2HBPA

Solution structure of sla1 homology domain 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
b'KKSRLWVDRSGTFKVDAEFIGCAKGKIHLHKANGVKIAVAADKLSNEDLAYVEKITGFSLEKFKAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoskeleton assembly control protein SLA1
publication title Structure of Sla1p homology domain 1 and interaction with the NPFxD endocytic internalization motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis, protein binding
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.700 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2hbpA00
2HBPA
chains in the Genus database with same CATH superfamily
2ABLA 2GBQA 4ZTFA 4HA8A 5GANj 1IREB 1K9AA 4L5GA 1VQPQ 1VQOT 3FC3A 2MOXA 3OYEA 4ZTJA 1Q82C 3X25B 4OMMA 3X24B 4E7LA 1B34A 3EHRA 3PMIA 2QEXQ 1X2KA 2D1XA 4F17A 2PQWA 4RTXA 3FIFA 1QVGA 4MZTA 1YI2T 4M77A 3GNFB 4C5GA 4JDSA 3OYMA 1VQNT 2J6KA 4J6WA 3CXCS 1UHCA 2CZ1B 2DIGA 1WGSA 2RJFA 2EYZA 1KQSS 2VB6A 4J9FA 2GGRA 2XG8D 2IVWA 2JT4A 1ZSZB 4KGXB 4QW2A 2MF2A 1UUEA 4CC2A 2CH4W 1S72T 1T3LA 1PG5B 1YCSB 1A0NB 1SHFA 2AIRB 2QQRA 5GMKl 4PK4A 2RJCA 2DF6A 4F7UE 2OTLQ 1U1TA 1YBYA 5GAN8 5FRNA 3E1SA 3A98A 3H6ZA 3CC4A 3I56T 3M58A 1UHFA 3PGGA 4E6RA 1GCQC 3EG3A 3CXCP 3VYHB 3OW2S 4XAXB 4J6YA 2HAXA 3G71Q 2K2VA 4M77G 1KQSP 1YJ9A 3HHTB 3JCMX 3OYNA 2MPXC 1YJNQ 4CC3A 3CMEQ 5LJ5f 3JB9G 3OSVA 2GTOA 2OAUA 3DLMA 1D1BA 4QQDA 3SWNA 1KQ2A 2LQKA 4M7AF 1VQ6Q 3GPLA 5GMKe 4N0AC 4C0FA 2LJ0A 1MHNA 1H8KA 1QCFA 1MMDA 1VQ7T 2VGMA 1BU1A 1TTHB 4F7UA 3ER0A 1TXQA 2EQJA 3JCMg 1GCPA 1T0JA 3OW2P 2DIQA 5GAOr 1XNIA 2IPOB 5I21A 2L3RA 3UA7A 5GAMj 1W1FA 1H3HA 1M90C 4FYYB 2JTMA 1Q86C 3RKYA 2WSEE 2QA4T 1WXUA 3R6OA 4ZGEB 1X01A 2RHIA 2E70A 5GAN5 2NYSA 2KE9A 3OA6A 3DB4A 4BI3A 3G6EQ 3I35A 3TEEA 2AK5A 3REBB 2ZZDA 3QZ5B 2FVUA 2XIDA 2DYBA 3KBGA 3VS5A 3CCUA 4KUIA 3A8OB 4JZ3A 4J9EA 3QSUA 2EGEA 3JRZA 4F7UG 3CCRA 1M27C 1E6HA 1YCYA 3PIOA 3TSZA 1ZLMA 5M9OA 2HL5C 2L2PA 3CC7A 2EFIA 3I9QA 2B8AA 3JV3A 3H0HA 3SB2A 3G4ST 1KJWA 2NUZA 1ZX6A 1M90R 2QQBA 1QCOA 4OMFB 1WDXA 1JB0E 1QVGS 1Q86R 2R57A 3NFCA 4RUGA 1XQHA 3N5BB 1TWBA 1X75C 1WX6A 1TG0A 4RG8A 3FB9A 4KGVB 4E2FB 3CPFA 5GANg 1VIEA 1AWOA 1VUBA 4DQ2A 4J9HA 1V1CA 1N8RC 5KYXB 3MCAB 3AT1B 2D0NA 4LXCA 3V8JA 5IT9E 1T3SA 2HQHA 3IQLA 1RAEB 2L3QA 4C8QC 2EJGA 1WZOA 3QDFA 5FU7B 3OYCA 4F04B 3M54A 2ZPIB 1WJSA 1VQKA 4HT8A 4J6XA 3GIBA 3CCEA 1FMVA 4YTLA 1RAHB 1M1FA 1KIKA 2RQRA 4J7FA 3CCQT 1LNXA 1M2OA 1TH7A 2VUBA 1ZBJA 2H8HA 1FMKA 3CCSA 1YJWT 2M1HA 4O5VA 3OYBA 2DJQA 1VQMQ 1OEBA 4ATOA 4C92F 4V2SA 2QK0A 5KH6A 4C5IA 1I4K1 4JS4A 2DXBA 4HCCA 5J39A 2DK3A 1MV3A 3FEOA 2YRDA 1K1ZA 1OPKA 4L6V5 1Q81U 1AWWA 2JUFA 1N8RR 2RHZA 1M1GA 2FO0A 1NE8A 1SG5A 2EYQA 2DA9A 2I2LA 4LDWA 3CD6T 2E1HA 2VXFA 2QASA 3CCJA 4IUPA 2ESWA 1I0CA 3VV0A 2O2OA 3CMAA 5FLXE 1WNLA 2LDMA 4CC4B 1V29B 4DBFA 2GQVA 3BY7A 4EMHA 4ELZC 5FRMA 1M30A 5CKEA 1KSWA 4Q5WA 1VQ5A 3CC2Q 1EX4A 1VA7A 5IN1A 4EMKA 2GQIA 3C95A 2RO0A 3D7SB 1G3TA 2EWNA 3EG2A 2QEXT 3OYFA 2O88A 1BCMA 2EJFA 2EVRA 3CCVA 5I22A 1XOVA 1NPRA 1RAIB 5FWCA 2DL3A 4M75A 4Z88A 1K8AC 3VS2A 3CBOA 1VQ8A 1GCQA 1R77A 3QHSA 1PNJA 2XDPA 2D9TA 1AD5A 1EIFA 2VV5A 1KQ1A 5I11A 1K0XA 1GBQA 1RI0A 5CQXA 2F2WA 1M3AA 5GAMg 3NMZC 2EQMA 5D7UA 1AVZC 4M7AD 3GP8A 4XTXA 1ZSZC 4II1A 3S3MA 5I2SA 2L3SA 4IUTA 5KYUA 4GBQA 3URGA 1PSEA 2ZAEA 4D8DA 2LCLA 3RMQA 2K9GA 4BI4A 3HTRA 3JCMc 2KXDA 1W2BA 2C06A 2X3WD 4GLMA 2EJ9A 1GRIA 3CCLQ 2OTLT 5HK0A 5KYWA 1K73C 4M7AB 3V7RA 4AG2C 2RHXA 2O4XB 3G1JA 4M77F 2ROLA 1OI1A 1K8AR 3G71T 2K5IA 4A4GA 4M75G 4CC7A 5HK3A 3VUZA 1YWOA 2QTVA 1FX7A 3JB9F 2EGAA 2J06A 1PD0A 3META 3CMET 4J9DA 2EIFA 1Z9ZA 3HFNA 3EG1A 3MJXA 1VQ6T 1SRMA 3WVDB 2QYZA 3BE3A 1VQLA 2J6FA 2PVGB 2JW4A 1JXMA 1XTDA 4QVZA 3V7SA 3CC4Q 4UC4A 3UPUA 3JCMd 2CZ0B 4C8QE 1TUCA 2XHCA 1J3TA 3VS4A 4FL6A 3I55A 1RL2A 1KFZA 1RAGB 1K73R 1ZUKA 5A0LA 1QWEA 3C94A 2X51A 4XU2A 1E7OA 2A28A 2W0ZA 1F1BB 1HYOA 1D1CA 4JZ4A 5A0DA 5DLQE 1O75A 3EGDA 2HSPA 5CR2A 3EH2A 1WPYA 2HQXA 1WI7A 3G6ET 2VYTA 1UB4A 5GAN4 3VS1A 2BE9B 4PJOD 4B6MA 3DB3A 3TSWA 3M4YA 2Y4YA 3FRNA 1NM7A 2QGGA 3VS0A 3S3NA 2CGHA 2DBKA 4C92A 1OX9A 1C6VX 4C8QA 2C0IA 2DD4A 3OQ5A 4F7UF 3H9NA 3TQ7P 2JM8A 1SSHA 2FZGB 1Y71A 2RD1A 2P4RA 1VOMA 2PUKB 2KR3A 2BE7D 3LYIA 2LRQA 2DNUA 4JRQA 2DTOA 4AFQC 1QVFS 2YUOA 2CP3A 5GANd 2YRCA 2VC8A 2VVKA 2MIOA 3U23A 3O5ZA 3EFSA 1FXXA 2YWWA 3A8MB 2KXCA 1O9SA 1AEYA 1MV0B 3UA6A 2ZCFB 1IO6A 1R0BG 2NUPA 2J7IA 1MNEA 1JJ2A 1YIJQ 5FU7C 2COYA 1TUDA 1QW1A 3PIPA 1D3BB 2BKDN 3LH0A 4C8QG 1C1AA 1NYGA 2DZ9A 3M0UA 2MCNA 1W6XA 4M78C 2C0TA 3NTKA 1QVFP 1KHIA 1S1NA 2XDDA 2K6DA 1QCNA 4X1VA 4XTUA 3CEYA 3PTAA 1VQMT 3QZ9B 1UJ0A 3CBMA 2R5AA 2EYWA 2COZA 3T9NA 5IHKA 3LH5A 4BB7A 1MMAA 4A4HA 1Y07A 5KYNA 1FMWA 3O8VA 2B86A 2RH2A 1YI2A 2LQ8A 3V7CA 3NPFA 2IG0A 1VQNA 3Q1JA 4JS5A 3JCMe 2YUNA 4NL2A 5CAIA 3LWIA 4PJLA 2R58A 4BD3A 2V8IA 1PD1A 1GXIE 1AT1B 1LOJA 2AKKA 3I5RA 4ZN1A 1M1KU 2AZSA 2HZYA 5IAYA 4ESRA 1M2VB 4ORZA 4J9CA 4GY5A 3OS5A 3ZL7C 2E4HA 4RKUE 2W10A 4A4KA 1VQ9Q 1KG1A 3TCJA 2A0FB 1N27A 3CC2T 4R55A 2FPFA 3SDZA 1TU0B 1X27A 4ZNXA 2DM1A 4BE2A 4FW1A 4NL3A 3I56A 1K0SA 1SSFA 2P4TA 1OYXA 2GTJA 3EAEA 2EQUA 3FDRA 4XK8E 1OU8A 3R6NA 1BB9A 7AT1B 4JJNK 3CMAQ 2VXEA 4M77D 3RERA 5HY6A 1OULA 2JN0A 1HXDA 2KROA 1U06A 3KUFA 2NUTB 2PU9B 2A08A 5GAMd 1UE9A 2F5TX 1H92A 4LDVA 1H641 4M77B 1VQ7A 1YITA 3QYGB 3M5AA 5GANe 3M59A 4ZN3A 3RBBB 1NG2A 3P8DA 4B9XA 4PJNA 4IUQA 1I07A 1OZ2A 3CPWS 1Q81C 3CCLT 2HD0A 3MP8A 1NLPC 4QKUA 1SKUB 5IXFA 3ZEHA 2QA4A 2BZYA 4M75F 4IKFA 2YRVA 2E64A 2X4WA 5KCHA 1Z9QA 2QG9B 1NBEB 1JU5C 1PM3A 5LJ5h 3JB9J 1M8VA 2QDLA 2EYYA 4J9IA 1WJRA 3HL8A 3L2UA 2WSCE 2X35A 1M8MA 3MP1A 4LDXA 3ME9A 3VJPA 2HNIA 4AMCA 4BY6B 1V76A 4MDWA 4L59A 2X4YA 1UFFA 1JEGA 2CP7A 2DL5A 4OF1A 1Q95G 2M0OA 3EGUA 4NS5A 4D8KA 1M9SA 4E7IA 2K57A 4Y92A 3CPWP 4KRTA 4FYVB 3CC4T 2JVVA 3M0RA 2CKKA 1WHMA 3QJYA 4C0DB 3S6WA 1Q81R 4IURA 3SWNB 4DEYA 2O01E 3V8LA 2DVEA 4X9CA 4PJMA 4OB0B 2EYXA 1OPLA 2RPNA 2LX7A 4X9DA 4M7DD 4M78E 2BIVA 2P0KA 4JJBA 1IHWA 1E6GA 1PCXA 2LJ3A 3EFRA 5L23A 2AHJB 4MMKA 1VQLQ 4RTUA 1X6BA 1BI3A 2E6NA 3JCMJ 3MO8A 2AKLA 2QGFB 2K3YA 5KYXA 2MWPA 2PTKA 3I55Q 2A3LA 5FW9A 2GCXA 2DJZA 2ZPHB 4M7DB 1WHJA 2OTJQ 4PLLA 2GNCA 2BTTA 2DL4A 4J5YA 3RUXA 5KYYB 3JCMf 4AG1C 1YJWA 3EFOA 5A0GA 4XTWA 3MEAA 1IGUA 3OB9A 1NJIR 3L42A 4PJOC 4J8OA 2XI9A 5GAOm 2LT4A 4RCBA 2JNGA 4FU6A 4FYWB 4M78A 2CS7A 2CP2A 2HSEB 3VRZA 1W4SA 4LD9K 1RADB 5GAMe 1BCOA 3KXTA 2DILA 2JJ9A 2HKNA 4HKEA 3L2QA 3GF5A 3A1PA 5I2MA 3MHXA 2JXBA 3LGLA 9ATCB 1GFDA 2QQ9A 1I8FA 2E3HA 3AHUA 3M53A 2RQUA 2LT1A 4GLKA 2MYSA 1QVGP 3VU3C 1OZ3A 3C4SA 2DD5A 2RQVA 1JRIA 3OBYA 2ZPGB 1YIJT 4C8QF 3NGPA 4XTYA 5LJ3j 2CH4A 3BFMA 1BI1A 4LDUA 4MDXA 5GAN7 4C5HA 1JO8A 3H0FA 4PKCC 3EG9A 2KBTA 4Z8AA 3NTHA 3HSBA 3VUBA 1SF9A 3VS7A 4M4ZA 4BE0A 2DEUA 1TOVA 4M78G 5CIUA 2QEXA 2YLCA 1RABB 2DO3A 5GANf 3A8HB 1X43A 1G3SA 4E7HA 4F14A 2ECZA 4IIOA 1UGVA 4JRKA 1R8OB 4EDUA 2K5FA 1NPPA 5KE2A 1PSFA 5L8RE 3RR6A 1VQPT 3MKDA 2RK1A 1BYMA 1IHVA 4DBRA 4JRIA 5KCOA 2LNHB 2CP6A 2XDBA 3CBPA 4N4IA 1NJIU 1VQ4Q 4O6JA 1VQ9T 2AT1B 3L1AA 1JBMA 2LC4A 4DBQA 2FG0A 2CREA 3H8ZA 2K79A 2M51A 1WYXA 1JXOA 2QQSA 2K5LA 2RI3A 4N4HA 2KEAA 3OYHA 3G71A 3GNGA 2YT6A 2PZ1A 2EKHA 2L3PA 4M75D 5IH2A 2D8JA 4HCKA 4EMKB 3CMEA 5HKCA 2MAMA 4WCIA 4N0AA 1FYNA 2DTIA 2LZ6B 2HBWA 1VQ6A 4E7JA 2JMCA 2V1QA 5AT1B 2EBPA 3OMCA 4Y91A 1Y96A 2KK4A 3I56Q 3GLXA 3OS1A 5IHIA 4LN2A 4KH1B 4M75B 4RTZA 3J80E 1XJWB 1ZSGA 3VS3A 2EAYA 2P0PA 3C12A 4IIMA 4HVWA 2G3RA 4DA4A 2KY9A 4HXJA 1MMGA 3J81E 1YJNT 2ATCB 1M3BA 2V1RA 3I5SA 3FJ5A 4OGEA 2M02A 3QPHA 4RCCA 3TU4K 3HPWA 1K76A 5FWBA 1ZHIA 2JS2A 4KGZB 4KH0B 4LUEA 3QJ6A 2QXFA 2HKQB 5LJ5j 4R56A 1N9RA 5KYUB 4PJOE 3M0PA 1RLQC 3QWXX 1YITQ 5GJWB 1WJQA 2COWA 1CKAA 2E5KA 1N6AA 1M1KC 1X69A 5KYWB 1WLPB 5GAMf 4BY6C 3C0CA 3UATA 5CK9A 4RTTA 3L2ZA 1YJ9Q 4QVCA 3NTIA 2JS0A 1G3WA 3SFMA 1FWZA 4DOVA 2L5QA 1M5Q1 2DXUA 3WXMB 4K11A 2KT8A 3JCMQ 3CCMA 5IXBA 4C0DC 2F1LA 2CDTA 2OJ2A 2DL7A 2KRMA 3SWNC 1ZQ1A 1WXTA 5LL6S 4IUUA 3OS0A 4E7ZA 2A7YA 4PJOA 2J6OA 1RLPC 2RNAA 3CXCA 1U3OA 2DRMA 5LJ3g 1QLYA 2CT3A 2IIMA 3M0QA 1H3ZA 1OX8A 2LQNA 1RI9A 4ZGJB 3BDLA 1ABOA 1KQSA 3REAB 1ABQA 1VQLT 2C0OA 2JTFA 2QI2A 3OYJA 1M1KR 2PVDB 3HP9A 3MEVA 1UDLA 1Q7YR 3M0SA 1VIFA 4M7DC 3I55T 4OMQA 2OTJT 4CRIA 3HRSA 2E65A 2ENMA 3EGDB 4Y28E 4C92D 3KFVA 2F69A 2K4YA 4LUDA 2RN8A 3OYDA 1KC8U 2M0YA 3EGXA 4C5EA 3CCUQ 3OW2A 1VQMA 2LX9A 1WQ7A 1NYFA 2YHTA 4NOYA 1YHQA 5GAN3 1R0CB 4OB3B 3CCRQ 4PJOG 4C92B 2K2MA 4C8QB 3PMTA 4E47A 3OYGA 4FCYA 3CC7Q 1PKSA 1LVKA 1UEBA 3SHWA 4MMLA 3MP6A 3UT1A 5CKFA 5LJ3h 2DBMA 1VQOA 1SEMA 2KGTA 4IUVA 3VRYA 2FZKB 5CVIA 1W2BS 5EC7A 3MEUA 4LNPA 4PJJA 1KK7A 4HCZA 1LPLA 4QQ6A 2YXYA 1MUZA 5GAOl 2V26A 3SEMA 2DX1A 3DKMA 2DYIA 1G5VA 3OMGA 3L2WA 1HK9A 2L8DA 1VQKQ 2Y90A 3CC2A 3CCEQ 4M78F 3JB9H 2NUPB 2FPDA 2VKNA 1G2BA 5GAOq 5FU6B 3CCSQ 1TUGB 4D6WA 5DM7R 2AZVA 1PKTA 1AWJA 2LNVA 2WSFE 3HKSA 2MWOA 3INZA 2EPDA 1Y57A 1ARKA 1SHGA 1P92A 2CUDA 3JCMV 3H0IA 2DMOA 5C0MA 1W2BP 1IGQA 2P0QA 2RQWA 4ME7A 5J26A 2F2VA 1PHTA 3P8BB 1Q7YU 2O9SA 3V8KA 2RQTA 1HSQA 3X28B 1S72A 2HQEA 2XKOC 4EIKA 1KHCA 4CI0C 1ZSZA 3VKIA 4EPCA 1WQWA 2ROTA 3QG1A 2ED1A 3ASKA 2I0NA 4BUGA 2NUTA 2DEQA 3RNJA 3RIRA 3CCJQ 5LJ5g 1M4ZA 1B07A 3A5ZB 1VQ4T 2X9HA 4AFSC 5GMKj 3UF4A 1K9MR 1KD1R 1T0HA 4PFOA 2MI6A 1B34B 4QVDA 3VYGA 3CCLA 1QMCA 1UTIA 2VWFA 5AYFA 4A63B 3OSSC 3JB9D 1AHJB 3P8HA 3RKXA 1VQ5Q 3LW5E 2P84A 2X3XD 3TREA 3PFSA 2QTXA 3E9FA 2KQWA 2SRCA 4AFUC 3OYKA 3DLLA 2CP0A 1GBRA 5A2QE 4HT9A 8AT1B 2LCCA 4A4EA 3HRTA 1RAAB 3G7ZA 4FT4A 1NEGA 3CCVQ 1ACMB 1Q82R 4EMKC 3H41A 5IHNA 2D6FA 2DZCA 1BI2A 4QQGA 1OOTA 2NLUA 3EG0A 3A8LB 1VQ8Q 4XU3A 3X20B 3PVLA 4M7AC 1B7TA 3PT9A 4M75C 2E5QA 3LLRA 2DAQA 3OBWA 5CQYA 4MZPA 2DXTA 2CYZB 2VGNA 4OMNA 2GFUA 5C6SA 4M7DE 2E3IA 2LVMA 2RHUA 3X26B 2XMFA 1JJ2S 3S3OA 3LWHA 1D09B 2F5KA 4FSXA 5HCKA 4E7KA 5KE3A 4ZGDB 2DERA 1YFNA 4X34A 1YITT 2KYMA 2DRKA 3OYIA 2J05A 3G4SA 1UGRB 4ANJA 4EMGA 2LQWA 1NJIC 2RJDA 1D0YA 1QP2A 3PE0A 4FSSA 1YJ9T 3M0TA 3TVTA 2Z0WA 1YNZA 2MMPA 4KULA 4RMOA 2D8HA 5D6XA 1I5OB 2OAWA 1NZ9A 4M7DA 2RK2A 1BKBA 1KD1U 1K9MU 1JJ2P 2A37A 4F7UB 2XICA 3NHNA 4JJDA 8ATCB 4J9GA 2O31A 1CSKA 5KYYA 2KVQG 3UDCA 2YLBA 2JMAA 2DVJA 2HBPA 1IRXA 5LJ3d 1LJOA 1OQKA 2GFAA 1G8XA 2EQKA 2DFUA 4KUDK 1BK2A 3QKJA 1QP3A 1LCKA 3CCQA 2K3XA 3JSCA 2QDYB 1Q82U 2E41A 2ZPEB 2CP5A 1PRLC 1IXDA 1N9SA 1Y0MA 3BW1A 2JOYA 3CCMQ 1YIJA 3GOXA 4DOWA 4FIBA 1VYTA 3WVEB 2RI5A 1DJ7B 3OYYA 2M9UA 4MZMA 3JCMh 3QO3A 2H3JA 1NLOC 3THKA 5EG2A 4F16A 2RI2A 4JLGA 1EFNA 3RKWA 4M7DG 2PUOB 1ZUUA 1TSFA 3VS6A 1UJYA 2KMTA 4PFPA 4OVAA 2KRNA 3CCUT 1PC0A 5D6WA 3CD6A 2RJEA 3PNWC 3A8GB 4OB2B 4PJOF 4M78D 1ZBXA 4AFZC 3CCRT 4C92C 2KDSA 1BIAA 4WTOB 1CKBA 2DPPB 4XU0A 3CC7T 2PVOB 3MPUB 3EFOB 4BDYA 2A36A 2YSQA 2MK5A 4RTVA 2H3EB 2JM9A 1VQPA 5CKHA 3E19A 4M78B 3OS2A 4QT7A 3OYLA 2OX7A 2KSSA 2FEIA 1W70A 1YHQQ 4Z02A 2WACA 5FROA 1D0XA 1I5LA 4FW2A 5GMKi 3RESA 4J83A 1VQ9A 1X6OA 1D1AA 3FJPA 4KT0E 1VQKT 3CCET 4LD6A 1D0ZA 1VQOQ 4N4GA 5FU6C 1U5SA 3CCST 5GANh 4OMPA 3SD4A 4PNOA 4M7AE 1WFWA 4M75E 4TVRA 5D6YA 3FLGA 2XK0A 2XD0A 3EG9B 2R5MA 3OYAA 2FYKA 1M3CA 4PFZA 3RDVA 4JUVA 3E2UA 3JB9I 1QKXA 3JCMP 5GMKm 1YI2Q 5DLOA 4OMLA 2XU8A 4VUBA 2NWMA 2E10A 1VQNQ 2D0QB 4FYXB 4WF2A 1M90U 5GMKh 4Z89A 2OTLA 3MEWA 5LJ3e 1Q86U 4OB1B 1KC8C 2HCKA 1GL5A 4A54A 5LJ5d 4RTWA 3ZFJA 3ULRB 1QVFA 3BDUA 3CCJT 4E7SA 3QXEB 1WA7A 4BI8B 4ELYC 4M7AA 3CMAT 2EW3A 1YJNA 2O4XA 4OMOA 2EQIA 1IB8A 4BE1A 1S72Q 1QWFA 2CZ6B 1AWXA 1YN8A 1EZZB 1VQ5T 2HEQA 2DLPA 4C0GA 2OI3A 1BIBA 5CCAA 2ZPFB 1ZUYA 4M77C 1PWTA 3JCMb 3CCVT 3UWNA 4JJCA 1YP5A 3ZBDA 3CQTA 4PLIA 4PL6A 2RA2A 5CO7A 1KC8R 4XTVA 5GJVB 5GAN2 1PRMC 1X2QA 2CSQA 1U8RA 1VQ8T 2X4JA 1SRLA 1N8RU 1ZA1B 2V8JA 4XU1A 1X6GA 4KBMB 2KRSA 1HJDA 5ECAA 2QAZA 4M7AG 4RTYA 4DEXA 2DE0X 2CSIA 4A4FA 3QUIA 1OU9A 1VQ7Q 3G6EA 2KI7A 2PNIA 2ED0A 1QKWA 2EGCA 1B3QA 3OY9A 1Y96B 2CUBA 4HVVA 2FRYA 2FZCB 1Q7YC 3E9GA 4XTZA 3F70A 1WHKA 4BACA 1RAFB 2DKGA 3M55A 5GAMh 1G83A 1JQQA 4FT2A 1GFCA 1TS9A 2DL8A 2QA4Q 4C92E 3M57A 2LCSA 2VASA 2FRWA 2YUPA 2OTJA 1MNDA 3EHQA 2EKOA 1NEBA 3J7AF 2K7AA 4B9WA 4DBHA 1BI0A 1UG1A 1VYUA 2RF0A 1WHHA 2L0AA 2F2XA 3QYHB 2DTHA 1RACB 1MGQA 3LGFA 5CKBA 1QQJA 1RUWA 5GAN6 4P5NA 4JPBW 1U1SA 1I81A 2FB7A 3G4SQ 3GBQA 2ZGWA 2BZ8A 2HL3A 4JLIA 3PVQA 1C0MA 3L2VA 3L2RA 3QIIA 5LJ5e 4XQ3A 2O9VA 2JZ2A 4LDYA 4C8QD 2FL7A 2Y4XA 2E6ZA 4JRPA 2ZPBB 4FM4B 1MMNA 4R0KA 1QVPA 2QQAA 4LE9A 6AT1B 1D3BA 1AZEA 4RG2A 1BBZA 4PJOB 3CCMT 1UGPB 1WHGA 5DY9A 3JCMW 3HRUA 2FPEA 2RHYA 2KNBB 2HMAA 3CPWA 4AT1B 5CKDA 4M7DF 2YUQA 1K8AU 4A53A 2RMOA 3QDRB 2KYBA 1VYVA 1ZA2B 3JAME 1WIEA 3CCQQ 2DETA 2E12A 2KAFA 4BDZA 3QBYA 4J9BA 3M4GA 2RB6A 5LJ3f 2YDLA 1YJWQ 2JTEA 2M16A 2FHDA 2V8KA 1N5ZA 1SPKA 1YWPA 2K3BA 1G3YA 1AZGB 2SEMA 1WXBA 3RMSA 4C92G 3EGXB 2G6FX 2RM4A 2KT1A 5GAOp 1OV3A 4OP0A 2LTOA 1HD3A 2LJ1A 4HCBA 3M56A 2BZXA 2DXCA 3EH1A 3QWYA 3HFOA 3M9QA 4OGCA 1K73U 1I1JA 2CT4A 1M2VA 1WHLA 1UGQB 3LX7A 3CD6Q 2LP5A 1K9MC 2GF7A 2HDAA 1Y7XA 4J7IA 5GAOn 1KD1C 1AOJA 1YHQT 1K4US 4M77E 2L89A 5J3BA 2CZ7B 4C0ZA 2LMJA 1VQ4A 4HVUA 1IZ6A 1UGSB 1UECA 2X4XA 2BUDA
chains in the Genus database with same CATH topology
1RL2A 2RJDA 4JRKA 1QP2A 1R8OB 4EDUA 1YJ9T 4ZTFA 2K5FA 5A0LA 1NPPA 4HA8A 3C94A 4XU2A 5GANj 5KE2A 1IREB 4L5GA 1PSFA 2MMPA 4KULA 5L8RE 1VQOT 4RMOA 1VQPT 5D6XA 3FC3A 3OYEA 4ZTJA 1NZ9A 1Q82C 4M7DA 2RK2A 3X25B 1BKBA 1KD1U 1K9MU 5A0DA 3X24B 4F7UB 2RK1A 5DLQE 1O75A 2XICA 1B34A 4E7LA 1BYMA 5CR2A 4JRIA 3PMIA 5KCOA 1WPYA 2KVQG 2PQWA 2XDBA 2HQXA 3UDCA 2YLBA 3G6ET 2VYTA 2HBPA 3CBPA 4N4IA 1NJIU 1UB4A 5LJ3d 5GAN4 1LJOA 3FIFA 1QVGA 4PJOD 3DB3A 3M4YA 2Y4YA 4O6JA 2GFAA 3FRNA 2EQKA 3L1AA 4MZTA 1VQ9T 1YI2T 1JBMA 4M77A 3GNFB 3S3NA 2CGHA 2LC4A 3QKJA 1QP3A 4C5GA 4JDSA 3OYMA 3CCQA 2K3XA 3JSCA 2QDYB 4C92A 1Q82U 1VQNT 2E41A 4C8QA 2DD4A 2ZPEB 3OQ5A 4J6WA 4F7UF 3H8ZA 3CXCS 1N9SA 2DIGA 2CZ1B 2K5LA 1WGSA 2QQSA 1Y71A 2RD1A 2RI3A 4N4HA 2RJFA 3BW1A 3OYHA 1KQSS 2JOYA 1YIJA 3G71A 3GNGA 3GOXA 4DOWA 2PUKB 3LYIA 4FIBA 3WVEB 2RI5A 2LRQA 1DJ7B 2XG8D 2IVWA 2M9UA 3OYYA 4M75D 4MZMA 3QO3A 3JCMh 4JRQA 2DTOA 4EMKB 4QW2A 1QVFS 2H3JA 2MF2A 3CMEA 5HKCA 2MAMA 5EG2A 2RI2A 4JLGA 2DTIA 4N0AA 3RKWA 4M7DG 2PUOB 5GANd 1S72T 2VC8A 2KMTA 2QQRA 5GMKl 1VQ6A 4E7JA 4OVAA 3CCUT 3EFSA 5D6WA 2RJCA 1FXXA 3CD6A 4F7UE 3A8MB 1U1TA 1YBYA 2RJEA 3A8GB 1O9SA 3PNWC 3OMCA 4Y91A 5GAN8 3E1SA 4OB2B 1Y96A 2KK4A 3H6ZA 4PJOF 5FRNA 3GLXA 3OS1A 3CC4A 3I56T 4M78D 1ZBXA 3M58A 3PGGA 4M75B 3J80E 2ZCFB 3CCRT 4C92C 2KDSA 3OW2S 3VYHB 2EAYA 1BIAA 2P0PA 4XAXB 1JJ2A 4J6YA 2DPPB 3C12A 2HAXA 2K2VA 5FU7C 4M77G 4XU0A 3CC7T 2G3RA 4DA4A 2PVOB 1QW1A 4BDYA 3PIPA 1D3BB 2KY9A 2BKDN 3HHTB 1YJ9A 3LH0A 3JCMX 4C8QG 3OYNA 3J81E 1YJNT 5LJ5f 2DZ9A 4OGEA 1VQPA 5CKHA 3JB9G 3E19A 3QPHA 3OSVA 4M78B 3DLMA 2OAUA 3HPWA 3NTKA 4M78C 1ZHIA 4RCCA 3OS2A 3OYLA 4QQDA 3SWNA 1KHIA 2KSSA 1KQ2A 2LQKA 2XDDA 3QJ6A 2QXFA 4M7AF 4XTUA 3GPLA 3CEYA 3PTAA 5GMKe 1VQMT 5LJ5j 4N0AC 3QZ9B 4C0FA 4R56A 1N9RA 3I55A 4PJOE 3CBMA 1MHNA 2R5AA 4Z02A 3T9NA 1VQ7T 2WACA 1WJQA 5FROA 2VGMA 4F7UA 3ER0A 4BB7A 4A4HA 2EQJA 1I5LA 1N6AA 5GMKi 1Y07A 4J83A 3RESA 3JCMg 5GAMf 1M1KC 4BY6C 1VQ9A 3O8VA 2RH2A 1YI2A 1X6OA 2LQ8A 3V7CA 5CK9A 3L2ZA 3FJPA 4KT0E 2DIQA 1VQKT 2IG0A 3CCET 1VQNA 5GAOr 3Q1JA 4QVCA 3NTIA 3JCMe 4JS5A 4LD6A 1G3WA 1XNIA 5I21A 4N4GA 1FWZA 2L3RA 4NL2A 5FU6C 3SFMA 4DOVA 5CAIA 5GAMj 2L5QA 1M5Q1 2DXUA 3WXMB 3LWIA 3CCST 5GANh 1M90C 2JTMA 3SD4A 3JCMQ 2R58A 4PNOA 4M7AE 4BD3A 1Q86C 2V8IA 4M75E 3RKYA 4TVRA 5D6YA 3FLGA 3CCMA 2WSEE 2QA4T 2XK0A 1GXIE 4C0DC 3R6OA 4ZGEB 1X01A 2RHIA 2E70A 5GAN5 1LOJA 2XD0A 2R5MA 3OYAA 3OA6A 3SWNC 4ZN1A 1ZQ1A 2FYKA 3DB4A 1M1KU 5IAYA 4BI3A 5LL6S 4IUUA 4JUVA 3TEEA 3OS0A 3JB9I 2A7YA 4GY5A 2ZZDA 3OS5A 4PJOA 3QZ5B 4RKUE 3CXCA 4A4KA 3JCMP 5GMKm 1KG1A 5LJ3g 5DLOA 2FVUA 2XIDA 2XU8A 1H3ZA 3TCJA 4VUBA 4ZGJB 3BDLA 1N27A 3KBGA 3CCUA 4KUIA 2E10A 4R55A 2D0QB 4WF2A 1M90U 1KQSA 5GMKh 3CC2T 3A8OB 3SDZA 2OTLA 3MEWA 5LJ3e 1Q86U 4OB1B 4BE2A 1KC8C 4NL3A 1VQLT 3I56A 2JTFA 1SSFA 2P4TA 2QI2A 3QSUA 3OYJA 1OYXA 3JRZA 2PVDB 4A54A 4F7UG 3EAEA 5LJ5d 3CCRA 2EQUA 3FDRA 3ZFJA 1YCYA 3HP9A 3MEVA 4XK8E 3PIOA 1QVFA 5M9OA 3BDUA 3CCJT 3QXEB 3CC7A 2EFIA 2B8AA 3SB2A 3G4ST 4BI8B 4JJNK 1VIFA 2VXEA 4ELYC 4M7DC 4M7AA 3CMAT 3I55T 4M77D 2OTJT 4CRIA 3HRSA 1YJNA 3RERA 2E65A 2O4XA 5HY6A 2QQBA 4Y28E 4C92D 4OMFB 2JN0A 1JB0E 1QVGS 1HXDA 2R57A 3NFCA 4BE1A 3KUFA 2F69A 2K4YA 1XQHA 2CZ6B 2PU9B 3N5BB 3OYDA 1X75C 1KC8U 4C5EA 5GAMd 1VQ5T 2F5TX 4RG8A 3OW2A 1VQMA 2LX9A 3FB9A 1WQ7A 5GANg 3CPFA 4C0GA 1VIEA 1BIBA 1VUBA 2YHTA 4LDVA 4DQ2A 5CCAA 1N8RC 3MCAB 4NOYA 2ZPFB 1H641 4M77B 4M77C 1YHQA 5GAN3 4OB3B 3V8JA 3QYGB 1YITA 3M5AA 5GANe 5IT9E 1VQ7A 3JCMb 4PJOG 3M59A 4C92B 3CCVT 4ZN3A 3UWNA 4FL6A 3PMTA 4C8QB 4C8QC 4E47A 3ZBDA 3OYGA 2EJGA 3P8DA 4B9XA 4PLIA 5FU7B 3OYCA 4PL6A 2RA2A 2ZPIB 3M54A 1WJSA 1VQKA 5CO7A 4HT8A 1UEBA 4J6XA 3GIBA 3CCEA 4YTLA 4XTVA 4IUQA 4MMLA 1M1FA 5GAN2 1OZ2A 3MP6A 4J7FA 3CPWS 3CCQT 1LNXA 1TH7A 2VUBA 3UT1A 1Q81C 5CKFA 5LJ3h 1U8RA 1VQ8T 1VQOA 3CCLT 2HD0A 3CCSA 2X4JA 4IUVA 3MP8A 1N8RU 1YJWT 2M1HA 4O5VA 2V8JA 4XU1A 3OYBA 4KBMB 5CVIA 3ZEHA 2QA4A 4M75F 1W2BS 4IKFA 3MEUA 4ATOA 4C92F 2YRVA 4V2SA 2E64A 4M7AG 2X4WA 5KCHA 5KH6A 4HCZA 4C5IA 4QQ6A 4A4FA 1I4K1 3QUIA 5LJ5h 5GAOl 4JS4A 3JB9J 1M8VA 3G6EA 2DXBA 4HCCA 1WJRA 5J39A 3HL8A 3L2UA 2DK3A 2WSCE 2X35A 3DKMA 3OY9A 3FEOA 1G5VA 3MP1A 3OMGA 4LDXA 3ME9A 3L2WA 1Y96B 3VJPA 2HNIA 1HK9A 4L6V5 2L8DA 4BY6B 1Q81U 4MDWA 2JUFA 4L59A 2X4YA 2Y90A 2RHZA 3CC2A 1Q7YC 4OF1A 2M0OA 4M78F 3JB9H 3E9GA 4NS5A 4XTZA 3F70A 1M1GA 1M9SA 1NE8A 2EYQA 4BACA 5GAOq 2I2LA 4LDWA 4E7IA 3CD6T 2E1HA 5FU6B 2K57A 4D6WA 5DM7R 2VXFA 2DKGA 3M55A 2LNVA 2JVVA 3CC4T 2WSFE 3HKSA 2MWOA 3INZA 5GAMh 4FT2A 3CCJA 4IUPA 2CKKA 4C92E 1P92A 3M57A 3QJYA 4C0DB 3JCMV 3S6WA 3VV0A 3CMAA 4IURA 5FLXE 2OTJA 3SWNB 1WNLA 2LDMA 5C0MA 2O01E 2EKOA 2P0QA 4ME7A 3V8LA 5J26A 2DVEA 4X9CA 1V29B 2GQVA 4OB0B 3BY7A 3P8BB 4EMHA 1Q7YU 4ELZC 3J7AF 3V8KA 4B9WA 5FRMA 1BI0A 3X28B 1S72A 5CKEA 2HQEA 4Q5WA 2XKOC 4X9DA 4M78E 3TU4K 1VQ5A 2BIVA 2P0KA 4M7DD 1KHCA 5IN1A 4CI0C 4EMKA 3EFRA 3VKIA 3C95A 2RO0A 4EPCA 1G3TA 1WQWA 2AHJB 2DTHA 3QYHB 4MMKA 1MGQA 3LGFA 3QG1A 2EWNA 2QEXT 3ASKA 1BI3A 3OYFA 4BUGA 2EJFA 2E6NA 5CKBA 2DEQA 5GAN6 3JCMJ 3CCVA 4P5NA 3MO8A 3RIRA 1U1SA 1I81A 2K3YA 5LJ5g 2FB7A 1M4ZA 1XOVA 3A5ZB 1NPRA 1VQ4T 2ZGWA 4JLIA 2MWPA 5GMKj 2A3LA 2GCXA 2DJZA 2ZPHB 4M7DB 3L2VA 3L2RA 4M75A 3QIIA 5LJ5e 4XQ3A 1K8AC 4PLLA 2MI6A 2JZ2A 3CBOA 1B34B 1VQ8A 4QVDA 4LDYA 3QHSA 3VYGA 3CCLA 4C8QD 2FL7A 2Y4XA 2E6ZA 4J5YA 5AYFA 3RUXA 2ZPBB 4JRPA 4FM4B 2XDPA 3JCMf 2D9TA 1EIFA 1QVPA 2QQAA 1KQ1A 2VV5A 3OSSC 5A0GA 1D3BA 3JB9D 1YJWA 1AHJB 3P8HA 4XTWA 3MEAA 3LW5E 3RKXA 4RG2A 3OB9A 3TREA 1RI0A 3L42A 5CQXA 4PJOB 3PFSA 4PJOC 4J8OA 2QTXA 2XI9A 2KQWA 3E9FA 5GAOm 3CCMT 2LT4A 3OYKA 5GAMg 3DLLA 5A2QE 2EQMA 4RCBA 4HT9A 1UGPB 2JNGA 2LCCA 4FU6A 5DY9A 4A4EA 3HRTA 4M78A 3HRUA 3JCMW 3G7ZA 4M7AD 4FT4A 2CS7A 3GP8A 2RHYA 4XTXA 1W4SA 3CPWA 4LD9K 5CKDA 4M7DF 4II1A 4EMKC 5GAMe 3S3MA 3KXTA 5I2SA 1K8AU 4A53A 4IUTA 2D6FA 2DZCA 1BI2A 3URGA 1PSEA 3QDRB 4HKEA 2LCLA 4QQGA 3L2QA 3RMQA 3GF5A 4BI4A 2NLUA 3JAME 5I2MA 3JCMc 3MHXA 2E12A 3LGLA 2KAFA 3A8LB 1W2BA 2C06A 4XU3A 4BDZA 2EJ9A 2QQ9A 2OTLT 1I8FA 5HK0A 3QBYA 3X20B 1K73C 3AHUA 3M53A 4M7AB 3M4GA 2RB6A 4M7AC 2LT1A 3PT9A 4GLKA 2RHXA 5LJ3f 4M75C 3V7RA 2E5QA 2O4XB 3LLRA 2M16A 2FHDA 1OZ3A 2V8KA 4M77F 2DAQA 1OI1A 3VU3C 3OBWA 5CQYA 3C4SA 4MZPA 2DD5A 2DXTA 1JRIA 3OBYA 2CYZB 2ZPGB 3G71T 1G3YA 1YIJT 2K5IA 4C8QF 4A4GA 4KUDK 2VGNA 4M75G 5HK3A 4XTYA 5LJ3j 3RMSA 4C92G 2GFUA 2RM4A 5GAOp 3BFMA 3VUZA 5C6SA 4M7DE 3JB9F 1BI1A 1FX7A 4LDUA 4OP0A 2LTOA 2LVMA 4MDXA 2RHUA 5GAN7 4HCBA 3M56A 3X26B 4C5HA 3CMET 3META 3S3OA 1JJ2S 4PKCC 2DXCA 2EIFA 3LWHA 3NTHA 3HSBA 3VUBA 2F5KA 4FSXA 4E7KA 3HFOA 3HFNA 3M9QA 4OGCA 1K73U 5KE3A 4BE0A 4ZGDB 1VQ6T 1UGQB 3LX7A 3WVDB 4M78G 5CIUA 1VQLA 2QEXA 2PVGB 2GF7A 1KD1C 1Y7XA 1XTDA 4J7IA 5GAOn 4QVZA 3V7SA 1K9MC 2YLCA 4UC4A 1YHQT 4X34A 3UPUA 1YITT 4M77E 2DO3A 3JCMd 2L89A 5J3BA 2CZ0B 2CZ7B 4C0ZA 5GANf 3A8HB 3OYIA 1VQ4A 1IZ6A 3G4SA 1UGRB 4C8QE 1G3SA 4E7HA 1UGSB 2XHCA 4EMGA 2X4XA 2BUDA 1NJIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBP A; 
#chains in the Genus database with same CATH topology
 2ABL A;  2GBQ A;  4ZTF A;  4HA8 A;  5GAN j;  1IRE B;  1K9A A;  4L5G A;  1VQP Q;  1VQO T;  3FC3 A;  2MOX A;  3OYE A;  4ZTJ A;  1Q82 C;  3X25 B;  4OMM A;  3X24 B;  4E7L A;  1B34 A;  3EHR A;  3PMI A;  2QEX Q;  1X2K A;  2D1X A;  4F17 A;  2PQW A;  4RTX A;  3FIF A;  1QVG A;  4MZT A;  1YI2 T;  4M77 A;  3GNF B;  4C5G A;  4JDS A;  3OYM A;  1VQN T;  2J6K A;  4J6W A;  3CXC S;  1UHC A;  2CZ1 B;  2DIG A;  1WGS A;  2RJF A;  2EYZ A;  1KQS S;  2VB6 A;  4J9F A;  2GGR A;  2XG8 D;  2IVW A;  2JT4 A;  1ZSZ B;  4KGX B;  4QW2 A;  2MF2 A;  1UUE A;  4CC2 A;  2CH4 W;  1S72 T;  1T3L A;  1PG5 B;  1YCS B;  1A0N B;  1SHF A;  2AIR B;  2QQR A;  5GMK l;  4PK4 A;  2RJC A;  2DF6 A;  4F7U E;  2OTL Q;  1U1T A;  1YBY A;  5GAN 8;  5FRN A;  3E1S A;  3A98 A;  3H6Z A;  3CC4 A;  3I56 T;  3M58 A;  1UHF A;  3PGG A;  4E6R A;  1GCQ C;  3EG3 A;  3CXC P;  3VYH B;  3OW2 S;  4XAX B;  4J6Y A;  2HAX A;  3G71 Q;  2K2V A;  4M77 G;  1KQS P;  1YJ9 A;  3HHT B;  3JCM X;  3OYN A;  2MPX C;  1YJN Q;  4CC3 A;  3CME Q;  5LJ5 f;  3JB9 G;  3OSV A;  2GTO A;  2OAU A;  3DLM A;  1D1B A;  4QQD A;  3SWN A;  1KQ2 A;  2LQK A;  4M7A F;  1VQ6 Q;  3GPL A;  5GMK e;  4N0A C;  4C0F A;  2LJ0 A;  1MHN A;  1H8K A;  1QCF A;  1MMD A;  1VQ7 T;  2VGM A;  1BU1 A;  1TTH B;  4F7U A;  3ER0 A;  1TXQ A;  2EQJ A;  3JCM g;  1GCP A;  1T0J A;  3OW2 P;  2DIQ A;  5GAO r;  1XNI A;  2IPO B;  5I21 A;  2L3R A;  3UA7 A;  5GAM j;  1W1F A;  1H3H A;  1M90 C;  4FYY B;  2JTM A;  1Q86 C;  3RKY A;  2WSE E;  2QA4 T;  1WXU A;  3R6O A;  4ZGE B;  1X01 A;  2RHI A;  2E70 A;  5GAN 5;  2NYS A;  2KE9 A;  3OA6 A;  3DB4 A;  4BI3 A;  3G6E Q;  3I35 A;  3TEE A;  2AK5 A;  3REB B;  2ZZD A;  3QZ5 B;  2FVU A;  2XID A;  2DYB A;  3KBG A;  3VS5 A;  3CCU A;  4KUI A;  3A8O B;  4JZ3 A;  4J9E A;  3QSU A;  2EGE A;  3JRZ A;  4F7U G;  3CCR A;  1M27 C;  1E6H A;  1YCY A;  3PIO A;  3TSZ A;  1ZLM A;  5M9O A;  2HL5 C;  2L2P A;  3CC7 A;  2EFI A;  3I9Q A;  2B8A A;  3JV3 A;  3H0H A;  3SB2 A;  3G4S T;  1KJW A;  2NUZ A;  1ZX6 A;  1M90 R;  2QQB A;  1QCO A;  4OMF B;  1WDX A;  1JB0 E;  1QVG S;  1Q86 R;  2R57 A;  3NFC A;  4RUG A;  1XQH A;  3N5B B;  1TWB A;  1X75 C;  1WX6 A;  1TG0 A;  4RG8 A;  3FB9 A;  4KGV B;  4E2F B;  3CPF A;  5GAN g;  1VIE A;  1AWO A;  1VUB A;  4DQ2 A;  4J9H A;  1V1C A;  1N8R C;  5KYX B;  3MCA B;  3AT1 B;  2D0N A;  4LXC A;  3V8J A;  5IT9 E;  1T3S A;  2HQH A;  3IQL A;  1RAE B;  2L3Q A;  4C8Q C;  2EJG A;  1WZO A;  3QDF A;  5FU7 B;  3OYC A;  4F04 B;  3M54 A;  2ZPI B;  1WJS A;  1VQK A;  4HT8 A;  4J6X A;  3GIB A;  3CCE A;  1FMV A;  4YTL A;  1RAH B;  1M1F A;  1KIK A;  2RQR A;  4J7F A;  3CCQ T;  1LNX A;  1M2O A;  1TH7 A;  2VUB A;  1ZBJ A;  2H8H A;  1FMK A;  3CCS A;  1YJW T;  2M1H A;  4O5V A;  3OYB A;  2DJQ A;  1VQM Q;  1OEB A;  4ATO A;  4C92 F;  4V2S A;  2QK0 A;  5KH6 A;  4C5I A;  1I4K 1;  4JS4 A;  2DXB A;  4HCC A;  5J39 A;  2DK3 A;  1MV3 A;  3FEO A;  2YRD A;  1K1Z A;  1OPK A;  4L6V 5;  1Q81 U;  1AWW A;  2JUF A;  1N8R R;  2RHZ A;  1M1G A;  2FO0 A;  1NE8 A;  1SG5 A;  2EYQ A;  2DA9 A;  2I2L A;  4LDW A;  3CD6 T;  2E1H A;  2VXF A;  2QAS A;  3CCJ A;  4IUP A;  2ESW A;  1I0C A;  3VV0 A;  2O2O A;  3CMA A;  5FLX E;  1WNL A;  2LDM A;  4CC4 B;  1V29 B;  4DBF A;  2GQV A;  3BY7 A;  4EMH A;  4ELZ C;  5FRM A;  1M30 A;  5CKE A;  1KSW A;  4Q5W A;  1VQ5 A;  3CC2 Q;  1EX4 A;  1VA7 A;  5IN1 A;  4EMK A;  2GQI A;  3C95 A;  2RO0 A;  3D7S B;  1G3T A;  2EWN A;  3EG2 A;  2QEX T;  3OYF A;  2O88 A;  1BCM A;  2EJF A;  2EVR A;  3CCV A;  5I22 A;  1XOV A;  1NPR A;  1RAI B;  5FWC A;  2DL3 A;  4M75 A;  4Z88 A;  1K8A C;  3VS2 A;  3CBO A;  1VQ8 A;  1GCQ A;  1R77 A;  3QHS A;  1PNJ A;  2XDP A;  2D9T A;  1AD5 A;  1EIF A;  2VV5 A;  1KQ1 A;  5I11 A;  1K0X A;  1GBQ A;  1RI0 A;  5CQX A;  2F2W A;  1M3A A;  5GAM g;  3NMZ C;  2EQM A;  5D7U A;  1AVZ C;  4M7A D;  3GP8 A;  4XTX A;  1ZSZ C;  4II1 A;  3S3M A;  5I2S A;  2L3S A;  4IUT A;  5KYU A;  4GBQ A;  3URG A;  1PSE A;  2ZAE A;  4D8D A;  2LCL A;  3RMQ A;  2K9G A;  4BI4 A;  3HTR A;  3JCM c;  2KXD A;  1W2B A;  2C06 A;  2X3W D;  4GLM A;  2EJ9 A;  1GRI A;  3CCL Q;  2OTL T;  5HK0 A;  5KYW A;  1K73 C;  4M7A B;  3V7R A;  4AG2 C;  2RHX A;  2O4X B;  3G1J A;  4M77 F;  2ROL A;  1OI1 A;  1K8A R;  3G71 T;  2K5I A;  4A4G A;  4M75 G;  4CC7 A;  5HK3 A;  3VUZ A;  1YWO A;  2QTV A;  1FX7 A;  3JB9 F;  2EGA A;  2J06 A;  1PD0 A;  3MET A;  3CME T;  4J9D A;  2EIF A;  1Z9Z A;  3HFN A;  3EG1 A;  3MJX A;  1VQ6 T;  1SRM A;  3WVD B;  2QYZ A;  3BE3 A;  1VQL A;  2J6F A;  2PVG B;  2JW4 A;  1JXM A;  1XTD A;  4QVZ A;  3V7S A;  3CC4 Q;  4UC4 A;  3UPU A;  3JCM d;  2CZ0 B;  4C8Q E;  1TUC A;  2XHC A;  1J3T A;  3VS4 A;  4FL6 A;  3I55 A;  1RL2 A;  1KFZ A;  1RAG B;  1K73 R;  1ZUK A;  5A0L A;  1QWE A;  3C94 A;  2X51 A;  4XU2 A;  1E7O A;  2A28 A;  2W0Z A;  1F1B B;  1HYO A;  1D1C A;  4JZ4 A;  5A0D A;  5DLQ E;  1O75 A;  3EGD A;  2HSP A;  5CR2 A;  3EH2 A;  1WPY A;  2HQX A;  1WI7 A;  3G6E T;  2VYT A;  1UB4 A;  5GAN 4;  3VS1 A;  2BE9 B;  4PJO D;  4B6M A;  3DB3 A;  3TSW A;  3M4Y A;  2Y4Y A;  3FRN A;  1NM7 A;  2QGG A;  3VS0 A;  3S3N A;  2CGH A;  2DBK A;  4C92 A;  1OX9 A;  1C6V X;  4C8Q A;  2C0I A;  2DD4 A;  3OQ5 A;  4F7U F;  3H9N A;  3TQ7 P;  2JM8 A;  1SSH A;  2FZG B;  1Y71 A;  2RD1 A;  2P4R A;  1VOM A;  2PUK B;  2KR3 A;  2BE7 D;  3LYI A;  2LRQ A;  2DNU A;  4JRQ A;  2DTO A;  4AFQ C;  1QVF S;  2YUO A;  2CP3 A;  5GAN d;  2YRC A;  2VC8 A;  2VVK A;  2MIO A;  3U23 A;  3O5Z A;  3EFS A;  1FXX A;  2YWW A;  3A8M B;  2KXC A;  1O9S A;  1AEY A;  1MV0 B;  3UA6 A;  2ZCF B;  1IO6 A;  1R0B G;  2NUP A;  2J7I A;  1MNE A;  1JJ2 A;  1YIJ Q;  5FU7 C;  2COY A;  1TUD A;  1QW1 A;  3PIP A;  1D3B B;  2BKD N;  3LH0 A;  4C8Q G;  1C1A A;  1NYG A;  2DZ9 A;  3M0U A;  2MCN A;  1W6X A;  4M78 C;  2C0T A;  3NTK A;  1QVF P;  1KHI A;  1S1N A;  2XDD A;  2K6D A;  1QCN A;  4X1V A;  4XTU A;  3CEY A;  3PTA A;  1VQM T;  3QZ9 B;  1UJ0 A;  3CBM A;  2R5A A;  2EYW A;  2COZ A;  3T9N A;  5IHK A;  3LH5 A;  4BB7 A;  1MMA A;  4A4H A;  1Y07 A;  5KYN A;  1FMW A;  3O8V A;  2B86 A;  2RH2 A;  1YI2 A;  2LQ8 A;  3V7C A;  3NPF A;  2IG0 A;  1VQN A;  3Q1J A;  4JS5 A;  3JCM e;  2YUN A;  4NL2 A;  5CAI A;  3LWI A;  4PJL A;  2R58 A;  4BD3 A;  2V8I A;  1PD1 A;  1GXI E;  1AT1 B;  1LOJ A;  2AKK A;  3I5R A;  4ZN1 A;  1M1K U;  2AZS A;  2HZY A;  5IAY A;  4ESR A;  1M2V B;  4ORZ A;  4J9C A;  4GY5 A;  3OS5 A;  3ZL7 C;  2E4H A;  4RKU E;  2W10 A;  4A4K A;  1VQ9 Q;  1KG1 A;  3TCJ A;  2A0F B;  1N27 A;  3CC2 T;  4R55 A;  2FPF A;  3SDZ A;  1TU0 B;  1X27 A;  4ZNX A;  2DM1 A;  4BE2 A;  4FW1 A;  4NL3 A;  3I56 A;  1K0S A;  1SSF A;  2P4T A;  1OYX A;  2GTJ A;  3EAE A;  2EQU A;  3FDR A;  4XK8 E;  1OU8 A;  3R6N A;  1BB9 A;  7AT1 B;  4JJN K;  3CMA Q;  2VXE A;  4M77 D;  3RER A;  5HY6 A;  1OUL A;  2JN0 A;  1HXD A;  2KRO A;  1U06 A;  3KUF A;  2NUT B;  2PU9 B;  2A08 A;  5GAM d;  1UE9 A;  2F5T X;  1H92 A;  4LDV A;  1H64 1;  4M77 B;  1VQ7 A;  1YIT A;  3QYG B;  3M5A A;  5GAN e;  3M59 A;  4ZN3 A;  3RBB B;  1NG2 A;  3P8D A;  4B9X A;  4PJN A;  4IUQ A;  1I07 A;  1OZ2 A;  3CPW S;  1Q81 C;  3CCL T;  2HD0 A;  3MP8 A;  1NLP C;  4QKU A;  1SKU B;  5IXF A;  3ZEH A;  2QA4 A;  2BZY A;  4M75 F;  4IKF A;  2YRV A;  2E64 A;  2X4W A;  5KCH A;  1Z9Q A;  2QG9 B;  1NBE B;  1JU5 C;  1PM3 A;  5LJ5 h;  3JB9 J;  1M8V A;  2QDL A;  2EYY A;  4J9I A;  1WJR A;  3HL8 A;  3L2U A;  2WSC E;  2X35 A;  1M8M A;  3MP1 A;  4LDX A;  3ME9 A;  3VJP A;  2HNI A;  4AMC A;  4BY6 B;  1V76 A;  4MDW A;  4L59 A;  2X4Y A;  1UFF A;  1JEG A;  2CP7 A;  2DL5 A;  4OF1 A;  1Q95 G;  2M0O A;  3EGU A;  4NS5 A;  4D8K A;  1M9S A;  4E7I A;  2K57 A;  4Y92 A;  3CPW P;  4KRT A;  4FYV B;  3CC4 T;  2JVV A;  3M0R A;  2CKK A;  1WHM A;  3QJY A;  4C0D B;  3S6W A;  1Q81 R;  4IUR A;  3SWN B;  4DEY A;  2O01 E;  3V8L A;  2DVE A;  4X9C A;  4PJM A;  4OB0 B;  2EYX A;  1OPL A;  2RPN A;  2LX7 A;  4X9D A;  4M7D D;  4M78 E;  2BIV A;  2P0K A;  4JJB A;  1IHW A;  1E6G A;  1PCX A;  2LJ3 A;  3EFR A;  5L23 A;  2AHJ B;  4MMK A;  1VQL Q;  4RTU A;  1X6B A;  1BI3 A;  2E6N A;  3JCM J;  3MO8 A;  2AKL A;  2QGF B;  2K3Y A;  5KYX A;  2MWP A;  2PTK A;  3I55 Q;  2A3L A;  5FW9 A;  2GCX A;  2DJZ A;  2ZPH B;  4M7D B;  1WHJ A;  2OTJ Q;  4PLL A;  2GNC A;  2BTT A;  2DL4 A;  4J5Y A;  3RUX A;  5KYY B;  3JCM f;  4AG1 C;  1YJW A;  3EFO A;  5A0G A;  4XTW A;  3MEA A;  1IGU A;  3OB9 A;  1NJI R;  3L42 A;  4PJO C;  4J8O A;  2XI9 A;  5GAO m;  2LT4 A;  4RCB A;  2JNG A;  4FU6 A;  4FYW B;  4M78 A;  2CS7 A;  2CP2 A;  2HSE B;  3VRZ A;  1W4S A;  4LD9 K;  1RAD B;  5GAM e;  1BCO A;  3KXT A;  2DIL A;  2JJ9 A;  2HKN A;  4HKE A;  3L2Q A;  3GF5 A;  3A1P A;  5I2M A;  3MHX A;  2JXB A;  3LGL A;  9ATC B;  1GFD A;  2QQ9 A;  1I8F A;  2E3H A;  3AHU A;  3M53 A;  2RQU A;  2LT1 A;  4GLK A;  2MYS A;  1QVG P;  3VU3 C;  1OZ3 A;  3C4S A;  2DD5 A;  2RQV A;  1JRI A;  3OBY A;  2ZPG B;  1YIJ T;  4C8Q F;  3NGP A;  4XTY A;  5LJ3 j;  2CH4 A;  3BFM A;  1BI1 A;  4LDU A;  4MDX A;  5GAN 7;  4C5H A;  1JO8 A;  3H0F A;  4PKC C;  3EG9 A;  2KBT A;  4Z8A A;  3NTH A;  3HSB A;  3VUB A;  1SF9 A;  3VS7 A;  4M4Z A;  4BE0 A;  2DEU A;  1TOV A;  4M78 G;  5CIU A;  2QEX A;  2YLC A;  1RAB B;  2DO3 A;  5GAN f;  3A8H B;  1X43 A;  1G3S A;  4E7H A;  4F14 A;  2ECZ A;  4IIO A;  1UGV A;  4JRK A;  1R8O B;  4EDU A;  2K5F A;  1NPP A;  5KE2 A;  1PSF A;  5L8R E;  3RR6 A;  1VQP T;  3MKD A;  2RK1 A;  1BYM A;  1IHV A;  4DBR A;  4JRI A;  5KCO A;  2LNH B;  2CP6 A;  2XDB A;  3CBP A;  4N4I A;  1NJI U;  1VQ4 Q;  4O6J A;  1VQ9 T;  2AT1 B;  3L1A A;  1JBM A;  2LC4 A;  4DBQ A;  2FG0 A;  2CRE A;  3H8Z A;  2K79 A;  2M51 A;  1WYX A;  1JXO A;  2QQS A;  2K5L A;  2RI3 A;  4N4H A;  2KEA A;  3OYH A;  3G71 A;  3GNG A;  2YT6 A;  2PZ1 A;  2EKH A;  2L3P A;  4M75 D;  5IH2 A;  2D8J A;  4HCK A;  4EMK B;  3CME A;  5HKC A;  2MAM A;  4WCI A;  4N0A A;  1FYN A;  2DTI A;  2LZ6 B;  2HBW A;  1VQ6 A;  4E7J A;  2JMC A;  2V1Q A;  5AT1 B;  2EBP A;  3OMC A;  4Y91 A;  1Y96 A;  2KK4 A;  3I56 Q;  3GLX A;  3OS1 A;  5IHI A;  4LN2 A;  4KH1 B;  4M75 B;  4RTZ A;  3J80 E;  1XJW B;  1ZSG A;  3VS3 A;  2EAY A;  2P0P A;  3C12 A;  4IIM A;  4HVW A;  2G3R A;  4DA4 A;  2KY9 A;  4HXJ A;  1MMG A;  3J81 E;  1YJN T;  2ATC B;  1M3B A;  2V1R A;  3I5S A;  3FJ5 A;  4OGE A;  2M02 A;  3QPH A;  4RCC A;  3TU4 K;  3HPW A;  1K76 A;  5FWB A;  1ZHI A;  2JS2 A;  4KGZ B;  4KH0 B;  4LUE A;  3QJ6 A;  2QXF A;  2HKQ B;  5LJ5 j;  4R56 A;  1N9R A;  5KYU B;  4PJO E;  3M0P A;  1RLQ C;  3QWX X;  1YIT Q;  5GJW B;  1WJQ A;  2COW A;  1CKA A;  2E5K A;  1N6A A;  1M1K C;  1X69 A;  5KYW B;  1WLP B;  5GAM f;  4BY6 C;  3C0C A;  3UAT A;  5CK9 A;  4RTT A;  3L2Z A;  1YJ9 Q;  4QVC A;  3NTI A;  2JS0 A;  1G3W A;  3SFM A;  1FWZ A;  4DOV A;  2L5Q A;  1M5Q 1;  2DXU A;  3WXM B;  4K11 A;  2KT8 A;  3JCM Q;  3CCM A;  5IXB A;  4C0D C;  2F1L A;  2CDT A;  2OJ2 A;  2DL7 A;  2KRM A;  3SWN C;  1ZQ1 A;  1WXT A;  5LL6 S;  4IUU A;  3OS0 A;  4E7Z A;  2A7Y A;  4PJO A;  2J6O A;  1RLP C;  2RNA A;  3CXC A;  1U3O A;  2DRM A;  5LJ3 g;  1QLY A;  2CT3 A;  2IIM A;  3M0Q A;  1H3Z A;  1OX8 A;  2LQN A;  1RI9 A;  4ZGJ B;  3BDL A;  1ABO A;  1KQS A;  3REA B;  1ABQ A;  1VQL T;  2C0O A;  2JTF A;  2QI2 A;  3OYJ A;  1M1K R;  2PVD B;  3HP9 A;  3MEV A;  1UDL A;  1Q7Y R;  3M0S A;  1VIF A;  4M7D C;  3I55 T;  4OMQ A;  2OTJ T;  4CRI A;  3HRS A;  2E65 A;  2ENM A;  3EGD B;  4Y28 E;  4C92 D;  3KFV A;  2F69 A;  2K4Y A;  4LUD A;  2RN8 A;  3OYD A;  1KC8 U;  2M0Y A;  3EGX A;  4C5E A;  3CCU Q;  3OW2 A;  1VQM A;  2LX9 A;  1WQ7 A;  1NYF A;  2YHT A;  4NOY A;  1YHQ A;  5GAN 3;  1R0C B;  4OB3 B;  3CCR Q;  4PJO G;  4C92 B;  2K2M A;  4C8Q B;  3PMT A;  4E47 A;  3OYG A;  4FCY A;  3CC7 Q;  1PKS A;  1LVK A;  1UEB A;  3SHW A;  4MML A;  3MP6 A;  3UT1 A;  5CKF A;  5LJ3 h;  2DBM A;  1VQO A;  1SEM A;  2KGT A;  4IUV A;  3VRY A;  2FZK B;  5CVI A;  1W2B S;  5EC7 A;  3MEU A;  4LNP A;  4PJJ A;  1KK7 A;  4HCZ A;  1LPL A;  4QQ6 A;  2YXY A;  1MUZ A;  5GAO l;  2V26 A;  3SEM A;  2DX1 A;  3DKM A;  2DYI A;  1G5V A;  3OMG A;  3L2W A;  1HK9 A;  2L8D A;  1VQK Q;  2Y90 A;  3CC2 A;  3CCE Q;  4M78 F;  3JB9 H;  2NUP B;  2FPD A;  2VKN A;  1G2B A;  5GAO q;  5FU6 B;  3CCS Q;  1TUG B;  4D6W A;  5DM7 R;  2AZV A;  1PKT A;  1AWJ A;  2LNV A;  2WSF E;  3HKS A;  2MWO A;  3INZ A;  2EPD A;  1Y57 A;  1ARK A;  1SHG A;  1P92 A;  2CUD A;  3JCM V;  3H0I A;  2DMO A;  5C0M A;  1W2B P;  1IGQ A;  2P0Q A;  2RQW A;  4ME7 A;  5J26 A;  2F2V A;  1PHT A;  3P8B B;  1Q7Y U;  2O9S A;  3V8K A;  2RQT A;  1HSQ A;  3X28 B;  1S72 A;  2HQE A;  2XKO C;  4EIK A;  1KHC A;  4CI0 C;  1ZSZ A;  3VKI A;  4EPC A;  1WQW A;  2ROT A;  3QG1 A;  2ED1 A;  3ASK A;  2I0N A;  4BUG A;  2NUT A;  2DEQ A;  3RNJ A;  3RIR A;  3CCJ Q;  5LJ5 g;  1M4Z A;  1B07 A;  3A5Z B;  1VQ4 T;  2X9H A;  4AFS C;  5GMK j;  3UF4 A;  1K9M R;  1KD1 R;  1T0H A;  4PFO A;  2MI6 A;  1B34 B;  4QVD A;  3VYG A;  3CCL A;  1QMC A;  1UTI A;  2VWF A;  5AYF A;  4A63 B;  3OSS C;  3JB9 D;  1AHJ B;  3P8H A;  3RKX A;  1VQ5 Q;  3LW5 E;  2P84 A;  2X3X D;  3TRE A;  3PFS A;  2QTX A;  3E9F A;  2KQW A;  2SRC A;  4AFU C;  3OYK A;  3DLL A;  2CP0 A;  1GBR A;  5A2Q E;  4HT9 A;  8AT1 B;  2LCC A;  4A4E A;  3HRT A;  1RAA B;  3G7Z A;  4FT4 A;  1NEG A;  3CCV Q;  1ACM B;  1Q82 R;  4EMK C;  3H41 A;  5IHN A;  2D6F A;  2DZC A;  1BI2 A;  4QQG A;  1OOT A;  2NLU A;  3EG0 A;  3A8L B;  1VQ8 Q;  4XU3 A;  3X20 B;  3PVL A;  4M7A C;  1B7T A;  3PT9 A;  4M75 C;  2E5Q A;  3LLR A;  2DAQ A;  3OBW A;  5CQY A;  4MZP A;  2DXT A;  2CYZ B;  2VGN A;  4OMN A;  2GFU A;  5C6S A;  4M7D E;  2E3I A;  2LVM A;  2RHU A;  3X26 B;  2XMF A;  1JJ2 S;  3S3O A;  3LWH A;  1D09 B;  2F5K A;  4FSX A;  5HCK A;  4E7K A;  5KE3 A;  4ZGD B;  2DER A;  1YFN A;  4X34 A;  1YIT T;  2KYM A;  2DRK A;  3OYI A;  2J05 A;  3G4S A;  1UGR B;  4ANJ A;  4EMG A;  2LQW A;  1NJI C;  2RJD A;  1D0Y A;  1QP2 A;  3PE0 A;  4FSS A;  1YJ9 T;  3M0T A;  3TVT A;  2Z0W A;  1YNZ A;  2MMP A;  4KUL A;  4RMO A;  2D8H A;  5D6X A;  1I5O B;  2OAW A;  1NZ9 A;  4M7D A;  2RK2 A;  1BKB A;  1KD1 U;  1K9M U;  1JJ2 P;  2A37 A;  4F7U B;  2XIC A;  3NHN A;  4JJD A;  8ATC B;  4J9G A;  2O31 A;  1CSK A;  5KYY A;  2KVQ G;  3UDC A;  2YLB A;  2JMA A;  2DVJ A;  2HBP A;  1IRX A;  5LJ3 d;  1LJO A;  1OQK A;  2GFA A;  1G8X A;  2EQK A;  2DFU A;  4KUD K;  1BK2 A;  3QKJ A;  1QP3 A;  1LCK A;  3CCQ A;  2K3X A;  3JSC A;  2QDY B;  1Q82 U;  2E41 A;  2ZPE B;  2CP5 A;  1PRL C;  1IXD A;  1N9S A;  1Y0M A;  3BW1 A;  2JOY A;  3CCM Q;  1YIJ A;  3GOX A;  4DOW A;  4FIB A;  1VYT A;  3WVE B;  2RI5 A;  1DJ7 B;  3OYY A;  2M9U A;  4MZM A;  3JCM h;  3QO3 A;  2H3J A;  1NLO C;  3THK A;  5EG2 A;  4F16 A;  2RI2 A;  4JLG A;  1EFN A;  3RKW A;  4M7D G;  2PUO B;  1ZUU A;  1TSF A;  3VS6 A;  1UJY A;  2KMT A;  4PFP A;  4OVA A;  2KRN A;  3CCU T;  1PC0 A;  5D6W A;  3CD6 A;  2RJE A;  3PNW C;  3A8G B;  4OB2 B;  4PJO F;  4M78 D;  1ZBX A;  4AFZ C;  3CCR T;  4C92 C;  2KDS A;  1BIA A;  4WTO B;  1CKB A;  2DPP B;  4XU0 A;  3CC7 T;  2PVO B;  3MPU B;  3EFO B;  4BDY A;  2A36 A;  2YSQ A;  2MK5 A;  4RTV A;  2H3E B;  2JM9 A;  1VQP A;  5CKH A;  3E19 A;  4M78 B;  3OS2 A;  4QT7 A;  3OYL A;  2OX7 A;  2KSS A;  2FEI A;  1W70 A;  1YHQ Q;  4Z02 A;  2WAC A;  5FRO A;  1D0X A;  1I5L A;  4FW2 A;  5GMK i;  3RES A;  4J83 A;  1VQ9 A;  1X6O A;  1D1A A;  3FJP A;  4KT0 E;  1VQK T;  3CCE T;  4LD6 A;  1D0Z A;  1VQO Q;  4N4G A;  5FU6 C;  1U5S A;  3CCS T;  5GAN h;  4OMP A;  3SD4 A;  4PNO A;  4M7A E;  1WFW A;  4M75 E;  4TVR A;  5D6Y A;  3FLG A;  2XK0 A;  2XD0 A;  3EG9 B;  2R5M A;  3OYA A;  2FYK A;  1M3C A;  4PFZ A;  3RDV A;  4JUV A;  3E2U A;  3JB9 I;  1QKX A;  3JCM P;  5GMK m;  1YI2 Q;  5DLO A;  4OML A;  2XU8 A;  4VUB A;  2NWM A;  2E10 A;  1VQN Q;  2D0Q B;  4FYX B;  4WF2 A;  1M90 U;  5GMK h;  4Z89 A;  2OTL A;  3MEW A;  5LJ3 e;  1Q86 U;  4OB1 B;  1KC8 C;  2HCK A;  1GL5 A;  4A54 A;  5LJ5 d;  4RTW A;  3ZFJ A;  3ULR B;  1QVF A;  3BDU A;  3CCJ T;  4E7S A;  3QXE B;  1WA7 A;  4BI8 B;  4ELY C;  4M7A A;  3CMA T;  2EW3 A;  1YJN A;  2O4X A;  4OMO A;  2EQI A;  1IB8 A;  4BE1 A;  1S72 Q;  1QWF A;  2CZ6 B;  1AWX A;  1YN8 A;  1EZZ B;  1VQ5 T;  2HEQ A;  2DLP A;  4C0G A;  2OI3 A;  1BIB A;  5CCA A;  2ZPF B;  1ZUY A;  4M77 C;  1PWT A;  3JCM b;  3CCV T;  3UWN A;  4JJC A;  1YP5 A;  3ZBD A;  3CQT A;  4PLI A;  4PL6 A;  2RA2 A;  5CO7 A;  1KC8 R;  4XTV A;  5GJV B;  5GAN 2;  1PRM C;  1X2Q A;  2CSQ A;  1U8R A;  1VQ8 T;  2X4J A;  1SRL A;  1N8R U;  1ZA1 B;  2V8J A;  4XU1 A;  1X6G A;  4KBM B;  2KRS A;  1HJD A;  5ECA A;  2QAZ A;  4M7A G;  4RTY A;  4DEX A;  2DE0 X;  2CSI A;  4A4F A;  3QUI A;  1OU9 A;  1VQ7 Q;  3G6E A;  2KI7 A;  2PNI A;  2ED0 A;  1QKW A;  2EGC A;  1B3Q A;  3OY9 A;  1Y96 B;  2CUB A;  4HVV A;  2FRY A;  2FZC B;  1Q7Y C;  3E9G A;  4XTZ A;  3F70 A;  1WHK A;  4BAC A;  1RAF B;  2DKG A;  3M55 A;  5GAM h;  1G83 A;  1JQQ A;  4FT2 A;  1GFC A;  1TS9 A;  2DL8 A;  2QA4 Q;  4C92 E;  3M57 A;  2LCS A;  2VAS A;  2FRW A;  2YUP A;  2OTJ A;  1MND A;  3EHQ A;  2EKO A;  1NEB A;  3J7A F;  2K7A A;  4B9W A;  4DBH A;  1BI0 A;  1UG1 A;  1VYU A;  2RF0 A;  1WHH A;  2L0A A;  2F2X A;  3QYH B;  2DTH A;  1RAC B;  1MGQ A;  3LGF A;  5CKB A;  1QQJ A;  1RUW A;  5GAN 6;  4P5N A;  4JPB W;  1U1S A;  1I81 A;  2FB7 A;  3G4S Q;  3GBQ A;  2ZGW A;  2BZ8 A;  2HL3 A;  4JLI A;  3PVQ A;  1C0M A;  3L2V A;  3L2R A;  3QII A;  5LJ5 e;  4XQ3 A;  2O9V A;  2JZ2 A;  4LDY A;  4C8Q D;  2FL7 A;  2Y4X A;  2E6Z A;  4JRP A;  2ZPB B;  4FM4 B;  1MMN A;  4R0K A;  1QVP A;  2QQA A;  4LE9 A;  6AT1 B;  1D3B A;  1AZE A;  4RG2 A;  1BBZ A;  4PJO B;  3CCM T;  1UGP B;  1WHG A;  5DY9 A;  3JCM W;  3HRU A;  2FPE A;  2RHY A;  2KNB B;  2HMA A;  3CPW A;  4AT1 B;  5CKD A;  4M7D F;  2YUQ A;  1K8A U;  4A53 A;  2RMO A;  3QDR B;  2KYB A;  1VYV A;  1ZA2 B;  3JAM E;  1WIE A;  3CCQ Q;  2DET A;  2E12 A;  2KAF A;  4BDZ A;  3QBY A;  4J9B A;  3M4G A;  2RB6 A;  5LJ3 f;  2YDL A;  1YJW Q;  2JTE A;  2M16 A;  2FHD A;  2V8K A;  1N5Z A;  1SPK A;  1YWP A;  2K3B A;  1G3Y A;  1AZG B;  2SEM A;  1WXB A;  3RMS A;  4C92 G;  3EGX B;  2G6F X;  2RM4 A;  2KT1 A;  5GAO p;  1OV3 A;  4OP0 A;  2LTO A;  1HD3 A;  2LJ1 A;  4HCB A;  3M56 A;  2BZX A;  2DXC A;  3EH1 A;  3QWY A;  3HFO A;  3M9Q A;  4OGC A;  1K73 U;  1I1J A;  2CT4 A;  1M2V A;  1WHL A;  1UGQ B;  3LX7 A;  3CD6 Q;  2LP5 A;  1K9M C;  2GF7 A;  2HDA A;  1Y7X A;  4J7I A;  5GAO n;  1KD1 C;  1AOJ A;  1YHQ T;  1K4U S;  4M77 E;  2L89 A;  5J3B A;  2CZ7 B;  4C0Z A;  2LMJ A;  1VQ4 A;  4HVU A;  1IZ6 A;  1UGS B;  1UEC A;  2X4X A;  2BUD A; 
#chains in the Genus database with same CATH homology
 1RL2 A;  2RJD A;  4JRK A;  1QP2 A;  1R8O B;  4EDU A;  1YJ9 T;  4ZTF A;  2K5F A;  5A0L A;  1NPP A;  4HA8 A;  3C94 A;  4XU2 A;  5GAN j;  5KE2 A;  1IRE B;  4L5G A;  1PSF A;  2MMP A;  4KUL A;  5L8R E;  1VQO T;  4RMO A;  1VQP T;  5D6X A;  3FC3 A;  3OYE A;  4ZTJ A;  1NZ9 A;  1Q82 C;  4M7D A;  2RK2 A;  3X25 B;  1BKB A;  1KD1 U;  1K9M U;  5A0D A;  3X24 B;  4F7U B;  2RK1 A;  5DLQ E;  1O75 A;  2XIC A;  1B34 A;  4E7L A;  1BYM A;  5CR2 A;  4JRI A;  3PMI A;  5KCO A;  1WPY A;  2KVQ G;  2PQW A;  2XDB A;  2HQX A;  3UDC A;  2YLB A;  3G6E T;  2VYT A;  2HBP A;  3CBP A;  4N4I A;  1NJI U;  1UB4 A;  5LJ3 d;  5GAN 4;  1LJO A;  3FIF A;  1QVG A;  4PJO D;  3DB3 A;  3M4Y A;  2Y4Y A;  4O6J A;  2GFA A;  3FRN A;  2EQK A;  3L1A A;  4MZT A;  1VQ9 T;  1YI2 T;  1JBM A;  4M77 A;  3GNF B;  3S3N A;  2CGH A;  2LC4 A;  3QKJ A;  1QP3 A;  4C5G A;  4JDS A;  3OYM A;  3CCQ A;  2K3X A;  3JSC A;  2QDY B;  4C92 A;  1Q82 U;  1VQN T;  2E41 A;  4C8Q A;  2DD4 A;  2ZPE B;  3OQ5 A;  4J6W A;  4F7U F;  3H8Z A;  3CXC S;  1N9S A;  2DIG A;  2CZ1 B;  2K5L A;  1WGS A;  2QQS A;  1Y71 A;  2RD1 A;  2RI3 A;  4N4H A;  2RJF A;  3BW1 A;  3OYH A;  1KQS S;  2JOY A;  1YIJ A;  3G71 A;  3GNG A;  3GOX A;  4DOW A;  2PUK B;  3LYI A;  4FIB A;  3WVE B;  2RI5 A;  2LRQ A;  1DJ7 B;  2XG8 D;  2IVW A;  2M9U A;  3OYY A;  4M75 D;  4MZM A;  3QO3 A;  3JCM h;  4JRQ A;  2DTO A;  4EMK B;  4QW2 A;  1QVF S;  2H3J A;  2MF2 A;  3CME A;  5HKC A;  2MAM A;  5EG2 A;  2RI2 A;  4JLG A;  2DTI A;  4N0A A;  3RKW A;  4M7D G;  2PUO B;  5GAN d;  1S72 T;  2VC8 A;  2KMT A;  2QQR A;  5GMK l;  1VQ6 A;  4E7J A;  4OVA A;  3CCU T;  3EFS A;  5D6W A;  2RJC A;  1FXX A;  3CD6 A;  4F7U E;  3A8M B;  1U1T A;  1YBY A;  2RJE A;  3A8G B;  1O9S A;  3PNW C;  3OMC A;  4Y91 A;  5GAN 8;  3E1S A;  4OB2 B;  1Y96 A;  2KK4 A;  3H6Z A;  4PJO F;  5FRN A;  3GLX A;  3OS1 A;  3CC4 A;  3I56 T;  4M78 D;  1ZBX A;  3M58 A;  3PGG A;  4M75 B;  3J80 E;  2ZCF B;  3CCR T;  4C92 C;  2KDS A;  3OW2 S;  3VYH B;  2EAY A;  1BIA A;  2P0P A;  4XAX B;  1JJ2 A;  4J6Y A;  2DPP B;  3C12 A;  2HAX A;  2K2V A;  5FU7 C;  4M77 G;  4XU0 A;  3CC7 T;  2G3R A;  4DA4 A;  2PVO B;  1QW1 A;  4BDY A;  3PIP A;  1D3B B;  2KY9 A;  2BKD N;  3HHT B;  1YJ9 A;  3LH0 A;  3JCM X;  4C8Q G;  3OYN A;  3J81 E;  1YJN T;  5LJ5 f;  2DZ9 A;  4OGE A;  1VQP A;  5CKH A;  3JB9 G;  3E19 A;  3QPH A;  3OSV A;  4M78 B;  3DLM A;  2OAU A;  3HPW A;  3NTK A;  4M78 C;  1ZHI A;  4RCC A;  3OS2 A;  3OYL A;  4QQD A;  3SWN A;  1KHI A;  2KSS A;  1KQ2 A;  2LQK A;  2XDD A;  3QJ6 A;  2QXF A;  4M7A F;  4XTU A;  3GPL A;  3CEY A;  3PTA A;  5GMK e;  1VQM T;  5LJ5 j;  4N0A C;  3QZ9 B;  4C0F A;  4R56 A;  1N9R A;  3I55 A;  4PJO E;  3CBM A;  1MHN A;  2R5A A;  4Z02 A;  3T9N A;  1VQ7 T;  2WAC A;  1WJQ A;  5FRO A;  2VGM A;  4F7U A;  3ER0 A;  4BB7 A;  4A4H A;  2EQJ A;  1I5L A;  1N6A A;  5GMK i;  1Y07 A;  4J83 A;  3RES A;  3JCM g;  5GAM f;  1M1K C;  4BY6 C;  1VQ9 A;  3O8V A;  2RH2 A;  1YI2 A;  1X6O A;  2LQ8 A;  3V7C A;  5CK9 A;  3L2Z A;  3FJP A;  4KT0 E;  2DIQ A;  1VQK T;  2IG0 A;  3CCE T;  1VQN A;  5GAO r;  3Q1J A;  4QVC A;  3NTI A;  3JCM e;  4JS5 A;  4LD6 A;  1G3W A;  1XNI A;  5I21 A;  4N4G A;  1FWZ A;  2L3R A;  4NL2 A;  5FU6 C;  3SFM A;  4DOV A;  5CAI A;  5GAM j;  2L5Q A;  1M5Q 1;  2DXU A;  3WXM B;  3LWI A;  3CCS T;  5GAN h;  1M90 C;  2JTM A;  3SD4 A;  3JCM Q;  2R58 A;  4PNO A;  4M7A E;  4BD3 A;  1Q86 C;  2V8I A;  4M75 E;  3RKY A;  4TVR A;  5D6Y A;  3FLG A;  3CCM A;  2WSE E;  2QA4 T;  2XK0 A;  1GXI E;  4C0D C;  3R6O A;  4ZGE B;  1X01 A;  2RHI A;  2E70 A;  5GAN 5;  1LOJ A;  2XD0 A;  2R5M A;  3OYA A;  3OA6 A;  3SWN C;  4ZN1 A;  1ZQ1 A;  2FYK A;  3DB4 A;  1M1K U;  5IAY A;  4BI3 A;  5LL6 S;  4IUU A;  4JUV A;  3TEE A;  3OS0 A;  3JB9 I;  2A7Y A;  4GY5 A;  2ZZD A;  3OS5 A;  4PJO A;  3QZ5 B;  4RKU E;  3CXC A;  4A4K A;  3JCM P;  5GMK m;  1KG1 A;  5LJ3 g;  5DLO A;  2FVU A;  2XID A;  2XU8 A;  1H3Z A;  3TCJ A;  4VUB A;  4ZGJ B;  3BDL A;  1N27 A;  3KBG A;  3CCU A;  4KUI A;  2E10 A;  4R55 A;  2D0Q B;  4WF2 A;  1M90 U;  1KQS A;  5GMK h;  3CC2 T;  3A8O B;  3SDZ A;  2OTL A;  3MEW A;  5LJ3 e;  1Q86 U;  4OB1 B;  4BE2 A;  1KC8 C;  4NL3 A;  1VQL T;  3I56 A;  2JTF A;  1SSF A;  2P4T A;  2QI2 A;  3QSU A;  3OYJ A;  1OYX A;  3JRZ A;  2PVD B;  4A54 A;  4F7U G;  3EAE A;  5LJ5 d;  3CCR A;  2EQU A;  3FDR A;  3ZFJ A;  1YCY A;  3HP9 A;  3MEV A;  4XK8 E;  3PIO A;  1QVF A;  5M9O A;  3BDU A;  3CCJ T;  3QXE B;  3CC7 A;  2EFI A;  2B8A A;  3SB2 A;  3G4S T;  4BI8 B;  4JJN K;  1VIF A;  2VXE A;  4ELY C;  4M7D C;  4M7A A;  3CMA T;  3I55 T;  4M77 D;  2OTJ T;  4CRI A;  3HRS A;  1YJN A;  3RER A;  2E65 A;  2O4X A;  5HY6 A;  2QQB A;  4Y28 E;  4C92 D;  4OMF B;  2JN0 A;  1JB0 E;  1QVG S;  1HXD A;  2R57 A;  3NFC A;  4BE1 A;  3KUF A;  2F69 A;  2K4Y A;  1XQH A;  2CZ6 B;  2PU9 B;  3N5B B;  3OYD A;  1X75 C;  1KC8 U;  4C5E A;  5GAM d;  1VQ5 T;  2F5T X;  4RG8 A;  3OW2 A;  1VQM A;  2LX9 A;  3FB9 A;  1WQ7 A;  5GAN g;  3CPF A;  4C0G A;  1VIE A;  1BIB A;  1VUB A;  2YHT A;  4LDV A;  4DQ2 A;  5CCA A;  1N8R C;  3MCA B;  4NOY A;  2ZPF B;  1H64 1;  4M77 B;  4M77 C;  1YHQ A;  5GAN 3;  4OB3 B;  3V8J A;  3QYG B;  1YIT A;  3M5A A;  5GAN e;  5IT9 E;  1VQ7 A;  3JCM b;  4PJO G;  3M59 A;  4C92 B;  3CCV T;  4ZN3 A;  3UWN A;  4FL6 A;  3PMT A;  4C8Q B;  4C8Q C;  4E47 A;  3ZBD A;  3OYG A;  2EJG A;  3P8D A;  4B9X A;  4PLI A;  5FU7 B;  3OYC A;  4PL6 A;  2RA2 A;  2ZPI B;  3M54 A;  1WJS A;  1VQK A;  5CO7 A;  4HT8 A;  1UEB A;  4J6X A;  3GIB A;  3CCE A;  4YTL A;  4XTV A;  4IUQ A;  4MML A;  1M1F A;  5GAN 2;  1OZ2 A;  3MP6 A;  4J7F A;  3CPW S;  3CCQ T;  1LNX A;  1TH7 A;  2VUB A;  3UT1 A;  1Q81 C;  5CKF A;  5LJ3 h;  1U8R A;  1VQ8 T;  1VQO A;  3CCL T;  2HD0 A;  3CCS A;  2X4J A;  4IUV A;  3MP8 A;  1N8R U;  1YJW T;  2M1H A;  4O5V A;  2V8J A;  4XU1 A;  3OYB A;  4KBM B;  5CVI A;  3ZEH A;  2QA4 A;  4M75 F;  1W2B S;  4IKF A;  3MEU A;  4ATO A;  4C92 F;  2YRV A;  4V2S A;  2E64 A;  4M7A G;  2X4W A;  5KCH A;  5KH6 A;  4HCZ A;  4C5I A;  4QQ6 A;  4A4F A;  1I4K 1;  3QUI A;  5LJ5 h;  5GAO l;  4JS4 A;  3JB9 J;  1M8V A;  3G6E A;  2DXB A;  4HCC A;  1WJR A;  5J39 A;  3HL8 A;  3L2U A;  2DK3 A;  2WSC E;  2X35 A;  3DKM A;  3OY9 A;  3FEO A;  1G5V A;  3MP1 A;  3OMG A;  4LDX A;  3ME9 A;  3L2W A;  1Y96 B;  3VJP A;  2HNI A;  1HK9 A;  4L6V 5;  2L8D A;  4BY6 B;  1Q81 U;  4MDW A;  2JUF A;  4L59 A;  2X4Y A;  2Y90 A;  2RHZ A;  3CC2 A;  1Q7Y C;  4OF1 A;  2M0O A;  4M78 F;  3JB9 H;  3E9G A;  4NS5 A;  4XTZ A;  3F70 A;  1M1G A;  1M9S A;  1NE8 A;  2EYQ A;  4BAC A;  5GAO q;  2I2L A;  4LDW A;  4E7I A;  3CD6 T;  2E1H A;  5FU6 B;  2K57 A;  4D6W A;  5DM7 R;  2VXF A;  2DKG A;  3M55 A;  2LNV A;  2JVV A;  3CC4 T;  2WSF E;  3HKS A;  2MWO A;  3INZ A;  5GAM h;  4FT2 A;  3CCJ A;  4IUP A;  2CKK A;  4C92 E;  1P92 A;  3M57 A;  3QJY A;  4C0D B;  3JCM V;  3S6W A;  3VV0 A;  3CMA A;  4IUR A;  5FLX E;  2OTJ A;  3SWN B;  1WNL A;  2LDM A;  5C0M A;  2O01 E;  2EKO A;  2P0Q A;  4ME7 A;  3V8L A;  5J26 A;  2DVE A;  4X9C A;  1V29 B;  2GQV A;  4OB0 B;  3BY7 A;  3P8B B;  4EMH A;  1Q7Y U;  4ELZ C;  3J7A F;  3V8K A;  4B9W A;  5FRM A;  1BI0 A;  3X28 B;  1S72 A;  5CKE A;  2HQE A;  4Q5W A;  2XKO C;  4X9D A;  4M78 E;  3TU4 K;  1VQ5 A;  2BIV A;  2P0K A;  4M7D D;  1KHC A;  5IN1 A;  4CI0 C;  4EMK A;  3EFR A;  3VKI A;  3C95 A;  2RO0 A;  4EPC A;  1G3T A;  1WQW A;  2AHJ B;  2DTH A;  3QYH B;  4MMK A;  1MGQ A;  3LGF A;  3QG1 A;  2EWN A;  2QEX T;  3ASK A;  1BI3 A;  3OYF A;  4BUG A;  2EJF A;  2E6N A;  5CKB A;  2DEQ A;  5GAN 6;  3JCM J;  3CCV A;  4P5N A;  3MO8 A;  3RIR A;  1U1S A;  1I81 A;  2K3Y A;  5LJ5 g;  2FB7 A;  1M4Z A;  1XOV A;  3A5Z B;  1NPR A;  1VQ4 T;  2ZGW A;  4JLI A;  2MWP A;  5GMK j;  2A3L A;  2GCX A;  2DJZ A;  2ZPH B;  4M7D B;  3L2V A;  3L2R A;  4M75 A;  3QII A;  5LJ5 e;  4XQ3 A;  1K8A C;  4PLL A;  2MI6 A;  2JZ2 A;  3CBO A;  1B34 B;  1VQ8 A;  4QVD A;  4LDY A;  3QHS A;  3VYG A;  3CCL A;  4C8Q D;  2FL7 A;  2Y4X A;  2E6Z A;  4J5Y A;  5AYF A;  3RUX A;  2ZPB B;  4JRP A;  4FM4 B;  2XDP A;  3JCM f;  2D9T A;  1EIF A;  1QVP A;  2QQA A;  1KQ1 A;  2VV5 A;  3OSS C;  5A0G A;  1D3B A;  3JB9 D;  1YJW A;  1AHJ B;  3P8H A;  4XTW A;  3MEA A;  3LW5 E;  3RKX A;  4RG2 A;  3OB9 A;  3TRE A;  1RI0 A;  3L42 A;  5CQX A;  4PJO B;  3PFS A;  4PJO C;  4J8O A;  2QTX A;  2XI9 A;  2KQW A;  3E9F A;  5GAO m;  3CCM T;  2LT4 A;  3OYK A;  5GAM g;  3DLL A;  5A2Q E;  2EQM A;  4RCB A;  4HT9 A;  1UGP B;  2JNG A;  2LCC A;  4FU6 A;  5DY9 A;  4A4E A;  3HRT A;  4M78 A;  3HRU A;  3JCM W;  3G7Z A;  4M7A D;  4FT4 A;  2CS7 A;  3GP8 A;  2RHY A;  4XTX A;  1W4S A;  3CPW A;  4LD9 K;  5CKD A;  4M7D F;  4II1 A;  4EMK C;  5GAM e;  3S3M A;  3KXT A;  5I2S A;  1K8A U;  4A53 A;  4IUT A;  2D6F A;  2DZC A;  1BI2 A;  3URG A;  1PSE A;  3QDR B;  4HKE A;  2LCL A;  4QQG A;  3L2Q A;  3RMQ A;  3GF5 A;  4BI4 A;  2NLU A;  3JAM E;  5I2M A;  3JCM c;  3MHX A;  2E12 A;  3LGL A;  2KAF A;  3A8L B;  1W2B A;  2C06 A;  4XU3 A;  4BDZ A;  2EJ9 A;  2QQ9 A;  2OTL T;  1I8F A;  5HK0 A;  3QBY A;  3X20 B;  1K73 C;  3AHU A;  3M53 A;  4M7A B;  3M4G A;  2RB6 A;  4M7A C;  2LT1 A;  3PT9 A;  4GLK A;  2RHX A;  5LJ3 f;  4M75 C;  3V7R A;  2E5Q A;  2O4X B;  3LLR A;  2M16 A;  2FHD A;  1OZ3 A;  2V8K A;  4M77 F;  2DAQ A;  1OI1 A;  3VU3 C;  3OBW A;  5CQY A;  3C4S A;  4MZP A;  2DD5 A;  2DXT A;  1JRI A;  3OBY A;  2CYZ B;  2ZPG B;  3G71 T;  1G3Y A;  1YIJ T;  2K5I A;  4C8Q F;  4A4G A;  4KUD K;  2VGN A;  4M75 G;  5HK3 A;  4XTY A;  5LJ3 j;  3RMS A;  4C92 G;  2GFU A;  2RM4 A;  5GAO p;  3BFM A;  3VUZ A;  5C6S A;  4M7D E;  3JB9 F;  1BI1 A;  1FX7 A;  4LDU A;  4OP0 A;  2LTO A;  2LVM A;  4MDX A;  2RHU A;  5GAN 7;  4HCB A;  3M56 A;  3X26 B;  4C5H A;  3CME T;  3MET A;  3S3O A;  1JJ2 S;  4PKC C;  2DXC A;  2EIF A;  3LWH A;  3NTH A;  3HSB A;  3VUB A;  2F5K A;  4FSX A;  4E7K A;  3HFO A;  3HFN A;  3M9Q A;  4OGC A;  1K73 U;  5KE3 A;  4BE0 A;  4ZGD B;  1VQ6 T;  1UGQ B;  3LX7 A;  3WVD B;  4M78 G;  5CIU A;  1VQL A;  2QEX A;  2PVG B;  2GF7 A;  1KD1 C;  1Y7X A;  1XTD A;  4J7I A;  5GAO n;  4QVZ A;  3V7S A;  1K9M C;  2YLC A;  4UC4 A;  1YHQ T;  4X34 A;  3UPU A;  1YIT T;  4M77 E;  2DO3 A;  3JCM d;  2L89 A;  5J3B A;  2CZ0 B;  2CZ7 B;  4C0Z A;  5GAN f;  3A8H B;  3OYI A;  1VQ4 A;  1IZ6 A;  3G4S A;  1UGR B;  4C8Q E;  1G3S A;  4E7H A;  1UGS B;  2XHC A;  4EMG A;  2X4X A;  2BUD A;  1NJI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...