMA 3N51A 3SV0A 5DFLA 3V3VA 1J1CA 4CMUA 1IAJA 4ZMEA 2VWYA 4AUAA 4QMPA 1LUFA 4IB1A 4LUEA 3IONA 5FXSA 4A9UA 4QPMA 3MW1A 3TJDA 4IM2A 1P5EA 3HV6A 5AAEA 4YC3A 4BTFA 3UQFA 4C35A 2GS7A 2XBJA 3UOHA 3GOPA 4BWPA 3EN6A 4H3BA 5AV0A 4HVDA 4AW0A 5BX0A 1KUTA 4LRJA 3GLGE 2C6DA 4A9SA 3ZCLA 3E7VA 4IB3A 4TWNA 4FKIA 3QYWA 5CEKA 3JYAA 4R1VA 4WHZA 3GENA 3HRCA 3BEAA 1XJDA 2DNAA 2VTAA 1GZOA 3BHTA 4IDTA 4X6RA 2YM6A 3R9DA 5E8YA 1AIPC 1ZOEA 2UVYA 4ZAUA 1G8SA 3PJ8A 3QALE 5IA0A 3D5XA 1YI4A 4APCA 3A8WA 4DG2E 1WBTA 1V1KA 3FMEA 3KRXA 4DH5A 3E87A 3NYNA 4Y85A 4DLJA 3UG1A 5E4HA 1QCFA 2VWVA 3C51A 3Q9XA 3GFWA 3TKIA 3LVPA 3DAJA 3EIDA 4O0XA 3FRHA 1QZEA 2QU6A 4XCUA 4AA0A 5I9YA 4WD5A 4IIRA 2QHMA 3BHUA 1IXSA 5HESA 5FEDA 2IZRA 1OTRA 3CSVA 4BDCA 4FVRA 5M51A 4E6CA 4U79A 5A4LA 4XV3A 4JQ7A 3LMGA 3CQUA 3TV6A 3TTJA 2F49A 3FXWA 3UYTA 4FVPA 2ZVAA 4PMMA 5C03A 4FT0A 3HDNA 4EH6A 4GW8A 4J8MA 2PZIA 1QMZA 2B9JA 2GNFA 1BL7A 1OL1A 1MUOA 1CM8A 3BGPA 5LXMA 4EUTA 4APPA 3RINA 3Q32A 2B52A 2LVAA 4ANLA 2WTIA 4RPVA 3SHEA 1CKIA 2XM8A 3GI3A 4FKGA 1CTPE 2HWOA 4IM0A 3T9IA 4B8MA 2EB3A 3FXZA 4NL0A 3PE2A 3ZM4A 1OIQA 4ZTNA 1VEBA 4DFZE 4F1TA 5IEXA 4FKQA 2PY3A 3HP2A 2PVJA 2BDJA 4A07A 3S0OA 4IAFA 4L46A 1A48A 5HG7A 5HOAA 2OK1A 4GK4A 4ZZMA 3Q2JA 4O86A 1UA2A 2A4LA 5JZJA 4BWXA 4IJPA 1WCCA 5BVEA 3BBTB 3UVQA 5CALA 3QZHA 3SD0A 3NVMB 3S2PA 3F61A 3B2WA 3SRVB 4HCUA 2XUUA 4C34A 3WI6A 2GHMA 4BCNA 1YHVA 1ZARA 4DLIA 4LL5A 2Y4IC 2BCJA 4HGTA 1WIVA 4QMXA 4RIYA 4XS2A 5TF9A 4Y73A 3BRBA 5A14A 5JKGA 2VWXA 5CU2A 5EFQA 3F5GA 4C59A 3FMKA 4DFXE 4GKIA 1VEGA 2DAIA 4U43A 2A0CX 3KN6A 3UOKA 3U55A 3T9TA 3HDMA 2L4FA 2X1NA 4ANSA 4FG7A 2YM7A 3FZTA 3TZMA 4F70A 3RPRA 4BTJA 5J9ZA 4MXCA 1HOWA 5HG5A 3VUKA 3QKKA 3ENMA 3OY1A 2X7FA 3PA4A 4N4SA 3R63A 5FDXA 5ACBC 3G5DA 4D0XA 3QBNA 4FKUA 2LAVA 4R6VA 1YHSA 3PJ3A 4LRKA 4DCAA 2R3OA 3PFQA 2LVNC 4JR3A 5AV4A 4CFMA 4XG9A 3CXWA 1JKSA 3U4WA 4S31A 2I6LA 3LCOA 1XBCA 3DK7A 3NW6A 3BLHA 4IX4A 2RL5A 3D2IA 3DXNA 3H3CA 4PDYA 2RFNA 3GU5A 2EVAA 4GU9A 5HCZA 2X2KA 4AFJA 1M17A 4XYFA 4OTDA 4E4NA 3C4CA 1OITA 4HGSA 5CSPA 1XWSA 3FQEA 3OUNB 4UMTA 3V5WA 3ORPA 1RDQE 5A9UA 4BGQA 2ITNA 3LQ3A 3Q2MA 3FZSA 3PXRA 4EOQA 3E3BX 2WEVA 5IQDA 3QZIA 4KSQA 4C4FA 4EZ3A 3RI1A 4C02A 2YHVA 3GC7A 1H1WA 4O91A 4EWQA 4EKLA 3DV3A 3V5TA 1VG5A 3R9NA 3GC8A 2WQNA 2QHNA 4TZRA 4CFFA 2VTJA 3RZBA 1V0BA 3PA3A 5I9UA 5HO6A 5BMSA 2G2IA 4O6LA 4FYOA 4XBRA 3UOLA 3RHXA 4M67A 5AP3A 2F7ZE 4C36A 4FOBA 3G33A 1E1VA 5IDNA 5DIAA 4LFIA 3ZDUA 1STCE 4QP4A 2VO6A 2YACA 2O3PA 3K5UA 2ITPA 2ITZA 1KOBA 4J98A 4LV8A 4YJPA 3B8QA 3PIXA 4TNBA 4YNEA 4I22A 5CSHA 4LGHA 5T6KA 2XH5A 4DH1A 5AA8A 2BRBA 3HZTA 5FUTA 1R0EA 2BROA 2QOQA 3GU8A 3SGCA 2FVDA 5L2TA 2OZOA 3MV5A 2QO9A 3I0OA 3DKFA 1U4DA 1WBOA 4NSTA 4X6QC 2GU8A 2YFXA 1OPJA 1ZXEA 3R22A 2JNHA 2DI0A 1ZOHA 3QQFA 2WTWA 5CU6A 3D9VA 2H96A 4AF3A 2DHYA 4I1ZA 2WXVA 5HG9A 5LVPA 2WMXA 1KE6A 4EH9A 1SNXA 1ATPE 4OGRA 3EQPA 3TZ7A 4QQ5A 3GC9A 4FTOA 5EOBA 4F7SA 5KUPA 4S2ZA 3ZLYA 5IQIA 3C4ZA 3VUHA 4RIXA 1NY3A 2DWBA 2QHOB 3W2QA 3FLQA 3W32A 4RX8A 4TT7A 3UIXA 2ZYBA 3NMUF 4X2KA 2X8EA 4MBIA 4EL9A 1YDTE 4AU8A 3G6GA 4ITHA 5L8LA 4BFMA 1PMVA 1UNGA 2W05A 3BLQA 2EXEA 5L8KA 3PA5A 2WAJA 3FLNC 2JKMA 4ONAA 3KMUA 2BZKB 4CT1A 4ZLOA 2XB7A 4EEVA 1IM2A 2VTMA 3DLSA 4M15A 5AAGA 4OBQA 2VGOA 1RE8A 3NGAA 3BYOA 4O1PA 3CTQA 2OIQA 5IEVA 4F6WA 3L9NA 5IDPA 4C2VA 1HQYE 4UX9A 3V51A 5KMIA 4WG5A 1OKSA 2JDOA 3HUBA 4E93A 4NFNA 3MGYA 1I09A 4LOPA 4CGAA 5EDPA 2QR7A 3F82A 4OTHA 4PPCA 4Z7HA 2I0HA 4G5PA 2K0BX 4KS8A 4G31A 2X81A 1AQ1A 4F7NA 1PJKA 2J51A 4F64A 1OPLA 1R3CA 1KOAA 4MNEA 2ITWA 5ANJA 3GCUA 2FH9A 2JY5A 4JIKA 3GUBA 3ZBXA 2C69A 1YDSE 2R0IA 1SVGA 5E8UA 3LFDA 4LMUA 5AUWA 5DFPA 4N0SA 2OH0E 4XRJA 2OZAA 4WSQA 3U8WA 5HTBA 3ATTA 4UXQA 3E93A 3CLYA 5HO7A 5IF1A 5BVNA 3O0GA 1G3IA 5AUVA 3VJOA 4Q7JA 3U6JA 3G9LX 4FTUA 2XK9A 4FODA 3V04A 4ASZA 3I6UA 3DTCA 2UW5A 5AUTA 4IH8A 3D2KA 3E8DA 4I5HA 4JR7A 4BDGA 4XOYA 4KS7A 4PTCA 4R8QA 4XJ0A 5ANGA 5M06A 3F7WA 5LARA 3QZFA 5EH0A 3NIEA 3WOWA 3Q9YA 3TNPC 3V6SA 5A3XA 4FKLA 4C33A 1S9JA 2C1AA 3AOXA 3AGMA 4ENYA 2QONA 3EQRA 4AAAA 3VHKA 1ZYLA 4C8BA 5HG8A 4R3PA 5AUYA 1PXIA 3TWJA 3FJQE 4GV1A 4ZTQA 3A7JA 3AD4A 4TYHA 2VTOA 3EFWA 4X7QA 4HVSA 1W7HA 5CZHA 3QD0A 2UZVA 5CAOA 5D9HA 5M08A 3NCGA 2YDJA 4BTMA 4BIEA 3VS7A 3H0ZA 2R9SA 2XKFA 5HORA 3I5NA 3MVHA 5TKDA 1PHKA 2WU6A 3E8NA 4EQMA 2C5XA 2O25A 4RJ6A 2VTNA 1QPCA 5HGIA 3LLAA 4AW1A 1GZKA 4ZTSA 4FTNA 4G1WA 5B0XA 2QVSE 5CF8A 4IX5A 3C5UA 5DBXA 3NSZA 3MPAA 4FUYA 4BZOA 1R1WA 3W2RA 4E3CA 5J5SA 2XK6A 4WA9A 4M97A 5DR2A 3F5PA 4O2ZA 5HHWA 5EQPA 1Q8UA 4BIBA 4UN2B 4FTAA 4E6AA 1SG9A 2HK5A 4DGMA 4I6BA 2BHEA 3QCYA 4IJ9A 1G5SA 5DR9A 1TKIA 1JNKA 2CJMA 1IG1A 2ITUA 5HX8A 1MRVA 2W0JA 3SX9A 4GMYA 4ZS4A 3G6HA 5K3YA 5CEIA 3BI6A 4JBOA 4O96A 5LVMA 2V22A 1JKKA 5ANOA 3FI4A 3KL8A 4TYGA 1AGWA 4CNHA 3R2YA 2G2FA 2UZLA 3DQWA 1VZOA 1XXHE 5KNJA 2XKDA 3HA6A 4DEBA 4RZVA 3EL8A 1PXKA 3HV5A 4LOQA 1DO2A 4WKQA 4X2NA 5CAQA 2EXCX 2B9HA 5KMLA 4C7TA 3PLSA 5L8JA 3HGKA 3I1AA 3ORMA 4BIDA 1TQPA 3PXKA 3OF0A 4AE9A 2GQGA 3KK8A 4MF0A 4XX9A 3RNIA 4F9AA 3HLLA 4EH7A 3OOGA 4G3GA 3C5IA 2UZTA 3FKOA 3BIZA 3ORXA 4PDPA 3QA0A 3PSCA 5IQBA 5IQCA 3ERKA 5KBRA 3PPJA 3F88A 2OOBA 2UZNA 3L8XA 5EYMA 4EUUA 2IG7A 3VUMA 4XUFA 2XK7A 2HWPA 5BVFA 5CY3A 5H9BA 4QYHA 4MWIA 4YTCA 4CRLA 1UV5A 3UGCA 4O7LA 3D15A 4RVLA 3N4UA 4DT8A 4E73A 3OWPA 3WF8A 4NWMA 5HD7A 4RA4A 4UWBA 4V0GB 5M55A 5AP1A 4RVTA 4B8LA 4I5CA 4JL9A 4BN1A 1LEWA 3FMDA 5F4NA 3R28A 4W9WA 3W2CA 3QTUA 4C3RA 1TR8A 3BELA 4ZY4A 4G3OA 4HZSA 5GJDA 2YLEA 3ORTA 1P3QQ 4RC4A 4IHPA 3UTOA 3ZBFA 4GYIA 3PY3A 4GCJA 4P5ZA 4WT6A 3Q53A 3EFJA 3TCPA 3O8TA 1NV9A 4C2WA 2WTCA 2EB2A 3FZ1A 1KYIA 4QQTA 3DZOA 3FAAA 3SQQA 4NW5A 2AC3A 5A6OA 4XMOA 3PJ2A 4FSQA 3U9NA 1SMHA 1BI7A 1WZYA 4KABA 2FSMX 2W9FB 4NEUA 5AX3A 3ZXZA 3HVCA 3VQUA 4B7TA 2Y8OA 4GSBA 2KNVA 4WNKA 5IH4A 4DFUA 2FGIA 3KXZA 3DFAA 3FQHA 2R3GA 3O2MA 3COKA 1KE7A 4I20A 4YZ9A 4F0GA 2EKFA 2O63A 5IKWA 3FHIA 5HE0A 5AIKA 4LGDA 4YO4A 2DQ7X 4RGJA 4FSZA 4DH3A 4DYMA 3OZ6A 2WQMA 1OKVA 4K2RA 2WMSA 3C9WA 4FTIA 5FLFA 4U8ZA 3DAKA 5L2QA 5ANIA 3UO4A 3IOKA 2DS1A 4GVAA 4YBJA 4ORKA 2YM4A 2O2UA 4FSRA 3RK9A 4YUQA 3VS4A 4BWKA 4BDHA 5J7BA 4ASDA 3KQ7A 3WBLA 4CFNA 3U6HA 4NIFA 2IZSA 2O0UA 3FMMA 4E8AA 4F7LA 4F6UA 2YCQA 2CGVA 4ZTMA 1YXVA 3FHRA 3VBYA 4DE4A 4PTGA 4JLCA 4Q9ZA 4PRJA 1Q41A 2Y4IB 1DM2A 4AXAA 4WG3A 2HELA 5AUZA 5H8BA 1ZZLA 4LYNA 3RAIA 3Q6UA 3DBFA 3LQ5A 2ITQA 4EH2A 2C3JA 4CD0A 3SG8A 5BUJA 2HZ4A 4N6YA 4K18A 5AV1A 3A7HA 5FP6A 4AX8A 2Y7JA 2WMQA 1WGLA 2WTJA 5FWKK 4UB7A 4WNOA 1YQJA 3RM6A 2GFCA 4KKGA 4CKJA 3U6IA 5FXRA 5HQ0A 2HZ0A 2ONLC 4ALWA 3W2PA 2PVNA 2CN8A 5G1XA 2R3HA 3PTGA 3PWYA 4FKVA 5EM7A 3RHKA 1WR1B 3PVBA 3PSBA 2PUNA 1OUYA 1K3AA 1H01A 3EKNA 3Q04A 4BICA 1Z57A 1HCKA 4D2VA 4B99A 3MFTA 5HCXA 1PXLA 3F2AA 3F7ZA 2BTSA 4P7EA 4MF1A 5FXQA 3QQHA 4WUAA 1M2QA 4I3ZA 3F3ZA 5JFWA 1ZMVA 4RVKA 3DBEA 3I79A 4GT3A 4L44A 4J96A 4LOOA 5C01A 3ZSHA 3KREA 4EK8A 4DTKA 2ITYA 3AC8A 3FC2A 1FMKA 4NM0A 4O0TA 2F7XE 4GUEA 4BKZA 5A4QA 1SNUA 3KF7A 4FSUA 3EFKA 1NXKA 4D9UA 1ZWSA 3DDQA 1OBDA 2XIKA 2B3TA 4O0WA 1Q3WA 4UWCA 3QX2A 3REPA 3R21A 5GHVA 4G3CA 5EW9A 2VWWA 2YM5A 4H05A 2B54A 3JS2A 2C68A 5HVKA 3G51A 4FVQA 3DA6A 2UZWE 2XYUA 3NUNA 3P79A 5CVHA 5C9CA 1SVEA 3ULIA 5HX6A 2I0VA 1YWRA 3U51A 2UV2A 2A27A 2XCKA 4FSTA 4UYNA 3O51A 1K9AA 4IVAA 3QLFA 5DA3A 4ZSLA 4UWYA 3P7AA 4FNZA 5CT0A 2UW9A 3EOCA 1BVSA 1ZV1A 4IANA 1YXTA 3GB2A 2CKEA 3JPVA 3KN5A 4BGGA 2I40A 3LOKA 2GCDA 2PVHA 4FV8A 4QYYA 5GJGA 3CE3A 3OCSA 3DJ7A 3IDPA 3TN8A 2ETKA 4D4YA 4PY1A 3QF9A 4E6QA 4PP9A 3AC5A 2AUHA 4F65A 4F99A 3GCVA 3AG9A 3ZYAA 4UV0A 4CYIA 4IW0A 4NZWB 3WF7A 4DT9A 4U42A 1OL2A 4FA2A 3MESA 2V62A 4TWPA 4XV1A 4R78A 3BKBA 4DGLC 5M4IA 3TNQB 3GNIB 4Y83A 3L9MA 3NS9A 2QLQA 3TNIA 4V0GA 5HNGA 4AG8A 4F2LA 4FL1A 3FL4A 2OG8A 1M2RA 4L01A 2C6MA 4YP8A 3UC4A 2CLQA 3ORIA 1YWVA 4W8EA 3DQXA 4IEBA 1FGIA 4OTQA 4EQUA 4H1MA 4JBVA 4AOTA 3PSDA 5K0KA 4BZDA 4EH8A 2XZSA 1FPUA 5DI1A 4DEAA 4E1ZA 4QP9A 4Z55A 3NAYA 5BMMA 2Q83A 1K2PA 3OT3A 4FSNA 1WBNA 4U40A 5HKMA 2RG5A 2R0UA 2XJ0A 5K0XA 2OU7A 4RWIA 5IQGA 2WMBA 4CMOA 3RCJA 3EYHA 4O1OA 3FPQA 4KD1A 3SXRA 4QMLA 3SA0A 4FI1A 3SOCA 4TWCA 3PPZA 3ZZEA 4IAYA 3F2NA 3HAVA 4G9CA 3TIYA 4E5AX 4RC3A 3UP2A 1XBAA 4BYIA 4E5BA 2ITXA 2CKOA 3DKGA 1H1RA 3GC0A 3NZ0A 4O0RA 4MD9E 3PRIA 2UW7A 1OIRA 3TNHA 2I0EA 4AZWA 3D0EA 4FIIA 2Z7RA 2OKRA 3G2FA 3LCSA 5AUXA 4MD7E 4E26A 5I3RA 3QUPA 2PPQA 4JDJA 4ANOA 5T68A 4TY1A 2R2PA 2PE0A 3HMMA 3MPTA 3G15A 5M44A 4XRLA 4EK5A 3F3UA 3EQCA 3UIBA 3DPKA 4LM5A 4HVIA 3CJFA 1UU7A 3UMXA 4USEA 1WVXA 2YITA 4KIKA 5HLPA 4ZTHA 3ODZX 1DS5A 4H39A 4C3FA 4YBKA 3AT2A 1GAGA 4FKSA 4PL5A 2R3IA 4DEDA 4TTHB 3ITZA 1DI9A 5FG8A 4DTBA 2C3IB 2CSNA 3LPBA 4GFGA 1W8CA 5CU4A 1U46A 4EK3A 4O7TA 2PUUA 1EH4A 2H6DA 4HVHA 5A46A 4NK9A 2OJGA 4AACA 2C3LA 3EL7A 3ZH8A 4C4EA 2VRXA 1Y6AA 4ACDA 5CNNA 4MXOA 4X0MA 5JFSA 4FKJA 4NTTA 1WVYA 4YZDA 4U3ZA 1Z5MA 2C5YA 5T3QA 3VNTA 1IR3A 2XNNA 3HV3A 2LVPC 3JUHA 4O38A 3GOKA 1SVHA 1Y91A 3P86A 4ITJA 1H4LA 3V8WA 2DZLA 1F4IA 4D1SA 3I7BA 3FMNA 3D4QA 4BCFA 2QOBA 3ALOA 1WBVA 2XNBA 5AV3A 2FB8A 1Q4LA 3BU3A 4XH6A 3K54A 5H3QA 4CRSA 4EOSA 2PVMA 3FI2A 4CFWA 1F0QA 3AC2A 4FSWA 3WZJA 3S1HA 1HCLA 2IW6A 2J0MB 4XG3A 2X4ZA 2J2IB 5ANEA 1GZ8A 3QLGA 3R9OA 3EQDA 3W8LA 4JX7A 3R30A 5L2IA 2HW6A 3RWPA 2IW8A 3V5JA 2WD1A 3BHVA 2XIYA 4FF8A 4L7FA 3R8LA 4ACHA 3EH9A 3NW7A 3DB6A 2O8YA 2A1AB 3E7OA 2W1CA 2YEXA 3EQFA 4D5HA 1VR2A 3HEGA 4FT3A 4L3LA 4R77A 3JR1A 4D2SA 4JBQA 3NVKI 4RX9A 4EHGA 4FNXA 2PUIA 2BAJA 2XK8A 3QD2B 4MXYA 3BE9A 5J1WA 3DGKA 2GDOA 4QMUA 3GEQA 3AGLA 4G17A 5DE2A 5B2KA 4EHEA 4GFMA 1S9IA 1XR1A 1X8BA 3RPOA 2PZPA 3DBDA 3AC4A 3PP1A 4JG6A 3FZOA 1PKGA 5DPVA 2YA9A 4ZSEA 3PVUA 2BIYA 4KBCA 4O21A 3ZOSA 4AN3A 4FTMA 5CEOA 3DAEA 3V5LA 2CHLA 4QMZA 1OI9A 5E8XA 5EI8A 4I24A 2OGVA 4OTGA 3L9LA 3LXKA 1HJPA 4AZFA 4QO9A 3ZTXA 3DJ6A 3CP9A 3GU6A 1VYWA 3KKVA 3LZBA 3OROA 3UQGA 5C8NA 5FTOA 1L3RE 1XH4A 2RSVA 2XIRA 3ZLWA 4XNEA 3PG3A 5DT0A 4M13A 1Y8YA 3QUDA 3BU6A 1YXXA 5EHYA 5FEEA 4Y5QA 3H9FA 4X3FB 4BDFA 5JRQA 4RIXB 4IVCA 2X2MA 3UNJA 2JFLA 2J7TA 3QQKA 1O9UA 4M0ZA 2XNOA 4U97A 2VTPA 2W1EA 3D14A 3IHPA 3KC3A 3OCBA 2YLFA 5B2LA 3PXQA 3AQVA 5EDRA 3MH2A 2R5TA 5HTCA 4U7ZA 3HMPA 4XHKB 2MROB 5CTPA 4ZJVA 5IISA 4UZHA 1F5QA 3VWAA 3OWLA 4DBNA 3VBQA 3TXOA 4E20A 1CKJA 4JDKA 4U0IA 5IPJA 3U87A 1W82A 3NR9A 4U44A 1JKTA 3ZFMA 4C0TA 4YR8A 2W99B 2YZLA 4HYHA 2IPXA 4ARKA 3OTVA 2PVRA 2BMCA 2R3QA 2C6KA 3LCVB 1IASA 3KY2A 4FT7A 4ASXA 3QC4A 1J91A 3ODYX 4YJVA 2Z8CA 2UZBA 4BCOA 4BGHA 1O6YA 4XV2A 2XF0A 2JDTA 3V5PA 3RBWA 5F94A 2KNAA 3JY9A 4FTQA 1DO0A 2PWLA 5KMNA 4BB4A 1PMUA 3FLYA 5AAFA 5C1QB 3F3TA 2B7AA 4J7BA 1NW1A 1T45A 2C0IA 4I0TA 4BDKA 3BYVA 3VUDA 1W83A 3UZPA 4BCHA 3HKOA 5JGAA 3BQCA 3FI8A 2X8IA 1DAWA 5K4JA 2CKPA 4ID7A 3CQWA 5LMBA 4YTFA 3MVMA 4I0RA 4S32A 2OJFE 3GBZA 3UG2A 4PF4A 2RKUA 2UZOA 4YZMA 3SVVA 3DNDA 4NM5A 4IAZA 3PZEA 4KB8A 3LCKA 3D5UA 5AR8A 3RK7A 4CQEA 3F2RA 4NM3A 2RGPA 4BL1A
chains in the Genus database with same CATH superfamily
2OO8X 2VO7A 5KPRA 4D1XA 2W06A 3MIAA 4IC7A 5HE1A 4F0FA 4IDVA 3LFNA 3L8SA 1O6KA 3LFSA 3I04M 3P23A 5EM8A 4TKSA 3AFHA 2XBAA 5EG3A 3ORNA 1YSYA 3R2BA 1WHCA 3DNEA 2G5GX 1Q8WA 4TN6A 4D0WA 1WXQA 4DGGA 5AIRA 5GINE 4HEOA 4C37A 4FG9A 2A19B 2C6IA 4TYIA 2VF7A 2O64A 5DWRA 4DEHA 2UUBM 1GVNA 3OCGA 4S33A 4IB5A 4PTEA 4K77A 2XLJA 4Q5HA 1DGGA 3FSFA 4QTBA 2UUEA 3MDYA 4FRFA 5JK3A 4LUDA 4J53A 4QYEA 3UIMA 3GQ4A 3IO7A 3OWJA 3EWHA 4BCKA 2R6FA 4RJ8A 4PDGA 1V92A 4EHEA 4LI5A 4FTCA 1XO2B 2QODA 4K9YA 3WZUA 3FTEA 3VKGA 4RIYB 4QP2A 4ZOGA 3QRTA 2GMXA 2J6MA 5HICA 1HT1E 1H24A 2PZ5A 1OIUA 2EJSA 4JRVA 3D83A 4FUXA 4TPTA 4N57A 4C57A 2HCKA 3AKLA 4KAOA 2BWBA 4DITA 4R71A 3CQEA 2Q0NA 4WSYA 2C0TA 2IVUA 3NLBA 4NJDA 3SATA 2R44A 4G6ZA 3FWQA 3SRVA 3Q4CA 5J79A 4IZAA 4B9DA 5G6VA 4O7WA 2WZJA 3NUPA 3ZS5A 3KDSE 4RIWA 4DHJA 3WF5A 3FKNA 1PYXA 2YAKA 3EN5A 5AP0A 4AA5A 4KIPA 5I0BA 4O27B 4FV2A 2PE1A 3OS3A 3PPKA 4GU6A 4OTPA 4AGWA 3AMAA 4M0DA 2QG5A 1ZY4A 5IG1A 2XJ1A 5IU2A 2PULA 4PX6A 3RALA 4DHIB 4IBMA 5CNOA 5FEQA 3KRJA 1ZYCA 4AW5A 4D5KA 3AMBA 2QP9X 4BRXA 2XYNA 3AXWA 3COMA 1ZRZA 5HVYA 3ILKA 3GCSA 1H1SA 3FV8A 2VTIA 3I60A 3PDTA 2FSOX 5AEPA 4HYIA 4QPAA 4AT3A 3SHGB 2CNQA 3ZO3A 5EHLA 5CANA 1R6BX 3B7QA 2XRUA 3LJ0A 3SAYA 3Q5IA 3CF6E 4UN0C 5AP5A 4FWHA 1YVJA 4CLJA 3LXPA 3PXYA 4YHTA 2DAKA 1Q61A 3E46A 4XOZA 2ZFYA 4RJ4A 3Q8GA 2OH4A 5M4UA 1YOLA 3PXZA 4QMWA 4RJ5A 3EQHA 3KS8A 3EFLA 4H58A 4HZRA 3I7CA 3JR5A 4R1YA 4ZY5A 5BNJA 5DMZA 2F5SA 1PKDA 3QTXA 3NNWA 5DG5A 5BUEA 2ETRA 3HJQA 3RE8A 4NSOB 3CTHA 1H1PA 3NWLA 5DN3A 4LCBA 2F5NA 1ERKA 1GJOA 1YW2A 2BFYA 2QOHA 4ANRA 1GNGA 2PMOX 4XLIA 4ACCA 3BU5A 2L4EA 4I21A 4ERWA 5IH5A 1IA9A 3FYKX 2QG7A 1FVRA 3M42A 3WZKA 4JAIA 1QZMA 2RFEA 4G3EA 1YI6A 4J95A 4AZVA 2YFQA 1BYGA 1FQ1B 5FD2A 1J7UA 7CATA 3MB7A 3UVPA 4O7VA 4FV6A 3ZLSA 1JR3D 2CWBA 3GRYA 2VD5A 3R04A 3VBTA 5HBJA 3QU0A 3TDVA 2G3QA 1LPUA 2V7OA 5BR8M 3VRYA 4FJVA 4L45A 1FOTA 3AKKA 3MVLA 4FV4A 2FH0A 4AAYA 3CCNA 5FGKA 4MB7A 3ANRA 4Z6YA 3ZUVA 3R9RA 2XNMA 2W82A 2BKZA 1MP8A 3EQBA 4RLKA 3W8QA 5LQFA 2G01A 3EZVA 4FEQA 4JN6A 4MXAA 3QUEA 3W0PA 3PRFA 4V05A 2JIIA 2H1RA 3KRLA 1JKLA 1Q39A 1O6LA 4FCVA 2KTYA 4FV1A 1K3XA 4UYAA 3UMWA 2ESMA 4JDIA 5K5NA 4Z16A 3U60B 2QSFX 2V55A 2HENA 3O50A 5LWNA 5I4NA 3TG1A 5F9EA 4NIFB 1VYZA 2Q2EB 4PMPA 2PMNX 1QPJA 4WURA 3R7GA 3A62A 4TYHB 2BUJA 5EQEA 4NYEA 4I0SA 1OFIA 2IVTA 4HNIA 3MFSA 3ZDIA 3ZFYA 3ZO4A 3Q8XA 5KX8A 5AR4A 2DZOB 3IGOA 4L67A 4GH2A 5FRIA 4CSVA 4BVUA 1N36M 4EJNA 1PMNA 5A2QS 4F1OA 2F5OA 4LY6A 1XC8A 2CDZA 2W1ZA 5AR2A 2UW6A 1M7QA 3ZONA 2OW3A 2WMWA 3FZRA 2PU8A 3QTZA 1D0LA 1U5RA 3CKWA 4QEBA 3ETAA 4X3FA 1D2NA 4Y28F 1DV0A 3DK6A 3FUPA 4LL0A 5CQWA 5AR7A 4CKIA 2PMIA 1OIPA 1L8TA 4O4FA 2NNWB 5H8EA 4X3FC 5HBHA 2BAQA 4AGDA 1VDLA 3GLFE 1TQIA 2F2CB 4M12A 1SYKA 4O0YA 4BB9A 4YJOA 2W17A 2E9UA 4RSSA 3ZHPC 2LVOC 2YM3A 1TH2A 2IVSA 2CUZA 3MY0A 2EUCA 3O7LB 2UZEA 4TRLA 1JLUE 1OPKA 4WRGA 2C3KA 4QP1A 4LF5M 1KSWA 2FSLX 3CS9A 3GGFA 3ACJA 3MY1A 3QYEA 4KIQA 5IA5A 1R39A 2RRUA 2XKEA 3ZO1A 3HZJA 4QMNA 2XF3A 3MY5A 3GPXA 4MNEB 3LFAA 3N4TA 3PIYA 4K0YA 1C7YA 3KP0E 2MR9A 2DAMA 5FLXS 3FMHA 2YDKA 1QDRA 3C58A 4IB0A 4M7IA 3WYYA 3KXNA 5EXPA 4ANQA 3UIUA 1Y57A 2JKOA 2DWNA 2IZUA 1R7RA 4X62M 4KKEA 3W0RA 3OFMA 3P7CA 2ZTCA 4Y72A 4L78A 1DAYA 1G3NA 4CISA 3HJSA 2P4IA 1Q8YA 3CTJA 1WVWA 4L3JA 3BE2A 4D4RA 4X65M 4UY9A 4EOMA 4EH4A 2KULA 1B39A 4GIIA 4R7HA 2WEIA 4IFCA 3HKPA 4K6ZA 3MMPA 1M2PA 3QFVA 1Y6BA 2WPAA 4G3FA 3EMGA 4KIOA 4RQKA 4U9AA 2VWIA 5EKOA 5JT2A 2CMWA 5CX9A 5CI7A 4C3PA 5CF5A 3DDPA 4GRBA 3ENHA 3ORLA 4OTFA 4BDBA 4BZNA 1VJYA 3F9NA 3TACA 3G9NA 3VONA 3RWQA 4RIOA 4EYJA 2ITTA 2CV1A 3BHHA 2UXBM 2CHQA 4C4IA 3ZRMA 4YHJA 4J8NA 3LIJA 2QU5A 3SMPA 5FTJA 3NYXA 3OWKA 4HOKA 3LFBA 5BVOA 4PDOA 3SLSA 1FNNA 3F5XA 1OKZA 1ZYJA 2JLDA 2W7XA 4OT5A 3VF9A 3RVGA 1TH4A 3PXGA 2J5EA 3LE6A 4D2TA 2R3RA 2GS2A 3C0IA 4FKWA 5EK7A 3O23A 1LP4A 4EH3A 4U81A 4FZDB 4HPTE 3EQGA 3LXNA 5J9LA 1JR3E 3ZRLA 4LGGA 5F1ZA 5M53A 4O83A 3CGOA 3LFFA 3ROYA 2CGWA 2X7GA 1IAHA 4P17A 3MB6A 3EQIA 4EOPA 3QYZA 4S34A 3ROCA 2YIQA 3LHJA 2XEZA 4OR5A 5CT7A 4RX5A 1YDRE 3UPZA 3IK3A 4AP7A 3C4FA 1K3WA 1M52A 3KULB 4ZY6A 2LWXA 3RAWA 4MX9A 4HVGA 4PNIA 3UK6A 5AR5A 4Q9SA 3LM0A 4I4FA 2ERZE 2CPKE 3V01A 3MN3A 2LBCA 1MN3A 3KP1E 1M7NA 4PQNA 3EJ1A 5JGBA 4AXEA 4F9CA 3BLRA 3HNGA 3MVJA 2Y0QA 3FUUA 2G1TA 2O5RA 4QP3A 3Q9WA 4JMQA 3FD9A 4U41A 3R8UA 2R18A 4UMPA 4L6QA 3K1JA 3H9RA 2XK4A 3U54A 4BDDA 1PXPA 3TJCA 3BZ3A 2Z4SA 5LMNM 4WG4A 3VS5A 5ETFA 3OCTA 4F08A 4EJ7A 2ZAOA 2CGUA 2J0KA 2OBJA 3H30A 5GZ9A 1ST4A 3W2SA 5EKNA 2PUPA 3U6CA 2WMUA 3DZQA 3PFYA 4M0YA 4JBPA 1S3SA 2VAGA 4OTRA 1BLXA 5EHOA 2OIDA 4BI1A 3HJ8A 3LXLA 4L43A 2WMAA 3VKHA 4FL3A 3UNKA 3M0EA 3QGWA 5HIEA 2Z7LA 2BZJA 3EN9A 4L8MA 1V34A 2JITA 4IXPA 5C4LA 1HNXM 2VUWA 4PUZA 4G6LA 3PXFA 2PHKA 3UPXA 5E1SA 4FIHA 4Q5EA 4USDA 1QYRA 2R7BA 4A4OA 2IN6A 1PJTA 5FTLA 1MRYA 2C6LA 2Y4PA 4QTDA 5LVLA 5IREB 2XIZA 1QPEA 4IIWA 4CLIA 3DS6A 4JI4M 3QAUA 2BVAA 2B4SB 1NVSA 1LEZA 2Z60A 4FTLA 4AKHA 3IECA 4LJAA 1YRPA 2NO3A 4G3DA 2PVYA 3QWJA 4ZTRA 5JQ8A 4ALUA 2SRCA 4HJOA 5ANKA 3A8XA 4J97A 4EC9A 3TNWA 3E21A 2X7OA 2BJVA 4L68A 4LG2A 4ANNA 4QTEA 5M4CA 2OSCA 2UZUE 2OXYA 4XGIA 4I23A 4A9RA 5CWZA 4C62A 4QNYA 3L8VA 4UXLA 3BYUA 5EM6A 5HZNA 1J7LA 1JSUA 2BPMA 2VX3A 3R1NA 5HNBA 1HR0M 3IW4A 3R7UA 2KA6B 3LFCA 2OICA 4Q2AA 5IUHA 3TL4X 2J0JA 4I41A 4WNMA 5E8WA 3RPSA 2OZAB 4NFMA 3TZ8A 1GIHA 4DEIA 2Y6MA 2OO9A 3R1SA 3FMLA 1YXUA 2WMVA 2QOFA 1OL6A 3IPHA 2JUJA 5ITQA 2GFSA 1SXJA 2W1FA 2DZNB 4TYJA 2XNGA 4AZEA 4RF0A 5HLNA 4YGAA 3W0MA 1UWHA 3EN7A 1DI8A 3E64A 1E9SA 4CIZA 1GZNA 3PUFC 2HOGA 3MFRA 5HEZA 2XVDA 2ITOA 3EB0A 1DGBA 4FV9A 3R8VA 3UNZA 4OVZB 3SMSA 4MWHA 4C4JA 4CZUA 5JMSA 2HW7A 1Q3BA 3R8ZA 4O4BB 2RF9A 4M14A 3KMWA 4Z9LA 1A06A 5J95A 4M9SA 1H8FA 5I5ZA 2UW0A 5CAPA 1W0XC 4DBXA 5EM5A 4CXAA 3B8RA 4QMMA 3W0OA 1PGYA 2E5LM 1XNRM 5KQDA 3A7IA 3PY1A 4MBLA 3S4QA 5KO1A 4JS8A 4MVFA 3AT4A 4IAKA 4AQCA 2GPHA 3AOEA 5HE3A 1RU3A 1H0WA 2JBPA 2VZ6A 3PYYA 4MNFA 4C4HA 1EFUB 4XG8A 3UZUA 4UALA 3RKBA 4QYGA 2KNZA 3TV7A 5BVDA 1T46A 3W55A 4F1IA 3GLGB 1XMQM 2P55A 4LGYA 2QO7A 2UW3A 2YABA 3AKZA 4G16A 4KKHA 3NEWA 4XV9A 3VS6A 2BILB 2X6DA 4O2PA 2YDIA 1E94E 2HXLA 3D7ZA 3O96A 2BRGA 4NOOB 3Q9ZA 3D5WA 2C6EA 4DGOA 2BRHA 3UJGA 1KE5A 4O7RA 3KFUG 1OECA 3GCPA 4JRNA 3ZEPA 4YHHM 4WRSA 4DR4M 3M1SA 1G41A 4G6OA 4O0VA 5ETCA 3CY2A 1UFZA 3KXXA 2J50A 4FOCA 4O6EA 3L28A 1UNHA 3K3JA 3UQCA 2R3PA 3FI3A 5HIDA 3RGFA 3D94A 2G8LA 2UUCM 2QC6A 3JXWA 4FZ7A 5AM7A 5EOLA 2CN5A 5AADA 2FNAA 4MGKE 2RFDA 2X2LA 4I6FA 5FQDC 4D58A 2JDRA 4DTAA 3MJ5A 2W96B 5AUUA 4FR4A 4DC2A 1U54A 3N4VA 5IEYA 4NL4H 2YWVA 3RMFA 2VDBB 1OGUA 1PXMA 4FKPA 4L9IA 4WBOA 4EIWA 4YLKA 4HL4A 2O65A 4QQCA 4APCA 2VNYA 3LCTA 5KMOA 2HL7A 4GG7A 3TL8A 2J7NA 4YZCA 3WZEA 1IQPA 1IFYA 2ZBKB 4LJ9A 1WMKA 4FYNA 3Q60A 4PNKA 3AD5A 5LVOA 3BBZA 3K5VA 4EI4A 3NYOA 4U45A 3SYKA 2CGXA 4A06A 2OLCA 1N34M 4F1MA 5BPYA 4ZEGA 4IWDA 5H8GA 3QWKA 3UVRA 3EZRA 4YPSA 1KV1A 3OOMA 4AWIA 4EYMA 5KBQA 4OAUC 2QI8A 2E9NA 3R7IA 1GL6A 3QQUA 4AG6A 3DXPA 2QR8A 4E26A 2ZMDA 3SFZA 3U9CA 4DGNA 4WO5A 5CS6A 4RFMA 3O8PA 2L6OA 1OB3A 1Z6TA 3LW0A 3F69A 4FX3A 3OT8A 3MA6A 3W2CA 2C6OA 1XH9A 2F57A 2PL0A 4FZ6A 2JY6B 4XG4A 4D28A 2MGWA 1CSNA 2FYSA 3ANQA 3O71A 4XEYA 1CKPA 4CFNA 1OQYA 1PXNA 4NUSA 2YCRA 3WE8A 4NRVA 4DAWA 4MH7A 3IW8A 2IW9A 3A7FA 3HRBA 3R83A 5IQAA 3R73A 3ZUTA 4YJTA 4YZNA 2W9ZB 2R3LA 4I92A 4G4QA 2AC5A 4GT5A 2JBOA 3VC4A 3TDWA 3HYHA 3E5AA 2NQ8C 5FTQA 5HCYA 3G90X 2PVLA 1N32M 2XM9A 1LR4A 3B2TA 1JAMA 2XMYA 1H28A 3HMOA 3OD6X 4L42A 3LVWA 4PDIA 4W4WA 4ALVA 4HW7A 2WU7A 4BJJA 5D7AA 3V5QA 4RBLA 3VS2A 4RJ7A 3DXQA 3UOJA 4D9TA 1WJ7A 2EXMA 2JIVA 3QKLA 4GVJA 4P90A 1T6OA 4FZAB 3U5ZA 4JI0M 3P9JA 3QD4A 2ERCA 5H2UA 5DYJA 1Q8ZA 5C8KA 1J5EM 3CR0A 1QAQA 4PPAA 5J87A 4XG6A 4E4XA 3PVGA 4YSJA 3R7EA 4FEXA 4IWQA 4FV0A 4YU2A 2YCSA 3FKLA 3QKMA 4KLNA 3V6RA 4GEWA 4IVBA 3W18A 1R0PA 4LF4M 5DOSA 3L29A 4G6NA 4J99A 4BDIA 1B38A 5AX9A 2HZIA 2YM8A 2ZJWA 3PY0A 2LH0A 1NVMA 2ZDUA 5F20A 1U5QA 5BVWA 1MRUA 2BR1A 2OIBA 3C13A 3QGYA 1PJSA 4XP0A 2R3JA 3I4BA 3TE6A 4OTIA 4MD8E 3OG7A 4RRVA 1NNUC 4YJUA 4CEGA 4CV9A 2Z7SA 3R7OA 3ML1A 1H25A 4AI6A 4FT9A 4MGHA 1REJA 4OW0A 1UKIA 4JT3A 3CIKA 5ETAA 4D2PA 3KRRA 3LQ8A 3VAPA 5CEQA 1OBGA 2OPFA 1JBPE 2WQOA 4H36A 4ZS0A 3UDSA 3DTWA 5AMNA 2XK3A 2D7EA 2IO6A 4JAJA 5AR3A 2JAMA 3BYSA 2QQ8A 3BGQA 4Y46A 4TNDA 5L8RF 3AJIB 3MTLA 2W5BA 5CSWA 3GLHB 4KNBA 5JH6A 2RFSA 3F3VA 5E26A 4MCVA 5CEMA 5L2WA 3GP0A 4R5SA 4YMJA 5D11A 1GOLA 4HNFA 2I0YA 3BBWA 3ZSGA 3F5UA 3K9OA 5KHWA 2ONLA 3AL0C 2XKCA 5DT4A 3S3IA 2UVZA 4NTSA 1CDKA 4RZWA 5B7VA 3GU7A 3W0NA 2EU9A 2P0CA 3EIHA 2ZB0A 4IZYA 5CZIA 3KOXE 3M11A 2OWBA 3ZRKA 4NW6A 4JX3A 5EI2A 4IBKA 5LCKA 2QOOA 4BCIA 3A2CA 3HA8A 2BWEA 3I5ZA 5LWMA 2JP7A 2OOAA 3HL7A 4AG5A 4EZ7A 4F09A 1NA7A 2CNUA 4ZSAA 2HKJA 3G0EA 1FINA 2J4ZA 4LV5A 4NM7A 3NX8A 3BX5A 4WNPA 3U61A 4RIWB 4HYUA 1MX0A 2VWBA 2JY7A 3UJNA 2UUAM 4I4EA 4XLVA 2R64A 4IZ5A 2I7QA 3DBQA 5A4EA 4EOIA 4TYEA 4FICA 5J7BA 4AXFA 3UDBA 3HU1A 1BKXA 1WBWA 3UP7A 2WOTA 2QD9A 4QRCA 3SXFA 2DWLA 1NSFA 1NJGA 4GH9A 3THGA 3U6QA 1P14A 2JEDA 2OJ9A 2F7EE 3QQLA 4HPUE 4NJ3A 1XQZA 1K82A 2BFXA 3DJ5A 4GRIA 3ZC6A 3QZGA 2AHMA 5BV3A 3LJ2A 4CCUA 4FE2A 4LZJA 4IAIA 5GZ8A 5JN2A 3OBGA 3UZRA 2LHCA 4JI1M 3ZO2A 4DEEA 1WGNA 3NUAA 2ZOQA 3N9XA 4D1ZA 5AM6A 4DF3A 4IBIA 4QTCA 2OFVA 3VIDA 1FVTA 3P5KA 1UU8A 3QAME 4HCTA 1MQBA 5DRDA 3W67A 2VTRA 4M66A 2X0GA 3VF8A 4YTIA 4BBFA 2I7NA 4QPSA 3NRMA 3O17A 2C47A 2F9GA 4YJRA 2Y9QA 4BBEA 4ERKA 5BYLA 1GABA 3CKXA 1JQHA 4CQGA 2CHGA 4I8OA 2BHHA 4FIGA 4W4YA 5ETIA 3ZZWA 5I9VA 4IBFA 3GFEA 5L4QA 2QOKA 2GTNA 4J71A 2NRUA 5CF4A 2CKQA 2C0OA 2QOCA 3PIZA 4M8TA 5LVNA 2W1GA 5FDPA 3FQSA 2IVVA 3CF0A 4BDEA 3TQSA 3QQGA 3LFQA 3Q4ZA 4DH7A 4CTBA 1N77A 3C7QA 4BJJB 3Q4TA 5K5XA 2JDVA 2W1DA 3CPCA 3M7GA 1IY2A 4QNMA 1GY3A 1B6CB 2XH9A 3NYVA 2XS0A 4CYJA 3MJ1A 2QKRA 3Q96A 4BC6A 1ND4A 4NCTC 3QXOA 2UU9M 4KBAA 5IA4A 2KEBA 2ZV9A 5CXZA 5M57A 3GPYA 1IRKA 2JD5A 2ZDTA 4MGZE 3KXGA 3IOPA 5BPVA 3QXPA 4D55A 3AC3A 1OJLA 2IZTA 4XP3A 2PE2A 3OMVA 3MA3A 4M9ZA 3PJCA 2O5KA 2KHHA 3F3WA 3QRUA 4FIFA 4IWOA 3CPBA 1IN7A 3POZA 4GL9A 1IXRC 2OFUA 5E8VA 3SASA 3UDTA 5C8MA 4IE9A 3R7YA 4O7ZA 4HCVA 4NXMM 2OI4X 2WMRA 3SKCA 1AD5A 2WKMA 3P78A 4RFYA 5EDQA 3U6OA 2UXDM 4DH8A 4YSMA 4QP8A 3R9HA 2YIYA 2QQ7A 5E6JA 2P2IA 3Q4UA 2JY8A 3P7BA 3RNYA 2BKKA 2C4GA 4CMTA 5EI6A 1I94M 2OXXA 3EKKA 3NNUA 2B1PA 2NPQA 4PWNA 3KB7A 3SAWA 2NP8A 5JRSA 4CTCA 4UMUA 3M2WA 5ICPA 1Q8TA 1ZYDA 2A5YB 1OKYA 2VWZA 1HT2E 4FKTA 3ZMMA 1UU3A 4YZBA 3MSSA 4OBPA 2Z7QA 2VTLA 3P08A 4OUCA 5DH3A 3ZLXA 5HTIA 4AN9A 2GHLA 4FSYA 2BRNA 5CQUA 1APME 3GRVA 2WFYA 2QLUA 3L9PA 4L7SA 5HIBA 4AT4A 5GJFA 3NW5A 4F9YA 5I9XA 4EOOA 2DVWB 4QOXA 4PV0A 4M68A 4EHZA 4F7JA 4KA3A 5JEBA 3KFAA 3TUCA 5DEYA 2PVFA 1N75A 4NH1A 1U54B 4MQ1A 4GUBA 4C38A 2XA4A 4HYSA 1UWJA 3VRZA 5I3OA 4AXCA 2CE7A 3FRIA 2FO0A 4JG7A 4RWKA 3ULZA 2G15A 3DU8A 4QMSA 2HHHM 2YWPA 4G2FA 1PF8A 1GLNA 1OL5A 2BALA 3I01M 3E62A 3D7TB 4FMQA 4BKYA 4P16A 5LMUM 5L3AA 3IW6A 4M3QA 5HU3A 2BDFA 3RPVA 4DV1M 1Q5KA 2GTMA 2K6BA 4RNAA 3HX3A 3L1SA 4O4CA 2DYLA 2BIKB 2OF4A 1YOJA 3GT8A 4UMQA 3HU2A 1ZYSA 2F2UA 3NWWA 3O8UA 4AN2A 4EK6A 4AQYM 4Z3VA 3TKUA 4B6LA 3ORKA 5IZFA 1NT2A 1H1QA 4J52A 4YJQA 4ZSGA 2REIA 2EUFB 4JOAA 1J7IA 4O7SA 4QOSA 2EO2A 5C26A 2HZNA 3VJNA 1OMWA 1W2CA 4EH5A 2X4FA 2DENA 2ZV2A 3DB8A 5TE0A 1VEKA 3A4OX 1RQQA 3WF6A 5J8IA 2WHBA 4FK6A 5HLWA 2PYWA 4I6LA 3NUSA 4FT5A 4QT1A 3W10A 3C0HA 3MS9A 4I94A 1OAOC 1MQ4A 4AGCA 3U6DA 2RGOA 4RX7A 4DG0E 4F9BA 3ACKA 1IN8A 2JGZA 4MHAA 2CCHA 2WTKC 3FC1X 3IW5A 1OUKA 3OC1A 2EKKA 3MK6A 4GG5A 5TT7A 5I9WA 2E9PA 3R8PA 5KMMA 5M07A 3LM5A 1PMEA 3O7LD 3ET7A 1OL7A 1MU5A 2R65A 2F4VM 2WQBA 4F0IA 1YLAA 1OVEA 3E63A 2YIWA 3MPMA 3AC1A 3QA8A 3SOAA 3NIZA 5FTMA 3T3UA 3TT0A 4R3CA 3VBVA 4DV6M 3TM0A 3ID6C 4NT4A 3Q3BA 4TW9A 5KZ0A 2JKQA 2G9XA 1Z5BA 4S30A 3ORZA 2LGCA 5AP6A 2LTUA 4GC9A 4U80A 2A2AA 3COHA 3GQLA 2C5VA 5FSWA 1QQWA 5KE0A 4ZSJA 4K8AA 2C9CA 3FLSA 3PJ1A 5D41A 4AZSA 3SDJA 3BL7A 3H9OA 4BDJA 5KQ8A 2L7IA 4II5A 2VTTA 1XH8A 1W98A 1P2AA 4FGBA 4FV5A 3V8SA 4O7NA 3ATSA 4X2JA 1JSVA 4F4PA 4Y8DA 4QP6A 2XSZA 2HY81 3B7NA 1VQ1A 4MH0E 2FUMA 1BL6A 3SW7A 4EQCA 4NSRA 2GNIA 3DBCA 1L1ZA 1FMOE 1ZZ2A 3MFUA 4FIJA 4KRCA 4Y5HA 3ELJA 1OKWA 1OAIA 3C4XA 2B53A 2XNPA 1NY5A 3KXHA 4E4MA 4G34A 2BDWA 2Z8YM 3C0GA 1H26A 3M6AA 4V04A 5E8ZA 4GFOA 4NXNM 3HHYA 4YURA 5J5TA 4O82A 4LQMA 3HECA 5HI2A 3G0FA 2H8HA 4FKRA 3TUDA 3F92A 2JDSA 3K3IA 4QDEA 1A5TA 1P4FA 3QD3A 2WTKB 3K9PA 3DFCB 4WP2A 3FY0A 4BYJA 2XIXA 3VS1A 3IGGA 5JFVA 1IA8A 3CGWA 1GO5A 2XCHA 5DGZA 3QC9A 2ZV8A 4DN5A 4ZJJA 2W4OA 1BX6A 1WFCA 3QTRA 4NKAA 5CVFA 4H3PA 2MJ5B 4X3JA 3RZFA 5CYIA 3KS4A 5DEWA 5EQTA 1Q3DA 4RJ3A 4CZYB 3II5A 4F63A 2GNLA 3QRIA 4MBJA 3C9PA 4GIHA 1YXSA 2VV9A 2BAKA 3DY7A 4XG7A