2HBPA

Solution structure of sla1 homology domain 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
KKSRLWVDRSGTFKVDAEFIGCAKGKIHLHKANGVKIAVAADKLSNEDLAYVEKITGFSLEKFKAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoskeleton assembly control protein SLA1
publication title Structure of Sla1p homology domain 1 and interaction with the NPFxD endocytic internalization motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis, protein binding
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.700 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hbpA00
2HBPA
chains in the Genus database with same CATH superfamily
2CKKA 1KHCA 3BY7A 3JB9H 2NWMA 1QKXA 4Z89A 1BYMA 2DIQA 2IG0A 6AT1B 1Q81C 4M7AF 1FWZA 1YIJA 1UTIA 3CCEQ 3I35A 4E7ZA 1K9MR 2OAUA 1M1KR 4AFSC 1OV3A 2DF6A 4HVVA 2QI2A 1VQ8T 4EIKA 3I55A 2ROLA 2J7IA 4MMLA 1JXOA 4KT0E 3QYHB 3G4ST 1W1FA 1C1AA 4BI4A 2DM1A 2HMAA 1HJDA 2FL7A 4IUTA 1T0HA 3EHQA 1U1TA 2R5AA 1CKBA 4DA4A 5GAMe 1RACB 2B86A 2MI6A 2V1QA 2JUFA 5KYWA 1E6HA 1JBMA 2DE0X 3MP1A 5IHIA 3REAB 4Q5WA 3MEVA 1JJ2P 1BI2A 5HK0A 1SHFA 5FLXE 2QGFB 2MMPA 5J3BA 1IHWA 1QW1A 5GAN8 1I5LA 1VQNT 1OU8A 2E5KA 3RNJA 1VIEA 2GQIA 1U8RA 3PVLA 1ZSGA 2NUTA 3CQTA 5FU6B 5GANf 1KIKA 1JO8A 3DKMA 5KCHA 2VV5A 2ROTA 4LUDA 3CMAT 3CPWA 2E3IA 2COWA 4ZTJA 4C0DC 2NLUA 1XJWB 3MEAA 1M2VA 2K3YA 3CC2Q 2OI3A 4N4IA 3H41A 4RTZA 2DPPB 1G83A 1D3BB 1A0NB 3T9NA 1X01A 1M3AA 1SEMA 5GAOl 3OYIA 2RK2A 3PVQA 4OMNA 3M9QA 1B07A 2HZYA 2YSQA 3VYHB 1PD1A 4F17A 2OJ2A 2YUQA 4HKEA 2ESWA 1D1CA 4AG2C 3V8JA 1M8MA 2EYQA 1VQ4T 4CC4B 1R8OB 4M77B 2A3LA 3L2QA 3QXEB 1D1AA 4FT2A 3HSBA 3GOXA 2YUOA 3M0SA 2RD1A 1H641 2XMFA 2FPDA 4NL3A 2RQVA 1PWTA 1BK2A 2LQWA 3OYFA 5GMKh 3EGDA 2MK5A 4J9GA 2QQRA 1PSFA 2DETA 2CP5A 4JDSA 2KRSA 2D9TA 4OF1A 5GANh 1ZHIA 3BW1A 2MWOA 4M78G 4CC7A 4LDXA 1X2KA 4E2FB 3L42A 1RABB 2CZ1B 3HL8A 3IQLA 2IPOB 1YHQA 2V1RA 5LJ5d 4F04B 2RHUA 1B34B 3LLRA 3L2WA 4KRTA 3JCMW 2RF0A 1EZZB 1OZ3A 1ZUYA 2M16A 4A54A 3CC4Q 1VYUA 3TU4K 3JRZA 4LXCA 4Z88A 5GAOm 3M0PA 3MEUA 2OX7A 1QVFP 1HK9A 3LGFA 3OBYA 4RMOA 1NM7A 3FJ5A 2A08A 1M90C 2CZ6B 3GF5A 4FU6A 4MDXA 4OB3B 4EMKC 2PU9B 4JS5A 1N27A 1YJWQ 4JZ3A 4PJOE 2OTLQ 2HAXA 3SHWA 5FU7B 3NHNA 1VIFA 5GMKl 2RO0A 4AG1C 1PM3A 1MMNA 1SHGA 4MZPA 1K8AC 3CCSQ 1OPLA 1BI0A 1AHJB 1R0CB 1VQ5T 1S72A 2WSFE 4KGVB 2QA4T 2EW3A 5LL6S 4HCKA 3J80E 1CSKA 3INZA 2JZ2A 1UB4A 2QDYB 3O8VA 2NUZA 2O4XA 1K76A 4M75F 4NL2A 1NG2A 2KT1A 2KGTA 4MZTA 3EG1A 2KROA 5KYNA 1FXXA 4C0ZA 2EQKA 2F1LA 4C92C 3CEYA 4C8QA 2EGAA 4M78A 2K4YA 2JM8A 3MHXA 2CUBA 4JJCA 1PKTA 4J9CA 3P8HA 2EYWA 3A8LB 2CGHA 4OGEA 3SFMA 4PNOA 4FL6A 4KULA 4RTYA 1ZBJA 3I9QA 5KYWB 3OQ5A 2RQUA 1VYTA 2D8HA 3CCUA 1M27C 1V1CA 2F5KA 2ZPFB 3RMQA 3CCJA 1KFZA 3I56A 3JCMb 4FYXB 1Q7YC 3TVTA 3SWNA 2FG0A 2HDAA 2DRKA 1OPKA 2E70A 3JCMf 3PGGA 5FROA 3CCMT 1PHTA 4IIOA 3JCMJ 3M55A 4R56A 3I5SA 4M7AA 4A4HA 2JXBA 5LJ3g 5GMKm 1NE8A 2H3EB 3M57A 4C92E 2JVVA 4KH0B 2F5TX 1SSFA 3ZEHA 1ZUUA 1MV3A 1N8RR 4WF2A 1VQOA 2KQWA 1YJNA 1B3QA 1QKWA 1AZGB 2EKOA 4M77G 4PJJA 2DO3A 5I22A 1RAAB 2RNAA 1H3ZA 2P84A 1UJ0A 4LN2A 2EBPA 4C5IA 2SRCA 4FT4A 1WNLA 3NTKA 3SB2A 3CMEQ 3CCRT 1LVKA 4XU1A 4KGZB 1RLQC 1JB0E 4N0AA 1S1NA 5GAN2 1VQ9A 5KE3A 3G71Q 3I5RA 3M53A 2ECZA 5FRMA 4JLGA 2K5FA 3VUBA 3VS7A 2DK3A 3V8KA 2CP7A 3V7SA 3EGDB 1YI2A 1QCOA 5C6SA 2I0NA 2ED1A 2ZPHB 4IIMA 2IIMA 1M5Q1 2FZGB 1TUGB 2QEXA 2EJ9A 3JCMh 3MP6A 3G6ET 2RHIA 5CR2A 2LTOA 1RAIB 4LNPA 2ATCB 2EGEA 3R6NA 3UPUA 1YP5A 4IURA 2VGNA 1OX9A 2K3BA 5EC7A 2GQVA 3OW2A 2LX7A 4C92D 2I2LA 2X4YA 4PLIA 1SF9A 2QAZA 4PJOF 4D8DA 1K0SA 2DAQA 4F7UF 2GFUA 3UT1A 2CZ0B 1UG1A 5FU6C 1C0MA 1SPKA 3M4YA 3OS1A 2LNHB 5I2MA 4Z8AA 3PMIA 3CCVA 1KQSS 1WI7A 2DL8A 3CC4A 2YUNA 2K5IA 4B9WA 5D7UA 1O9SA 1TH7A 2LT1A 1D09B 3A98A 4IUUA 1OOTA 4J9DA 2XIDA 1M1FA 1WFWA 1YJ9A 4JUVA 1Q82R 3S3NA 3E9GA 2EIFA 4FSXA 1W70A 1YIJT 4ANJA 1E6GA 4OVAA 5IHKA 3PTAA 2RK1A 2LCLA 3MP8A 4XTWA 4ZN3A 2RQWA 2BZ8A 2L0AA 3NGPA 2YXYA 4M77C 2BUDA 1VQ8Q 1K73R 3DB4A 2FRWA 3I55T 2XD0A 1Q86C 1RADB 1QQJA 2QGGA 3G4SQ 2O4XB 3NFCA 1YBYA 3L1AA 1GXIE 1QLYA 1ZSZA 1SG5A 1M2OA 4D6WA 1FMKA 1TWBA 4C0GA 4J6XA 3HFNA 1T3SA 4BDZA 2LCCA 5IXFA 2YLBA 4XTUA 1QVGS 2DD5A 1X75C 4C8QB 4XU0A 1NPPA 1VQMT 4M78B 1W2BP 1VQNQ 4J6YA 2HQEA 1NEBA 2XDDA 2XDBA 1WHKA 4M77E 5GANg 1TTHB 3CMAQ 3X28B 3OW2S 2HKNA 1DJ7B 2D8JA 3RR6A 5CO7A 3SWNB 1SRLA 4QT7A 1GBQA 3TQ7P 1YITA 4CC3A 2L8DA 2EJGA 1BIAA 4LD6A 2VGMA 3FC3A 7AT1B 2Z0WA 1VUBA 4M75A 2HL3A 4FYWB 1KG1A 5GAMf 5LJ5e 2VC8A 4PFOA 1B7TA 1X2QA 2FVUA 1OX8A 1KC8U 3RDVA 1KSWA 1LJOA 3JAME 3UA6A 1OULA 3QZ9B 2DILA 3RBBB 4X9CA 1VQ4Q 3CCQA 3M5AA 3PNWC 1WQWA 2COYA 3JB9I 3X25B 1K0XA 1OEBA 1Y71A 5FU7C 5DY9A 1Y0MA 1Y57A 2DVJA 2DERA 2DYIA 4RG8A 3V7CA 2RMOA 3OYJA 4ELZC 2JS2A 1RUWA 4N4HA 2F69A 1M90R 1F1BB 2EGCA 1D0ZA 2J6FA 1X6OA 3FRNA 2DIGA 5ECAA 4XTVA 3UDCA 2QXFA 2CDTA 1AD5A 3X26B 3L2RA 2DLPA 2KT8A 2DA9A 2E1HA 3EG3A 2LVMA 2GNCA 2PUOB 2O31A 4LD9K 2K7AA 3UATA 4F7UG 4PL6A 2PZ1A 3REBB 1YCSB 1UHCA 3WVDB 3RESA 4M77D 3D7SB 1M8VA 2QG9B 2DXBA 2AIRB 1GBRA 1YHQT 1P92A 3HRUA 3QO3A 1TUCA 1MMGA 1G3SA 2L3QA 3JB9J 4M7DF 1IHVA 4ZNXA 2LQNA 5CAIA 1K9MU 2CYZB 1UGQB 1M1KU 4EMHA 5GAMh 1JU5C 3AHUA 1RAGB 1XTDA 2EAYA 2E5QA 4MDWA 3EGUA 2CSQA 8ATCB 4JJDA 2CT3A 2YUPA 2J06A 2DL7A 4L5GA 3RKYA 4QQGA 1W2BA 4PLLA 1YCYA 4JRQA 1QWEA 2QYZA 3Q1JA 5LJ3d 3NPFA 3ULRB 2K2VA 5IH2A 5GAOq 3EHRA 4QVCA 1X27A 2HD0A 3ASKA 1VQPA 2DXUA 4R0KA 4Y91A 4FIBA 2GGRA 3OMCA 4FYYB 1LCKA 4A63B 2DZCA 2H8HA 1IXDA 5LJ3j 1S72T 3JB9G 2M02A 3VRZA 1W4SA 3GPLA 1XNIA 5I21A 2RQTA 1VQ5Q 4JJBA 2K2MA 2QA4Q 4HVUA 2G6FX 3JSCA 4PFPA 4AFZC 1WXUA 2LX9A 4C5HA 2BE7D 2M9UA 1KC8C 3EAEA 1WJQA 5D6YA 1ABQA 2P0QA 2RN8A 2YWWA 3VS2A 2AZSA 4L6V5 3PE0A 2DEUA 1MGQA 1GCQA 4PJOA 4AT1B 2YRCA 1WDXA 2J6OA 2WSCE 4F7UA 3CC7A 4C8QG 4F16A 1VQ8A 2E12A 1GCPA 3CD6T 2CP2A 3UWNA 1BIBA 5FRNA 4J83A 2RB6A 2DX1A 1OI1A 1VYVA 1BCOA 1MHNA 4QVZA 5CKDA 3HHTB 1WXBA 3CCUT 2JOYA 2A0FB 1KQSP 3CCJT 3OYKA 4F14A 2X3WD 2Y4YA 3I56T 4AFQC 5KCOA 3OBWA 2GF7A 2AHJB 1K1ZA 3V7RA 2YT6A 1QWFA 5CVIA 2LJ1A 3CPFA 2KSSA 5LJ5j 3C12A 1UJYA 4BB7A 4ME7A 2PTKA 3CXCP 3CCMQ 4E7IA 3CPWS 1JJ2A 2OTJT 3JCMg 5DLOA 3KUFA 2A28A 2GCXA 4EMKA 1KJWA 4M7AG 5GAN4 1NEGA 4X34A 1VQOT 1LNXA 1FX7A 3H0HA 4KUIA 2VYTA 1YJNT 1VQLA 4IKFA 1K9MC 5HY6A 3EFRA 4QQDA 3JCMX 4J6WA 1AVZC 2RHZA 1VQ6T 4M75B 2E64A 3RERA 8AT1B 1G5VA 2DFUA 2JS0A 3CCRQ 2AK5A 2EQIA 1YNZA 1IRXA 3PMTA 2VB6A 3L2ZA 4FSSA 1VQ7Q 3NMZC 1VQ9T 9ATCB 3M0QA 4ZGJB 2GTOA 3S3OA 3FJPA 2L2PA 1RL2A 3OYCA 5CK9A 1NJIR 1VQ4A 1VA7A 1UGRB 1JQQA 4LE9A 5IHNA 3CCEA 4ESRA 2XU8A 3QJYA 4A4FA 4PFZA 1JRIA 2ED0A 2QK0A 3OYEA 1GFDA 1NLOC 2LC4A 2JNGA 2C0TA 1YI2T 1V29B 2C06A 4JLIA 3VV0A 2M51A 5CKFA 3OYYA 1KD1R 1LOJA 1ZA1B 2BKDN 2XHCA 2QEXT 4QKUA 3OY9A 2C0IA 1RAHB 2CH4A 5FWBA 3G6EQ 1XQHA 3HFOA 4ZGEB 1AOJA 2AT1B 2BIVA 1VQKT 3VS6A 5GAN7 3H6ZA 3TSZA 2KI7A 4C8QC 2JTEA 3G1JA 3ME9A 4M78C 1ARKA 2F2WA 2FRYA 3C0CA 3M58A 4ATOA 2X4XA 2NUTB 5IAYA 1NBEB 2AKLA 2ZZDA 2KVQG 3M4GA 1NJIU 1TXQA 5GANd 3CCVT 5FWCA 2KY9A 1RLPC 3X24B 2L3RA 3TREA 3LYIA 3DLLA 4KGXB 2W10A 3VJPA 5GMKj 2FZCB 1JJ2S 3A8MB 3OYMA 2MPXC 1M2VB 1T3LA 1N5ZA 4CRIA 1KD1U 5GANj 3EFOA 1EIFA 2DBKA 3CC2A 2LT4A 3SWNC 2DL3A 4DBQA 2X51A 1YJ9T 1GRIA 4RCBA 1Z9QA 3CXCA 1QVFA 3R6OA 5I2SA 1ACMB 1X6GA 1YIJQ 4JRPA 4C8QE 3OS5A 3VS4A 2D0NA 4PJMA 3M56A 4M78E 1H92A 1IGUA 1VQ7T 4RTVA 1D0YA 1G3YA 1BU1A 2R5MA 3TCJA 4AMCA 3OYAA 3QYGB 1PC0A 1Y7XA 2OAWA 5KYXA 4E6RA 2A7YA 2E6ZA 2PVOB 3I55Q 2YHTA 2CP0A 2G3RA 2QTVA 4E7JA 5CIUA 1K4US 4M7DA 2QASA 1VQ5A 3F70A 2CP3A 2ZPGB 2QA4A 4RUGA 3C4SA 4QQ6A 2ZPEB 3DLMA 1N8RU 4E7SA 3FLGA 3QWYA 5CKHA 1EX4A 2F2VA 3A8HB 1JEGA 1WJSA 3H9NA 4N0AC 4ZN1A 4J8OA 1V76A 4A4EA 1Q81R 1U06A 4PJOB 1ZA2B 5IT9E 2JW4A 3OSVA 4OMPA 4F7UB 1WHJA 2VXEA 2MIOA 1PCXA 1VQMQ 3LGLA 3OYBA 4O5VA 1MNEA 2O9VA 2YRVA 2L3SA 1TS9A 2FZKB 2L5QA 4X9DA 2HKQB 4LDVA 1Y07A 2F2XA 1NLPC 2O2OA 2Y4XA 5AT1B 3MO8A 3VRYA 2CT4A 1QCFA 1OQKA 3FEOA 3FIFA 3NTHA 2O88A 2DTIA 2ZAEA 3VS1A 2KXCA 2ENMA 4MZMA 2ZGWA 1YITT 4N4GA 3CCLT 2GFAA 2V26A 1WYXA 1D3BA 1WZOA 1NZ9A 4C8QD 4M75G 4M78D 5CKEA 1I4K1 5GAMg 1Q81U 1NYFA 2H3JA 5I11A 5GAOn 2K5LA 4Y28E 3CCQT 4XU3A 4OB2B 3META 1UEBA 3GBQA 2DD4A 1YJWA 1NPRA 2A37A 2DVEA 2M1HA 2OTLA 3M0TA 2KRNA 3CBOA 5HKCA 2RH2A 1U1SA 4GLKA 5CCAA 2QDLA 1G2BA 1M4ZA 4LUEA 2PUKB 1IZ6A 1GFCA 5KYYA 4GLMA 2QQAA 5J39A 3CCSA 4OMFB 2LMJA 2PNIA 3CCRA 1AT1B 1AWJA 3JCMc 1WHHA 2EYXA 3QSUA 2RQRA 3FDRA 5LJ3e 2KR3A 1MV0B 4DBHA 3BFMA 2WSEE 2DTOA 2MWPA 2VUBA 1RI0A 1X69A 2MF2A 1WQ7A 4HXJA 4PKCC 4JS4A 2GBQA 3V8LA 1YHQQ 3SD4A 2NYSA 2HSEB 1RI9A 3CPWP 5LJ5f 2RI3A 1U3OA 3O5ZA 4A4GA 3RIRA 4C92F 1Q82U 3HRSA 4RTUA 5KYUA 1N8RC 2W0ZA 3JCMV 4J9IA 3M54A 3OB9A 2KNBB 5IN1A 1D0XA 1SRMA 2DL5A 1U5SA 1UECA 1K73U 2LQ8A 1NYGA 5FW9A 3SDZA 4EPCA 4ORZA 1I1JA 3RUXA 5GMKi 5HK3A 4ELYC 2QTXA 2CH4W 1Q95G 3X20B 3J81E 1PSEA 4HT9A 4Z02A 1G8XA 1WHGA 2DRMA 3JCMd 4M7AB 1I8FA 1FMWA 2RJEA 1CKAA 2KMTA 3MPUB 1TOVA 2GTJA 2DTHA 4RCCA 4JJNK 3LW5E 2XK0A 1VQPT 1M30A 4EMGA 1FMVA 2YRDA 1MUZA 2DL4A 4LDWA 3LWHA 3EFOB 2O9SA 2RJFA 4OB1B 1S72Q 4RKUE 4II1A 2RI2A 2J6KA 4M75C 1SKUB 1PKSA 1UUEA 1TUDA 2DMOA 3OYDA 2K79A 4P5NA 3PT9A 1N6AA 3CMEA 5L8RE 5LJ5h 3AT1B 1WXTA 5EG2A 3QDFA 1BI1A 3EFSA 4X1VA 5KYXB 3NTIA 2QQBA 4PJNA 3QZ5B 2MYSA 3CC7T 3PFSA 3QUIA 4PJOG 3BE3A 3G71A 5AYFA 2FPFA 4M7DB 4J5YA 1KQ2A 4UC4A 1KK7A 3CD6Q 3OS2A 1QP2A 1K8AR 4RG2A 2DNUA 5DLQE 1IREB 3EG9A 3S6WA 2KYBA 4DBRA 1ZLMA 2LDMA 3QKJA 3LX7A 2X4WA 2V8KA 2XI9A 3CCUQ 1UE9A 4BE2A 4MMKA 2D6FA 1QCNA 2LZ6B 1ZQ1A 2KK4A 3CCJQ 1AWOA 4M75E 4DOWA 3I56Q 2CUDA 3H0IA 4E7KA 4R55A 2Y90A 5GJVB 1AEYA 2DBMA 4DOVA 4J7FA 1TSFA 1VQMA 2C0OA 2HBPA 5IXBA 1M90U 2X3XD 2ZPIB 1HSQA 2OTJQ 1PNJA 4BY6B 1QP3A 3URGA 3OA6A 1UGPB 2X35A 4QVDA 2RHXA 1Q82C 3UA7A 2RM4A 3P8DA 1VQLT 3RKWA 2PQWA 1VQOQ 1W6XA 4IUPA 4C5EA 1YJNQ 3L2VA 3QDRB 3HKSA 1BI3A 1JXMA 2DYBA 4ZTFA 2M0OA 1K8AU 1K73C 2YLCA 3HPWA 1VQ6Q 1OZ2A 4V2SA 3THKA 4XTXA 3M59A 1Q7YR 2EWNA 5KH6A 5GMKe 1BBZA 4AFUC 2CS7A 1EFNA 4J9EA 2JMAA 3QJ6A 2XICA 3DB3A 3E2UA 1UGVA 2NUPA 1E7OA 1VQ9Q 1MNDA 5GANe 1QVPA 2EVRA 2RI5A 3G7ZA 2PVGB 2AKKA 3CCET 1YN8A 4C92G 5KYYB 2EKHA 3EGXA 1OU9A 3S3MA 3KBGA 2V8JA 4OMLA 1YI2Q 1X6BA 2KBTA 4FW1A 1H3HA 2JJ9A 1G3TA 2QQSA 4M77F 1I81A 3E9FA 4NOYA 4XU2A 1ZSZB 1M1GA 3VU3C 4M75D 2QEXQ 2P0PA 3A5ZB 3G4SA 1UHFA 4O6JA 4FW2A 4BI8B 2K3XA 1WLPB 1KQ1A 2FB7A 2ZPBB 5GAOr 1Q7YU 1VQKQ 2HNIA 2RHYA 4XQ3A 1GCQC 4PJOC 2LJ0A 5GAOp 1I0CA 2HL5C 2FHDA 4HCZA 1KHIA 4XAXB 1VQNA 1ZX6A 5KYUB 5A2QE 2J05A 5A0DA 2EFIA 5DM7R 3M0UA 4GBQA 4OMOA 3RKXA 2R57A 2RJDA 3MKDA 2LCSA 3QBYA 3CCVQ 4HCCA 1PRLC 2DXCA 3TSWA 1FYNA 4L59A 4NS5A 3CMAA 3J7AF 4JZ4A 3MCAB 1HD3A 2VWFA 4A53A 2COZA 1M1KC 4JPBW 1Y96A 1W2BS 4HA8A 4HT8A 3CC2T 1MMDA 2JMCA 1O75A 2D1XA 1K9AA 4BI3A 4XK8E 2E4HA 3OS0A 3A8GB 1YJ9Q 3OYGA 4FM4B 3U23A 2A36A 3FB9A 4F7UE 1ABOA 5GAMd 2K57A 4VUBA 2CREA 2MCNA 3VS0A 2EYYA 1QVGP 2HEQA 3C94A 4BE1A 3WVEB 3JCMQ 2JTMA 5GAMj 3UF4A 4C92A 2P4RA 3ZFJA 4M7DG 4WCIA 5GAN6 1R0BG 1AZEA 2EQMA 3OSSC 2YDLA 1AWXA 2BZYA 1I5OB 1LPLA 4WTOB 2D0QB 3OYHA 3OW2P 3CBPA 4OGCA 3PIPA 3MEWA 4HVWA 4RTWA 2P0KA 2CZ7B 4HCBA 4JRIA 3EG9B 3QHSA 1OYXA 4BDYA 3CD6A 3TEEA 2E10A 1Q86R 1UDLA 2HBWA 2RJCA 5CQXA 3QG1A 2HCKA 4KH1B 1MMAA 4OMQA 4C0DB 4CI0C 1PD0A 1RAEB 3LH5A 2E41A 3CC4T 4J9FA 4PJLA 3HTRA 3GIBA 4C5GA 1YITQ 5GJWB 3P8BB 3CCLQ 1TU0B 2E65A 3M0RA 1M3CA 3LWIA 1KQSA 3ZL7C 4CC2A 4PJOD 1ZUKA 1UFFA 2OTJA 1BCMA 3E1SA 2RPNA 1T0JA 3CBMA 4B9XA 3GP8A 2VXFA 3BDLA 4M7AC 2JN0A 1WHLA 4BACA 1YJWT 3VKIA 2DZ9A 3MJXA 2OTLT 3CCQQ 3KFVA 2VASA 2R58A 1WX6A 3L2UA 4GY5A 3VYGA 3JCMP 1WPYA 1Q86U 4XTYA 2B8AA 2L3PA 1VQ6A 3CCST 4B6MA 2K6DA 4PK4A 5M9OA 2RA2A 2XKOC 1G3WA 4DEXA 2NUPB 5D6XA 3ZBDA 3JCMe 1ZBXA 2HQXA 2L89A 2KEAA 3KXTA 2FO0A 2DJZA 3EG0A 3E19A 2KYMA 1N9RA 2WACA 2SEMA 3EGXB 4BD3A 1WHMA 4M7AE 2EJFA 4DQ2A 2IVWA 3EH2A 3QPHA 2EPDA 1QVGA 4BE0A 4M7DC 5D6WA 2AZVA 2E6NA 5LJ5g 5CKBA 2DEQA 1TG0A 2XG8D 1C6VX 3BDUA 5GAN3 3JB9D 4OP0A 5KE2A 1PRMC 3QIIA 2VVKA 4DEYA 2EQUA 2MOXA 2JT4A 3H0FA 3GNGA 2BE9B 2FPEA 4KBMB 1XOVA 1Z9ZA 1M9SA 1VQKA 4KUDK 4YTLA 4EDUA 2KRMA 4Y92A 3VUZA 2E3HA 3EH1A 1YFNA 4RTXA 3H8ZA 4EMKB 4E7HA 2CSIA 5LJ3f 3CCMA 2LP5A 4BY6C 1BB9A 1VOMA 2O01E 1VQPQ 4D8KA 2KAFA 1HYOA 4M7DE 1NJIC 4OMMA 1Y96B 2FYKA 1M3BA 4BUGA 3OYNA 2P4TA 4M77A 5J26A 2HSPA 2MAMA 3CXCS 2EQJA 5C0MA 1QVFS 1KD1C 1IGQA 2BZXA 3VS3A 1WA7A 1N9SA 4OB0B 1WGSA 1PG5B 3CMET 3GLXA 2LJ3A 2V8IA 1HXDA 5L23A 4M7AD 1QMCA 4J9HA 2ABLA 1VQ7A 4JRKA 2M0YA 1H8KA 3G71T 1GL5A 3CC7Q 4C92B 2ZCFB 1R77A 1IO6A 2LNVA 3OMGA 4J9BA 5GAN5 4IUQA 3ER0A 3HRTA 4E47A 2LQKA 4RTTA 3VS5A 1I07A 4E7LA 2KDSA 2LRQA 4FCYA 3JB9F 2X4JA 1RAFB 2DXTA 3A8OB 1ZSZC 1IB8A 2JM9A 3OYLA 1B34A 2CP6A 1AWWA 4C0FA 3LH0A 2JTFA 4IUVA 1KC8R 3N5BB 3EG2A 4LDUA 5LJ3h 1WJRA 3G6EA 2K9GA 3JV3A 1WIEA 1BKBA 2XDPA 1YWOA 2DJQA 5HCKA 4FYVB 4XTZA 4J7IA 4TVRA 1YWPA 4QW2A 1SSHA 4M7DD 5A0LA 4C8QF 3GNFB 2HQHA 3RMSA 4M78F 1VQLQ 2QQ9A 4LDYA 2PVDB 2KXDA 2FEIA 1J3TA 3A1PA 3WXMB 2BTTA 2VKNA 3C95A 5CQYA 1UGSB 2DKGA 2EYZA 4K11A 3CCLA 3HP9A 2X9HA 4M4ZA 4ZGDB 4DBFA 5A0GA 1X43A 3QWXX 4A4KA 3PIOA 2KE9A 3SEMA 1D1BA
chains in the Genus database with same CATH topology
5FU6C 2V8JA 2CKKA 3M4YA 2BIVA 1KHCA 5I2MA 3OS1A 1VQKT 3BY7A 3JB9H 5GAN7 3PMIA 1G3TA 2QQSA 3CCVA 1KQSS 1BYMA 3H6ZA 4M77F 1I81A 3E9FA 4NOYA 2DIQA 4XU2A 2IG0A 3CC4A 4C8QC 1M1GA 3VU3C 1Q81C 4M75D 3ME9A 2P0PA 3A5ZB 1FWZA 4M78C 1YIJA 4M7AF 3G4SA 3M58A 2K5IA 4ATOA 4B9WA 4O6JA 2X4XA 1O9SA 1TH7A 2LT1A 2OAUA 4BI8B 2K3XA 5IAYA 4IUUA 1KQ1A 2ZZDA 2KVQG 2FB7A 3M4GA 1NJIU 2ZPBB 2QI2A 2XIDA 5GANd 3CCVT 5GAOr 1VQ8T 2KY9A 3X24B 1Q7YU 2HNIA 2L3RA 3TREA 2RHYA 3LYIA 3DLLA 3VJPA 1M1FA 4XQ3A 5GMKj 1YJ9A 3I55A 4PJOC 4JUVA 4KT0E 4MMLA 3A8MB 3OYMA 3E9GA 2EIFA 3QYHB 4FSXA 3G4ST 3S3NA 1YIJT 4BI4A 5GAOp 4OVAA 2FL7A 4IUTA 3PTAA 2FHDA 2RK1A 4HCZA 2LCLA 1KHIA 4XAXB 3MP8A 4CRIA 4XTWA 1U1TA 4ZN3A 2R5AA 5A2QE 4DA4A 1KD1U 1VQNA 5GAMe 4M7DB 5GANj 1EIFA 5A0DA 2EFIA 3CC2A 2LT4A 3SWNC 5DM7R 2MI6A 2JUFA 4M77C 3RKXA 1JBMA 2BUDA 2R57A 2RJDA 3MP1A 3DB4A 3QBYA 4HCCA 1YJ9T 2DXCA 3I55T 4Q5WA 3MEVA 4RCBA 1BI2A 2XD0A 5HK0A 1Q86C 3CXCA 5FLXE 1QVFA 3R6OA 2MMPA 5J3BA 5I2SA 4L59A 4NS5A 3CMAA 3J7AF 1QW1A 5GAN8 4JRPA 4C8QE 3MCAB 2O4XB 3NFCA 3OS5A 1YBYA 3L1AA 1I5LA 1VQNT 3M56A 1GXIE 4M78E 4A53A 1M1KC 1Y96A 4D6WA 1W2BS 1VQ7T 4HA8A 4HT8A 3CC2T 1G3YA 1VIEA 2R5MA 1U8RA 3TCJA 1O75A 4J6XA 3HFNA 4C0GA 4BDZA 1M1KU 3OYAA 3QYGB 5FU6B 5GANf 1Y7XA 2LCCA 3DKMA 4BI3A 5KCHA 2YLBA 4XK8E 4XTUA 2A7YA 2E6ZA 3A8GB 2VV5A 2PVOB 3OS0A 2DD5A 2YHTA 4FM4B 3OYGA 3CMAT 3CPWA 2G3RA 1X75C 4E7JA 4C8QB 5CIUA 4XU0A 1NPPA 4ZTJA 3FB9A 4M7DA 1VQMT 4M78B 4F7UE 5GAMd 1VQ5A 1JJ2S 2K57A 3F70A 4C0DC 2NLUA 2ZPGB 3MEAA 2QA4A 4VUBA 3C4SA 4QQ6A 4J6YA 2HQEA 2K3YA 2ZPEB 3DLMA 1N8RU 3FLGA 5CKHA 2XDDA 4N4IA 2XDBA 2DPPB 1D3BB 3A8HB 1WJSA 4N0AC 3T9NA 4ZN1A 4J8OA 4M77E 3C94A 5GANg 4BE1A 4A4EA 1X01A 3WVEB 3JCMQ 2JTMA 5GAMj 5GAOl 4C92A 3X28B 3OYIA 4PJOB 5IT9E 3OSVA 2RK2A 4F7UB 3M9QA 3OW2S 2VXEA 3ZFJA 4M7DG 1DJ7B 3VYHB 3LGLA 5GAN6 3OYBA 4O5VA 2EQMA 4HKEA 3OSSC 2YRVA 5CO7A 3SWNB 3V8JA 2EYQA 2L5QA 1VQ4T 1R8OB 4M77B 2D0QB 1YITA 2A3LA 4X9DA 2L8DA 3L2QA 2EJGA 1BIAA 4LD6A 2VGMA 4LDVA 1Y07A 3QXEB 3FC3A 2Y4XA 3OYHA 4FT2A 3CBPA 1VUBA 4M75A 1KG1A 3HSBA 3MO8A 4OGCA 3PIPA 3GOXA 5GAMf 3MEWA 5LJ5e 2VC8A 3FEOA 3FIFA 3NTHA 2DTIA 2FVUA 2RD1A 1H641 2P0KA 1KC8U 2CZ7B 4HCBA 4NL3A 4JRIA 1LJOA 3QHSA 4MZMA 1OYXA 3JAME 4M7AC 2ZGWA 5GMKh 3OYFA 4BDYA 1YITT 4N4GA 3CD6A 3QZ9B 2E10A 3TEEA 2GFAA 3CCLT 4X9CA 3CCQA 3M5AA 3PNWC 2QQRA 1PSFA 1WQWA 3JB9I 3X25B 1Y71A 4JDSA 5FU7C 1D3BA 5DY9A 2D9TA 1NZ9A 4OF1A 2RJCA 5CQXA 3QG1A 4C8QD 4M75G 4M78D 5GANh 4RG8A 1ZHIA 5CKEA 3V7CA 3OYJA 1I4K1 4C0DB 3BW1A 4ELZC 4CI0C 5GAMg 1Q81U 2MWOA 4N4HA 4M78G 2E41A 2H3JA 3CC4T 2F69A 5GAOn 2K5LA 4Y28E 3GIBA 4LDXA 1X6OA 3CCQT 4XU3A 4OB2B 3META 1UEBA 3FRNA 4C5GA 2DD4A 2DIGA 3L42A 2CZ1B 1NPRA 3P8BB 4XTVA 3UDCA 1YJWA 2E65A 3HL8A 2DVEA 2M1HA 2QXFA 3LWIA 2OTLA 1KQSA 3CBOA 1YHQA 4PJOD 3X26B 5LJ5d 3L2RA 2RHUA 1B34B 3LLRA 5HKCA 2RH2A 1U1SA 3L2WA 4GLKA 5CCAA 2OTJA 2E1HA 3JCMW 2LVMA 2PUOB 1M4ZA 2PUKB 4LD9K 1QVGS 1IZ6A 4F7UG 4PL6A 3E1SA 1OZ3A 3CBMA 2M16A 3WVDB 2VXFA 4A54A 4B9XA 3GP8A 2QQAA 3BDLA 5J39A 2JN0A 3RESA 3CCSA 4BACA 3TU4K 3JRZA 3VKIA 2DZ9A 1YJWT 4M77D 2OTLT 1M8VA 2DXBA 4OMFB 1YHQT 1P92A 5GAOm 3HRUA 3QO3A 3CCRA 3JCMc 2R58A 3MEUA 3L2UA 3QSUA 3FDRA 4GY5A 3VYGA 5LJ3e 1HK9A 3JCMP 1G3SA 3LGFA 3OBYA 3JB9J 4RMOA 1WPYA 1Q86U 4XTYA 4M7DF 2B8AA 3BFMA 2WSEE 1VQ6A 1M90C 2DTOA 2MWPA 2CZ6B 3CCST 5CAIA 1K9MU 2CYZB 1UGQB 3GF5A 2VUBA 5M9OA 4FU6A 4EMHA 1RI0A 2RA2A 4OB3B 4EMKC 2PU9B 4MDXA 4JS5A 2MF2A 1N27A 1G3WA 1WQ7A 2XKOC 5GAMh 3AHUA 4PJOE 4PKCC 5D6XA 4JS4A 3V8LA 2HAXA 3ZBDA 3JCMe 1ZBXA 3SD4A 1XTDA 2EAYA 2HQXA 2E5QA 5FU7B 4MDWA 5LJ5f 2RI3A 2L89A 1VIFA 5GMKl 4A4GA 2RO0A 3KXTA 3RIRA 4C92F 1Q82U 2DJZA 3HRSA 4L5GA 3RKYA 3E19A 4MZPA 4QQGA 1W2BA 1N9RA 2WACA 1N8RC 3JCMV 1K8AC 3M54A 3OB9A 4BD3A 4PLLA 5IN1A 1YCYA 1BI0A 1AHJB 4JRQA 1VQ5T 1S72A 2EJFA 4M7AE 2WSFE 3Q1JA 5LJ3d 4DQ2A 2IVWA 2K2VA 3QPHA 2QA4T 5LL6S 3J80E 1K73U 1QVGA 5GAOq 2LQ8A 2JZ2A 3INZA 4QVCA 3SDZA 4EPCA 1UB4A 2QDYB 3O8VA 4BE0A 2HD0A 4M7DC 2O4XA 3ASKA 5D6WA 3RUXA 5GMKi 2E6NA 5LJ5g 5CKBA 5HK3A 1VQPA 2DEQA 2DXUA 2QTXA 2XG8D 4M75F 3BDUA 4NL2A 4ELYC 5GAN3 3JB9D 4OP0A 4Y91A 4FIBA 3OMCA 3X20B 4MZTA 5KE2A 3QIIA 3J81E 2DZCA 1PSEA 4HT9A 4Z02A 5LJ3j 1FXXA 1S72T 3JCMd 4M7AB 4C0ZA 3JB9G 1W4SA 2EQUA 3GPLA 1XNIA 1I8FA 2RJEA 5I21A 2KMTA 2EQKA 3GNGA 4KBMB 2DTHA 1XOVA 4C92C 3CEYA 4RCCA 4C8QA 4JJNK 3LW5E 1M9SA 2XK0A 1VQPT 1VQKA 4M78A 4EMGA 2K4YA 3JSCA 3MHXA 4KUDK 4YTLA 2LX9A 4LDWA 4EDUA 4C5HA 3LWHA 3P8HA 2M9UA 3A8LB 3VUZA 3EAEA 1KC8C 2CGHA 4OGEA 3SFMA 1WJQA 5D6YA 4PNOA 2P0QA 4FL6A 3H8ZA 2RJFA 4KULA 4OB1B 4L6V5 4EMKB 3OQ5A 4RKUE 4E7HA 5LJ3f 3CCMA 4BY6C 4II1A 2RI2A 1MGQA 3CCUA 4PJOA 2F5KA 2ZPFB 2WSCE 3RMQA 4F7UA 3CC7A 4M75C 4C8QG 2O01E 1VQ8A 3CCJA 2E12A 2KAFA 3CD6T 4M7DE 1NJIC 3I56A 3UWNA 3JCMb 1BIBA 5FRNA 3OYDA 1Y96B 4J83A 2FYKA 1Q7YC 4P5NA 3PT9A 1N6AA 4BUGA 5L8RE 3OYNA 3CMEA 2RB6A 5LJ5h 3SWNA 5EG2A 2P4TA 1BI1A 2E70A 1OI1A 3EFSA 3PGGA 3JCMf 4M77A 5FROA 3CCMT 1MHNA 4QVZA 5J26A 5CKDA 3HHTB 3NTIA 3JCMJ 2QQBA 3M55A 3CCUT 2MAMA 4R56A 2EQJA 5C0MA 3CXCS 2JOYA 3QZ5B 1QVFS 3CC7T 3PFSA 4M7AA 4A4HA 5LJ3g 5GMKm 3QUIA 4PJOG 1NE8A 3G71A 5AYFA 3CCJT 1KD1C 3OYKA 3M57A 4C92E 2JVVA 2Y4YA 4J5YA 3I56T 5KCOA 1KQ2A 3OBWA 2F5TX 2GF7A 1SSFA 4UC4A 3ZEHA 2AHJB 1N9SA 4OB0B 3OS2A 3V7RA 1WGSA 1QP2A 3GLXA 4WF2A 5CVIA 3CMET 4RG2A 1VQOA 2V8IA 3CPFA 2KSSA 5DLQE 5LJ5j 1IREB 1HXDA 3C12A 3S6WA 2KQWA 1YJNA 2LDMA 3QKJA 4BB7A 3LX7A 2X4WA 4ME7A 4M7AD 2EKOA 4M77G 2V8KA 2DO3A 1VQ7A 4JRKA 3CPWS 4E7IA 1JJ2A 3JCMg 2OTJT 5DLOA 2XI9A 3KUFA 3G71T 4BE2A 1H3ZA 4MMKA 2GCXA 2D6FA 4EMKA 4M7AG 1ZQ1A 4C92B 5GAN4 2KK4A 2ZCFB 4C5IA 2LNVA 4M75E 4DOWA 4X34A 3OMGA 4FT4A 4E7KA 1VQOT 1LNXA 1WNLA 4IUQA 2Y90A 5GAN5 4R55A 1FX7A 3NTKA 3ER0A 3HRTA 2VYTA 4KUIA 3SB2A 4DOVA 1YJNT 1VQLA 4E47A 3CCRT 4IKFA 1K9MC 2LQKA 4J7FA 1VQMA 4XU1A 5HY6A 4E7LA 2HBPA 1JB0E 3EFRA 4N0AA 1M90U 2KDSA 5GAN2 2LRQA 2ZPIB 3JB9F 2X4JA 4QQDA 3JCMX 2DXTA 3A8OB 1VQ9A 4J6WA 4BY6B 2RHZA 1QP3A 5KE3A 3URGA 3OYLA 3OA6A 1UGPB 3M53A 2X35A 1VQ6T 1B34A 4M75B 5FRMA 2E64A 3RERA 4JLGA 2K5FA 2RHXA 4C0FA 3LH0A 4QVDA 1Q82C 2JTFA 3VUBA 4IUVA 1G5VA 2RM4A 3N5BB 3P8DA 1VQLT 4LDUA 3RKWA 2PQWA 5LJ3h 2DK3A 3V8KA 1WJRA 3G6EA 4IUPA 4C5EA 3L2VA 3V7SA 3QDRB 3PMTA 3HKSA 1BKBA 1BI3A 3L2ZA 1YI2A 2XDPA 5C6SA 1VQ9T 4ZTFA 2ZPHB 2M0OA 4ZGJB 1K8AU 1K73C 4XTZA 4J7IA 4TVRA 2YLCA 3S3OA 3FJPA 3HPWA 4QW2A 1RL2A 1M5Q1 1OZ2A 5CK9A 3OYCA 4V2SA 4M7DD 5A0LA 2QEXA 2EJ9A 1VQ4A 1UGRB 3JCMh 3GNFB 4C8QF 4XTXA 3M59A 2EWNA 3MP6A 3RMSA 4M78F 3G6ET 3CCEA 5KH6A 5GMKe 2RHIA 2XU8A 5CR2A 2QQ9A 4LDYA 2CS7A 3QJYA 2LTOA 4A4FA 1JRIA 2PVDB 3OYEA 2LC4A 3UPUA 2JNGA 1YI2T 1V29B 3QJ6A 4IURA 2XICA 2VGNA 3DB3A 4JLIA 2C06A 3VV0A 3WXMB 5CKFA 3OYYA 1LOJA 2GQVA 5GANe 2BKDN 1QVPA 3OW2A 2RI5A 4C92D 2I2LA 3G7ZA 2X4YA 2XHCA 3C95A 4PLIA 1UGSB 2DKGA 5CQYA 3OY9A 2QEXT 2PVGB 4PJOF 3CCLA 3HP9A 2DAQA 3CCET 4F7UF 2GFUA 4ZGDB 5A0GA 3UT1A 4C92G 1XQHA 2CZ0B 4A4KA 3HFOA 3PIOA 4ZGEB 3S3MA 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBP A; 
#chains in the Genus database with same CATH topology
 2CKK A;  1KHC A;  3BY7 A;  3JB9 H;  2NWM A;  1QKX A;  4Z89 A;  1BYM A;  2DIQ A;  2IG0 A;  6AT1 B;  1Q81 C;  4M7A F;  1FWZ A;  1YIJ A;  1UTI A;  3CCE Q;  3I35 A;  4E7Z A;  1K9M R;  2OAU A;  1M1K R;  4AFS C;  1OV3 A;  2DF6 A;  4HVV A;  2QI2 A;  1VQ8 T;  4EIK A;  3I55 A;  2ROL A;  2J7I A;  4MML A;  1JXO A;  4KT0 E;  3QYH B;  3G4S T;  1W1F A;  1C1A A;  4BI4 A;  2DM1 A;  2HMA A;  1HJD A;  2FL7 A;  4IUT A;  1T0H A;  3EHQ A;  1U1T A;  2R5A A;  1CKB A;  4DA4 A;  5GAM e;  1RAC B;  2B86 A;  2MI6 A;  2V1Q A;  2JUF A;  5KYW A;  1E6H A;  1JBM A;  2DE0 X;  3MP1 A;  5IHI A;  3REA B;  4Q5W A;  3MEV A;  1JJ2 P;  1BI2 A;  5HK0 A;  1SHF A;  5FLX E;  2QGF B;  2MMP A;  5J3B A;  1IHW A;  1QW1 A;  5GAN 8;  1I5L A;  1VQN T;  1OU8 A;  2E5K A;  3RNJ A;  1VIE A;  2GQI A;  1U8R A;  3PVL A;  1ZSG A;  2NUT A;  3CQT A;  5FU6 B;  5GAN f;  1KIK A;  1JO8 A;  3DKM A;  5KCH A;  2VV5 A;  2ROT A;  4LUD A;  3CMA T;  3CPW A;  2E3I A;  2COW A;  4ZTJ A;  4C0D C;  2NLU A;  1XJW B;  3MEA A;  1M2V A;  2K3Y A;  3CC2 Q;  2OI3 A;  4N4I A;  3H41 A;  4RTZ A;  2DPP B;  1G83 A;  1D3B B;  1A0N B;  3T9N A;  1X01 A;  1M3A A;  1SEM A;  5GAO l;  3OYI A;  2RK2 A;  3PVQ A;  4OMN A;  3M9Q A;  1B07 A;  2HZY A;  2YSQ A;  3VYH B;  1PD1 A;  4F17 A;  2OJ2 A;  2YUQ A;  4HKE A;  2ESW A;  1D1C A;  4AG2 C;  3V8J A;  1M8M A;  2EYQ A;  1VQ4 T;  4CC4 B;  1R8O B;  4M77 B;  2A3L A;  3L2Q A;  3QXE B;  1D1A A;  4FT2 A;  3HSB A;  3GOX A;  2YUO A;  3M0S A;  2RD1 A;  1H64 1;  2XMF A;  2FPD A;  4NL3 A;  2RQV A;  1PWT A;  1BK2 A;  2LQW A;  3OYF A;  5GMK h;  3EGD A;  2MK5 A;  4J9G A;  2QQR A;  1PSF A;  2DET A;  2CP5 A;  4JDS A;  2KRS A;  2D9T A;  4OF1 A;  5GAN h;  1ZHI A;  3BW1 A;  2MWO A;  4M78 G;  4CC7 A;  4LDX A;  1X2K A;  4E2F B;  3L42 A;  1RAB B;  2CZ1 B;  3HL8 A;  3IQL A;  2IPO B;  1YHQ A;  2V1R A;  5LJ5 d;  4F04 B;  2RHU A;  1B34 B;  3LLR A;  3L2W A;  4KRT A;  3JCM W;  2RF0 A;  1EZZ B;  1OZ3 A;  1ZUY A;  2M16 A;  4A54 A;  3CC4 Q;  1VYU A;  3TU4 K;  3JRZ A;  4LXC A;  4Z88 A;  5GAO m;  3M0P A;  3MEU A;  2OX7 A;  1QVF P;  1HK9 A;  3LGF A;  3OBY A;  4RMO A;  1NM7 A;  3FJ5 A;  2A08 A;  1M90 C;  2CZ6 B;  3GF5 A;  4FU6 A;  4MDX A;  4OB3 B;  4EMK C;  2PU9 B;  4JS5 A;  1N27 A;  1YJW Q;  4JZ3 A;  4PJO E;  2OTL Q;  2HAX A;  3SHW A;  5FU7 B;  3NHN A;  1VIF A;  5GMK l;  2RO0 A;  4AG1 C;  1PM3 A;  1MMN A;  1SHG A;  4MZP A;  1K8A C;  3CCS Q;  1OPL A;  1BI0 A;  1AHJ B;  1R0C B;  1VQ5 T;  1S72 A;  2WSF E;  4KGV B;  2QA4 T;  2EW3 A;  5LL6 S;  4HCK A;  3J80 E;  1CSK A;  3INZ A;  2JZ2 A;  1UB4 A;  2QDY B;  3O8V A;  2NUZ A;  2O4X A;  1K76 A;  4M75 F;  4NL2 A;  1NG2 A;  2KT1 A;  2KGT A;  4MZT A;  3EG1 A;  2KRO A;  5KYN A;  1FXX A;  4C0Z A;  2EQK A;  2F1L A;  4C92 C;  3CEY A;  4C8Q A;  2EGA A;  4M78 A;  2K4Y A;  2JM8 A;  3MHX A;  2CUB A;  4JJC A;  1PKT A;  4J9C A;  3P8H A;  2EYW A;  3A8L B;  2CGH A;  4OGE A;  3SFM A;  4PNO A;  4FL6 A;  4KUL A;  4RTY A;  1ZBJ A;  3I9Q A;  5KYW B;  3OQ5 A;  2RQU A;  1VYT A;  2D8H A;  3CCU A;  1M27 C;  1V1C A;  2F5K A;  2ZPF B;  3RMQ A;  3CCJ A;  1KFZ A;  3I56 A;  3JCM b;  4FYX B;  1Q7Y C;  3TVT A;  3SWN A;  2FG0 A;  2HDA A;  2DRK A;  1OPK A;  2E70 A;  3JCM f;  3PGG A;  5FRO A;  3CCM T;  1PHT A;  4IIO A;  3JCM J;  3M55 A;  4R56 A;  3I5S A;  4M7A A;  4A4H A;  2JXB A;  5LJ3 g;  5GMK m;  1NE8 A;  2H3E B;  3M57 A;  4C92 E;  2JVV A;  4KH0 B;  2F5T X;  1SSF A;  3ZEH A;  1ZUU A;  1MV3 A;  1N8R R;  4WF2 A;  1VQO A;  2KQW A;  1YJN A;  1B3Q A;  1QKW A;  1AZG B;  2EKO A;  4M77 G;  4PJJ A;  2DO3 A;  5I22 A;  1RAA B;  2RNA A;  1H3Z A;  2P84 A;  1UJ0 A;  4LN2 A;  2EBP A;  4C5I A;  2SRC A;  4FT4 A;  1WNL A;  3NTK A;  3SB2 A;  3CME Q;  3CCR T;  1LVK A;  4XU1 A;  4KGZ B;  1RLQ C;  1JB0 E;  4N0A A;  1S1N A;  5GAN 2;  1VQ9 A;  5KE3 A;  3G71 Q;  3I5R A;  3M53 A;  2ECZ A;  5FRM A;  4JLG A;  2K5F A;  3VUB A;  3VS7 A;  2DK3 A;  3V8K A;  2CP7 A;  3V7S A;  3EGD B;  1YI2 A;  1QCO A;  5C6S A;  2I0N A;  2ED1 A;  2ZPH B;  4IIM A;  2IIM A;  1M5Q 1;  2FZG B;  1TUG B;  2QEX A;  2EJ9 A;  3JCM h;  3MP6 A;  3G6E T;  2RHI A;  5CR2 A;  2LTO A;  1RAI B;  4LNP A;  2ATC B;  2EGE A;  3R6N A;  3UPU A;  1YP5 A;  4IUR A;  2VGN A;  1OX9 A;  2K3B A;  5EC7 A;  2GQV A;  3OW2 A;  2LX7 A;  4C92 D;  2I2L A;  2X4Y A;  4PLI A;  1SF9 A;  2QAZ A;  4PJO F;  4D8D A;  1K0S A;  2DAQ A;  4F7U F;  2GFU A;  3UT1 A;  2CZ0 B;  1UG1 A;  5FU6 C;  1C0M A;  1SPK A;  3M4Y A;  3OS1 A;  2LNH B;  5I2M A;  4Z8A A;  3PMI A;  3CCV A;  1KQS S;  1WI7 A;  2DL8 A;  3CC4 A;  2YUN A;  2K5I A;  4B9W A;  5D7U A;  1O9S A;  1TH7 A;  2LT1 A;  1D09 B;  3A98 A;  4IUU A;  1OOT A;  4J9D A;  2XID A;  1M1F A;  1WFW A;  1YJ9 A;  4JUV A;  1Q82 R;  3S3N A;  3E9G A;  2EIF A;  4FSX A;  1W70 A;  1YIJ T;  4ANJ A;  1E6G A;  4OVA A;  5IHK A;  3PTA A;  2RK1 A;  2LCL A;  3MP8 A;  4XTW A;  4ZN3 A;  2RQW A;  2BZ8 A;  2L0A A;  3NGP A;  2YXY A;  4M77 C;  2BUD A;  1VQ8 Q;  1K73 R;  3DB4 A;  2FRW A;  3I55 T;  2XD0 A;  1Q86 C;  1RAD B;  1QQJ A;  2QGG A;  3G4S Q;  2O4X B;  3NFC A;  1YBY A;  3L1A A;  1GXI E;  1QLY A;  1ZSZ A;  1SG5 A;  1M2O A;  4D6W A;  1FMK A;  1TWB A;  4C0G A;  4J6X A;  3HFN A;  1T3S A;  4BDZ A;  2LCC A;  5IXF A;  2YLB A;  4XTU A;  1QVG S;  2DD5 A;  1X75 C;  4C8Q B;  4XU0 A;  1NPP A;  1VQM T;  4M78 B;  1W2B P;  1VQN Q;  4J6Y A;  2HQE A;  1NEB A;  2XDD A;  2XDB A;  1WHK A;  4M77 E;  5GAN g;  1TTH B;  3CMA Q;  3X28 B;  3OW2 S;  2HKN A;  1DJ7 B;  2D8J A;  3RR6 A;  5CO7 A;  3SWN B;  1SRL A;  4QT7 A;  1GBQ A;  3TQ7 P;  1YIT A;  4CC3 A;  2L8D A;  2EJG A;  1BIA A;  4LD6 A;  2VGM A;  3FC3 A;  7AT1 B;  2Z0W A;  1VUB A;  4M75 A;  2HL3 A;  4FYW B;  1KG1 A;  5GAM f;  5LJ5 e;  2VC8 A;  4PFO A;  1B7T A;  1X2Q A;  2FVU A;  1OX8 A;  1KC8 U;  3RDV A;  1KSW A;  1LJO A;  3JAM E;  3UA6 A;  1OUL A;  3QZ9 B;  2DIL A;  3RBB B;  4X9C A;  1VQ4 Q;  3CCQ A;  3M5A A;  3PNW C;  1WQW A;  2COY A;  3JB9 I;  3X25 B;  1K0X A;  1OEB A;  1Y71 A;  5FU7 C;  5DY9 A;  1Y0M A;  1Y57 A;  2DVJ A;  2DER A;  2DYI A;  4RG8 A;  3V7C A;  2RMO A;  3OYJ A;  4ELZ C;  2JS2 A;  1RUW A;  4N4H A;  2F69 A;  1M90 R;  1F1B B;  2EGC A;  1D0Z A;  2J6F A;  1X6O A;  3FRN A;  2DIG A;  5ECA A;  4XTV A;  3UDC A;  2QXF A;  2CDT A;  1AD5 A;  3X26 B;  3L2R A;  2DLP A;  2KT8 A;  2DA9 A;  2E1H A;  3EG3 A;  2LVM A;  2GNC A;  2PUO B;  2O31 A;  4LD9 K;  2K7A A;  3UAT A;  4F7U G;  4PL6 A;  2PZ1 A;  3REB B;  1YCS B;  1UHC A;  3WVD B;  3RES A;  4M77 D;  3D7S B;  1M8V A;  2QG9 B;  2DXB A;  2AIR B;  1GBR A;  1YHQ T;  1P92 A;  3HRU A;  3QO3 A;  1TUC A;  1MMG A;  1G3S A;  2L3Q A;  3JB9 J;  4M7D F;  1IHV A;  4ZNX A;  2LQN A;  5CAI A;  1K9M U;  2CYZ B;  1UGQ B;  1M1K U;  4EMH A;  5GAM h;  1JU5 C;  3AHU A;  1RAG B;  1XTD A;  2EAY A;  2E5Q A;  4MDW A;  3EGU A;  2CSQ A;  8ATC B;  4JJD A;  2CT3 A;  2YUP A;  2J06 A;  2DL7 A;  4L5G A;  3RKY A;  4QQG A;  1W2B A;  4PLL A;  1YCY A;  4JRQ A;  1QWE A;  2QYZ A;  3Q1J A;  5LJ3 d;  3NPF A;  3ULR B;  2K2V A;  5IH2 A;  5GAO q;  3EHR A;  4QVC A;  1X27 A;  2HD0 A;  3ASK A;  1VQP A;  2DXU A;  4R0K A;  4Y91 A;  4FIB A;  2GGR A;  3OMC A;  4FYY B;  1LCK A;  4A63 B;  2DZC A;  2H8H A;  1IXD A;  5LJ3 j;  1S72 T;  3JB9 G;  2M02 A;  3VRZ A;  1W4S A;  3GPL A;  1XNI A;  5I21 A;  2RQT A;  1VQ5 Q;  4JJB A;  2K2M A;  2QA4 Q;  4HVU A;  2G6F X;  3JSC A;  4PFP A;  4AFZ C;  1WXU A;  2LX9 A;  4C5H A;  2BE7 D;  2M9U A;  1KC8 C;  3EAE A;  1WJQ A;  5D6Y A;  1ABQ A;  2P0Q A;  2RN8 A;  2YWW A;  3VS2 A;  2AZS A;  4L6V 5;  3PE0 A;  2DEU A;  1MGQ A;  1GCQ A;  4PJO A;  4AT1 B;  2YRC A;  1WDX A;  2J6O A;  2WSC E;  4F7U A;  3CC7 A;  4C8Q G;  4F16 A;  1VQ8 A;  2E12 A;  1GCP A;  3CD6 T;  2CP2 A;  3UWN A;  1BIB A;  5FRN A;  4J83 A;  2RB6 A;  2DX1 A;  1OI1 A;  1VYV A;  1BCO A;  1MHN A;  4QVZ A;  5CKD A;  3HHT B;  1WXB A;  3CCU T;  2JOY A;  2A0F B;  1KQS P;  3CCJ T;  3OYK A;  4F14 A;  2X3W D;  2Y4Y A;  3I56 T;  4AFQ C;  5KCO A;  3OBW A;  2GF7 A;  2AHJ B;  1K1Z A;  3V7R A;  2YT6 A;  1QWF A;  5CVI A;  2LJ1 A;  3CPF A;  2KSS A;  5LJ5 j;  3C12 A;  1UJY A;  4BB7 A;  4ME7 A;  2PTK A;  3CXC P;  3CCM Q;  4E7I A;  3CPW S;  1JJ2 A;  2OTJ T;  3JCM g;  5DLO A;  3KUF A;  2A28 A;  2GCX A;  4EMK A;  1KJW A;  4M7A G;  5GAN 4;  1NEG A;  4X34 A;  1VQO T;  1LNX A;  1FX7 A;  3H0H A;  4KUI A;  2VYT A;  1YJN T;  1VQL A;  4IKF A;  1K9M C;  5HY6 A;  3EFR A;  4QQD A;  3JCM X;  4J6W A;  1AVZ C;  2RHZ A;  1VQ6 T;  4M75 B;  2E64 A;  3RER A;  8AT1 B;  1G5V A;  2DFU A;  2JS0 A;  3CCR Q;  2AK5 A;  2EQI A;  1YNZ A;  1IRX A;  3PMT A;  2VB6 A;  3L2Z A;  4FSS A;  1VQ7 Q;  3NMZ C;  1VQ9 T;  9ATC B;  3M0Q A;  4ZGJ B;  2GTO A;  3S3O A;  3FJP A;  2L2P A;  1RL2 A;  3OYC A;  5CK9 A;  1NJI R;  1VQ4 A;  1VA7 A;  1UGR B;  1JQQ A;  4LE9 A;  5IHN A;  3CCE A;  4ESR A;  2XU8 A;  3QJY A;  4A4F A;  4PFZ A;  1JRI A;  2ED0 A;  2QK0 A;  3OYE A;  1GFD A;  1NLO C;  2LC4 A;  2JNG A;  2C0T A;  1YI2 T;  1V29 B;  2C06 A;  4JLI A;  3VV0 A;  2M51 A;  5CKF A;  3OYY A;  1KD1 R;  1LOJ A;  1ZA1 B;  2BKD N;  2XHC A;  2QEX T;  4QKU A;  3OY9 A;  2C0I A;  1RAH B;  2CH4 A;  5FWB A;  3G6E Q;  1XQH A;  3HFO A;  4ZGE B;  1AOJ A;  2AT1 B;  2BIV A;  1VQK T;  3VS6 A;  5GAN 7;  3H6Z A;  3TSZ A;  2KI7 A;  4C8Q C;  2JTE A;  3G1J A;  3ME9 A;  4M78 C;  1ARK A;  2F2W A;  2FRY A;  3C0C A;  3M58 A;  4ATO A;  2X4X A;  2NUT B;  5IAY A;  1NBE B;  2AKL A;  2ZZD A;  2KVQ G;  3M4G A;  1NJI U;  1TXQ A;  5GAN d;  3CCV T;  5FWC A;  2KY9 A;  1RLP C;  3X24 B;  2L3R A;  3TRE A;  3LYI A;  3DLL A;  4KGX B;  2W10 A;  3VJP A;  5GMK j;  2FZC B;  1JJ2 S;  3A8M B;  3OYM A;  2MPX C;  1M2V B;  1T3L A;  1N5Z A;  4CRI A;  1KD1 U;  5GAN j;  3EFO A;  1EIF A;  2DBK A;  3CC2 A;  2LT4 A;  3SWN C;  2DL3 A;  4DBQ A;  2X51 A;  1YJ9 T;  1GRI A;  4RCB A;  1Z9Q A;  3CXC A;  1QVF A;  3R6O A;  5I2S A;  1ACM B;  1X6G A;  1YIJ Q;  4JRP A;  4C8Q E;  3OS5 A;  3VS4 A;  2D0N A;  4PJM A;  3M56 A;  4M78 E;  1H92 A;  1IGU A;  1VQ7 T;  4RTV A;  1D0Y A;  1G3Y A;  1BU1 A;  2R5M A;  3TCJ A;  4AMC A;  3OYA A;  3QYG B;  1PC0 A;  1Y7X A;  2OAW A;  5KYX A;  4E6R A;  2A7Y A;  2E6Z A;  2PVO B;  3I55 Q;  2YHT A;  2CP0 A;  2G3R A;  2QTV A;  4E7J A;  5CIU A;  1K4U S;  4M7D A;  2QAS A;  1VQ5 A;  3F70 A;  2CP3 A;  2ZPG B;  2QA4 A;  4RUG A;  3C4S A;  4QQ6 A;  2ZPE B;  3DLM A;  1N8R U;  4E7S A;  3FLG A;  3QWY A;  5CKH A;  1EX4 A;  2F2V A;  3A8H B;  1JEG A;  1WJS A;  3H9N A;  4N0A C;  4ZN1 A;  4J8O A;  1V76 A;  4A4E A;  1Q81 R;  1U06 A;  4PJO B;  1ZA2 B;  5IT9 E;  2JW4 A;  3OSV A;  4OMP A;  4F7U B;  1WHJ A;  2VXE A;  2MIO A;  1PCX A;  1VQM Q;  3LGL A;  3OYB A;  4O5V A;  1MNE A;  2O9V A;  2YRV A;  2L3S A;  1TS9 A;  2FZK B;  2L5Q A;  4X9D A;  2HKQ B;  4LDV A;  1Y07 A;  2F2X A;  1NLP C;  2O2O A;  2Y4X A;  5AT1 B;  3MO8 A;  3VRY A;  2CT4 A;  1QCF A;  1OQK A;  3FEO A;  3FIF A;  3NTH A;  2O88 A;  2DTI A;  2ZAE A;  3VS1 A;  2KXC A;  2ENM A;  4MZM A;  2ZGW A;  1YIT T;  4N4G A;  3CCL T;  2GFA A;  2V26 A;  1WYX A;  1D3B A;  1WZO A;  1NZ9 A;  4C8Q D;  4M75 G;  4M78 D;  5CKE A;  1I4K 1;  5GAM g;  1Q81 U;  1NYF A;  2H3J A;  5I11 A;  5GAO n;  2K5L A;  4Y28 E;  3CCQ T;  4XU3 A;  4OB2 B;  3MET A;  1UEB A;  3GBQ A;  2DD4 A;  1YJW A;  1NPR A;  2A37 A;  2DVE A;  2M1H A;  2OTL A;  3M0T A;  2KRN A;  3CBO A;  5HKC A;  2RH2 A;  1U1S A;  4GLK A;  5CCA A;  2QDL A;  1G2B A;  1M4Z A;  4LUE A;  2PUK B;  1IZ6 A;  1GFC A;  5KYY A;  4GLM A;  2QQA A;  5J39 A;  3CCS A;  4OMF B;  2LMJ A;  2PNI A;  3CCR A;  1AT1 B;  1AWJ A;  3JCM c;  1WHH A;  2EYX A;  3QSU A;  2RQR A;  3FDR A;  5LJ3 e;  2KR3 A;  1MV0 B;  4DBH A;  3BFM A;  2WSE E;  2DTO A;  2MWP A;  2VUB A;  1RI0 A;  1X69 A;  2MF2 A;  1WQ7 A;  4HXJ A;  4PKC C;  4JS4 A;  2GBQ A;  3V8L A;  1YHQ Q;  3SD4 A;  2NYS A;  2HSE B;  1RI9 A;  3CPW P;  5LJ5 f;  2RI3 A;  1U3O A;  3O5Z A;  4A4G A;  3RIR A;  4C92 F;  1Q82 U;  3HRS A;  4RTU A;  5KYU A;  1N8R C;  2W0Z A;  3JCM V;  4J9I A;  3M54 A;  3OB9 A;  2KNB B;  5IN1 A;  1D0X A;  1SRM A;  2DL5 A;  1U5S A;  1UEC A;  1K73 U;  2LQ8 A;  1NYG A;  5FW9 A;  3SDZ A;  4EPC A;  4ORZ A;  1I1J A;  3RUX A;  5GMK i;  5HK3 A;  4ELY C;  2QTX A;  2CH4 W;  1Q95 G;  3X20 B;  3J81 E;  1PSE A;  4HT9 A;  4Z02 A;  1G8X A;  1WHG A;  2DRM A;  3JCM d;  4M7A B;  1I8F A;  1FMW A;  2RJE A;  1CKA A;  2KMT A;  3MPU B;  1TOV A;  2GTJ A;  2DTH A;  4RCC A;  4JJN K;  3LW5 E;  2XK0 A;  1VQP T;  1M30 A;  4EMG A;  1FMV A;  2YRD A;  1MUZ A;  2DL4 A;  4LDW A;  3LWH A;  3EFO B;  2O9S A;  2RJF A;  4OB1 B;  1S72 Q;  4RKU E;  4II1 A;  2RI2 A;  2J6K A;  4M75 C;  1SKU B;  1PKS A;  1UUE A;  1TUD A;  2DMO A;  3OYD A;  2K79 A;  4P5N A;  3PT9 A;  1N6A A;  3CME A;  5L8R E;  5LJ5 h;  3AT1 B;  1WXT A;  5EG2 A;  3QDF A;  1BI1 A;  3EFS A;  4X1V A;  5KYX B;  3NTI A;  2QQB A;  4PJN A;  3QZ5 B;  2MYS A;  3CC7 T;  3PFS A;  3QUI A;  4PJO G;  3BE3 A;  3G71 A;  5AYF A;  2FPF A;  4M7D B;  4J5Y A;  1KQ2 A;  4UC4 A;  1KK7 A;  3CD6 Q;  3OS2 A;  1QP2 A;  1K8A R;  4RG2 A;  2DNU A;  5DLQ E;  1IRE B;  3EG9 A;  3S6W A;  2KYB A;  4DBR A;  1ZLM A;  2LDM A;  3QKJ A;  3LX7 A;  2X4W A;  2V8K A;  2XI9 A;  3CCU Q;  1UE9 A;  4BE2 A;  4MMK A;  2D6F A;  1QCN A;  2LZ6 B;  1ZQ1 A;  2KK4 A;  3CCJ Q;  1AWO A;  4M75 E;  4DOW A;  3I56 Q;  2CUD A;  3H0I A;  4E7K A;  4R55 A;  2Y90 A;  5GJV B;  1AEY A;  2DBM A;  4DOV A;  4J7F A;  1TSF A;  1VQM A;  2C0O A;  2HBP A;  5IXB A;  1M90 U;  2X3X D;  2ZPI B;  1HSQ A;  2OTJ Q;  1PNJ A;  4BY6 B;  1QP3 A;  3URG A;  3OA6 A;  1UGP B;  2X35 A;  4QVD A;  2RHX A;  1Q82 C;  3UA7 A;  2RM4 A;  3P8D A;  1VQL T;  3RKW A;  2PQW A;  1VQO Q;  1W6X A;  4IUP A;  4C5E A;  1YJN Q;  3L2V A;  3QDR B;  3HKS A;  1BI3 A;  1JXM A;  2DYB A;  4ZTF A;  2M0O A;  1K8A U;  1K73 C;  2YLC A;  3HPW A;  1VQ6 Q;  1OZ2 A;  4V2S A;  3THK A;  4XTX A;  3M59 A;  1Q7Y R;  2EWN A;  5KH6 A;  5GMK e;  1BBZ A;  4AFU C;  2CS7 A;  1EFN A;  4J9E A;  2JMA A;  3QJ6 A;  2XIC A;  3DB3 A;  3E2U A;  1UGV A;  2NUP A;  1E7O A;  1VQ9 Q;  1MND A;  5GAN e;  1QVP A;  2EVR A;  2RI5 A;  3G7Z A;  2PVG B;  2AKK A;  3CCE T;  1YN8 A;  4C92 G;  5KYY B;  2EKH A;  3EGX A;  1OU9 A;  3S3M A;  3KBG A;  2V8J A;  4OML A;  1YI2 Q;  1X6B A;  2KBT A;  4FW1 A;  1H3H A;  2JJ9 A;  1G3T A;  2QQS A;  4M77 F;  1I81 A;  3E9F A;  4NOY A;  4XU2 A;  1ZSZ B;  1M1G A;  3VU3 C;  4M75 D;  2QEX Q;  2P0P A;  3A5Z B;  3G4S A;  1UHF A;  4O6J A;  4FW2 A;  4BI8 B;  2K3X A;  1WLP B;  1KQ1 A;  2FB7 A;  2ZPB B;  5GAO r;  1Q7Y U;  1VQK Q;  2HNI A;  2RHY A;  4XQ3 A;  1GCQ C;  4PJO C;  2LJ0 A;  5GAO p;  1I0C A;  2HL5 C;  2FHD A;  4HCZ A;  1KHI A;  4XAX B;  1VQN A;  1ZX6 A;  5KYU B;  5A2Q E;  2J05 A;  5A0D A;  2EFI A;  5DM7 R;  3M0U A;  4GBQ A;  4OMO A;  3RKX A;  2R57 A;  2RJD A;  3MKD A;  2LCS A;  3QBY A;  3CCV Q;  4HCC A;  1PRL C;  2DXC A;  3TSW A;  1FYN A;  4L59 A;  4NS5 A;  3CMA A;  3J7A F;  4JZ4 A;  3MCA B;  1HD3 A;  2VWF A;  4A53 A;  2COZ A;  1M1K C;  4JPB W;  1Y96 A;  1W2B S;  4HA8 A;  4HT8 A;  3CC2 T;  1MMD A;  2JMC A;  1O75 A;  2D1X A;  1K9A A;  4BI3 A;  4XK8 E;  2E4H A;  3OS0 A;  3A8G B;  1YJ9 Q;  3OYG A;  4FM4 B;  3U23 A;  2A36 A;  3FB9 A;  4F7U E;  1ABO A;  5GAM d;  2K57 A;  4VUB A;  2CRE A;  2MCN A;  3VS0 A;  2EYY A;  1QVG P;  2HEQ A;  3C94 A;  4BE1 A;  3WVE B;  3JCM Q;  2JTM A;  5GAM j;  3UF4 A;  4C92 A;  2P4R A;  3ZFJ A;  4M7D G;  4WCI A;  5GAN 6;  1R0B G;  1AZE A;  2EQM A;  3OSS C;  2YDL A;  1AWX A;  2BZY A;  1I5O B;  1LPL A;  4WTO B;  2D0Q B;  3OYH A;  3OW2 P;  3CBP A;  4OGC A;  3PIP A;  3MEW A;  4HVW A;  4RTW A;  2P0K A;  2CZ7 B;  4HCB A;  4JRI A;  3EG9 B;  3QHS A;  1OYX A;  4BDY A;  3CD6 A;  3TEE A;  2E10 A;  1Q86 R;  1UDL A;  2HBW A;  2RJC A;  5CQX A;  3QG1 A;  2HCK A;  4KH1 B;  1MMA A;  4OMQ A;  4C0D B;  4CI0 C;  1PD0 A;  1RAE B;  3LH5 A;  2E41 A;  3CC4 T;  4J9F A;  4PJL A;  3HTR A;  3GIB A;  4C5G A;  1YIT Q;  5GJW B;  3P8B B;  3CCL Q;  1TU0 B;  2E65 A;  3M0R A;  1M3C A;  3LWI A;  1KQS A;  3ZL7 C;  4CC2 A;  4PJO D;  1ZUK A;  1UFF A;  2OTJ A;  1BCM A;  3E1S A;  2RPN A;  1T0J A;  3CBM A;  4B9X A;  3GP8 A;  2VXF A;  3BDL A;  4M7A C;  2JN0 A;  1WHL A;  4BAC A;  1YJW T;  3VKI A;  2DZ9 A;  3MJX A;  2OTL T;  3CCQ Q;  3KFV A;  2VAS A;  2R58 A;  1WX6 A;  3L2U A;  4GY5 A;  3VYG A;  3JCM P;  1WPY A;  1Q86 U;  4XTY A;  2B8A A;  2L3P A;  1VQ6 A;  3CCS T;  4B6M A;  2K6D A;  4PK4 A;  5M9O A;  2RA2 A;  2XKO C;  1G3W A;  4DEX A;  2NUP B;  5D6X A;  3ZBD A;  3JCM e;  1ZBX A;  2HQX A;  2L89 A;  2KEA A;  3KXT A;  2FO0 A;  2DJZ A;  3EG0 A;  3E19 A;  2KYM A;  1N9R A;  2WAC A;  2SEM A;  3EGX B;  4BD3 A;  1WHM A;  4M7A E;  2EJF A;  4DQ2 A;  2IVW A;  3EH2 A;  3QPH A;  2EPD A;  1QVG A;  4BE0 A;  4M7D C;  5D6W A;  2AZV A;  2E6N A;  5LJ5 g;  5CKB A;  2DEQ A;  1TG0 A;  2XG8 D;  1C6V X;  3BDU A;  5GAN 3;  3JB9 D;  4OP0 A;  5KE2 A;  1PRM C;  3QII A;  2VVK A;  4DEY A;  2EQU A;  2MOX A;  2JT4 A;  3H0F A;  3GNG A;  2BE9 B;  2FPE A;  4KBM B;  1XOV A;  1Z9Z A;  1M9S A;  1VQK A;  4KUD K;  4YTL A;  4EDU A;  2KRM A;  4Y92 A;  3VUZ A;  2E3H A;  3EH1 A;  1YFN A;  4RTX A;  3H8Z A;  4EMK B;  4E7H A;  2CSI A;  5LJ3 f;  3CCM A;  2LP5 A;  4BY6 C;  1BB9 A;  1VOM A;  2O01 E;  1VQP Q;  4D8K A;  2KAF A;  1HYO A;  4M7D E;  1NJI C;  4OMM A;  1Y96 B;  2FYK A;  1M3B A;  4BUG A;  3OYN A;  2P4T A;  4M77 A;  5J26 A;  2HSP A;  2MAM A;  3CXC S;  2EQJ A;  5C0M A;  1QVF S;  1KD1 C;  1IGQ A;  2BZX A;  3VS3 A;  1WA7 A;  1N9S A;  4OB0 B;  1WGS A;  1PG5 B;  3CME T;  3GLX A;  2LJ3 A;  2V8I A;  1HXD A;  5L23 A;  4M7A D;  1QMC A;  4J9H A;  2ABL A;  1VQ7 A;  4JRK A;  2M0Y A;  1H8K A;  3G71 T;  1GL5 A;  3CC7 Q;  4C92 B;  2ZCF B;  1R77 A;  1IO6 A;  2LNV A;  3OMG A;  4J9B A;  5GAN 5;  4IUQ A;  3ER0 A;  3HRT A;  4E47 A;  2LQK A;  4RTT A;  3VS5 A;  1I07 A;  4E7L A;  2KDS A;  2LRQ A;  4FCY A;  3JB9 F;  2X4J A;  1RAF B;  2DXT A;  3A8O B;  1ZSZ C;  1IB8 A;  2JM9 A;  3OYL A;  1B34 A;  2CP6 A;  1AWW A;  4C0F A;  3LH0 A;  2JTF A;  4IUV A;  1KC8 R;  3N5B B;  3EG2 A;  4LDU A;  5LJ3 h;  1WJR A;  3G6E A;  2K9G A;  3JV3 A;  1WIE A;  1BKB A;  2XDP A;  1YWO A;  2DJQ A;  5HCK A;  4FYV B;  4XTZ A;  4J7I A;  4TVR A;  1YWP A;  4QW2 A;  1SSH A;  4M7D D;  5A0L A;  4C8Q F;  3GNF B;  2HQH A;  3RMS A;  4M78 F;  1VQL Q;  2QQ9 A;  4LDY A;  2PVD B;  2KXD A;  2FEI A;  1J3T A;  3A1P A;  3WXM B;  2BTT A;  2VKN A;  3C95 A;  5CQY A;  1UGS B;  2DKG A;  2EYZ A;  4K11 A;  3CCL A;  3HP9 A;  2X9H A;  4M4Z A;  4ZGD B;  4DBF A;  5A0G A;  1X43 A;  3QWX X;  4A4K A;  3PIO A;  2KE9 A;  3SEM A;  1D1B A; 
#chains in the Genus database with same CATH homology
 5FU6 C;  2V8J A;  2CKK A;  3M4Y A;  2BIV A;  1KHC A;  5I2M A;  3OS1 A;  1VQK T;  3BY7 A;  3JB9 H;  5GAN 7;  3PMI A;  1G3T A;  2QQS A;  3CCV A;  1KQS S;  1BYM A;  3H6Z A;  4M77 F;  1I81 A;  3E9F A;  4NOY A;  2DIQ A;  4XU2 A;  2IG0 A;  3CC4 A;  4C8Q C;  1M1G A;  3VU3 C;  1Q81 C;  4M75 D;  3ME9 A;  2P0P A;  3A5Z B;  1FWZ A;  4M78 C;  1YIJ A;  4M7A F;  3G4S A;  3M58 A;  2K5I A;  4ATO A;  4B9W A;  4O6J A;  2X4X A;  1O9S A;  1TH7 A;  2LT1 A;  2OAU A;  4BI8 B;  2K3X A;  5IAY A;  4IUU A;  1KQ1 A;  2ZZD A;  2KVQ G;  2FB7 A;  3M4G A;  1NJI U;  2ZPB B;  2QI2 A;  2XID A;  5GAN d;  3CCV T;  5GAO r;  1VQ8 T;  2KY9 A;  3X24 B;  1Q7Y U;  2HNI A;  2L3R A;  3TRE A;  2RHY A;  3LYI A;  3DLL A;  3VJP A;  1M1F A;  4XQ3 A;  5GMK j;  1YJ9 A;  3I55 A;  4PJO C;  4JUV A;  4KT0 E;  4MML A;  3A8M B;  3OYM A;  3E9G A;  2EIF A;  3QYH B;  4FSX A;  3G4S T;  3S3N A;  1YIJ T;  4BI4 A;  5GAO p;  4OVA A;  2FL7 A;  4IUT A;  3PTA A;  2FHD A;  2RK1 A;  4HCZ A;  2LCL A;  1KHI A;  4XAX B;  3MP8 A;  4CRI A;  4XTW A;  1U1T A;  4ZN3 A;  2R5A A;  5A2Q E;  4DA4 A;  1KD1 U;  1VQN A;  5GAM e;  4M7D B;  5GAN j;  1EIF A;  5A0D A;  2EFI A;  3CC2 A;  2LT4 A;  3SWN C;  5DM7 R;  2MI6 A;  2JUF A;  4M77 C;  3RKX A;  1JBM A;  2BUD A;  2R57 A;  2RJD A;  3MP1 A;  3DB4 A;  3QBY A;  4HCC A;  1YJ9 T;  2DXC A;  3I55 T;  4Q5W A;  3MEV A;  4RCB A;  1BI2 A;  2XD0 A;  5HK0 A;  1Q86 C;  3CXC A;  5FLX E;  1QVF A;  3R6O A;  2MMP A;  5J3B A;  5I2S A;  4L59 A;  4NS5 A;  3CMA A;  3J7A F;  1QW1 A;  5GAN 8;  4JRP A;  4C8Q E;  3MCA B;  2O4X B;  3NFC A;  3OS5 A;  1YBY A;  3L1A A;  1I5L A;  1VQN T;  3M56 A;  1GXI E;  4M78 E;  4A53 A;  1M1K C;  1Y96 A;  4D6W A;  1W2B S;  1VQ7 T;  4HA8 A;  4HT8 A;  3CC2 T;  1G3Y A;  1VIE A;  2R5M A;  1U8R A;  3TCJ A;  1O75 A;  4J6X A;  3HFN A;  4C0G A;  4BDZ A;  1M1K U;  3OYA A;  3QYG B;  5FU6 B;  5GAN f;  1Y7X A;  2LCC A;  3DKM A;  4BI3 A;  5KCH A;  2YLB A;  4XK8 E;  4XTU A;  2A7Y A;  2E6Z A;  3A8G B;  2VV5 A;  2PVO B;  3OS0 A;  2DD5 A;  2YHT A;  4FM4 B;  3OYG A;  3CMA T;  3CPW A;  2G3R A;  1X75 C;  4E7J A;  4C8Q B;  5CIU A;  4XU0 A;  1NPP A;  4ZTJ A;  3FB9 A;  4M7D A;  1VQM T;  4M78 B;  4F7U E;  5GAM d;  1VQ5 A;  1JJ2 S;  2K57 A;  3F70 A;  4C0D C;  2NLU A;  2ZPG B;  3MEA A;  2QA4 A;  4VUB A;  3C4S A;  4QQ6 A;  4J6Y A;  2HQE A;  2K3Y A;  2ZPE B;  3DLM A;  1N8R U;  3FLG A;  5CKH A;  2XDD A;  4N4I A;  2XDB A;  2DPP B;  1D3B B;  3A8H B;  1WJS A;  4N0A C;  3T9N A;  4ZN1 A;  4J8O A;  4M77 E;  3C94 A;  5GAN g;  4BE1 A;  4A4E A;  1X01 A;  3WVE B;  3JCM Q;  2JTM A;  5GAM j;  5GAO l;  4C92 A;  3X28 B;  3OYI A;  4PJO B;  5IT9 E;  3OSV A;  2RK2 A;  4F7U B;  3M9Q A;  3OW2 S;  2VXE A;  3ZFJ A;  4M7D G;  1DJ7 B;  3VYH B;  3LGL A;  5GAN 6;  3OYB A;  4O5V A;  2EQM A;  4HKE A;  3OSS C;  2YRV A;  5CO7 A;  3SWN B;  3V8J A;  2EYQ A;  2L5Q A;  1VQ4 T;  1R8O B;  4M77 B;  2D0Q B;  1YIT A;  2A3L A;  4X9D A;  2L8D A;  3L2Q A;  2EJG A;  1BIA A;  4LD6 A;  2VGM A;  4LDV A;  1Y07 A;  3QXE B;  3FC3 A;  2Y4X A;  3OYH A;  4FT2 A;  3CBP A;  1VUB A;  4M75 A;  1KG1 A;  3HSB A;  3MO8 A;  4OGC A;  3PIP A;  3GOX A;  5GAM f;  3MEW A;  5LJ5 e;  2VC8 A;  3FEO A;  3FIF A;  3NTH A;  2DTI A;  2FVU A;  2RD1 A;  1H64 1;  2P0K A;  1KC8 U;  2CZ7 B;  4HCB A;  4NL3 A;  4JRI A;  1LJO A;  3QHS A;  4MZM A;  1OYX A;  3JAM E;  4M7A C;  2ZGW A;  5GMK h;  3OYF A;  4BDY A;  1YIT T;  4N4G A;  3CD6 A;  3QZ9 B;  2E10 A;  3TEE A;  2GFA A;  3CCL T;  4X9C A;  3CCQ A;  3M5A A;  3PNW C;  2QQR A;  1PSF A;  1WQW A;  3JB9 I;  3X25 B;  1Y71 A;  4JDS A;  5FU7 C;  1D3B A;  5DY9 A;  2D9T A;  1NZ9 A;  4OF1 A;  2RJC A;  5CQX A;  3QG1 A;  4C8Q D;  4M75 G;  4M78 D;  5GAN h;  4RG8 A;  1ZHI A;  5CKE A;  3V7C A;  3OYJ A;  1I4K 1;  4C0D B;  3BW1 A;  4ELZ C;  4CI0 C;  5GAM g;  1Q81 U;  2MWO A;  4N4H A;  4M78 G;  2E41 A;  2H3J A;  3CC4 T;  2F69 A;  5GAO n;  2K5L A;  4Y28 E;  3GIB A;  4LDX A;  1X6O A;  3CCQ T;  4XU3 A;  4OB2 B;  3MET A;  1UEB A;  3FRN A;  4C5G A;  2DD4 A;  2DIG A;  3L42 A;  2CZ1 B;  1NPR A;  3P8B B;  4XTV A;  3UDC A;  1YJW A;  2E65 A;  3HL8 A;  2DVE A;  2M1H A;  2QXF A;  3LWI A;  2OTL A;  1KQS A;  3CBO A;  1YHQ A;  4PJO D;  3X26 B;  5LJ5 d;  3L2R A;  2RHU A;  1B34 B;  3LLR A;  5HKC A;  2RH2 A;  1U1S A;  3L2W A;  4GLK A;  5CCA A;  2OTJ A;  2E1H A;  3JCM W;  2LVM A;  2PUO B;  1M4Z A;  2PUK B;  4LD9 K;  1QVG S;  1IZ6 A;  4F7U G;  4PL6 A;  3E1S A;  1OZ3 A;  3CBM A;  2M16 A;  3WVD B;  2VXF A;  4A54 A;  4B9X A;  3GP8 A;  2QQA A;  3BDL A;  5J39 A;  2JN0 A;  3RES A;  3CCS A;  4BAC A;  3TU4 K;  3JRZ A;  3VKI A;  2DZ9 A;  1YJW T;  4M77 D;  2OTL T;  1M8V A;  2DXB A;  4OMF B;  1YHQ T;  1P92 A;  5GAO m;  3HRU A;  3QO3 A;  3CCR A;  3JCM c;  2R58 A;  3MEU A;  3L2U A;  3QSU A;  3FDR A;  4GY5 A;  3VYG A;  5LJ3 e;  1HK9 A;  3JCM P;  1G3S A;  3LGF A;  3OBY A;  3JB9 J;  4RMO A;  1WPY A;  1Q86 U;  4XTY A;  4M7D F;  2B8A A;  3BFM A;  2WSE E;  1VQ6 A;  1M90 C;  2DTO A;  2MWP A;  2CZ6 B;  3CCS T;  5CAI A;  1K9M U;  2CYZ B;  1UGQ B;  3GF5 A;  2VUB A;  5M9O A;  4FU6 A;  4EMH A;  1RI0 A;  2RA2 A;  4OB3 B;  4EMK C;  2PU9 B;  4MDX A;  4JS5 A;  2MF2 A;  1N27 A;  1G3W A;  1WQ7 A;  2XKO C;  5GAM h;  3AHU A;  4PJO E;  4PKC C;  5D6X A;  4JS4 A;  3V8L A;  2HAX A;  3ZBD A;  3JCM e;  1ZBX A;  3SD4 A;  1XTD A;  2EAY A;  2HQX A;  2E5Q A;  5FU7 B;  4MDW A;  5LJ5 f;  2RI3 A;  2L89 A;  1VIF A;  5GMK l;  4A4G A;  2RO0 A;  3KXT A;  3RIR A;  4C92 F;  1Q82 U;  2DJZ A;  3HRS A;  4L5G A;  3RKY A;  3E19 A;  4MZP A;  4QQG A;  1W2B A;  1N9R A;  2WAC A;  1N8R C;  3JCM V;  1K8A C;  3M54 A;  3OB9 A;  4BD3 A;  4PLL A;  5IN1 A;  1YCY A;  1BI0 A;  1AHJ B;  4JRQ A;  1VQ5 T;  1S72 A;  2EJF A;  4M7A E;  2WSF E;  3Q1J A;  5LJ3 d;  4DQ2 A;  2IVW A;  2K2V A;  3QPH A;  2QA4 T;  5LL6 S;  3J80 E;  1K73 U;  1QVG A;  5GAO q;  2LQ8 A;  2JZ2 A;  3INZ A;  4QVC A;  3SDZ A;  4EPC A;  1UB4 A;  2QDY B;  3O8V A;  4BE0 A;  2HD0 A;  4M7D C;  2O4X A;  3ASK A;  5D6W A;  3RUX A;  5GMK i;  2E6N A;  5LJ5 g;  5CKB A;  5HK3 A;  1VQP A;  2DEQ A;  2DXU A;  2QTX A;  2XG8 D;  4M75 F;  3BDU A;  4NL2 A;  4ELY C;  5GAN 3;  3JB9 D;  4OP0 A;  4Y91 A;  4FIB A;  3OMC A;  3X20 B;  4MZT A;  5KE2 A;  3QII A;  3J81 E;  2DZC A;  1PSE A;  4HT9 A;  4Z02 A;  5LJ3 j;  1FXX A;  1S72 T;  3JCM d;  4M7A B;  4C0Z A;  3JB9 G;  1W4S A;  2EQU A;  3GPL A;  1XNI A;  1I8F A;  2RJE A;  5I21 A;  2KMT A;  2EQK A;  3GNG A;  4KBM B;  2DTH A;  1XOV A;  4C92 C;  3CEY A;  4RCC A;  4C8Q A;  4JJN K;  3LW5 E;  1M9S A;  2XK0 A;  1VQP T;  1VQK A;  4M78 A;  4EMG A;  2K4Y A;  3JSC A;  3MHX A;  4KUD K;  4YTL A;  2LX9 A;  4LDW A;  4EDU A;  4C5H A;  3LWH A;  3P8H A;  2M9U A;  3A8L B;  3VUZ A;  3EAE A;  1KC8 C;  2CGH A;  4OGE A;  3SFM A;  1WJQ A;  5D6Y A;  4PNO A;  2P0Q A;  4FL6 A;  3H8Z A;  2RJF A;  4KUL A;  4OB1 B;  4L6V 5;  4EMK B;  3OQ5 A;  4RKU E;  4E7H A;  5LJ3 f;  3CCM A;  4BY6 C;  4II1 A;  2RI2 A;  1MGQ A;  3CCU A;  4PJO A;  2F5K A;  2ZPF B;  2WSC E;  3RMQ A;  4F7U A;  3CC7 A;  4M75 C;  4C8Q G;  2O01 E;  1VQ8 A;  3CCJ A;  2E12 A;  2KAF A;  3CD6 T;  4M7D E;  1NJI C;  3I56 A;  3UWN A;  3JCM b;  1BIB A;  5FRN A;  3OYD A;  1Y96 B;  4J83 A;  2FYK A;  1Q7Y C;  4P5N A;  3PT9 A;  1N6A A;  4BUG A;  5L8R E;  3OYN A;  3CME A;  2RB6 A;  5LJ5 h;  3SWN A;  5EG2 A;  2P4T A;  1BI1 A;  2E70 A;  1OI1 A;  3EFS A;  3PGG A;  3JCM f;  4M77 A;  5FRO A;  3CCM T;  1MHN A;  4QVZ A;  5J26 A;  5CKD A;  3HHT B;  3NTI A;  3JCM J;  2QQB A;  3M55 A;  3CCU T;  2MAM A;  4R56 A;  2EQJ A;  5C0M A;  3CXC S;  2JOY A;  3QZ5 B;  1QVF S;  3CC7 T;  3PFS A;  4M7A A;  4A4H A;  5LJ3 g;  5GMK m;  3QUI A;  4PJO G;  1NE8 A;  3G71 A;  5AYF A;  3CCJ T;  1KD1 C;  3OYK A;  3M57 A;  4C92 E;  2JVV A;  2Y4Y A;  4J5Y A;  3I56 T;  5KCO A;  1KQ2 A;  3OBW A;  2F5T X;  2GF7 A;  1SSF A;  4UC4 A;  3ZEH A;  2AHJ B;  1N9S A;  4OB0 B;  3OS2 A;  3V7R A;  1WGS A;  1QP2 A;  3GLX A;  4WF2 A;  5CVI A;  3CME T;  4RG2 A;  1VQO A;  2V8I A;  3CPF A;  2KSS A;  5DLQ E;  5LJ5 j;  1IRE B;  1HXD A;  3C12 A;  3S6W A;  2KQW A;  1YJN A;  2LDM A;  3QKJ A;  4BB7 A;  3LX7 A;  2X4W A;  4ME7 A;  4M7A D;  2EKO A;  4M77 G;  2V8K A;  2DO3 A;  1VQ7 A;  4JRK A;  3CPW S;  4E7I A;  1JJ2 A;  3JCM g;  2OTJ T;  5DLO A;  2XI9 A;  3KUF A;  3G71 T;  4BE2 A;  1H3Z A;  4MMK A;  2GCX A;  2D6F A;  4EMK A;  4M7A G;  1ZQ1 A;  4C92 B;  5GAN 4;  2KK4 A;  2ZCF B;  4C5I A;  2LNV A;  4M75 E;  4DOW A;  4X34 A;  3OMG A;  4FT4 A;  4E7K A;  1VQO T;  1LNX A;  1WNL A;  4IUQ A;  2Y90 A;  5GAN 5;  4R55 A;  1FX7 A;  3NTK A;  3ER0 A;  3HRT A;  2VYT A;  4KUI A;  3SB2 A;  4DOV A;  1YJN T;  1VQL A;  4E47 A;  3CCR T;  4IKF A;  1K9M C;  2LQK A;  4J7F A;  1VQM A;  4XU1 A;  5HY6 A;  4E7L A;  2HBP A;  1JB0 E;  3EFR A;  4N0A A;  1M90 U;  2KDS A;  5GAN 2;  2LRQ A;  2ZPI B;  3JB9 F;  2X4J A;  4QQD A;  3JCM X;  2DXT A;  3A8O B;  1VQ9 A;  4J6W A;  4BY6 B;  2RHZ A;  1QP3 A;  5KE3 A;  3URG A;  3OYL A;  3OA6 A;  1UGP B;  3M53 A;  2X35 A;  1VQ6 T;  1B34 A;  4M75 B;  5FRM A;  2E64 A;  3RER A;  4JLG A;  2K5F A;  2RHX A;  4C0F A;  3LH0 A;  4QVD A;  1Q82 C;  2JTF A;  3VUB A;  4IUV A;  1G5V A;  2RM4 A;  3N5B B;  3P8D A;  1VQL T;  4LDU A;  3RKW A;  2PQW A;  5LJ3 h;  2DK3 A;  3V8K A;  1WJR A;  3G6E A;  4IUP A;  4C5E A;  3L2V A;  3V7S A;  3QDR B;  3PMT A;  3HKS A;  1BKB A;  1BI3 A;  3L2Z A;  1YI2 A;  2XDP A;  5C6S A;  1VQ9 T;  4ZTF A;  2ZPH B;  2M0O A;  4ZGJ B;  1K8A U;  1K73 C;  4XTZ A;  4J7I A;  4TVR A;  2YLC A;  3S3O A;  3FJP A;  3HPW A;  4QW2 A;  1RL2 A;  1M5Q 1;  1OZ2 A;  5CK9 A;  3OYC A;  4V2S A;  4M7D D;  5A0L A;  2QEX A;  2EJ9 A;  1VQ4 A;  1UGR B;  3JCM h;  3GNF B;  4C8Q F;  4XTX A;  3M59 A;  2EWN A;  3MP6 A;  3RMS A;  4M78 F;  3G6E T;  3CCE A;  5KH6 A;  5GMK e;  2RHI A;  2XU8 A;  5CR2 A;  2QQ9 A;  4LDY A;  2CS7 A;  3QJY A;  2LTO A;  4A4F A;  1JRI A;  2PVD B;  3OYE A;  2LC4 A;  3UPU A;  2JNG A;  1YI2 T;  1V29 B;  3QJ6 A;  4IUR A;  2XIC A;  2VGN A;  3DB3 A;  4JLI A;  2C06 A;  3VV0 A;  3WXM B;  5CKF A;  3OYY A;  1LOJ A;  2GQV A;  5GAN e;  2BKD N;  1QVP A;  3OW2 A;  2RI5 A;  4C92 D;  2I2L A;  3G7Z A;  2X4Y A;  2XHC A;  3C95 A;  4PLI A;  1UGS B;  2DKG A;  5CQY A;  3OY9 A;  2QEX T;  2PVG B;  4PJO F;  3CCL A;  3HP9 A;  2DAQ A;  3CCE T;  4F7U F;  2GFU A;  4ZGD B;  5A0G A;  3UT1 A;  4C92 G;  1XQH A;  2CZ0 B;  4A4K A;  3HFO A;  3PIO A;  4ZGE B;  3S3M A;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...