2HAWA

Crystal structure of family ii inorganic pyrophosphatase in complex with pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
307
Chain Sequence
EKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A trimetal site and substrate distortion in a family II inorganic pyrophosphatase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Manganese-dependent inorganic pyrophosphatase
total genus 110
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2006-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01368 DHH DHH family
A PF02833 DHHA2 DHHA2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.20 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2hawA02
3.90.1640.10 Alpha Beta Alpha-Beta Complex inorganic pyrophosphatase (n-terminal core) inorganic pyrophosphatase (n-terminal core) 2hawA01
1WPPA 4PY9A 2IW4A 1K20A 2QB6A 3W5WA 2QB7A 4LS9A 1I74A 2HAWA 3DEVA 1WPMA 4RPAA 2EB0A 1K23A 2QB8A 2ENXA 1WPNA
chains in the Genus database with same CATH superfamily
1T6KA 2GKJA 5HA4A 2ZVFA 2ZXOA 4JD7A 1IR6A 5IWEA 5GL4A 2PW0A 2LT2A 5H2GA 3EKMA 1QY9A 3G7KA 3ICJA 4DUNA 3G98A 4IK0A 3IGHX 1BWZA 4RPAA 1U1WA 1XUAA 3EDNA 3PW9A 3W5WA 3DEVA 2KW7A 1U1XA 1W62A 1WPPA 4Q60A 2ZXRA 4K7GB 1WPMA 1U0KA 1S7JA 4J9WA 1K20A 4LB0A 2QB6A 5GKXA 5H2YA 4JUUA 5ANPA 2HAWA 1TM0A 1K23A 3WQZA 4J9XA 3PVHA 1W61A 1I74A 1SDJA 4JCIA 1QYAA 2ENXA 2H9FA 2KPTA 1YM5A 2QB8A 4DWZA 4PY9A 5M47A 3EJXA 1U1VA 2Q9JA 1GQZA 4Q2HA 2IW4A 4OA3A 2PVZA 4K7XA 2GKEA 4GL6A 4JBDA 3FVEA 4K8LA 1WPNA 2OTNA 4FC5A 1XUBA 4IJZA 4LG3A 2AZPA 2QB7A 4LS9A 3PTJA 5GL2A 2EB0A 2ZXPA 2Q9HA 2YMAA 5GL3A 2MPBA
chains in the Genus database with same CATH topology
1T6KA 2GKJA 5HA4A 2ZVFA 2ZXOA 4JD7A 1IR6A 5IWEA 5GL4A 2PW0A 2LT2A 5H2GA 3EKMA 1QY9A 3G7KA 3ICJA 4DUNA 3G98A 4IK0A 3IGHX 1BWZA 4RPAA 1U1WA 1XUAA 3EDNA 3PW9A 3W5WA 3DEVA 2KW7A 1U1XA 1W62A 1WPPA 4Q60A 2ZXRA 4K7GB 1WPMA 1U0KA 1S7JA 4J9WA 1K20A 4LB0A 2QB6A 5GKXA 5H2YA 4JUUA 5ANPA 2HAWA 1TM0A 1K23A 3WQZA 4J9XA 3PVHA 1W61A 1I74A 1SDJA 4JCIA 1QYAA 2ENXA 2H9FA 2KPTA 1YM5A 2QB8A 4DWZA 4PY9A 5M47A 3EJXA 1U1VA 2Q9JA 1GQZA 4Q2HA 2IW4A 4OA3A 2PVZA 4K7XA 2GKEA 4GL6A 4JBDA 3FVEA 4K8LA 1WPNA 2OTNA 4FC5A 1XUBA 4IJZA 4LG3A 2AZPA 2QB7A 4LS9A 3PTJA 5GL2A 2EB0A 2ZXPA 2Q9HA 2YMAA 5GL3A 2MPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPP A;  4PY9 A;  2IW4 A;  1K20 A;  2QB6 A;  3W5W A;  2QB7 A;  4LS9 A;  1I74 A;  2HAW A;  3DEV A;  1WPM A;  4RPA A;  2EB0 A;  1K23 A;  2QB8 A;  2ENX A;  1WPN A; 
#chains in the Genus database with same CATH topology
 1T6K A;  2GKJ A;  5HA4 A;  2ZVF A;  2ZXO A;  4JD7 A;  1IR6 A;  5IWE A;  5GL4 A;  2PW0 A;  2LT2 A;  5H2G A;  3EKM A;  1QY9 A;  3G7K A;  3ICJ A;  4DUN A;  3G98 A;  4IK0 A;  3IGH X;  1BWZ A;  4RPA A;  1U1W A;  1XUA A;  3EDN A;  3PW9 A;  3W5W A;  3DEV A;  2KW7 A;  1U1X A;  1W62 A;  1WPP A;  4Q60 A;  2ZXR A;  4K7G B;  1WPM A;  1U0K A;  1S7J A;  4J9W A;  1K20 A;  4LB0 A;  2QB6 A;  5GKX A;  5H2Y A;  4JUU A;  5ANP A;  2HAW A;  1TM0 A;  1K23 A;  3WQZ A;  4J9X A;  3PVH A;  1W61 A;  1I74 A;  1SDJ A;  4JCI A;  1QYA A;  2ENX A;  2H9F A;  2KPT A;  1YM5 A;  2QB8 A;  4DWZ A;  4PY9 A;  5M47 A;  3EJX A;  1U1V A;  2Q9J A;  1GQZ A;  4Q2H A;  2IW4 A;  4OA3 A;  2PVZ A;  4K7X A;  2GKE A;  4GL6 A;  4JBD A;  3FVE A;  4K8L A;  1WPN A;  2OTN A;  4FC5 A;  1XUB A;  4IJZ A;  4LG3 A;  2AZP A;  2QB7 A;  4LS9 A;  3PTJ A;  5GL2 A;  2EB0 A;  2ZXP A;  2Q9H A;  2YMA A;  5GL3 A;  2MPB A; 
#chains in the Genus database with same CATH homology
 1T6K A;  2GKJ A;  5HA4 A;  2ZVF A;  2ZXO A;  4JD7 A;  1IR6 A;  5IWE A;  5GL4 A;  2PW0 A;  2LT2 A;  5H2G A;  3EKM A;  1QY9 A;  3G7K A;  3ICJ A;  4DUN A;  3G98 A;  4IK0 A;  3IGH X;  1BWZ A;  4RPA A;  1U1W A;  1XUA A;  3EDN A;  3PW9 A;  3W5W A;  3DEV A;  2KW7 A;  1U1X A;  1W62 A;  1WPP A;  4Q60 A;  2ZXR A;  4K7G B;  1WPM A;  1U0K A;  1S7J A;  4J9W A;  1K20 A;  4LB0 A;  2QB6 A;  5GKX A;  5H2Y A;  4JUU A;  5ANP A;  2HAW A;  1TM0 A;  1K23 A;  3WQZ A;  4J9X A;  3PVH A;  1W61 A;  1I74 A;  1SDJ A;  4JCI A;  1QYA A;  2ENX A;  2H9F A;  2KPT A;  1YM5 A;  2QB8 A;  4DWZ A;  4PY9 A;  5M47 A;  3EJX A;  1U1V A;  2Q9J A;  1GQZ A;  4Q2H A;  2IW4 A;  4OA3 A;  2PVZ A;  4K7X A;  2GKE A;  4GL6 A;  4JBD A;  3FVE A;  4K8L A;  1WPN A;  2OTN A;  4FC5 A;  1XUB A;  4IJZ A;  4LG3 A;  2AZP A;  2QB7 A;  4LS9 A;  3PTJ A;  5GL2 A;  2EB0 A;  2ZXP A;  2Q9H A;  2YMA A;  5GL3 A;  2MPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...