2HAWA

Crystal structure of family ii inorganic pyrophosphatase in complex with pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
307
Chain Sequence
EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A trimetal site and substrate distortion in a family II inorganic pyrophosphatase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Manganese-dependent inorganic pyrophosphatase
total genus 110
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2hawA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2hawA01
1I74A 2EB0A 2ENXA 2IW4A 2HAWA 2QB6A 1WPMA 4LS9A 4RPAA 4PY9A 1WPPA 3W5WA 2QB8A 1K23A 1WPNA 1K20A 2QB7A 3DEVA
chains in the Genus database with same CATH superfamily
2EB0A 1W61A 3EJXA 4RPAA 2PW0A 2H9FA 5GL2A 4J9WA 3PVHA 3WQZA 3W5WA 1WPPA 2Q9HA 1SDJA 1K23A 2LT2A 1BWZA 1IR6A 4IJZA 4FC5A 2ZVFA 3EDNA 5ANPA 2ENXA 2KPTA 4GL6A 1U0KA 1U1VA 4PY9A 2PVZA 1YM5A 4K7GB 4K7XA 2MPBA 3DEVA 1U1XA 4DUNA 4JD7A 4Q2HA 1W62A 4Q60A 4K8LA 1K20A 2Q9JA 3IGHX 2YMAA 1QYAA 1XUAA 3EKMA 5H2GA 5IWEA 2QB7A 4IK0A 2ZXPA 5GKXA 2GKJA 5GL4A 1GQZA 4J9XA 4LB0A 1XUBA 1S7JA 3PTJA 2IW4A 2HAWA 2GKEA 1U1WA 2ZXOA 4JCIA 3ICJA 3FVEA 2QB6A 1WPMA 2QB8A 5GL3A 4DWZA 5M47A 3G98A 4JUUA 4LS9A 3PW9A 3G7KA 5H2YA 2KW7A 4LG3A 1T6KA 2ZXRA 4OA3A 1TM0A 1WPNA 2AZPA 2OTNA 1I74A 4JBDA 5HA4A 1QY9A
chains in the Genus database with same CATH topology
2EB0A 1W61A 3EJXA 4RPAA 2PW0A 2H9FA 5GL2A 4J9WA 3PVHA 3WQZA 3W5WA 1WPPA 2Q9HA 1SDJA 1K23A 2LT2A 1BWZA 1IR6A 4IJZA 4FC5A 2ZVFA 3EDNA 5ANPA 2ENXA 2KPTA 4GL6A 1U0KA 1U1VA 4PY9A 2PVZA 1YM5A 4K7GB 4K7XA 2MPBA 3DEVA 1U1XA 4DUNA 4JD7A 4Q2HA 1W62A 4Q60A 4K8LA 1K20A 2Q9JA 3IGHX 2YMAA 1QYAA 1XUAA 3EKMA 5H2GA 5IWEA 2QB7A 4IK0A 2ZXPA 5GKXA 2GKJA 5GL4A 1GQZA 4J9XA 4LB0A 1XUBA 1S7JA 3PTJA 2IW4A 2HAWA 2GKEA 1U1WA 2ZXOA 4JCIA 3ICJA 3FVEA 2QB6A 1WPMA 2QB8A 5GL3A 4DWZA 5M47A 3G98A 4JUUA 4LS9A 3PW9A 3G7KA 5H2YA 2KW7A 4LG3A 1T6KA 2ZXRA 4OA3A 1TM0A 1WPNA 2AZPA 2OTNA 1I74A 4JBDA 5HA4A 1QY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I74 A;  2EB0 A;  2ENX A;  2IW4 A;  2HAW A;  2QB6 A;  1WPM A;  4LS9 A;  4RPA A;  4PY9 A;  1WPP A;  3W5W A;  2QB8 A;  1K23 A;  1WPN A;  1K20 A;  2QB7 A;  3DEV A; 
#chains in the Genus database with same CATH topology
 2EB0 A;  1W61 A;  3EJX A;  4RPA A;  2PW0 A;  2H9F A;  5GL2 A;  4J9W A;  3PVH A;  3WQZ A;  3W5W A;  1WPP A;  2Q9H A;  1SDJ A;  1K23 A;  2LT2 A;  1BWZ A;  1IR6 A;  4IJZ A;  4FC5 A;  2ZVF A;  3EDN A;  5ANP A;  2ENX A;  2KPT A;  4GL6 A;  1U0K A;  1U1V A;  4PY9 A;  2PVZ A;  1YM5 A;  4K7G B;  4K7X A;  2MPB A;  3DEV A;  1U1X A;  4DUN A;  4JD7 A;  4Q2H A;  1W62 A;  4Q60 A;  4K8L A;  1K20 A;  2Q9J A;  3IGH X;  2YMA A;  1QYA A;  1XUA A;  3EKM A;  5H2G A;  5IWE A;  2QB7 A;  4IK0 A;  2ZXP A;  5GKX A;  2GKJ A;  5GL4 A;  1GQZ A;  4J9X A;  4LB0 A;  1XUB A;  1S7J A;  3PTJ A;  2IW4 A;  2HAW A;  2GKE A;  1U1W A;  2ZXO A;  4JCI A;  3ICJ A;  3FVE A;  2QB6 A;  1WPM A;  2QB8 A;  5GL3 A;  4DWZ A;  5M47 A;  3G98 A;  4JUU A;  4LS9 A;  3PW9 A;  3G7K A;  5H2Y A;  2KW7 A;  4LG3 A;  1T6K A;  2ZXR A;  4OA3 A;  1TM0 A;  1WPN A;  2AZP A;  2OTN A;  1I74 A;  4JBD A;  5HA4 A;  1QY9 A; 
#chains in the Genus database with same CATH homology
 2EB0 A;  1W61 A;  3EJX A;  4RPA A;  2PW0 A;  2H9F A;  5GL2 A;  4J9W A;  3PVH A;  3WQZ A;  3W5W A;  1WPP A;  2Q9H A;  1SDJ A;  1K23 A;  2LT2 A;  1BWZ A;  1IR6 A;  4IJZ A;  4FC5 A;  2ZVF A;  3EDN A;  5ANP A;  2ENX A;  2KPT A;  4GL6 A;  1U0K A;  1U1V A;  4PY9 A;  2PVZ A;  1YM5 A;  4K7G B;  4K7X A;  2MPB A;  3DEV A;  1U1X A;  4DUN A;  4JD7 A;  4Q2H A;  1W62 A;  4Q60 A;  4K8L A;  1K20 A;  2Q9J A;  3IGH X;  2YMA A;  1QYA A;  1XUA A;  3EKM A;  5H2G A;  5IWE A;  2QB7 A;  4IK0 A;  2ZXP A;  5GKX A;  2GKJ A;  5GL4 A;  1GQZ A;  4J9X A;  4LB0 A;  1XUB A;  1S7J A;  3PTJ A;  2IW4 A;  2HAW A;  2GKE A;  1U1W A;  2ZXO A;  4JCI A;  3ICJ A;  3FVE A;  2QB6 A;  1WPM A;  2QB8 A;  5GL3 A;  4DWZ A;  5M47 A;  3G98 A;  4JUU A;  4LS9 A;  3PW9 A;  3G7K A;  5H2Y A;  2KW7 A;  4LG3 A;  1T6K A;  2ZXR A;  4OA3 A;  1TM0 A;  1WPN A;  2AZP A;  2OTN A;  1I74 A;  4JBD A;  5HA4 A;  1QY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...