2HBQB

Crystal structure of wildtype human caspase-1 in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2hbqB00
3KJFB 1BMQB 2P2CB 3KJQB 2H4YB 3GJTB 2DKOB 3P45B 2CNLB 3P4UB 1I51B 1GFWB 2FQQB 2C2ZB 1RHJB 1RHUB 3D6MB 3D6HB 2CNOB 2QLJB 4LSZB 5IC6B 3IBCB 1RWWB 2H5JB 1RHQB 1RWXB 1F9EB 1PAUB 3GJQB 4ZVTB 4ZVSB 2XZTB 1IBCB 2CJYB 3R6GB 2HBZB 2CDRB 1RWKB 2QL5B 4ZVPB 4ZVQB 1QTNB 4DCJB 3NS7B 1RWOB 2XZDB 5IC4B 3EDRB 1RWMB 2CNNB 2H65B 3EDQB 5K20B 3GJRB 4ZVRB 1RHKB 2CJXB 2HBRB 2Y0BB 2XYPB 2H51B 1RHRB 1RWNB 3IBFB 3R7SB 2H5IB 3GJSB 2C2KB 1SC3B 1I3OB 2CNKB 2C2MB 3R6LB 2HBYB 1QDUB 1SC1B 2XYHB 2XYGB 2QL9B 1PYOB 3KJNB 2C2OB 1RWVB 1SC4B 2H48B 4ZVOB 3RJMB 2Y1LB 1RHMB 2H54B 3D6FB 3R7NB 2QLFB 2H4WB 4DCPB 1NMEB 2QLBB 3R5JB 4ZVUB 3R7BB 4JB8B 3SIPB 1ICEB 2HBQB 3QNWB 4DCOB 1RE1B 2QL7B 2C1EB 1RWPB
chains in the Genus database with same CATH superfamily
2CPIA 2BANB 2QT7A 1YSJA 1RKIA 1CQNA 2GA7A 3M2UA 4ZIVA 1BWVA 3TUZC 1NK7A 1U6BA 2R7XA 2BEFA 1R27B 3A8KA 1Y3KA 1TL5A 4RO0A 4CO5A 1FDDA 2L08A 1WC1A 2X1BA 5GAGI 1S6PA 5KFYA 4E2FB 2B9WA 3ETMA 2GQ2A 5J2QB 2VOOA 2VBXA 2ZOMA 3JYTB 1UVKA 3UN2A 2VHGA 1U0SA 3MAHA 2YNFA 1NJZA 4IFVA 4Q2LA 1KWMA 3PIPQ 4KH0B 4BBYA 1SVDA 4BWMA 1RYRA 5HN0A 2NXCA 2UUTA 1C1CB 1OS5A 2CQ4A 2VG7A 4USUA 3PYDA 1HW9A 4NYOA 5B0FA 1WHXA 2X7IA 2VF3A 5HLFA 4PWWA 3GCXP 3Q2SC 4XTTA 4DQQA 1JNZB 1TKDA 4O3NA 1VQ5S 4M94A 3AQOA 4IG0B 1S1TB 1FX4A 1ZA1B 1D09B 1IBKF 1MROB 1KLMB 2OI2A 3I5BA 2J9DA 4ETZA 2WONB 3BYPA 3QYYA 2CKWA 2HHHJ 1CJVB 3QRRA 2ZKTA 1GTHA 5AJ3J 3I56S 1IJFB 5AE3A 1DHMA 2YKMA 1TKZA 5KT7A 3HHLC 2IYIA 3CCVS 3T5JA 2ZH5A 1FJEB 1E6VA 5KG3A 4P2FA 4J9OA 1X4BA 5EDWA 3TQ1A 1NJIT 2PFFB 2YQ0A 3AOCA 1LWFA 2AJ2A 3G6VA 4FXVA 1ZTWA 3PNIA 1T03A 2BVZA 3D3BJ 2VZ9A 4GO7X 1URNA 4QWEA 3M6UA 3GMGA 4M5HA 3TA2A 1U47A 4K5RA 4ZPWR 5CCMA 4U9RA 3GV7B 3LF0A 3BS9A 2VH7A 3W62A 2NXEA 1HWUA 2NUUG 3T9ZA 3KG4A 4QQBA 3AAWB 4ECYA 3SQOP 1U48A 4RUHA 3DYAB 3LGHA 3D0HE 1HNVA 1S99A 1VQ8S 5CHCB 1JLQB 2DNZA 1IM4A 3AB4B 4K5SA 2GIQA 2XNQA 4F3OA 4NXMJ 1KQSR 1VBXA 2GHPA 2IYGA 4QW9A 3OUYA 4LFAJ 3OL8A 1MWYA 1VISA 2YX1A 3ZO7A 2AU0A 5AJ3F 1TK8A 1RAHB 3MECB 3EICA 3FFIA 5IFMA 1N6QB 1HD1A 5H9EJ 5ETOA 2GQQA 3VZIA 3HT3A 3IO1A 4P71A 1RTZA 5C25A 4R8UB 1KVKA 1UPMB 3TAQA 2WOMB 2ZNZA 5DLGA 3HHNB 4LREA 3T5KA 3NCPA 3IWNC 1OMSA 2JJ4D 2VFRA 5E3RA 5F41A 3JTNA 1UETA 2V50A 1AUDA 2LQ5A 3OLBA 2KM8B 1ZTTA 1NPPA 4XO0A 1RTJA 3HT0A 1VR6A 4Z7YA 5KFCA 4EYIB 4HTJA 1Q53A 4F02A 4R5PB 3M8WA 1KD1T 1MNEA 3DOMB 3JSMB 4RWWA 2Y9HA 1N56A 3OTCA 3PRDA 3KG1A 3X3UA 1YJVA 2HBYB 3L7PA 2R7OA 1WDDA 4KV8A 3VV2B 3TARA 4OYBA 3FGVA 1HHTP 2C2OB 2DGSA 2FJXA 4OV1A 1FKOA 2HAIA 1XEZA 4DR2F 1E6YB 1JLFA 3AOAA 4J90A 1SL2A 3GFZA 5ETPA 3G82B 3J7A1 1QE1B 1UL3A 4C98A 2KJWA 2IC3A 1KR4A 5HLFB 4CTAA 5H9FK 1LNQA 1MWQA 4FF1A 1R8HA 2W4PA 4KHMA 3VGTA 1R8AA 2HMIB 2Z2YB 4USMA 5D3GA 5ETQA 5HVFA 4FPRA 2XI3A 2BYCA 3PW2A 4ES2A 1X4EA 2ROEA 2LA6A 4PG5A 5B0DA 5HMZA 3A3NB 2QA4S 1ZM2A 1NHVA 5EWFA 2GVZA 1JLCB 2VG7B 2EEYA 4RW6A 4CP5A 1V5IB 3BV8A 5IOLA 2K06A 1RHJB 2YKPA 2FVQA 1O51A 2EWHA 2OPRA 2ZBIA 3B4DA 4A48A 1VIOA 3GSDA 1FRKA 2F9JA 1P27B 1JLAA 1ZA2B 2OEKA 3K57A 1KLMA 1FRMA 3CCWA 2HQDA 1ZH5A 2RILA 4KHRA 1WOOA 2ZBQA 1IKWA 1TUGB 2YY3A 2KHDA 3CJ5A 4USWA 4WFNQ 3ISNC 2R2SA 3KMSA 2JL9A 1KP6A 1RWXB 5F0UA 2M4MA 1JKHB 3U27A 2B56A 3DRSA 2VICA 3TX0A 2VBZA 1RAAB 1U2RA 4Q7AA 3FEYB 3POTA 2RUGA 1I5OB 2AJ1A 4OYOA 3DXBA 4DR3J 4DPOA 1NPKA 2PA8D 1RUSA 2QMUB 1U02A 1C1BB 4DV3J 4WE1B 2YKNA 1HNWF 5DG9A 5K14A 1S0OA 2WOMA 3DC2A 2Q6BA 1SBRA 2CA9A 3GTYX 1FE4A 3EVWA 3KLFB 2M3DA 2HWHA 2HVZA 3I0RB 3KJVB 3QWPA 1H6KX 3OQ2A 3NS7B 3L09A 1YVFA 2DHAA 4LSNA 4OJHA 5IQQA 4TU8A 1NM2A 1VC0A 1F2HA 1U8WA 2VBWA 5LSLA 3I9V9 2UV8G 3IP0A 1F5CA 4A8SA 1M0SA 1LXNA 4JI0J 1ZPWX 2J8AA 2QE5A 3GG0A 3JXOA 3MECA 4Y2IA 3KK3B 4RNNA 4I6AA 3VALA 2FUG9 2XSFA 4FNIA 4HACA 2JX2A 4KFBA 2VQEJ 2UUCJ 2LKZA 1EJ7L 3DLLQ 1QLNA 1U25A 2BMBA 1KN6A 4F25A 3LGNA 3QAUA 4LF6F 1FKOB 1QD1A 2L3MA 1YRXA 3KWMA 3CCQS 4WKRA 3RTVA 5D0GA 2KZZA 3MUMP 4YQWA 1RT4B 2A0FB 4HTIA 4WP3A 1VBYA 5HSPA 1H7XA 1OSCA 4WKYA 3TZYA 1D9AA 2L9DA 2IVFB 5G4DA 3TAPA 4Y00A 1Q81T 3I32A 3W3SA 1BQMA 4O3SA 1DURA 4JI8J 4OX7A 2JSXA 2PMHA 3NLCA 4EK2A 1NSQA 3T1YJ 2MQQA 4LBPA 3WIVA 4WWSA 1BE4A 3DRRA 3PIOQ 3K59A 3FKBA 3I4PA 4K4YA 3VVUA 4B3SF 1PO6A 2Q3PA 5K8NA 4IG0A 5KFTA 3CD7A 4WTOB 1FRJA 2HRUA 3MDFA 4G6VB 3NGSA 1CULA 3DOKA 3U02A 3GLJA 5A8WA 2CADA 5L39A 2HYIB 1M1HA 2YNGA 5L9XA 4J9VA 2B9YA 4EYHB 1QDUB 3BEGB 2IC3B 3MEDB 4DV1F 1RLDA 2XYHB 4YB5A 1YJRA 1H3DA 1FJCA 3MR2A 3IWLA 1VRUB 3LOUA 2PEBA 1U0HB 3HSGA 2DGQA 3CMAS 4ECQA 3UD3P 4H4KC 4B3RJ 3SV3A 3W63A 4XPEA 1JJ4A 1RADB 1PJ5A 2O67A 1NXIA 2QLFB 2RRNA 3KXDA 4ZA1A 4I2PB 3TANA 4WU3A 1FD2A 1SKSA 1RA7A 4NWBA 2HQFA 1O0PA 4URSA 4IH5A 1QSSA 3UN3A 4XDDA 4USIA 1GAOA 2BX6A 2CPZA 3SIPB 3GV5B 1S9GB 4DU8A 1SUQA 2HZAA 1VQ7S 4OYPA 5C42B 2DHHA 4LF5F 4O3RA 2JWNA 3R3TA 4PXDA 4FXDA 2KHCA 1S12A 4NEYA 3S1TA 1M5SA 4Y6IA 5KFVA 4ETXA 2XQCA 2P2CB 3KJQB 1WUUA 2WBMA 5DDQC 2V4RA 3IG1B 4EBDA 2FLLA 4GKKJ 2PE8A 1LWFB 3BSAA 3JSMA 1NK6A 1X8DA 1RU2A 5F8MA 1S57A 4FP9A 1GFWB 4LQ3A 2J8SA 2ZD1B 3TA1A 5C25B 1Q8IA 2QA4G 1LW0B 4Y2AA 3CJKB 1HBUB 5KG5A 2UU9F 5BR8F 3DRSB 3AJ2A 1VQMS 2AEMA 4MTPA 4NI2B 3SDEA 3I87A 3WZ0A 3DMJB 2B9EA 3BF4A 2EI5A 1RWWB 2LVWA 1WF0A 3BSCA 4DV7F 1FDAA 2G9OA 4LFCJ 4L74A 4KGZB 3PV8A 5ETVA 3RB3A 2GO9A 3PX4A 1F9EB 5K14B 5J2PA 2EXUA 3QO9B 2B51A 2EBGA 3ZZPA 3OLAA 5L8RC 3UD5A 1IKVA 4LFCF 4BC9A 4YR2A 3SMZA 1VRTA 2CQPA 4P2XA 1UA0A 2XZTB 4KO0B 4V19J 1VQSA 3BKTA 4U67Q 1RBAA 1FWLA 2FTRA 3DLJA 2O3DA 3CNQP 5BR8J 4UQGA 2UU9J 3DDKA 4Q2MA 3M8PB 2DEJA 1SI9A 1NBEB 1ACMB 4OI3A 4XK8C 1RA6A 4ED4A 2LA4A 3C6TB 3MMAB 1PYTA 3J81j 2XMJA 1QE1A 2OUGA 3MMJA 1WOPA 1LQ9A 2J0WA 2WSFC 4DXLA 3DFEA 3QJPA 1NSKL 4ILMA 4HACB 1EETA 1CS4B 2ZUAA 2YNIB 2DNPA 2MKHA 1PSDA 2YKOA 1X9SA 1N52B 1Q16B 1N34F 3GWCA 3G9CA 1TQLA 2CQGA 2RD5C 2VKRA 3ZZYA 4ED6A 2BOAA 1IKWB 4GO5X 4O0IA 1TFWA 2AJQA 3EDQB 3OTBA 4MFBA 3Q2TC 4U6PA 2E66A 5JVHQ 1HBNA 3Q89A 1WEXA 2C3MA 4X66J 4K4SA 1T95A 3TR5A 1Q5YA 2RHSB 1KTVA 1NJYA 1XBWA 2IVYA 2C3OA 2VFVA 1S1VB 4KBIA 3SCLE 1CLFA 3HZEA 1TR0A 2YX7A 2HMIA 1S0MA 1UVMA 4OQJA 3ENQA 4OZJA 3BH6B 3PCOB 2V2QA 1UFKA 2COLA 5A8WB 4P52A 2BRLA 4ILLA 1PCAA 5ETLA 1XR7A 3LW5C 3TP2A 1TVRB 3RBZA 1N54B 3FSIA 4GKJJ 2C2KB 2OD4A 4MYTA 4OX8A 3H0PA 1TAQA 3JSRA 4CLYA 1R8PA 1JLGB 3HZGA 3MPYA 3QJJA 4ZPBA 5HO4A 1JX4A 2DNLA 1CC7A 2CJBA 3NS5A 2MQLA 3HFZB 2K3IA 3C14A 4TQRA 3UN5A 1AROP 5A8KB 1VIXA 3MPDA 2BUNA 2YKNB 3MM8A 4MYUA 3ZTQA 4KFBB 3CCRS 5KFHA 4CLWA 4DX8H 1JIHA 1HWJA 2PI5A 4MMOA 3HJFA 1DLOB 2DT9A 6AT1B 4JI6J 2PD1A 1HNVB 2Y1LB 3FBBA 1SB6A 3H8YA 3K8WA 5GVQA 2DJWA 2Y1RI 3G4SS 4LF6J 3RR8A 2ZZNA 1HLWA 1D9DA 1KFSA 1OY6A 2OD6A 4DCPB 1UWBB 4DFMA 4OJ1A 1TTHB 2RSQA 2VQEF 1Y5LB 4I1TA 3QLHB 5J2PB 2KYZA 4N8NA 3M6XA 4DLGA 1V3ZA 2OELA 4ZPCA 2MQPA 3VQSA 1AB8A 2QSWA 3CDBA 3LQVA 3MUVP 2HFVA 2G1DA 5DM7Q 2UP1A 4WE1A 5KTQA 3C6UA 2W7OA 2RVJA 1WI8A 4MKBA 3GJTB 3MWBA 1ZM4A 3UCGA 3EGNA 4KB7A 1PJ6A 2XMMA 3MCNA 1AZSA 1JLEA 2CPFA 3CJ8A 1HARA 1NAQA 4KY3A 3FNNA 1A7GE 1H98A 2CFXA 1VK8A 4L6V3 4WP8A 4WCEQ 5K9FA 3QIPA 1YIJS 1S77D 2N82B 3W2WB 2DXEA 2KB2A 5D4OA 4ZN1A 1X31C 2VG6B 1TL1A 5U47A 4CYUB 5KFMA 1ZZFA 3DLEB 3KHLA 4DR3F 4EUVA 3R1LA 2KT3A 2DB1A 3CE8A 4NMLA 3G8SA 3IM8A 4J9LA 1IKXB 2H5JB 5IT0A 3OD2A 1FRHA 4RX6A 2VQFF 3CJ0A 1RAGB 2XG8A 2P9CA 4C0OC 5DQIA 4DQRA 5LSRA 4P6QA 2D69A 2EVZA 4B3OB 1MMDA 1SJQA 5F9NA 2PMZD 1LW2A 2B4UA 1VJWA 1SJFA 1HR0F 1B3TA 4TYBA 2CG4A 4C3KA 2E9RX 1IBCB 2HNDB 1TK5A 4C8ZA 4H4KA 5RUBA 2LCWA 3R6GB 3M8RA 1GT8A 1YQHA 4G1QA 2PC6A 3MCOA 4I6WA 1OJ4A 2J0QD 2GMLA 2O01C 4B9NA 1HI1A 4F4AA 4K4ZA 3MTJA 5J1EB 2FJEB 3RB4A 1VMBA 1T02A 1WKKA 4DR6F 3MPWA 1NJWA 4EEYA 5DQHA 1HMVB 5A8RB 1ULRA 3H5UA 2ZH7A 4K50A 3EYZA 3NMAA 2GHWA 3VVTA 5AE2A 3BKFA 1RT6A 2V8PA 3HFKA 5LL6d 4IYQA 4NLYA 2UUWA 2NLWA 1RABB 3B82A 3UI3A 3EDRB 2XEXA 4RW8A 2YNHA 2A1BA 5KFRA 3LP0A 1A6LA 4J9RA 1N5SA 4JV5J 4ZN3A 3DRYA 4ZCMA 3NXZA 2JOQA 2NUHA 3M2VA 1R7IA 2F40A 3N5FA 3DRPA 4WK3A 2IFXA 2XMTA 4CZCA 1SCJB 3EE3A 3B6BA 4K2XA 2JLEA 1VLOA 2IBOA 1OQ3A 3RU0A 3T6BA 2Z8QA 1T3NA 3FEZA 1K9MT 2DNRA 1MU2A 3H2UB 5MAOA 4LVOP 1OO0B 1VQOS 2BKOA 2KL8A 3NP5A 4WU2A 4DHVA 1DTTA 2XMUA 4YHHJ 1HR0J 4NLSA 3V2UC 4JI3F 5D6GA 3PACA 2R7VA 1R3NA 1IQTA 3EMTA 2MQNA 3H40A 2DHXA 2G0JA 1WEZA 4GRSA 3KKFA 3KLFA 1SC6A 3I31A 2N3OA 1S4EA 1VQLS 5IT9U 1F2GA 1IKYA 3HF5A 1S49A 5KFEA 5KFZA 3J80Y 3ZZZA 3GQCA 1DJ0A 4LSNB 2Y1JA 2I9SA 3MUTP 1QM9A 3D67A 3W9IA 3HSJA 3EM1A 1WJ9A 4ZJLA 5J1PA 5IM0A 3CJKA 4DF8A 2MTLA 4FPIA 4OMFG 1FO1A 2LQJA 2MJNA 3CCTA 3OUYB 1U49A 1IBLJ 4A8FA 4ELVA 2V2VA 2MZ1A 4UZBA 2VFSA 5F8HA 4LJMA 1R31A 3DLKB 3MPUB 2FJDB 3HD1A 1H38A 1UJ6A 3S01A 1L3UA 2FHJD 1JXVA 4QW8A 4WK1A 1FDBA 2GQCA 2XZWA 3A8JA 4WYLA 3VAIA 1QSLA 4NXMF 4IDKA 3KNAA 4CT9A 1BY9A 3CD5A 2ASYA 1GMVA 3L95X 4BHQA 3FUYA 1BQXA 5HMYA 3PYGA 4A46A 3V81A 4J9NA 1G2EA 1EQ0A 2HK2A 4PCQA 4ED1A 2F4FA 2QIFA 4Q44A 3GB0A 2P9GA 3GCWP 1TVRA 4I4BA 1DQ8A 2V69A 3IM9A 3KJFB 4PWDA 4LRAA 4LVNP 1NHUA 4FN5A 1FDNA 4W98A 3CCES 4ZHRA 1YKWA 1HNIA 1LWCB 3ZZUA 4MT1A 3E2EA 1NK0A 1AYEA 4ED0A 1C0TA 4C0BA 2M70A 2DH9A 2UUAJ 1EZZB 2ZNYA 1T94A 4NASA 3D6TB 1M5KC 1BWEA 4ZP7A 3B8HA 3MCMA 4M5NA 1L5UA 4KE5A 3AY0A 3LP2B 1CJUA 2W4DA 4OIXA 2U1AA 3NCRA 5K8OA 5GMEA 2FC8A 2QTWA 2YXLA 3CW2C 3T1HJ 1YRTA 1D9FA 4DR1F 2HFNA 3PYEA 2J9EA 1ZM9A 3R27A 4J9UE 4J9SA 4B3MF 2CQ1A 1P8GA 3BBBA 4B9MA 4DSJA 1CPZA 1JXEA 2BM1A 5DDRC 5H1SV 4ZVTB 4MAKA 3WBZA 4WIIA 3FBFA 1HI8A 3NOCA 1IWGA 4ZLLA 3QT6A 4C7QA 1UJ5A 2R8KA 3RAXA 4Q43A 5D77A 1RCOB 1Y3JA 1Y4ZB 3SZ2A 1SL1A 4CO3A 1PG5B 2KI2A 4ZVGA 3KLHB 1QAIA 3DLGB 5DZ6A 2IAJB 1R8CA 4M95A 3OVAA 2OEMA 1RK8A 1SJ1A 3W2WA 1SQFA 1CJKA 3HX9A 4EI2A 1KC8T 2NXNA 4R25A 3R2DJ 1F3VA 1V5VA 3QGPA 1K73T 4FBUA 2B43A 3OVSA 3UE2A 1N34J 2A3JA 2RF2A 2EFOA 1C0UB 3KLGA 2Z57B 4ES3A 2HS4A 1KDNA 2V0NA 4J37A 2P5VA 3BGLA 4OHVA 4QIGA 2DTJA 4UUWA 2A6MA 2D3UA 5IM0B 3R1HA 4L76A 5I3QA 1S1UB 4C8NA 4L3NA 2I5JA 3VGSA 3KLIB 3GR0A 1N5YB 2DCLA 3N9UC 4DUTA 1FEHA 2O1PA 1WTFA 2OH2A 3CF5Q 2EBEA 4L3KA 1K0VA 4ID8A 1F9FA 2IDEA 5J2NA 2JEJA 2OPQB 4TKTA 3CTRA 5AXKA 8ATCB 3KLEA 1QAYA 2VPWB 1S7IA 5GAEU 1RHRB 1N5TA 4WJBA 3R7SB 2IM1A 3FDSA 3SEOA 4IG3A 1CJTA 4HL9A 1TUWA 4RLEA 1VQKS 4AXIA 5DQGA 5GMKa 3GR1A 2Z2ZA 2RE1A 4CM2A 3ZZ0A 7FD1A 1DY3A 2HZVA 5DM6Q 3MR7A 2QMWA 2EC2A 2LECA 3J7YU 2HS3A 1AT1B 2B6AA 4O3QA 1CQMA 1X4AA 4AUKA 3NOGA 4UZCA 3ZNUA 3GPAA 3J80U 3H42A 3ISZA 2DO4A 1XNQF 5DDPC 2HK3A 3OJUA 3FMBA 4MFBB 1R0AA 4J9QA 5EGYA 4CLKA 4PXCA 2KT2A 3LP2A 3GV8B 2Q79A 3K0JA 4GKKF 1JMTA 1HMVA 3D28A 4RW4B 5A8RA 2G0CA 3G8QA 4DZ6A 4F4YA 1JQGA 4DFKA 4W90B 1YHQS 1VS3A 2H4WB 4IFYB 5T14A 1NMEB 1TL7B 2RDIA 3HFVA 2XM3A 3QQCD 3BPSP 5C5JA 4FVMA 2GAHC 3OFHA 3THVA 1Q86T 5FD1A 3IC1A 4TY8A 2HURA 4ECSA 3KDOA 5KFPA 2LXUA 4FF2A 4DR4F 1ICEB 3EZUA 3QNWB 4M8LA 3PR5B 4HDHA 2F3JA 5J2MB 5J2QA 1UZHA 4C0HA 4IOBA 4NCGB 1HHSA 1U45A 5EX0A 4PWDB 2IIHA 5I42A 5E3PA 3W9HA 4YFUA 1KSPA 3J81Y 4K4VA 4CO0A 4KKOA 3QSIA 4K4WA 1FXLA 4P74A 3BBFA 1NSPA 3D3CJ 4NLUA 1RT5A 5BJRA 1F5AA 4TXSA 4R5PA 4F4WA 3BDEA 5BXIA 4DV1J 1T7PA 2AW0A 3GIMA 3RAQA 2ZUGA 4FBTA 2E9TA 1QJHA 1F1BB 2R2TA 5ETNA 4KV8B 3TWZA 4E8UA 4HT5A 5CD4H 1IQZA 2DIVA 2K7JA 2F8MA 4KT0C 4S0MA 2QLJB 3SCIE 1MSWD 2CDQA 3QATA 2Z56B 4DPXA 3IBCB 1L3VA 3PRBA 3MEEB 1S6PB 2HGNA 2J9DE 3VAFA 2FGOA 4Y65A 3MR5A 2WB1D 2WTFA 3T1YF 3MAAB 3M8YA 3QAEA 2JVRA 5GAGU 4JI8F 2Z4PA 3RR7A 1TKXA 2Z58B 2KFZA 2K7KA 3EUNA 3FCVA 1FNMA 3PW7A 2LMIA 9RUBA 3FJ2A 2B5JA 2DGUA 4I6YA 2MKJA 3HO1A 2ZDOA 3M30B 4YN3B 2RB7A 2ZM6F 3SFUA 7FDRA 1AA1B 3BH7B 1GX6A 1DQ9A 4C8OA 3CPWR 4DR5J 4DL7A 3R2CJ 3THTA 1LWCA 4X62F 4NLRA 2DRAA 3DDNA 4OHYA 1RAEB 1OYEA 5ETSA 4F7VA 4ECWA 4HYKA 2CQCA 2EKYA 1PBAA 2I5JB 3BYRA 2XZDB 3AFGA 4NEZA 3UDLA 5L46A 1HWKA 5E0OA 1X60A 3N6MA 3HXMA 2EK1A 4ANCA 1B7YB 3CO9A 3J7AN 1R6VA 4MIWA 4ANDA 5ETTA 4HT7A 3NBPA 1FWKA 2W9CA 5E3CA 2MY8A 1C4CA 4QWBA 1MROA 3CIMA 4DPUA 2A6OA 1U24A 5L1LA 2CPHA 2DNGA 2ZBPA 2IDLA 4USTA 4DN0A 3HP6A 2R2RA 3OTEA 3SBMA 4DV3F 2KU7A 3C8YA 3CDWA 4NLOA 3IR5B 4NMXA 2ASJA 1HQUA 3N5BA 4G65A 3CWJA 4OZNA 2BE2B 2EFQA 5AXNA 1R89A 3OL7A 1C1BA 4EU0A 4AYBD 2HAFA 3IBFB 2ADCA 4M5JA 1XMOF 3TI0A 1SV5B 2WHOA 1D0EA 4WYWA 2XS7A 4IOAQ 4WZQA 1H72C 2BW7A 4UT4A 3M8ZA 2WSEC 3D0GE 5M2UA 2ZH6A 4ZLJA 1VHIA 4WFBQ 5IXUA 4DV2F 2RRBA 1M90T 5K8MA 2V94A 4NRTA 2GVZB 3FRYA 1CBKA 3CEDA 1GK8A 4KKOB 3ZC4A 2JLGA 3GONA 1C0TB 4WPAA 1JXLA 2KXNB 3G82A 4O4GA 3W2VB 3HVAA 3MR6A 1LK7A 1TL7A 2PN6A 4NLDA 4OI0A 2XYGB 4ZP9A 1Q7LB 4MJKA 2PI4A 1VDHA 4HI1A 1TMMA 2MYFA 2V4JA 4NLTA 2H48B 4OZ1A 3Q22A 2HSEB 2FJWA 3RB6A 2AHOB 2KJVA 2DNMA 2X3GA 1WORA 3TJAA 1QVGR 1JLBA 4I2QA 4DUYF 1N36J 4C8KA 1S1WB 3KOAA 2B0GA 4DN9A 1QVFR 4K7QA 2VL1A 2MSTA 3W5ZA 1HHQA 2FLNA 5KOWA 3MAAA 2ROPA 5LMUF 2HGMA 2VA3A 1C0UA 5BYRA 4LMZA 3DNCA 4B3TJ 1R0BG 3PW4A 2OSQA 1Q5VA 1RTJB 2KVIA 2OMOA 1X9WA 4N76A 3AJDA 2DIUA 3RBDA 1S1UA 2HHVA 2K1RB 3WQPA 4DR2J 1WHYA 2KYXA 5FIIA 4DDFA 1YBUA 2LEPA 1RKJA 2JEFA 1QY7A 1IKYB 4A8OA 1JB0C 1PC5A 3Q8UA 5F9LA 4LRDA 1VQNS 4JI4F 2ATLA 1SKUB 1RT2A 3MMCA 3DM2B 3OL9A 1PAEX 4OYWA 2XCPA 2I0XA 1NB7A 2N4DA 2XMWA 2YWFA 1RAFB 3W8GA 4CT8A 1R43A 4RU9A 2W8KA 1F0XA 2BQUA 3M8SA 2RU3A 2QA2A 1WD6A 5IC6B 3W1YC 4LUBA 3NKYA 2CWXA 5SUHA 2B9XA 2DGTA 3LH2S 3N0VA 3WX8A 2JLFA 4ZLPA 4XIUA 1LWEA 2DY1A 3N6LA 4C11B 3K8VA 2DGOA 2PMWA 2QGFB 3DCAA 2W24A 3VAHA 3CGIA 4LRCA 1N8RT 3GJQB 4E0DA 1ZETA 4LF8J 2L9WA 3BQ1A 2BDPA 4Y2MA 8RUCA 3T6JA 3E01B 4ZVSB 2HHPA 2APOA 4JOUA 2RS8A 4ELTA 2EFPA 4DR7F 4V19X 2E1AA 2MY7A 2OHDA 4MIBA 1U1NA 4XAKA 2GGPA 1KLNA 3BDPA 3ZTPA 2H3EB 2HWTA 3E51A 4LFAF 5FJ4A 3AQPA 5F8JA 3GU0A 3MM6A 1D8ZA 3T5LA 4JV2A 4Y2KA 1N32F 3LP1B 3MMBB 1P9YA 4I56A 2OPRB 5CA5A 4Q45A 4LR9A 3V6DB 3PX6A 1TK0A 3WC2A 1HA1A 2FHOB 5D0EA 1YRUA 4I7FB 3BGRB 1PIEA 5GADI 3Q8RB 3AOBA 1L3TA 2LU1A 4DI6A 5CZXA 2KXHA 1RT4A 1FFWB 2B7BB 2GC8A 1Z2LA 3P5BP 4P2SA 3VHQA 4RNFA 4Z7CA 1UTAA 5C42A 3PJWA 2XS2A 4ANEA 3DLHA 2O66A 2KTQA 1XN9A 3A13A 3K5NA 2JDJA 2GMJA 2LQBA 4K0KF 3NGDA 1YG0A 2J5AA 3SSQA 2EPIA 3M6WA 2LYVA 5B0AA 4EFAC 3EWGA 1OPIA 2HHHF 2MMYA 2R7UA 2DRBA 3KK1B 2XYPB 1TAUA 1NRKA 1YGYA 1RWNB 4PAAA 3AHPA 4TYAA 2RDJA 2XLKA 2NZ4A 1I94J 2QN6B 4NCGA 5KFFA 3SCJE 4JYAJ 2YNGB 3TUPA 4X64J 1MLAA 1KQGB 2D41A 1TU0B 4O3OA 4DQPA 4URQU 2FY1A 3VCDA 5HQLA 4LR8A 3M2RB 2AV5A 5A76A 3M1VB 3H59A 4KAIA 3R5GA 5M2RA 2XMAA 4UTGA 1KONA 1OSDA 2MZTA 2JRSA 3ICLA 5DGBA 2ZC4A 2ZWOA 3KK3A 3R6LB 3O1LA 3HSDA 2AGOA 3BN4A 3OR1B 4NA2A 1XIQA 2RKIA 4F36A 1RT7A 4ZLNA 3KLGB 2RQCA 2PO4A 3HULA 1KS2A 3F44A 1S6OA 3IRXB 3L3CA 1EARA 1RTHA 3PJ9A 3HSZA 5EN1A 3DMJA 2NYIA 4DL0C 2G2ZA 2A18A 2H54B 5K5MA 3PJXA 3ZZOA 3V6JA 3KK1A 2ILZA 3HVRA 2WW4A 1T11A 4CH7A 3P3DA 3M32A 1YI2S 1UEUA 4HDGA 1RYSA 4WFYA 2NPFA 4ZPAA 4DQSA 3G6YA 3CC7S 2BR0A 3UW1A 3OXLA 4FYXB 1XMQJ 4XDCA 1CG2A 1RT2B 2WVBA 2GW8A 1B0VA 2F5GA 2IMWP 3D68A 4DJBA 2FVRA 4A8QA 4YY3F 2KXFA 3P45B 4I69A 2ZHOA 2CNLB 2ZOFA 3DOKB 4U7CA 1XNRF 4OI4A 4EBEA 5J1NA 3W2VA 2B4PA 4N41A 4PR6A 1X4HA 2DPIA 2YWGA 1SH3A 2G2OA 2HQ3A 2WSCC 4ZCIA 5A0YB 3D6MB 2GJ2A 4J91A 4DLEA 1FJGF 4GVBA 4ZJOA 4YS2A 2MHEA 1VRTB 4NL5A 5L9NA 3PKMA 3D54A 2V34A 3CIZA 5I3UB 4F4KA 2PIIA 2KN4A 1BD6A 1RHQB 2ZITA 2R2UA 2BXJA 4E98A 4CLPA 4CNZA 3PHTA 4OZ2A 3K89A 3C19A 4KH1B 1HBNB 1CULB 2RNEA 2WK4A 3ELHA 1SUQB 4PQAA 4OZ0A 4WP9A 5IWAF 4AL7A 4F2RA 3CSKA 1RAIB 2CQDA 2KKHA 4O4GB 4TY8B 5T7LB 3RRGA 1ZOTA 4NCAA 4KIAA 4MH8A 4J9PA 5KT2A 2HHSA 3H5YA 4OYIA 3I4HX 6FDRA 1FJGJ 2AT1B 4PG4A 5GADU 4X65F 3OSPA 4NYPA 1DZ5A 2L48A 3W66A 2MPUA 3WC0A 3GSIA 5LSOA 2ZH9A 2OKQA 3PZPA 4ER8A 2E7XA 1U4BA 1MG7A 1S1WA 1RAOA 1HNZJ 4EZ6A 4ERDA 2EG1A 5D78A 3FCWA 3KUHA 4WFXA 4KJIA 3Q0AA 5KT3A 3VAJA 4DFPA 1TMJA 5CXTA 3CVKA 3OW2R 5L1JA 5F8NA 3MFHA 3M8PA 4JI2F 2DH7A 1NDLA 1S97A 2CNNB 2YKAA 4M5DB 1N6QA 3HKZD 4RNHA 5THWA 5DDOC 2J76E 2BZ2A 4G1PA 2LDIA 2XWXA 3HVWA 1IKXA 4PEOA 3QO9A 4P9SA 4JI0F 4DG1B 2VU5A 4RUCA 3QT7A 3LA0A 4JP8A 2HFOA 1J5OA 1S6UA 2OTLS 2YPYA 4ED8A 1J2VA 5HAOA 4FYYB 1YJ7A 2CJXB 3IRWP 1ZZNA 3PEJA 3H4BA 1IBMJ 3KHGA 2E5LJ 4DQIA 1UVIA 3FZBA 1UWBA 3Q86A 1S72S 2E29A 3BPDA 5E2QA 3SDEB 2ZZTA 5FLXY 2ACYA 1WC4A 2OGUA 5LJ5Y 3DLEA 3TYTA 1KBRA 5F3ZA 2VG5A 3M6VA 1G4CA 4AD6A 2DISA 2ZH1A 4M63A 3MAQA 4OYXA 2R8HA 4DV5J 1ZAVA 4M5KA 2GV1A 2MQMA 1S79A 1IJEB 2ACMA 3CB4A 4QPTA 5KFBA 2R8JA 1TL4A 4TU9A 2KM8C 1S9FA 4JYAF 3HHDA 4ECZA 1X4FA 3U1NA 4DV0F 2GMHA 5CZVA 1DRZA 1Y5IB 3PVXA 2DGWA 1IXKA 4RW8B 3VQTA 4CH0S 1YX2A 1PYOB 2J7UA 3IXQA 5F8IA 2HVIA 4QCLA 1FTCA 1OWXA 2ZVIA 4K8RA 4R0EA 4ZVOB 1IR0A 3FC9A 5D3GB 4UY8T 4CO1A 2F1FA 4RR5A 1WG1A 4K0KJ 4F50A 4HR2A 1OY9A 4URGA 4M5IA 4DSEA 4DX6A 3K7RA 2OLWA 3JQKA 4LIRA 4ZVUB 4LF7F 2V6AA 1D3WA 1NK5A 2UXBJ 2FD2A 2NXUA 4ICLA 2ZKUA 5LJ3Y 1JJHA 3IA0A 1CJVA 4QU7A 3KYLA 1VBKA 3WIUA 4FKXA 1N0VC 4Y3CA 3S7RA 1Q79A 1VHFA 4OI1A 5KAKA 2C2NA 3GG1A 2QYCA 1VQ4S 5KFOA 2DR8A 2IRUA 3M1VA 3V6KA 2JNJA 3FEXB 2BJ3A 3W65A 4CYUA 4DSIA 1HQ2A 5CYMA 4YR3A 3EPIA 2E5GA 4YB1P 2B4VA 4C2MA 1FTRA 4KR0B 1REVA 4FYVB 5ADZA 3T3FA 4AQYF 1B64A 1OQ6A 4DV6J 2JC0A 2YTCA 4CLUA 4ED3A 2H5EA 1LXJA 2E5IA 2WZ1A 5D15A 3TAMB 4H54A 5ETMA 5FLXU 1K44A 2V4JB 3CJ2A 1BXNA 1T3OA 2YNHB 1V3RA 2QFJA 2DEIA 1RT1B 4QIFA 5DRKA 2HNYB 3LPYA 3C2PA 1WC6A 3T1AA 3H5XA 1PAUB 3QLHA 3CUNA 4H4MA 2CQHA 3UVJB 2CPJA 2CZ4A 4DV4F 2XHWA 4IRDA 1RTDB 3JSYA 5HK4A 4NXNJ 3RYLA 5KG6A 3H98A 2V9WA 2A2DA 3RW6A 4Q0BB 2CDRB 4DOZA 2W9AA 5L1KA 2BV3A 4HHJA 2BJDA 4K59A 1I94F 1VBZA 3L4BC 1RWKB 1EHWA 4U96A 1W25A 5AT1B 2QL5B 3HVTA 2GFFA 1Y11A 4JI4J 3A1YG 3DRXA 1DQAA 1MMLA 1NU4A 1JJCB 1R8BA 2UVWA 1VI7A 5B0GA 4DCJB 4LF4F 1TL3B 2DK2A 3MI7X 3QFHA 1FEEA 2DBBA 4K4TA 1TL1B 2LDYA 1GXTA 4OX9F 2D3ZA 3DDIA 3TX8A 5HQ8A 1RWMB 4AXJA 3MM5B 2XLIA 5HMXA 1UFWA 1NH8A 4ID5B 3C6UB 2RU9A 4OYAA 2HFUA 3GILA 3F73A 2WVDA 4KHPJ 2AYGA 4DEZA 3ET6A 4QYRA 2VDIA 4CRJA 2N7CA 1TKTA 2L9NA 2Q6CA 3I9ZA 4K4XA 3RB0A 3ITHA 1GEHA 1WI6A 5SZTA 5DGAA 3Q8QB 2CJAA 1N36F 4FYWB 4L75A 4DUYJ 2WVFA 3IAM9 2FDNA 1S1TA 3G96A 3PDNA 3SSRA 3SQGA 3R5DA 4B02A 1Q82T 1T9VA 1SIWB 2RMLA 2HBRB 5HVHA 2FHMA 3NGRA 4IRCA 5I3PA 1U8SA 3OXFA 1NKEA 3QGIA 4QWDA 2AGPA 4Y28C 3GYGA 2DGXA 2MKSA 2ZBCA 3MM9B 1J5EJ 3IGVA 4ITSA 2VJUA 1E6VB 4KRWA 5GAEI 3CCSS 2CPDA 3G6ES 1H0HB 3PM9A 1JLCA 2ZOGA 3SI8A 2BJ8A 2XO6A 1FE0A 1QSYA 2O5DA 1RDRA 1SC3B 5EWEA 3GE9A 3TRGA 1XMOJ 5BYSA 1RT3A 2POKA 1GMWD 4NLPA 4AQYJ 1YJNS 4JUZA 3RZAA 4JI5F 2QRRA 2KDOA 3J7YI 3BREA 2QL9B 1WKLA 1V3SA 3PTWA 2IM3A 4P2MA 1HBOB 4PUOA 5KG7A 1S9GA 5EWGA 3CO0P 3DOLA 1EIYB 2P9EA 4M1KA 3WDOA 3RAMA 1SKRA 2IAJA 3EGZA 3FBCA 1S9EA 3H7HB 3K5PA 2WRMA 3ISND 3LUYA 2HIQA 3EZ5A 1S1XA 3CCLS 5C24B 1XC9A 4FF3A 3HHLB 2RS2A 1VQ6S 4X4NA 2MEWA 4DS4A 1HNXJ 1YBTA 4B08A 2W25A 3W61A 1U1MA 1SIZA 2FLPA 3R5AA 4NLGA 1NKBA 3PYFA 4JV1A 2ZBRA 3O6QA 4LFBJ 1N5VA 2C3YA 3LGMA 2GVDB 3L7UA 3H4DA 2CPEA 2ZHAA 1S7HA 3FSYA 1L3SA 3HMJG 2KFYA 1RZMA 3V6DA 1LK5A 5T41A 3C46A 2CPYA 3CJ4A 3FK4A 4JI7J 2RUSA 2HKEA 3CJRA 4FVCA 4X62J 4A8YA 4DR5F 4DV0J 3D1OA 1RHUB 4IKAA 4LBHA 3PY8A 1DFDA 5AE1A 2ZM6J 4USJC 5B0BA 4Q8FA 2HWIA 5LXRA 2CNOB 2VB6A 2ZEJA 3CDAA 4FZVA 5E5NA 5JUMA 2DNYA 1TZ0A 1Z4UA 5LMNJ 2HFSA 3SSSA 4DV5F 3ZTSA 4F8RA 1NDCA 4UUXA 1FVQA 2M5YA 1EAYC 2LLZA 2UXDJ 1NK9A 1FXDA 4UQTA 1L3KA 2ADBA 3M4XA 4F04B 4F2SA 2ZE2B 2YVSA 5K8PA 2I1RA 3WHIA 5IQ6A 2GIFA 1U1LA 3ILJA 1FFGB 1C1CA 3DLGA 4BS2A 1FK9A 1U1RA 3NS6A 1FJ7A 1F5BA 3B54A 2HIYA 3RUBL 2KH9A 1RI7A 1WSRA 3ONQA 2OPQA 4HHHA 5HATA 1S5ZA 1U0HA 2DCUB 4ELUA 3OBIA 2HPUA 2VG5B 2CJ9A 2RF2B 4L72B 2HVEA 2KT5A 4ZVPB 1JNRB 4ZVQB 4F67A 5ETKA 3GIIA 5HP1A 2R8IA 4O44B 4FXWA 2Y0SD 1WELA 3TZXA 4PPDA 1XR5A 2IPOB 4DSFA 5IC4B 1W2BR 4JI2J 4FNHA 1RLCL 2EG2A 1X5OA 2BJ7A 2XSJA 4P7TA 3V4MA 5HBMB 4A47A 1ZAXA 4YB7A 3MEDA 3CT9A 1JLAB 3EVMA 3MPVA 2GHVC 2VA2A 3PRVA 2UVUA 4NRUA 3JS9A 4ECXA 2ZDPA 3QJLA 4DR4J 2FJBB 4IQXA 2D3OR 1CJKB 1HNZF 1Q1KA 3FQLA 4N7TA 5CQGA 4DPTA 2CJQA 3DGVA 3IN5A 4ZVRB 4ZKAA 3D66A 1XR6A 3DOLB 3LALA 4I2PA 4X65J 2VOPA 1REVB 1RQ0A 2DD8S 1FKAF 2QSFA 4DUZF 1RT5B 2ZH4A 1DTQA 1UCNA 2KVQE 2P6TA 2Y0BB 4LIWA 4MK8A 4IUFA 1S9EB 1EKRA 2QLWA 1X9MA 5E41A 2H51B 3UFCX 2C2EA 3KLHA 1YK9A 2B3TB 3OFEA 2H5IB 3EGWB 1H74A 4LR7A 1RT1A 5KT4A 4NLVA 2VBYA 2HLTA 3M7VA 5J2MA 2R3VA 5KFJA 5HQMA 1HYSA 4H4MB 5CYMB 3TOQA 2FPHX 1K8AT 2IRXA 1T8EA 2XBPA 4NX9A 5EHHA 3OFGA 3CD6S 2EC0A 3THPA 2C2MB 3BGFA 2XLJA 1BQNB 3T5HA 1HBUA 1HW8A 4YR0A 1D1UA 4ZS6A 3KLIA 4NE9C 2YWWA 1N33F 3F41A 3RJMB 2VDHA 2XWYA 3A3OB 3DOMA 3PFOA 4KGKA 4DZDA 4YY3J 2HQCA 3BQ0A 3TUIC 4FS2A 2XY7A 4RNOA 2Y3YA 3X1LB 4D3GA 3GYNA 3Q8VA 2GVDA 3ETOA 4OLPA 3GYXB 3JQJA 4OHWA 2G1HA 1KQKA 4Q8EA 2KZMA 3TQEA 1WKJA 4MK9A 4PKDB 2ZE2A 1R0AB 4X4QA 3I82A 3ZTOA 3TUJC 1Q78A 1RTIA 1FKPA 1MN7A 2QX0A 1SKWA 4NLXA 2C1EB 2FIUA 4ZP8A 2LEBA 2UXCJ 2PSZA 1G6BA 1RGVA 2E1MC 3OSNA 3M30A 1V6HA 3JAMY 3J7Z5 2ASDA 3NNCA 1X4CA 4BC7A 3UD4P 2AD9A 2ALZA 1VC5A 3R8YA 1T9YA 3D2WA 3BO4A 3NL0A 1C2PA 5KFQA 2RDDA 1I51B 5DZ7A 1VRQC 5CYJA 2XI2A 1HBMB 2FQQB 3TJ8A 2YNIA 4KGVB 2D3O1 3BO3A 3KHHA 3S8SA 3JSBA 1SJ4P 3OVBA 2BE9B 3HHLD 5KG1A 4PRFA 1VQ9S 1Q95G 4M5GA 3M9NB 3TVYA 4LF9J 4TU7A 2M8HA 3I96A 2GX8A 3CD0A 4KYZA 4JI1F 4C3LA 4DWIA 2AKWB 1U6FA 1BC6A 1B99A 4V1Ak 3US5A 2DXDA 4CH1A 4F0KA 2W7PA 3DRRB 4B3MJ 2J7WA 2IJRA 4ZCKA 5HVGA 1AW0A 1HI0P 5BYQA 2R42A 4NCBA 1RACB 4G1IA 1WF1A 5A2QU 2VIHA 5A8KA 1S1VA 2CJKA 4JI1J 1MN9A 1S4FA 2DGVA 2GS8A 2LEAA 3EGVA 3MM8B 4HLBA 5GAHI 3DN9A 2CJYB 2J9CA 4KGMA 3K17A 1G1XA 2B8PA 5KFKA 1DLOA 1JKHA 5D4PA 4WFAQ 2UUAF 1TELA 5CD4A 1LEOA 3NMRA 2AEJA 2HZCA 3C15B 3GIRA 5HROB 1RU1A 1FRIA 5F8LA 1NZAA 2OPSA 3POTB 1F3FA 5C2CA 6FD1A 4DF4A 4I2QB 2DO0A 1RWUA 4WTYA 4X4RA 2ZD1A 4X2BA 2BA9A 1U6ZA 1NDKA 1TUVA 1W7WA 3PG9A 2IHR1 2W2MP 4M5LA 2J6UA 4OLOA 2M7SA 3ENVA 3ZZTA 1FX2A 3O8WA 3TAMA 2JC1A 4PXEA 5K20B 4DMZA 5I42B 1VOMA 1N32J 3CJQA 2EFNA 2BE2A 1QTMA 2DNOA 3QFWA 5GAHU 1YJTA 4IO1A 2MKCA 4R0JA 1JJ2R 3D7SB 5LOQA 4CI0B 4OJ3A 1JLBB 4TY9A 1IUJA 2N3LA 4ED5A 1HYSB 4KO0A 1QAXA 2GO8A 1PILA 4DR7J 2QYGA 3OL6A 2DYAA 4WXWA 5E33A 3ZFVA 3H2VE 1S6QB 4OI2A 5D0RA 4Q5VA 4LF8F 1JK9B 1APSA 3QGGA 3GJSB 1TFYA 3MOZA 3MMAA 5A6WA 1K1QA 2N7YA 1YZ7A 4N77A 4AT1B 3D1QA 4USHA 4UOHA 1S76D 3AD9C 3VR1A 2J7KA 1IR1A 1K1SA 1EQMA 1U1OA 1J27A 2XSJB 5HBMA 1WWHA 4P10A 4IO9Q 3QT8A 5KG4A 4ECUA 1I3OB 1QAJA 1VGYA 3E01A 1URRA 4WXOA 4BLGA 3AB2B 3CMQA 1HBMA 2VG6A 3MF5A 4OZLA 3JYTA 3IAS9 2FHKA 3KJNB 3UCZP 1WSVA 1RWVB 2QC3A 4YHHF 1A9NB 1REGX 1KKHA 3HHKA 1TKTB 3MEKA 1BLUA 3R5CA 5CAAA 1N4LA 2FJVA 3PO5A 2BJEA 3RBEA 5LXYA 4ZVEA 2V4QA 2DPJA 2UUBF 3MD1A 2OAUA 3BZQA 1ITPA 3CC2S 3MGJA 3M8QA 3OR2A 3OTDA 4RW9A 4TLRA 5HJXA 2MQOA 2ZWPA 4F4ZA 1FK9B 4B3TF 4JV5F 1PJ7A 4P73A 4CQ1A 5LMUJ 1U1QA 1FESA 2W7AA 1QUVA 2C42A 2FY8A 3JTOA 4FF4A 1GQEA 2BKPA 4XPCA 2M0GB 1X5SA 2PEHA 3AXKA 4NLQA 3EZOA 4PYDA 4OX6A 1KQFB 1GXUA 2HGLA 3I0SB 1JLQA 2W01A 5D8HB 1FXRA 2CRLA 2W2OP 3MM6B 3TZWA 4C48A 1JLGA 2AJFE 2DH8A 2ROGA 4GC7A 1ZM3A 2AIRB 2OO4A 1Z2ZA 1T9WA 3NY0A 3VZHA 5KFNA 5KG2A 4H4OB 2DXFA 3OTOJ 3HPOA 4NA3A 1CEZA 3BR9A 4C97A 3O44A 4A8WA 3AODA 2CQ2A 3D6HB 4OI6A 5GMDA 3EX7B 1DARA 1MWZA 4OHZA 3HK2A 3HHEA 4LSZB 3JTPA 5KFLA 2MKYA 3QBCA 2W2PP 2MB0B 2R8GA 2VFUA 3IMQJ 4NOHA 1M5HA 3A8IA 4X4PA 1GX5A 3VAKA 1TKZB 2VV5A 3UDEA 2VQFJ 2IBKA 2UXDF 1W26A 2XO7A 3OJSA 3QT5A 3BO2A 4RWXA 1XJWB 1DTQB 3HHLA 1WHVA 2XMKA 2RIJA 3UR0A 3IR7B 4TQSA 1HPZA 4FDFA 3GIJA 4U7UK 4QZVB 1RAJA 2VJVA 3A3PB 2C28A 3TA0A 1RJJA 2VASA 1KHVA 3Q8YA 1KVIA 2MJUA 2OFGX 1I6JA 3BGRA 2W1BA 5JMNA 3L9ZA 2FC9A 2B7CB 2MSSA 1UW9A 5G0RB 1N88A 3TZZA 4JI7F 3PW5A 1UA1A 1WEYA 2JFKA 1NO8A 1QTNB 1Z1ZA 2WONA 2XHCA 4I64A 4IDKB 4AL5A 3LO3A 1Y0HA 2OTJS 1VJQA 3RRHA 4PG6A 3EXYA 4UOFA 2ASLA 1X0PA 4LFBF 3O2IA 2GCFA 3C6TA 1F6TA 4EO8A 4B9LA 3G86A 2FHJA 4TLQA 4LBIA 2R7WA 2DNHA 1KRPA 1HNXF 4HH0A 1Q4RA 2QV6A 4R8UA 3VTIA 4U95A 3HM9A 2HHXA 4DL6A 2K3KA 4RKUC 4NZ6A 4MKYA 2GZOA 4Z2XA 2OIHA 1RTHB 1R0CB 3DM2A 1CJTB 1Q0NA 4O23A 1VCTA 4OYZA 1RCXB 2QO3A 5DLFA 2ATCB 1GTEA 3V81B 4J9KA 1VC6A 3D9BA 3KDNA 2FB0A 3ZXWA 3MXHP 4GVLA 1UEKA 4D3HA 4G1QB 1FWPA 1T9UA 3C15A 2OMLA 5HROA 2GJFA 3ADAC 3TJ9A 3EPGA 3LP1A 1LWEB 4QR2A 4C11A 2QEXS 4EWTA 2Q66A 5IS2A 3V5RA 1IN0A 4YOEA 4U8VA 2D9OA 4O3PA 2AJ4A 2V8HA 4OJGA 4TN2A 2QMXA 4A8MP 2NQPA 4I7FA 3MOJB 2RHQB 2Z2MA 1KNZA 2HVDA 3Q8PB 3NWGA 3N28A 3AXMA 2CUYA 4J7CA 2VFTA 4IH6A 3OV7A 2KG1A 3MR3A 3AJ1A 4BDPA 5B09A 2AWZA 1U1KA 4IFVB 1T9TA 3BBCA 3DYAA 3M32B 4KPCA 3UQSA 5CABA 3OTOF 4PXBA 2F4VJ 2BJ9A 1UP1A 4CWBA 3FVYA 3D0IE 4ATNA 5IT9Y 1SC4B 1QUPA 1Y00A 3BB5A 3DHXA 3EXCX 4RBTA 2J6SA 4N47A 1O6XA 1XK8A 1I1GA 4A8KA 2UVVA 1UMJA 1UZDA 3QIDA 4PPZA 3CDEA 4HVZA 4AE5A 2ZVSA 4NZ0A 2SXLA 1W2IA 3VAGA 2NPIA 3R5JB 2L41A 5H9FJ 3I0SA 4CO2A 1FF2A 1WG5A 2NSBA 3JQMA 3PHEA 2R9LA 4KHPF 2BACA 3UCUP 1BHNA 1X0FA 5KFGA 3G87A 1H73A 2LQ8A 2EKNA 4M5DA 4N5SA 2YKMB 1XWLA 2HG4A 5B0EA 2UUBJ 1M1GA 4F0MA 3OHAA 4GVBB 2AQ4A 2IA0A 2MQ8A 2HS0A 1M5VC 3P4UB 5G0RA 3ENAA 1UPPA 4Y2CA 2XMVA 1Y7PA 5DO2A 2XGPA 5I3UA 2NREA 1J5OB 3K5OA 4QYZJ 1FA0A 1RT7B 4CLSA 5DJBA 4IRKA 5ETRA 1YTYA 4EO6A 4DFJA 3R97A 4DU7A 2KO1A 2OPPB 3EVOA 3RW7A 3BSNA 4DX5A 2FVPA 4PYAA 1UVNA 1GH8A 2ZH2A 4DV4J 3HI9A 2CZVC 1FNOA 2KRRA 4AL6A 1WG4A 2LFVA 3HDSA 3MURP 1WF2A 4X4SA 3OXGA 2RJZA 2XB2D 3GFXA 2MLYA 5FDLA 2WCXA 2BBEA 2AF6A 4CIOA 2W9BB 2H1YA 4DV7J 2RQKA 4C8LA 5D0HA 4DBQA 1FT8A 4EMDA 3C16B 4ECVA 3G8TA 1WACA 4IH7A 1ELOA 4YB6A 3CULA 2HBZB 5LT5A 3BGOP 5KFIA 3CCUS 4DV6F 2RT3A 2F63A 4M5MA 3D1HA 2EFVA 2CYYA 4YDDB 2HHUA 4ZPTR 4PABA 1SQEA 1X7VA 2G2YA 4OV6A 3V4IA 3H25A 5DG7A 3V6HA 1GMWA 2AZ3A 3FSXA 3LTOA 2KRBA 3M8QB 4DX7A 2QL7B 3IBWA 2ZH8A 1Q8BA 5E7OB 2OFHX 2BABA 1BGXT 2X1GA 1NB2A 4QR0A 2MDAA 2CQ0A 2K8GA 4ICLB 5L38A 3PXGa 5A6PA 4ECRA 4KTQA 4CLTA 2HHTA 3GJRB 2DRDA 4ZCLA 3UDCA 4WIQA 2UXBF 9ATCB 4ZDNA 3BQ2A 2DHGA 3B78A 2ZH3A 2MLXA 2ZHBA 4RW4A 2ILYA 3PEHA 2MZRA 3F0NA 2CWKA 3LWMA 2CXEA 2HLUA 3OPKA 4DS5A 4ZPDA 5HI7A 4PG8A 2B4OA 4PG7A 1LOUA 3LAMA 3LP0B 3OR2B 4RW9B 4CM0A 4YEAA 5CCLA 4ZK7M 3Q8SB 1T05B 4OL8A 3ENWA 4I67A 4FYDA 4WF9Q 4PWUA 2DR6A 2W8LA 3DRPB 1LW0A 2CQ3A 3H5SA 2E1RA 2CQBA 2NR0A 1IWAA 1CJUB 1NLKL 1SJRA 2V8GA 1R6YA 3QPIA 2C2DA 1MU2B 1FERA 3HVTB 1SL0A 1S10A 5KT6A 1NJXA 2XY6A 2XULA 3HCXA 4DR1J 2OEJA 3T1HF 3IG1A 4X4UA 4U7UD 1OPZA 5B0CA 4LF9F 1K0TA 5KFUA 1TV6B 1LKZA 4OHXA 2RH3A 5DG8A 2Q1LA 1PKUA 2U2FA 3O3LA 1DBDA 1SC1B 5E3QA 2CAJA 2R7QA 5B08A 1U26A 3NGKA 1IBMF 4C9DA 5CH7B 2E5LF 2F8HA 1B0PA 1MW7A 1FD8A 1N5QA 3ILLA 2OP5A 1N5YA 3MCSA 1NHKL 1NK4A 1HWIA 2UXCF 1N0UA 2K1RA 1U2CA 2QLBB 1K47A 2VC0A 1TKXB 2CVEA 3LPEA 3SXLA 3P5TL 4OFZA 3TVKA 1C4AA 1VRUA 1BQMB 1O8BA 4I68A 4KC5A 3MFIA 4LRFA 3MM7B 5D4LA 4QWCA 3I55S 2HNZA 1G3OA 3KK2A 4NXNF 1NEEA 1RE1B 3TO8A 1RTDA 2E7VA 2GIRA 2QZ8A 2Y1IA 2GNKA 5CYQA 1BMQB 2W9CB 4J9MA 2H4YB 4ALZA 4NA1A 4CNYA 3B4MA 3IWXA 3FRZA 5EUHA 2BOPA 1N33J 4ZOSA 3I5AA 4RPFA 1UVJA 2IM2A 1RISA 2CZ9A 1RP5A 2VPZB 3KG0A 1YJ9S 2PFDA 3DGPA 3CCJS 2M52A 4K2JA 1IBLF 1KVJA 4P75A 1FCAA 2MZSA 3AD7C 2AYBA 1H2VZ 1CS4A 3GFHA 3R9LA 5AXMA 1HNWJ 1X4GA 3AA9A 1P6TA 1RBLA 1HKAA 1ZS6A 3M9MB 2VPXB 2FVCA 2P8IA 1HNIB 2IJFA 3MM9A 3MM5A 4HH1A 2B8QA 4WBFA 4CLFA 4BWJA 2XGQA 5IWAJ 4IG3B 2QA1A 3IR6B 3IS9A 1NCLA 2DR7A 3KHRA 2D74B 2FJAB 2ZJQQ 1NUEA 2YX4A 2ZJRQ 1HL6A 1P1TA 4JI3J 4UOCA 1SH0A 5JJBA 2BJ1A 2FZCB 1OYDA 3MMBA 4I0WA 1HQUB 1XTZA 4C8YA 1EETB 3NCQA 3TEGA 2NS1B 4DUZJ 4DL5A 4ZVFA 4B9TA 3N01A 3NNHA 2G4BA 4ES1A 4N56A 2V63A 4ID5A 3BGUA 1XNRJ 3QZ7A 2JEGA 2MZJA 1T0TV 3E3XA 3ET6B 2YPZA 8AT1B 2BKNA 4RW7A 3SYZA 2A10A 2F65A 1H2TZ 2VPYB 4X84A 4K4UA 1RWOB 1YZ6A 2OSRA 2HW3A 4C6AA 1S1XB 3RRKA 3NGUA 1VK3A 3MHYA 3W5XA 3Q83A 4WZMA 2CIMA 2E1PA 1XMQF 2I2YA 2LU2A 2Y8YA 3C14B 5I4MA 2JHEA 2E7WA 2WVEA 2G0IA 1TL3A 3AH6A 4C8MA 2MXYA 4DR6J 2VKZG 2W9BA 1HBOA 2NYHA 1PGZA 3G6XA 3UVJA 5KFAA 3NEKA 1WHWA 1U1PA 2LXIA 2M8DB 1RXOB 3KTQA 1FRXA 3MMCB 1AFIA 1XERA 3C16A 1NH7A 1RHKB 4TVAB 2YBVA 3LANA 3NGTA 2AYMA 3GFYA 2MGZB 4C3MA 2YKQA 2OPPA 4YUDA 1M5PC 2DITA 1SPBP 5C24A 2AP6A 3ZTRA 4F3MA 4QPXA 3M9OB 1TV6A 2D7SA 2M2BA 1XMBA 4EZ9A 3CDUA 2D9PA 3D5MA 2J6TA 3Q24A 3BKUA 4ED2A 2CPXA 1WTBA 2WVCA 2RKIB 2R7SA 3FZ2A 5CYQB 2C22A 4QYZK 2WW8A 5FDLB 1FI4A 5LMNF 4RL1A 4B17A 1LFPA 2GAGC 3W64A 3UO0A 1GXLA 1CVJA 2IY5B 5KG0A 1D8YA 4X64F 5IT4A 1YITS 2NXJA 2C3UA 1LW2B 5A2QY 1KFDA 2EK6A 3VF0B 2KG0A 3U1LA 3DI6B 4LSLA 1Y5NB 4FS1A 1S0NA 2PT0A 2HHQA 3UNYA 3W5YA 2XNRA 4NZ7A 3I6PA 3VGVA 2HVHA 1X4DA 5IV4A 4X4VA 1NPRA 1YJWS 1LV5A 3ITHB 5C2GA 2DNKA 1EP4A 2E5HA 4CLLA 2HNZB 2I8EA 3KK2B 1RHMB 3ILIA 4KSEB 2YH1A 2BW2A 1YLXA 3FQKA 1UEVA 2W4CA 2VUGA 2ZC3A 1M1KT 1SH2A 2CG8A 2V5HG 3CJ3A 4MKAA 3CJSA 3G71S 1T05A 3BN7A 1B4SA 1RB0A 3KUGA 7AT1B 1JWWA 2V9KA 3W60A 1M5OC 2J0XA 4QIWD 4PUOB 1CC8A 3SCKE 1JLEB 3NAHA 3K5LA 4DSLA 3GIKA 3OFFA 3GP9A 4HEA9 4W4MA 2IJNA 1G7CB 3FCHA 4HHUA 1RWPB 1HD0A 2GGPB 4ZIWA 3PX0A 4NLWA 1N48A 2BRKA 1HWLA 1SV5A 4IQMA 4YP3A 3QWUA 2Y8WA 4IFYA 4ZMMA 2DKOB 4ECTA 1F9HA 2JFDA 3NBPB 3V4IB 5HANA 4JI6F 2FYXA 3BR8A 2AX1A 1UVLA 4ZPVR 2MLZA 2Z0GA 2UV8A 3O5TB 4QR1A 4USKA 1WC3A 3SQGB 5HMWA 4CDIA 3BSOA 2XY5A 2C3PA 2C2ZB 2IRYA 3DU5A 2OJ3A 1UFLA 3DHWC 1A0OB 4O44A 3ZZRA 3PW0A 2RRAA 1O5JA 4JI5J 3SV4A 1TP7A 3CCZA 2E1CA 2MHNA 3ULHA 3TVZA 1LWXA 2YWHA 3MD3A 4JBCA 4YMEA 4ED7A 2XTJP 3KNGA 5JXSA 3PFEA 1IBKJ 4QWAA 1HIYA 4QOTA 2HEKA 1FNXH 2NZCA 2J0SD 4GKJF 4RUAA 1IVZA 1H7WA 1NNDA 2P6SA 2I38A 2E9ZA 2D1CA 3GZ7A 1J5EF 1IM6A 5IZHA 3P96A 4RJVA 5HL7Q 2LXFA 3IFEA 4RUBA 3UR3C 3ZNJ1 4EGLA 3OR1A 4CCHA 4A8XA 2ABYA 1RTIB 4O4RA 4W92B 1UAWA 2H9ZA 1VFJA 3NRBA 2VODA 3LWLA 4X66F 3F56A 3JB9k 3CXCR 4P7VA 1BUXA 5E3AA 1HQEA 4X4TA 1WOSA 2YH0A 4J5OA 4IR1A 3CJTA 2X1FA 4YDXA 4F4XA 3A12A 1Q8KA 2BE7D 5C7PA 3MM7A 3OHBA 4ZVHA 3AD8C 1YJUA 1WNEA 1FHTA 4HKQA 2FVSA 2HFZA 3U1MA 4OX9J 1MMNA 4B9UA 4DL3A 2Z2LA 4ENOA 2C2RA 1BQNA 2JZ5A 4NYZA 1AXQA 2X51A 3CCMS 2JH3A 5KT5A 2MGZA 4LF4J 2KFNA 2JVOA 3H20A 2AMCB 3BM7A 2HRYA 2DHSA 3TW0A 4USVA 1Q7YT 4B3OA 2IVMA 3M2UB 2NSCA 4KGXB 2V8DA 2F4VF 1IR2A 2AX0A 3E8OA 3DGPB 3QIPB 4Y34A 3NNAA 2AGQA 2DR9A 2IA6A 3L7OA 5MLCV 2FGCA 4CTAB 2RQMA 2V2KA 5EX3A 4RBVA 5HJYA 4UW2A 4PQUA 3QRQA 1WC5A 2BQ3A 1ZPVA 2YNFB 2XC9A 3PO4A 3MEGA 1SXLA 1OY8A 4U8YA 4LF1A 2ERRA 2V67A 2V8VA 4ZITA 5HP1B 1H2UX 4RNMA 4C4WA 3IS9B 3QMQA 1GNKA 1V9OA 2VD3A 3QGHA 1T9XA 2AJ0A 3K2YA 1AZSB 3P8BB 2XCAA 4DV2J 4RZRA 1DAXA 3UDVA 1NDPA 5T7LA 2MKKA 2HNDA 1YWXA 3HKWA 1YBAA 4TNOA 5A0YA 2JEIA 5KFXA 1U09A 3R5BA 4F26A 3VAMA 5J1EA 5JVGQ 4G3IA 1S0VA 2AYEA 1FVSA 3NAIA 4IR9A 2DNQA 2EW9A 2LQ9A 2QFIA 3D6FB 1PYSB 3PR4A 5KFDA 4RW7B 1GMUA 5KFSA 1ZYQA 4KQZA 4QIEA 2F7VA 1T03B 2CVIA 2QLXA 4LF5J 2VC1A 3VWSA 2V2ZA 3R7BB 1PC4A 1UWAA 4UF4A 3UWTA 1FRLA 4F0HA 1KTQA 3KMQA 3DLKA 3QRPA 2YWKA 4L73A 4LQ9A 4LF7J 1HFEL 5H9EK 2W2NP 1KOOA 2PDAA 5B7WA 1F60B 3M2VB 3DXSX 2HRTA 4DG1A 3D4JA 2F9DA 2WAQD 4DL4A 4JV0A 3DLBA 3RG6A 3C3LA 2XS5A 4B3RF 1OIAA 2E5JA 1AFJA 3MTKA 2NCKL 2X1AA 3I0RA 2MKIA 2WB4A 3W8PA 3KJVA 2AZ1A 3MZIA 1EB0A 5LM7E 1DTTB 1RT6B 2FZGB 2HNYA 4MK7A 1U2FA 1EX8A 3P49B 1NZ8A 3M05A 4ILRA 3JAMU 1S59A 1P1LA 4WFZA 3U7JA 1NK8A 3IRXA 2A2CA 4B3SJ 1WC0A 1YDLA 3QSYB 1B0TA 1E6YA 1JLFB 3DU6A 4FKYA 4OYMA 2Q43A 1PBUA 1X5PA 4QBUA 3C66A 5KOXA 2ZJPQ 1KOHA 4LT6A 1NKCA 2G13A 3LAKA 2MZQA 1VQPS 2I6WA 2PGCA 3DI6A 4LSLB 1SJ3P 5F0WA 3OT9A 1X5TA 2YQ3A 2BANA 1CSJA 4QJVA 4PQUB 1UJ4A 2ZFHA 1EP4B 2HHWA 2IMOA 3WX4A 4HI2A 1SQGA 2LP4A 3IGNA 3MEGB 4PZVA 3I5CA 4A4JA 2UUCF 3CC4S 2DY9A 3N6NA 2QG9B 3BJYA 1VYAA 4IOCQ 1Y9OA 4B9SA 4LF2A 1XQIA 5AXLA 2BM0A 1Q8LA 2YWEA 2AEFA 4LRBA 5F8GA 1ROFA 1FKPB 4Y0FA 2FZKB 4DPYA 2K2PA 3HLUA 3A4TA 1Y10A 2H65B 2OPSB 1EKSA 2UZAA 1VQYA 3N4WA 3RBXA 2YQ1A 2QJ3A 5KFWA 3FMWA 4BCAA 4AFFA 1ZBTA 3KLEB 4QIVA 5IV3A 3T9NA 1KEKA 4ZHRB 3NWRA 4RU2A 3AA8A 1S48A 2N4CA 3N79A 4MIAA 4N8OA 2DVIA 4UY85 4OZ3A 1ZAWA 4Z37A 3W9JA 1KHWA 3H90A 4QU6A 3KLVA 3EJMA 3NG8A 3KUEA 4MKVA 2DNNA 2R7RA 2F8EX 2W2QP 4H4OA 2HQIA 3UNGC 2DR5A 2ALYB 1XNQJ 2HQGA 5ITHA 2B6AB 1HQEB 4X4OA 2FLOA 1RT3B 2WBRA 2RAQA 5DS7A 4ZP6A 1B70B 3FFIB 4GMKA 3SFGA 1UKUA 4CLZA 3T19A 3S6EA 5J2NB 3KFWX 4DPWA 3P6YC 4CO4A 1RBOB 3W7BA 4UOGA 3K5MA 1VLYA 2X3DA 5F3TA 3TEHB 4RBUA 3VGUA 5M2PA 3K58A 3Q23A 3AT1B 4EBCA 1S6QA 4DL2A 4NPOA 4RW6B 4O0NA 3H2LA 5DETA 2CNKB 3QZ8A 4B9VA 3UPFA 1FFSB 4F3QA 2M88A 3T41A 1B7FA 2PA3A 2E44A 3DKDA 4OZ5A 4NI2A 2CQIA 5L1IA 3ILOA 3M2RA 4GC6A 2Z30B 3A8EA 2M9KA 3RGIA 3TNVA 2RQ4A 2EFGA 3FBEA 3MEEA 3R7NB 2UVRA 2VONA 4DSKA 1RSCA 2ZZMA 4ZJQA 3G2XA 3J81U 3CMES 1AUSL 1IKVB 1WDTA 4KPYA 1LFWA 5D4NA 3HJVA 4P72A 4JB8B 2R7TA 1U7LA 3PKYA 1NSAA 3HD2A 2R4FA 2GJIA 3J7ZT 2HBQB 2V68A 4Q0BA 4DCOB 2IM0A 1UW4A 2B5JB 2BQRA 1HPZB 1P9QC
chains in the Genus database with same CATH topology
3KJFB 1BMQB 2P2CB 3KJQB 2H4YB 3GJTB 2DKOB 3P45B 2CNLB 3P4UB 1I51B 1GFWB 2FQQB 2C2ZB 1RHJB 1RHUB 3D6MB 3D6HB 2CNOB 2QLJB 4LSZB 5IC6B 3IBCB 1RWWB 2H5JB 1RHQB 1RWXB 1F9EB 1PAUB 3GJQB 4ZVTB 4ZVSB 2XZTB 1IBCB 2CJYB 3R6GB 2HBZB 2CDRB 1RWKB 2QL5B 4ZVPB 4ZVQB 1QTNB 4DCJB 3NS7B 1RWOB 2XZDB 5IC4B 3EDRB 1RWMB 2CNNB 2H65B 3EDQB 5K20B 3GJRB 4ZVRB 1RHKB 2CJXB 2HBRB 2Y0BB 2XYPB 2H51B 1RHRB 1RWNB 3IBFB 3R7SB 2H5IB 3GJSB 2C2KB 1SC3B 1I3OB 2CNKB 2C2MB 3R6LB 2HBYB 1QDUB 1SC1B 2XYHB 2XYGB 2QL9B 1PYOB 3KJNB 2C2OB 1RWVB 1SC4B 2H48B 4ZVOB 3RJMB 2Y1LB 1RHMB 2H54B 3D6FB 3R7NB 2QLFB 2H4WB 4DCPB 1NMEB 2QLBB 3R5JB 4ZVUB 3R7BB 4JB8B 3SIPB 1ICEB 2HBQB 3QNWB 4DCOB 1RE1B 2QL7B 2C1EB 1RWPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJF B;  1BMQ B;  2P2C B;  3KJQ B;  2H4Y B;  3GJT B;  2DKO B;  3P45 B;  2CNL B;  3P4U B;  1I51 B;  1GFW B;  2FQQ B;  2C2Z B;  1RHJ B;  1RHU B;  3D6M B;  3D6H B;  2CNO B;  2QLJ B;  4LSZ B;  5IC6 B;  3IBC B;  1RWW B;  2H5J B;  1RHQ B;  1RWX B;  1F9E B;  1PAU B;  3GJQ B;  4ZVT B;  4ZVS B;  2XZT B;  1IBC B;  2CJY B;  3R6G B;  2HBZ B;  2CDR B;  1RWK B;  2QL5 B;  4ZVP B;  4ZVQ B;  1QTN B;  4DCJ B;  3NS7 B;  1RWO B;  2XZD B;  5IC4 B;  3EDR B;  1RWM B;  2CNN B;  2H65 B;  3EDQ B;  5K20 B;  3GJR B;  4ZVR B;  1RHK B;  2CJX B;  2HBR B;  2Y0B B;  2XYP B;  2H51 B;  1RHR B;  1RWN B;  3IBF B;  3R7S B;  2H5I B;  3GJS B;  2C2K B;  1SC3 B;  1I3O B;  2CNK B;  2C2M B;  3R6L B;  2HBY B;  1QDU B;  1SC1 B;  2XYH B;  2XYG B;  2QL9 B;  1PYO B;  3KJN B;  2C2O B;  1RWV B;  1SC4 B;  2H48 B;  4ZVO B;  3RJM B;  2Y1L B;  1RHM B;  2H54 B;  3D6F B;  3R7N B;  2QLF B;  2H4W B;  4DCP B;  1NME B;  2QLB B;  3R5J B;  4ZVU B;  3R7B B;  4JB8 B;  3SIP B;  1ICE B;  2HBQ B;  3QNW B;  4DCO B;  1RE1 B;  2QL7 B;  2C1E B;  1RWP B; 
#chains in the Genus database with same CATH topology
 2CPI A;  2BAN B;  2QT7 A;  1YSJ A;  1RKI A;  1CQN A;  2GA7 A;  3M2U A;  4ZIV A;  1BWV A;  3TUZ C;  1NK7 A;  1U6B A;  2R7X A;  2BEF A;  1R27 B;  3A8K A;  1Y3K A;  1TL5 A;  4RO0 A;  4CO5 A;  1FDD A;  2L08 A;  1WC1 A;  2X1B A;  5GAG I;  1S6P A;  5KFY A;  4E2F B;  2B9W A;  3ETM A;  2GQ2 A;  5J2Q B;  2VOO A;  2VBX A;  2ZOM A;  3JYT B;  1UVK A;  3UN2 A;  2VHG A;  1U0S A;  3MAH A;  2YNF A;  1NJZ A;  4IFV A;  4Q2L A;  1KWM A;  3PIP Q;  4KH0 B;  4BBY A;  1SVD A;  4BWM A;  1RYR A;  5HN0 A;  2NXC A;  2UUT A;  1C1C B;  1OS5 A;  2CQ4 A;  2VG7 A;  4USU A;  3PYD A;  1HW9 A;  4NYO A;  5B0F A;  1WHX A;  2X7I A;  2VF3 A;  5HLF A;  4PWW A;  3GCX P;  3Q2S C;  4XTT A;  4DQQ A;  1JNZ B;  1TKD A;  4O3N A;  1VQ5 S;  4M94 A;  3AQO A;  4IG0 B;  1S1T B;  1FX4 A;  1ZA1 B;  1D09 B;  1IBK F;  1MRO B;  1KLM B;  2OI2 A;  3I5B A;  2J9D A;  4ETZ A;  2WON B;  3BYP A;  3QYY A;  2CKW A;  2HHH J;  1CJV B;  3QRR A;  2ZKT A;  1GTH A;  5AJ3 J;  3I56 S;  1IJF B;  5AE3 A;  1DHM A;  2YKM A;  1TKZ A;  5KT7 A;  3HHL C;  2IYI A;  3CCV S;  3T5J A;  2ZH5 A;  1FJE B;  1E6V A;  5KG3 A;  4P2F A;  4J9O A;  1X4B A;  5EDW A;  3TQ1 A;  1NJI T;  2PFF B;  2YQ0 A;  3AOC A;  1LWF A;  2AJ2 A;  3G6V A;  4FXV A;  1ZTW A;  3PNI A;  1T03 A;  2BVZ A;  3D3B J;  2VZ9 A;  4GO7 X;  1URN A;  4QWE A;  3M6U A;  3GMG A;  4M5H A;  3TA2 A;  1U47 A;  4K5R A;  4ZPW R;  5CCM A;  4U9R A;  3GV7 B;  3LF0 A;  3BS9 A;  2VH7 A;  3W62 A;  2NXE A;  1HWU A;  2NUU G;  3T9Z A;  3KG4 A;  4QQB A;  3AAW B;  4ECY A;  3SQO P;  1U48 A;  4RUH A;  3DYA B;  3LGH A;  3D0H E;  1HNV A;  1S99 A;  1VQ8 S;  5CHC B;  1JLQ B;  2DNZ A;  1IM4 A;  3AB4 B;  4K5S A;  2GIQ A;  2XNQ A;  4F3O A;  4NXM J;  1KQS R;  1VBX A;  2GHP A;  2IYG A;  4QW9 A;  3OUY A;  4LFA J;  3OL8 A;  1MWY A;  1VIS A;  2YX1 A;  3ZO7 A;  2AU0 A;  5AJ3 F;  1TK8 A;  1RAH B;  3MEC B;  3EIC A;  3FFI A;  5IFM A;  1N6Q B;  1HD1 A;  5H9E J;  5ETO A;  2GQQ A;  3VZI A;  3HT3 A;  3IO1 A;  4P71 A;  1RTZ A;  5C25 A;  4R8U B;  1KVK A;  1UPM B;  3TAQ A;  2WOM B;  2ZNZ A;  5DLG A;  3HHN B;  4LRE A;  3T5K A;  3NCP A;  3IWN C;  1OMS A;  2JJ4 D;  2VFR A;  5E3R A;  5F41 A;  3JTN A;  1UET A;  2V50 A;  1AUD A;  2LQ5 A;  3OLB A;  2KM8 B;  1ZTT A;  1NPP A;  4XO0 A;  1RTJ A;  3HT0 A;  1VR6 A;  4Z7Y A;  5KFC A;  4EYI B;  4HTJ A;  1Q53 A;  4F02 A;  4R5P B;  3M8W A;  1KD1 T;  1MNE A;  3DOM B;  3JSM B;  4RWW A;  2Y9H A;  1N56 A;  3OTC A;  3PRD A;  3KG1 A;  3X3U A;  1YJV A;  2HBY B;  3L7P A;  2R7O A;  1WDD A;  4KV8 A;  3VV2 B;  3TAR A;  4OYB A;  3FGV A;  1HHT P;  2C2O B;  2DGS A;  2FJX A;  4OV1 A;  1FKO A;  2HAI A;  1XEZ A;  4DR2 F;  1E6Y B;  1JLF A;  3AOA A;  4J90 A;  1SL2 A;  3GFZ A;  5ETP A;  3G82 B;  3J7A 1;  1QE1 B;  1UL3 A;  4C98 A;  2KJW A;  2IC3 A;  1KR4 A;  5HLF B;  4CTA A;  5H9F K;  1LNQ A;  1MWQ A;  4FF1 A;  1R8H A;  2W4P A;  4KHM A;  3VGT A;  1R8A A;  2HMI B;  2Z2Y B;  4USM A;  5D3G A;  5ETQ A;  5HVF A;  4FPR A;  2XI3 A;  2BYC A;  3PW2 A;  4ES2 A;  1X4E A;  2ROE A;  2LA6 A;  4PG5 A;  5B0D A;  5HMZ A;  3A3N B;  2QA4 S;  1ZM2 A;  1NHV A;  5EWF A;  2GVZ A;  1JLC B;  2VG7 B;  2EEY A;  4RW6 A;  4CP5 A;  1V5I B;  3BV8 A;  5IOL A;  2K06 A;  1RHJ B;  2YKP A;  2FVQ A;  1O51 A;  2EWH A;  2OPR A;  2ZBI A;  3B4D A;  4A48 A;  1VIO A;  3GSD A;  1FRK A;  2F9J A;  1P27 B;  1JLA A;  1ZA2 B;  2OEK A;  3K57 A;  1KLM A;  1FRM A;  3CCW A;  2HQD A;  1ZH5 A;  2RIL A;  4KHR A;  1WOO A;  2ZBQ A;  1IKW A;  1TUG B;  2YY3 A;  2KHD A;  3CJ5 A;  4USW A;  4WFN Q;  3ISN C;  2R2S A;  3KMS A;  2JL9 A;  1KP6 A;  1RWX B;  5F0U A;  2M4M A;  1JKH B;  3U27 A;  2B56 A;  3DRS A;  2VIC A;  3TX0 A;  2VBZ A;  1RAA B;  1U2R A;  4Q7A A;  3FEY B;  3POT A;  2RUG A;  1I5O B;  2AJ1 A;  4OYO A;  3DXB A;  4DR3 J;  4DPO A;  1NPK A;  2PA8 D;  1RUS A;  2QMU B;  1U02 A;  1C1B B;  4DV3 J;  4WE1 B;  2YKN A;  1HNW F;  5DG9 A;  5K14 A;  1S0O A;  2WOM A;  3DC2 A;  2Q6B A;  1SBR A;  2CA9 A;  3GTY X;  1FE4 A;  3EVW A;  3KLF B;  2M3D A;  2HWH A;  2HVZ A;  3I0R B;  3KJV B;  3QWP A;  1H6K X;  3OQ2 A;  3NS7 B;  3L09 A;  1YVF A;  2DHA A;  4LSN A;  4OJH A;  5IQQ A;  4TU8 A;  1NM2 A;  1VC0 A;  1F2H A;  1U8W A;  2VBW A;  5LSL A;  3I9V 9;  2UV8 G;  3IP0 A;  1F5C A;  4A8S A;  1M0S A;  1LXN A;  4JI0 J;  1ZPW X;  2J8A A;  2QE5 A;  3GG0 A;  3JXO A;  3MEC A;  4Y2I A;  3KK3 B;  4RNN A;  4I6A A;  3VAL A;  2FUG 9;  2XSF A;  4FNI A;  4HAC A;  2JX2 A;  4KFB A;  2VQE J;  2UUC J;  2LKZ A;  1EJ7 L;  3DLL Q;  1QLN A;  1U25 A;  2BMB A;  1KN6 A;  4F25 A;  3LGN A;  3QAU A;  4LF6 F;  1FKO B;  1QD1 A;  2L3M A;  1YRX A;  3KWM A;  3CCQ S;  4WKR A;  3RTV A;  5D0G A;  2KZZ A;  3MUM P;  4YQW A;  1RT4 B;  2A0F B;  4HTI A;  4WP3 A;  1VBY A;  5HSP A;  1H7X A;  1OSC A;  4WKY A;  3TZY A;  1D9A A;  2L9D A;  2IVF B;  5G4D A;  3TAP A;  4Y00 A;  1Q81 T;  3I32 A;  3W3S A;  1BQM A;  4O3S A;  1DUR A;  4JI8 J;  4OX7 A;  2JSX A;  2PMH A;  3NLC A;  4EK2 A;  1NSQ A;  3T1Y J;  2MQQ A;  4LBP A;  3WIV A;  4WWS A;  1BE4 A;  3DRR A;  3PIO Q;  3K59 A;  3FKB A;  3I4P A;  4K4Y A;  3VVU A;  4B3S F;  1PO6 A;  2Q3P A;  5K8N A;  4IG0 A;  5KFT A;  3CD7 A;  4WTO B;  1FRJ A;  2HRU A;  3MDF A;  4G6V B;  3NGS A;  1CUL A;  3DOK A;  3U02 A;  3GLJ A;  5A8W A;  2CAD A;  5L39 A;  2HYI B;  1M1H A;  2YNG A;  5L9X A;  4J9V A;  2B9Y A;  4EYH B;  1QDU B;  3BEG B;  2IC3 B;  3MED B;  4DV1 F;  1RLD A;  2XYH B;  4YB5 A;  1YJR A;  1H3D A;  1FJC A;  3MR2 A;  3IWL A;  1VRU B;  3LOU A;  2PEB A;  1U0H B;  3HSG A;  2DGQ A;  3CMA S;  4ECQ A;  3UD3 P;  4H4K C;  4B3R J;  3SV3 A;  3W63 A;  4XPE A;  1JJ4 A;  1RAD B;  1PJ5 A;  2O67 A;  1NXI A;  2QLF B;  2RRN A;  3KXD A;  4ZA1 A;  4I2P B;  3TAN A;  4WU3 A;  1FD2 A;  1SKS A;  1RA7 A;  4NWB A;  2HQF A;  1O0P A;  4URS A;  4IH5 A;  1QSS A;  3UN3 A;  4XDD A;  4USI A;  1GAO A;  2BX6 A;  2CPZ A;  3SIP B;  3GV5 B;  1S9G B;  4DU8 A;  1SUQ A;  2HZA A;  1VQ7 S;  4OYP A;  5C42 B;  2DHH A;  4LF5 F;  4O3R A;  2JWN A;  3R3T A;  4PXD A;  4FXD A;  2KHC A;  1S12 A;  4NEY A;  3S1T A;  1M5S A;  4Y6I A;  5KFV A;  4ETX A;  2XQC A;  2P2C B;  3KJQ B;  1WUU A;  2WBM A;  5DDQ C;  2V4R A;  3IG1 B;  4EBD A;  2FLL A;  4GKK J;  2PE8 A;  1LWF B;  3BSA A;  3JSM A;  1NK6 A;  1X8D A;  1RU2 A;  5F8M A;  1S57 A;  4FP9 A;  1GFW B;  4LQ3 A;  2J8S A;  2ZD1 B;  3TA1 A;  5C25 B;  1Q8I A;  2QA4 G;  1LW0 B;  4Y2A A;  3CJK B;  1HBU B;  5KG5 A;  2UU9 F;  5BR8 F;  3DRS B;  3AJ2 A;  1VQM S;  2AEM A;  4MTP A;  4NI2 B;  3SDE A;  3I87 A;  3WZ0 A;  3DMJ B;  2B9E A;  3BF4 A;  2EI5 A;  1RWW B;  2LVW A;  1WF0 A;  3BSC A;  4DV7 F;  1FDA A;  2G9O A;  4LFC J;  4L74 A;  4KGZ B;  3PV8 A;  5ETV A;  3RB3 A;  2GO9 A;  3PX4 A;  1F9E B;  5K14 B;  5J2P A;  2EXU A;  3QO9 B;  2B51 A;  2EBG A;  3ZZP A;  3OLA A;  5L8R C;  3UD5 A;  1IKV A;  4LFC F;  4BC9 A;  4YR2 A;  3SMZ A;  1VRT A;  2CQP A;  4P2X A;  1UA0 A;  2XZT B;  4KO0 B;  4V19 J;  1VQS A;  3BKT A;  4U67 Q;  1RBA A;  1FWL A;  2FTR A;  3DLJ A;  2O3D A;  3CNQ P;  5BR8 J;  4UQG A;  2UU9 J;  3DDK A;  4Q2M A;  3M8P B;  2DEJ A;  1SI9 A;  1NBE B;  1ACM B;  4OI3 A;  4XK8 C;  1RA6 A;  4ED4 A;  2LA4 A;  3C6T B;  3MMA B;  1PYT A;  3J81 j;  2XMJ A;  1QE1 A;  2OUG A;  3MMJ A;  1WOP A;  1LQ9 A;  2J0W A;  2WSF C;  4DXL A;  3DFE A;  3QJP A;  1NSK L;  4ILM A;  4HAC B;  1EET A;  1CS4 B;  2ZUA A;  2YNI B;  2DNP A;  2MKH A;  1PSD A;  2YKO A;  1X9S A;  1N52 B;  1Q16 B;  1N34 F;  3GWC A;  3G9C A;  1TQL A;  2CQG A;  2RD5 C;  2VKR A;  3ZZY A;  4ED6 A;  2BOA A;  1IKW B;  4GO5 X;  4O0I A;  1TFW A;  2AJQ A;  3EDQ B;  3OTB A;  4MFB A;  3Q2T C;  4U6P A;  2E66 A;  5JVH Q;  1HBN A;  3Q89 A;  1WEX A;  2C3M A;  4X66 J;  4K4S A;  1T95 A;  3TR5 A;  1Q5Y A;  2RHS B;  1KTV A;  1NJY A;  1XBW A;  2IVY A;  2C3O A;  2VFV A;  1S1V B;  4KBI A;  3SCL E;  1CLF A;  3HZE A;  1TR0 A;  2YX7 A;  2HMI A;  1S0M A;  1UVM A;  4OQJ A;  3ENQ A;  4OZJ A;  3BH6 B;  3PCO B;  2V2Q A;  1UFK A;  2COL A;  5A8W B;  4P52 A;  2BRL A;  4ILL A;  1PCA A;  5ETL A;  1XR7 A;  3LW5 C;  3TP2 A;  1TVR B;  3RBZ A;  1N54 B;  3FSI A;  4GKJ J;  2C2K B;  2OD4 A;  4MYT A;  4OX8 A;  3H0P A;  1TAQ A;  3JSR A;  4CLY A;  1R8P A;  1JLG B;  3HZG A;  3MPY A;  3QJJ A;  4ZPB A;  5HO4 A;  1JX4 A;  2DNL A;  1CC7 A;  2CJB A;  3NS5 A;  2MQL A;  3HFZ B;  2K3I A;  3C14 A;  4TQR A;  3UN5 A;  1ARO P;  5A8K B;  1VIX A;  3MPD A;  2BUN A;  2YKN B;  3MM8 A;  4MYU A;  3ZTQ A;  4KFB B;  3CCR S;  5KFH A;  4CLW A;  4DX8 H;  1JIH A;  1HWJ A;  2PI5 A;  4MMO A;  3HJF A;  1DLO B;  2DT9 A;  6AT1 B;  4JI6 J;  2PD1 A;  1HNV B;  2Y1L B;  3FBB A;  1SB6 A;  3H8Y A;  3K8W A;  5GVQ A;  2DJW A;  2Y1R I;  3G4S S;  4LF6 J;  3RR8 A;  2ZZN A;  1HLW A;  1D9D A;  1KFS A;  1OY6 A;  2OD6 A;  4DCP B;  1UWB B;  4DFM A;  4OJ1 A;  1TTH B;  2RSQ A;  2VQE F;  1Y5L B;  4I1T A;  3QLH B;  5J2P B;  2KYZ A;  4N8N A;  3M6X A;  4DLG A;  1V3Z A;  2OEL A;  4ZPC A;  2MQP A;  3VQS A;  1AB8 A;  2QSW A;  3CDB A;  3LQV A;  3MUV P;  2HFV A;  2G1D A;  5DM7 Q;  2UP1 A;  4WE1 A;  5KTQ A;  3C6U A;  2W7O A;  2RVJ A;  1WI8 A;  4MKB A;  3GJT B;  3MWB A;  1ZM4 A;  3UCG A;  3EGN A;  4KB7 A;  1PJ6 A;  2XMM A;  3MCN A;  1AZS A;  1JLE A;  2CPF A;  3CJ8 A;  1HAR A;  1NAQ A;  4KY3 A;  3FNN A;  1A7G E;  1H98 A;  2CFX A;  1VK8 A;  4L6V 3;  4WP8 A;  4WCE Q;  5K9F A;  3QIP A;  1YIJ S;  1S77 D;  2N82 B;  3W2W B;  2DXE A;  2KB2 A;  5D4O A;  4ZN1 A;  1X31 C;  2VG6 B;  1TL1 A;  5U47 A;  4CYU B;  5KFM A;  1ZZF A;  3DLE B;  3KHL A;  4DR3 F;  4EUV A;  3R1L A;  2KT3 A;  2DB1 A;  3CE8 A;  4NML A;  3G8S A;  3IM8 A;  4J9L A;  1IKX B;  2H5J B;  5IT0 A;  3OD2 A;  1FRH A;  4RX6 A;  2VQF F;  3CJ0 A;  1RAG B;  2XG8 A;  2P9C A;  4C0O C;  5DQI A;  4DQR A;  5LSR A;  4P6Q A;  2D69 A;  2EVZ A;  4B3O B;  1MMD A;  1SJQ A;  5F9N A;  2PMZ D;  1LW2 A;  2B4U A;  1VJW A;  1SJF A;  1HR0 F;  1B3T A;  4TYB A;  2CG4 A;  4C3K A;  2E9R X;  1IBC B;  2HND B;  1TK5 A;  4C8Z A;  4H4K A;  5RUB A;  2LCW A;  3R6G B;  3M8R A;  1GT8 A;  1YQH A;  4G1Q A;  2PC6 A;  3MCO A;  4I6W A;  1OJ4 A;  2J0Q D;  2GML A;  2O01 C;  4B9N A;  1HI1 A;  4F4A A;  4K4Z A;  3MTJ A;  5J1E B;  2FJE B;  3RB4 A;  1VMB A;  1T02 A;  1WKK A;  4DR6 F;  3MPW A;  1NJW A;  4EEY A;  5DQH A;  1HMV B;  5A8R B;  1ULR A;  3H5U A;  2ZH7 A;  4K50 A;  3EYZ A;  3NMA A;  2GHW A;  3VVT A;  5AE2 A;  3BKF A;  1RT6 A;  2V8P A;  3HFK A;  5LL6 d;  4IYQ A;  4NLY A;  2UUW A;  2NLW A;  1RAB B;  3B82 A;  3UI3 A;  3EDR B;  2XEX A;  4RW8 A;  2YNH A;  2A1B A;  5KFR A;  3LP0 A;  1A6L A;  4J9R A;  1N5S A;  4JV5 J;  4ZN3 A;  3DRY A;  4ZCM A;  3NXZ A;  2JOQ A;  2NUH A;  3M2V A;  1R7I A;  2F40 A;  3N5F A;  3DRP A;  4WK3 A;  2IFX A;  2XMT A;  4CZC A;  1SCJ B;  3EE3 A;  3B6B A;  4K2X A;  2JLE A;  1VLO A;  2IBO A;  1OQ3 A;  3RU0 A;  3T6B A;  2Z8Q A;  1T3N A;  3FEZ A;  1K9M T;  2DNR A;  1MU2 A;  3H2U B;  5MAO A;  4LVO P;  1OO0 B;  1VQO S;  2BKO A;  2KL8 A;  3NP5 A;  4WU2 A;  4DHV A;  1DTT A;  2XMU A;  4YHH J;  1HR0 J;  4NLS A;  3V2U C;  4JI3 F;  5D6G A;  3PAC A;  2R7V A;  1R3N A;  1IQT A;  3EMT A;  2MQN A;  3H40 A;  2DHX A;  2G0J A;  1WEZ A;  4GRS A;  3KKF A;  3KLF A;  1SC6 A;  3I31 A;  2N3O A;  1S4E A;  1VQL S;  5IT9 U;  1F2G A;  1IKY A;  3HF5 A;  1S49 A;  5KFE A;  5KFZ A;  3J80 Y;  3ZZZ A;  3GQC A;  1DJ0 A;  4LSN B;  2Y1J A;  2I9S A;  3MUT P;  1QM9 A;  3D67 A;  3W9I A;  3HSJ A;  3EM1 A;  1WJ9 A;  4ZJL A;  5J1P A;  5IM0 A;  3CJK A;  4DF8 A;  2MTL A;  4FPI A;  4OMF G;  1FO1 A;  2LQJ A;  2MJN A;  3CCT A;  3OUY B;  1U49 A;  1IBL J;  4A8F A;  4ELV A;  2V2V A;  2MZ1 A;  4UZB A;  2VFS A;  5F8H A;  4LJM A;  1R31 A;  3DLK B;  3MPU B;  2FJD B;  3HD1 A;  1H38 A;  1UJ6 A;  3S01 A;  1L3U A;  2FHJ D;  1JXV A;  4QW8 A;  4WK1 A;  1FDB A;  2GQC A;  2XZW A;  3A8J A;  4WYL A;  3VAI A;  1QSL A;  4NXM F;  4IDK A;  3KNA A;  4CT9 A;  1BY9 A;  3CD5 A;  2ASY A;  1GMV A;  3L95 X;  4BHQ A;  3FUY A;  1BQX A;  5HMY A;  3PYG A;  4A46 A;  3V81 A;  4J9N A;  1G2E A;  1EQ0 A;  2HK2 A;  4PCQ A;  4ED1 A;  2F4F A;  2QIF A;  4Q44 A;  3GB0 A;  2P9G A;  3GCW P;  1TVR A;  4I4B A;  1DQ8 A;  2V69 A;  3IM9 A;  3KJF B;  4PWD A;  4LRA A;  4LVN P;  1NHU A;  4FN5 A;  1FDN A;  4W98 A;  3CCE S;  4ZHR A;  1YKW A;  1HNI A;  1LWC B;  3ZZU A;  4MT1 A;  3E2E A;  1NK0 A;  1AYE A;  4ED0 A;  1C0T A;  4C0B A;  2M70 A;  2DH9 A;  2UUA J;  1EZZ B;  2ZNY A;  1T94 A;  4NAS A;  3D6T B;  1M5K C;  1BWE A;  4ZP7 A;  3B8H A;  3MCM A;  4M5N A;  1L5U A;  4KE5 A;  3AY0 A;  3LP2 B;  1CJU A;  2W4D A;  4OIX A;  2U1A A;  3NCR A;  5K8O A;  5GME A;  2FC8 A;  2QTW A;  2YXL A;  3CW2 C;  3T1H J;  1YRT A;  1D9F A;  4DR1 F;  2HFN A;  3PYE A;  2J9E A;  1ZM9 A;  3R27 A;  4J9U E;  4J9S A;  4B3M F;  2CQ1 A;  1P8G A;  3BBB A;  4B9M A;  4DSJ A;  1CPZ A;  1JXE A;  2BM1 A;  5DDR C;  5H1S V;  4ZVT B;  4MAK A;  3WBZ A;  4WII A;  3FBF A;  1HI8 A;  3NOC A;  1IWG A;  4ZLL A;  3QT6 A;  4C7Q A;  1UJ5 A;  2R8K A;  3RAX A;  4Q43 A;  5D77 A;  1RCO B;  1Y3J A;  1Y4Z B;  3SZ2 A;  1SL1 A;  4CO3 A;  1PG5 B;  2KI2 A;  4ZVG A;  3KLH B;  1QAI A;  3DLG B;  5DZ6 A;  2IAJ B;  1R8C A;  4M95 A;  3OVA A;  2OEM A;  1RK8 A;  1SJ1 A;  3W2W A;  1SQF A;  1CJK A;  3HX9 A;  4EI2 A;  1KC8 T;  2NXN A;  4R25 A;  3R2D J;  1F3V A;  1V5V A;  3QGP A;  1K73 T;  4FBU A;  2B43 A;  3OVS A;  3UE2 A;  1N34 J;  2A3J A;  2RF2 A;  2EFO A;  1C0U B;  3KLG A;  2Z57 B;  4ES3 A;  2HS4 A;  1KDN A;  2V0N A;  4J37 A;  2P5V A;  3BGL A;  4OHV A;  4QIG A;  2DTJ A;  4UUW A;  2A6M A;  2D3U A;  5IM0 B;  3R1H A;  4L76 A;  5I3Q A;  1S1U B;  4C8N A;  4L3N A;  2I5J A;  3VGS A;  3KLI B;  3GR0 A;  1N5Y B;  2DCL A;  3N9U C;  4DUT A;  1FEH A;  2O1P A;  1WTF A;  2OH2 A;  3CF5 Q;  2EBE A;  4L3K A;  1K0V A;  4ID8 A;  1F9F A;  2IDE A;  5J2N A;  2JEJ A;  2OPQ B;  4TKT A;  3CTR A;  5AXK A;  8ATC B;  3KLE A;  1QAY A;  2VPW B;  1S7I A;  5GAE U;  1RHR B;  1N5T A;  4WJB A;  3R7S B;  2IM1 A;  3FDS A;  3SEO A;  4IG3 A;  1CJT A;  4HL9 A;  1TUW A;  4RLE A;  1VQK S;  4AXI A;  5DQG A;  5GMK a;  3GR1 A;  2Z2Z A;  2RE1 A;  4CM2 A;  3ZZ0 A;  7FD1 A;  1DY3 A;  2HZV A;  5DM6 Q;  3MR7 A;  2QMW A;  2EC2 A;  2LEC A;  3J7Y U;  2HS3 A;  1AT1 B;  2B6A A;  4O3Q A;  1CQM A;  1X4A A;  4AUK A;  3NOG A;  4UZC A;  3ZNU A;  3GPA A;  3J80 U;  3H42 A;  3ISZ A;  2DO4 A;  1XNQ F;  5DDP C;  2HK3 A;  3OJU A;  3FMB A;  4MFB B;  1R0A A;  4J9Q A;  5EGY A;  4CLK A;  4PXC A;  2KT2 A;  3LP2 A;  3GV8 B;  2Q79 A;  3K0J A;  4GKK F;  1JMT A;  1HMV A;  3D28 A;  4RW4 B;  5A8R A;  2G0C A;  3G8Q A;  4DZ6 A;  4F4Y A;  1JQG A;  4DFK A;  4W90 B;  1YHQ S;  1VS3 A;  2H4W B;  4IFY B;  5T14 A;  1NME B;  1TL7 B;  2RDI A;  3HFV A;  2XM3 A;  3QQC D;  3BPS P;  5C5J A;  4FVM A;  2GAH C;  3OFH A;  3THV A;  1Q86 T;  5FD1 A;  3IC1 A;  4TY8 A;  2HUR A;  4ECS A;  3KDO A;  5KFP A;  2LXU A;  4FF2 A;  4DR4 F;  1ICE B;  3EZU A;  3QNW B;  4M8L A;  3PR5 B;  4HDH A;  2F3J A;  5J2M B;  5J2Q A;  1UZH A;  4C0H A;  4IOB A;  4NCG B;  1HHS A;  1U45 A;  5EX0 A;  4PWD B;  2IIH A;  5I42 A;  5E3P A;  3W9H A;  4YFU A;  1KSP A;  3J81 Y;  4K4V A;  4CO0 A;  4KKO A;  3QSI A;  4K4W A;  1FXL A;  4P74 A;  3BBF A;  1NSP A;  3D3C J;  4NLU A;  1RT5 A;  5BJR A;  1F5A A;  4TXS A;  4R5P A;  4F4W A;  3BDE A;  5BXI A;  4DV1 J;  1T7P A;  2AW0 A;  3GIM A;  3RAQ A;  2ZUG A;  4FBT A;  2E9T A;  1QJH A;  1F1B B;  2R2T A;  5ETN A;  4KV8 B;  3TWZ A;  4E8U A;  4HT5 A;  5CD4 H;  1IQZ A;  2DIV A;  2K7J A;  2F8M A;  4KT0 C;  4S0M A;  2QLJ B;  3SCI E;  1MSW D;  2CDQ A;  3QAT A;  2Z56 B;  4DPX A;  3IBC B;  1L3V A;  3PRB A;  3MEE B;  1S6P B;  2HGN A;  2J9D E;  3VAF A;  2FGO A;  4Y65 A;  3MR5 A;  2WB1 D;  2WTF A;  3T1Y F;  3MAA B;  3M8Y A;  3QAE A;  2JVR A;  5GAG U;  4JI8 F;  2Z4P A;  3RR7 A;  1TKX A;  2Z58 B;  2KFZ A;  2K7K A;  3EUN A;  3FCV A;  1FNM A;  3PW7 A;  2LMI A;  9RUB A;  3FJ2 A;  2B5J A;  2DGU A;  4I6Y A;  2MKJ A;  3HO1 A;  2ZDO A;  3M30 B;  4YN3 B;  2RB7 A;  2ZM6 F;  3SFU A;  7FDR A;  1AA1 B;  3BH7 B;  1GX6 A;  1DQ9 A;  4C8O A;  3CPW R;  4DR5 J;  4DL7 A;  3R2C J;  3THT A;  1LWC A;  4X62 F;  4NLR A;  2DRA A;  3DDN A;  4OHY A;  1RAE B;  1OYE A;  5ETS A;  4F7V A;  4ECW A;  4HYK A;  2CQC A;  2EKY A;  1PBA A;  2I5J B;  3BYR A;  2XZD B;  3AFG A;  4NEZ A;  3UDL A;  5L46 A;  1HWK A;  5E0O A;  1X60 A;  3N6M A;  3HXM A;  2EK1 A;  4ANC A;  1B7Y B;  3CO9 A;  3J7A N;  1R6V A;  4MIW A;  4AND A;  5ETT A;  4HT7 A;  3NBP A;  1FWK A;  2W9C A;  5E3C A;  2MY8 A;  1C4C A;  4QWB A;  1MRO A;  3CIM A;  4DPU A;  2A6O A;  1U24 A;  5L1L A;  2CPH A;  2DNG A;  2ZBP A;  2IDL A;  4UST A;  4DN0 A;  3HP6 A;  2R2R A;  3OTE A;  3SBM A;  4DV3 F;  2KU7 A;  3C8Y A;  3CDW A;  4NLO A;  3IR5 B;  4NMX A;  2ASJ A;  1HQU A;  3N5B A;  4G65 A;  3CWJ A;  4OZN A;  2BE2 B;  2EFQ A;  5AXN A;  1R89 A;  3OL7 A;  1C1B A;  4EU0 A;  4AYB D;  2HAF A;  3IBF B;  2ADC A;  4M5J A;  1XMO F;  3TI0 A;  1SV5 B;  2WHO A;  1D0E A;  4WYW A;  2XS7 A;  4IOA Q;  4WZQ A;  1H72 C;  2BW7 A;  4UT4 A;  3M8Z A;  2WSE C;  3D0G E;  5M2U A;  2ZH6 A;  4ZLJ A;  1VHI A;  4WFB Q;  5IXU A;  4DV2 F;  2RRB A;  1M90 T;  5K8M A;  2V94 A;  4NRT A;  2GVZ B;  3FRY A;  1CBK A;  3CED A;  1GK8 A;  4KKO B;  3ZC4 A;  2JLG A;  3GON A;  1C0T B;  4WPA A;  1JXL A;  2KXN B;  3G82 A;  4O4G A;  3W2V B;  3HVA A;  3MR6 A;  1LK7 A;  1TL7 A;  2PN6 A;  4NLD A;  4OI0 A;  2XYG B;  4ZP9 A;  1Q7L B;  4MJK A;  2PI4 A;  1VDH A;  4HI1 A;  1TMM A;  2MYF A;  2V4J A;  4NLT A;  2H48 B;  4OZ1 A;  3Q22 A;  2HSE B;  2FJW A;  3RB6 A;  2AHO B;  2KJV A;  2DNM A;  2X3G A;  1WOR A;  3TJA A;  1QVG R;  1JLB A;  4I2Q A;  4DUY F;  1N36 J;  4C8K A;  1S1W B;  3KOA A;  2B0G A;  4DN9 A;  1QVF R;  4K7Q A;  2VL1 A;  2MST A;  3W5Z A;  1HHQ A;  2FLN A;  5KOW A;  3MAA A;  2ROP A;  5LMU F;  2HGM A;  2VA3 A;  1C0U A;  5BYR A;  4LMZ A;  3DNC A;  4B3T J;  1R0B G;  3PW4 A;  2OSQ A;  1Q5V A;  1RTJ B;  2KVI A;  2OMO A;  1X9W A;  4N76 A;  3AJD A;  2DIU A;  3RBD A;  1S1U A;  2HHV A;  2K1R B;  3WQP A;  4DR2 J;  1WHY A;  2KYX A;  5FII A;  4DDF A;  1YBU A;  2LEP A;  1RKJ A;  2JEF A;  1QY7 A;  1IKY B;  4A8O A;  1JB0 C;  1PC5 A;  3Q8U A;  5F9L A;  4LRD A;  1VQN S;  4JI4 F;  2ATL A;  1SKU B;  1RT2 A;  3MMC A;  3DM2 B;  3OL9 A;  1PAE X;  4OYW A;  2XCP A;  2I0X A;  1NB7 A;  2N4D A;  2XMW A;  2YWF A;  1RAF B;  3W8G A;  4CT8 A;  1R43 A;  4RU9 A;  2W8K A;  1F0X A;  2BQU A;  3M8S A;  2RU3 A;  2QA2 A;  1WD6 A;  5IC6 B;  3W1Y C;  4LUB A;  3NKY A;  2CWX A;  5SUH A;  2B9X A;  2DGT A;  3LH2 S;  3N0V A;  3WX8 A;  2JLF A;  4ZLP A;  4XIU A;  1LWE A;  2DY1 A;  3N6L A;  4C11 B;  3K8V A;  2DGO A;  2PMW A;  2QGF B;  3DCA A;  2W24 A;  3VAH A;  3CGI A;  4LRC A;  1N8R T;  3GJQ B;  4E0D A;  1ZET A;  4LF8 J;  2L9W A;  3BQ1 A;  2BDP A;  4Y2M A;  8RUC A;  3T6J A;  3E01 B;  4ZVS B;  2HHP A;  2APO A;  4JOU A;  2RS8 A;  4ELT A;  2EFP A;  4DR7 F;  4V19 X;  2E1A A;  2MY7 A;  2OHD A;  4MIB A;  1U1N A;  4XAK A;  2GGP A;  1KLN A;  3BDP A;  3ZTP A;  2H3E B;  2HWT A;  3E51 A;  4LFA F;  5FJ4 A;  3AQP A;  5F8J A;  3GU0 A;  3MM6 A;  1D8Z A;  3T5L A;  4JV2 A;  4Y2K A;  1N32 F;  3LP1 B;  3MMB B;  1P9Y A;  4I56 A;  2OPR B;  5CA5 A;  4Q45 A;  4LR9 A;  3V6D B;  3PX6 A;  1TK0 A;  3WC2 A;  1HA1 A;  2FHO B;  5D0E A;  1YRU A;  4I7F B;  3BGR B;  1PIE A;  5GAD I;  3Q8R B;  3AOB A;  1L3T A;  2LU1 A;  4DI6 A;  5CZX A;  2KXH A;  1RT4 A;  1FFW B;  2B7B B;  2GC8 A;  1Z2L A;  3P5B P;  4P2S A;  3VHQ A;  4RNF A;  4Z7C A;  1UTA A;  5C42 A;  3PJW A;  2XS2 A;  4ANE A;  3DLH A;  2O66 A;  2KTQ A;  1XN9 A;  3A13 A;  3K5N A;  2JDJ A;  2GMJ A;  2LQB A;  4K0K F;  3NGD A;  1YG0 A;  2J5A A;  3SSQ A;  2EPI A;  3M6W A;  2LYV A;  5B0A A;  4EFA C;  3EWG A;  1OPI A;  2HHH F;  2MMY A;  2R7U A;  2DRB A;  3KK1 B;  2XYP B;  1TAU A;  1NRK A;  1YGY A;  1RWN B;  4PAA A;  3AHP A;  4TYA A;  2RDJ A;  2XLK A;  2NZ4 A;  1I94 J;  2QN6 B;  4NCG A;  5KFF A;  3SCJ E;  4JYA J;  2YNG B;  3TUP A;  4X64 J;  1MLA A;  1KQG B;  2D41 A;  1TU0 B;  4O3O A;  4DQP A;  4URQ U;  2FY1 A;  3VCD A;  5HQL A;  4LR8 A;  3M2R B;  2AV5 A;  5A76 A;  3M1V B;  3H59 A;  4KAI A;  3R5G A;  5M2R A;  2XMA A;  4UTG A;  1KON A;  1OSD A;  2MZT A;  2JRS A;  3ICL A;  5DGB A;  2ZC4 A;  2ZWO A;  3KK3 A;  3R6L B;  3O1L A;  3HSD A;  2AGO A;  3BN4 A;  3OR1 B;  4NA2 A;  1XIQ A;  2RKI A;  4F36 A;  1RT7 A;  4ZLN A;  3KLG B;  2RQC A;  2PO4 A;  3HUL A;  1KS2 A;  3F44 A;  1S6O A;  3IRX B;  3L3C A;  1EAR A;  1RTH A;  3PJ9 A;  3HSZ A;  5EN1 A;  3DMJ A;  2NYI A;  4DL0 C;  2G2Z A;  2A18 A;  2H54 B;  5K5M A;  3PJX A;  3ZZO A;  3V6J A;  3KK1 A;  2ILZ A;  3HVR A;  2WW4 A;  1T11 A;  4CH7 A;  3P3D A;  3M32 A;  1YI2 S;  1UEU A;  4HDG A;  1RYS A;  4WFY A;  2NPF A;  4ZPA A;  4DQS A;  3G6Y A;  3CC7 S;  2BR0 A;  3UW1 A;  3OXL A;  4FYX B;  1XMQ J;  4XDC A;  1CG2 A;  1RT2 B;  2WVB A;  2GW8 A;  1B0V A;  2F5G A;  2IMW P;  3D68 A;  4DJB A;  2FVR A;  4A8Q A;  4YY3 F;  2KXF A;  3P45 B;  4I69 A;  2ZHO A;  2CNL B;  2ZOF A;  3DOK B;  4U7C A;  1XNR F;  4OI4 A;  4EBE A;  5J1N A;  3W2V A;  2B4P A;  4N41 A;  4PR6 A;  1X4H A;  2DPI A;  2YWG A;  1SH3 A;  2G2O A;  2HQ3 A;  2WSC C;  4ZCI A;  5A0Y B;  3D6M B;  2GJ2 A;  4J91 A;  4DLE A;  1FJG F;  4GVB A;  4ZJO A;  4YS2 A;  2MHE A;  1VRT B;  4NL5 A;  5L9N A;  3PKM A;  3D54 A;  2V34 A;  3CIZ A;  5I3U B;  4F4K A;  2PII A;  2KN4 A;  1BD6 A;  1RHQ B;  2ZIT A;  2R2U A;  2BXJ A;  4E98 A;  4CLP A;  4CNZ A;  3PHT A;  4OZ2 A;  3K89 A;  3C19 A;  4KH1 B;  1HBN B;  1CUL B;  2RNE A;  2WK4 A;  3ELH A;  1SUQ B;  4PQA A;  4OZ0 A;  4WP9 A;  5IWA F;  4AL7 A;  4F2R A;  3CSK A;  1RAI B;  2CQD A;  2KKH A;  4O4G B;  4TY8 B;  5T7L B;  3RRG A;  1ZOT A;  4NCA A;  4KIA A;  4MH8 A;  4J9P A;  5KT2 A;  2HHS A;  3H5Y A;  4OYI A;  3I4H X;  6FDR A;  1FJG J;  2AT1 B;  4PG4 A;  5GAD U;  4X65 F;  3OSP A;  4NYP A;  1DZ5 A;  2L48 A;  3W66 A;  2MPU A;  3WC0 A;  3GSI A;  5LSO A;  2ZH9 A;  2OKQ A;  3PZP A;  4ER8 A;  2E7X A;  1U4B A;  1MG7 A;  1S1W A;  1RAO A;  1HNZ J;  4EZ6 A;  4ERD A;  2EG1 A;  5D78 A;  3FCW A;  3KUH A;  4WFX A;  4KJI A;  3Q0A A;  5KT3 A;  3VAJ A;  4DFP A;  1TMJ A;  5CXT A;  3CVK A;  3OW2 R;  5L1J A;  5F8N A;  3MFH A;  3M8P A;  4JI2 F;  2DH7 A;  1NDL A;  1S97 A;  2CNN B;  2YKA A;  4M5D B;  1N6Q A;  3HKZ D;  4RNH A;  5THW A;  5DDO C;  2J76 E;  2BZ2 A;  4G1P A;  2LDI A;  2XWX A;  3HVW A;  1IKX A;  4PEO A;  3QO9 A;  4P9S A;  4JI0 F;  4DG1 B;  2VU5 A;  4RUC A;  3QT7 A;  3LA0 A;  4JP8 A;  2HFO A;  1J5O A;  1S6U A;  2OTL S;  2YPY A;  4ED8 A;  1J2V A;  5HAO A;  4FYY B;  1YJ7 A;  2CJX B;  3IRW P;  1ZZN A;  3PEJ A;  3H4B A;  1IBM J;  3KHG A;  2E5L J;  4DQI A;  1UVI A;  3FZB A;  1UWB A;  3Q86 A;  1S72 S;  2E29 A;  3BPD A;  5E2Q A;  3SDE B;  2ZZT A;  5FLX Y;  2ACY A;  1WC4 A;  2OGU A;  5LJ5 Y;  3DLE A;  3TYT A;  1KBR A;  5F3Z A;  2VG5 A;  3M6V A;  1G4C A;  4AD6 A;  2DIS A;  2ZH1 A;  4M63 A;  3MAQ A;  4OYX A;  2R8H A;  4DV5 J;  1ZAV A;  4M5K A;  2GV1 A;  2MQM A;  1S79 A;  1IJE B;  2ACM A;  3CB4 A;  4QPT A;  5KFB A;  2R8J A;  1TL4 A;  4TU9 A;  2KM8 C;  1S9F A;  4JYA F;  3HHD A;  4ECZ A;  1X4F A;  3U1N A;  4DV0 F;  2GMH A;  5CZV A;  1DRZ A;  1Y5I B;  3PVX A;  2DGW A;  1IXK A;  4RW8 B;  3VQT A;  4CH0 S;  1YX2 A;  1PYO B;  2J7U A;  3IXQ A;  5F8I A;  2HVI A;  4QCL A;  1FTC A;  1OWX A;  2ZVI A;  4K8R A;  4R0E A;  4ZVO B;  1IR0 A;  3FC9 A;  5D3G B;  4UY8 T;  4CO1 A;  2F1F A;  4RR5 A;  1WG1 A;  4K0K J;  4F50 A;  4HR2 A;  1OY9 A;  4URG A;  4M5I A;  4DSE A;  4DX6 A;  3K7R A;  2OLW A;  3JQK A;  4LIR A;  4ZVU B;  4LF7 F;  2V6A A;  1D3W A;  1NK5 A;  2UXB J;  2FD2 A;  2NXU A;  4ICL A;  2ZKU A;  5LJ3 Y;  1JJH A;  3IA0 A;  1CJV A;  4QU7 A;  3KYL A;  1VBK A;  3WIU A;  4FKX A;  1N0V C;  4Y3C A;  3S7R A;  1Q79 A;  1VHF A;  4OI1 A;  5KAK A;  2C2N A;  3GG1 A;  2QYC A;  1VQ4 S;  5KFO A;  2DR8 A;  2IRU A;  3M1V A;  3V6K A;  2JNJ A;  3FEX B;  2BJ3 A;  3W65 A;  4CYU A;  4DSI A;  1HQ2 A;  5CYM A;  4YR3 A;  3EPI A;  2E5G A;  4YB1 P;  2B4V A;  4C2M A;  1FTR A;  4KR0 B;  1REV A;  4FYV B;  5ADZ A;  3T3F A;  4AQY F;  1B64 A;  1OQ6 A;  4DV6 J;  2JC0 A;  2YTC A;  4CLU A;  4ED3 A;  2H5E A;  1LXJ A;  2E5I A;  2WZ1 A;  5D15 A;  3TAM B;  4H54 A;  5ETM A;  5FLX U;  1K44 A;  2V4J B;  3CJ2 A;  1BXN A;  1T3O A;  2YNH B;  1V3R A;  2QFJ A;  2DEI A;  1RT1 B;  4QIF A;  5DRK A;  2HNY B;  3LPY A;  3C2P A;  1WC6 A;  3T1A A;  3H5X A;  1PAU B;  3QLH A;  3CUN A;  4H4M A;  2CQH A;  3UVJ B;  2CPJ A;  2CZ4 A;  4DV4 F;  2XHW A;  4IRD A;  1RTD B;  3JSY A;  5HK4 A;  4NXN J;  3RYL A;  5KG6 A;  3H98 A;  2V9W A;  2A2D A;  3RW6 A;  4Q0B B;  2CDR B;  4DOZ A;  2W9A A;  5L1K A;  2BV3 A;  4HHJ A;  2BJD A;  4K59 A;  1I94 F;  1VBZ A;  3L4B C;  1RWK B;  1EHW A;  4U96 A;  1W25 A;  5AT1 B;  2QL5 B;  3HVT A;  2GFF A;  1Y11 A;  4JI4 J;  3A1Y G;  3DRX A;  1DQA A;  1MML A;  1NU4 A;  1JJC B;  1R8B A;  2UVW A;  1VI7 A;  5B0G A;  4DCJ B;  4LF4 F;  1TL3 B;  2DK2 A;  3MI7 X;  3QFH A;  1FEE A;  2DBB A;  4K4T A;  1TL1 B;  2LDY A;  1GXT A;  4OX9 F;  2D3Z A;  3DDI A;  3TX8 A;  5HQ8 A;  1RWM B;  4AXJ A;  3MM5 B;  2XLI A;  5HMX A;  1UFW A;  1NH8 A;  4ID5 B;  3C6U B;  2RU9 A;  4OYA A;  2HFU A;  3GIL A;  3F73 A;  2WVD A;  4KHP J;  2AYG A;  4DEZ A;  3ET6 A;  4QYR A;  2VDI A;  4CRJ A;  2N7C A;  1TKT A;  2L9N A;  2Q6C A;  3I9Z A;  4K4X A;  3RB0 A;  3ITH A;  1GEH A;  1WI6 A;  5SZT A;  5DGA A;  3Q8Q B;  2CJA A;  1N36 F;  4FYW B;  4L75 A;  4DUY J;  2WVF A;  3IAM 9;  2FDN A;  1S1T A;  3G96 A;  3PDN A;  3SSR A;  3SQG A;  3R5D A;  4B02 A;  1Q82 T;  1T9V A;  1SIW B;  2RML A;  2HBR B;  5HVH A;  2FHM A;  3NGR A;  4IRC A;  5I3P A;  1U8S A;  3OXF A;  1NKE A;  3QGI A;  4QWD A;  2AGP A;  4Y28 C;  3GYG A;  2DGX A;  2MKS A;  2ZBC A;  3MM9 B;  1J5E J;  3IGV A;  4ITS A;  2VJU A;  1E6V B;  4KRW A;  5GAE I;  3CCS S;  2CPD A;  3G6E S;  1H0H B;  3PM9 A;  1JLC A;  2ZOG A;  3SI8 A;  2BJ8 A;  2XO6 A;  1FE0 A;  1QSY A;  2O5D A;  1RDR A;  1SC3 B;  5EWE A;  3GE9 A;  3TRG A;  1XMO J;  5BYS A;  1RT3 A;  2POK A;  1GMW D;  4NLP A;  4AQY J;  1YJN S;  4JUZ A;  3RZA A;  4JI5 F;  2QRR A;  2KDO A;  3J7Y I;  3BRE A;  2QL9 B;  1WKL A;  1V3S A;  3PTW A;  2IM3 A;  4P2M A;  1HBO B;  4PUO A;  5KG7 A;  1S9G A;  5EWG A;  3CO0 P;  3DOL A;  1EIY B;  2P9E A;  4M1K A;  3WDO A;  3RAM A;  1SKR A;  2IAJ A;  3EGZ A;  3FBC A;  1S9E A;  3H7H B;  3K5P A;  2WRM A;  3ISN D;  3LUY A;  2HIQ A;  3EZ5 A;  1S1X A;  3CCL S;  5C24 B;  1XC9 A;  4FF3 A;  3HHL B;  2RS2 A;  1VQ6 S;  4X4N A;  2MEW A;  4DS4 A;  1HNX J;  1YBT A;  4B08 A;  2W25 A;  3W61 A;  1U1M A;  1SIZ A;  2FLP A;  3R5A A;  4NLG A;  1NKB A;  3PYF A;  4JV1 A;  2ZBR A;  3O6Q A;  4LFB J;  1N5V A;  2C3Y A;  3LGM A;  2GVD B;  3L7U A;  3H4D A;  2CPE A;  2ZHA A;  1S7H A;  3FSY A;  1L3S A;  3HMJ G;  2KFY A;  1RZM A;  3V6D A;  1LK5 A;  5T41 A;  3C46 A;  2CPY A;  3CJ4 A;  3FK4 A;  4JI7 J;  2RUS A;  2HKE A;  3CJR A;  4FVC A;  4X62 J;  4A8Y A;  4DR5 F;  4DV0 J;  3D1O A;  1RHU B;  4IKA A;  4LBH A;  3PY8 A;  1DFD A;  5AE1 A;  2ZM6 J;  4USJ C;  5B0B A;  4Q8F A;  2HWI A;  5LXR A;  2CNO B;  2VB6 A;  2ZEJ A;  3CDA A;  4FZV A;  5E5N A;  5JUM A;  2DNY A;  1TZ0 A;  1Z4U A;  5LMN J;  2HFS A;  3SSS A;  4DV5 F;  3ZTS A;  4F8R A;  1NDC A;  4UUX A;  1FVQ A;  2M5Y A;  1EAY C;  2LLZ A;  2UXD J;  1NK9 A;  1FXD A;  4UQT A;  1L3K A;  2ADB A;  3M4X A;  4F04 B;  4F2S A;  2ZE2 B;  2YVS A;  5K8P A;  2I1R A;  3WHI A;  5IQ6 A;  2GIF A;  1U1L A;  3ILJ A;  1FFG B;  1C1C A;  3DLG A;  4BS2 A;  1FK9 A;  1U1R A;  3NS6 A;  1FJ7 A;  1F5B A;  3B54 A;  2HIY A;  3RUB L;  2KH9 A;  1RI7 A;  1WSR A;  3ONQ A;  2OPQ A;  4HHH A;  5HAT A;  1S5Z A;  1U0H A;  2DCU B;  4ELU A;  3OBI A;  2HPU A;  2VG5 B;  2CJ9 A;  2RF2 B;  4L72 B;  2HVE A;  2KT5 A;  4ZVP B;  1JNR B;  4ZVQ B;  4F67 A;  5ETK A;  3GII A;  5HP1 A;  2R8I A;  4O44 B;  4FXW A;  2Y0S D;  1WEL A;  3TZX A;  4PPD A;  1XR5 A;  2IPO B;  4DSF A;  5IC4 B;  1W2B R;  4JI2 J;  4FNH A;  1RLC L;  2EG2 A;  1X5O A;  2BJ7 A;  2XSJ A;  4P7T A;  3V4M A;  5HBM B;  4A47 A;  1ZAX A;  4YB7 A;  3MED A;  3CT9 A;  1JLA B;  3EVM A;  3MPV A;  2GHV C;  2VA2 A;  3PRV A;  2UVU A;  4NRU A;  3JS9 A;  4ECX A;  2ZDP A;  3QJL A;  4DR4 J;  2FJB B;  4IQX A;  2D3O R;  1CJK B;  1HNZ F;  1Q1K A;  3FQL A;  4N7T A;  5CQG A;  4DPT A;  2CJQ A;  3DGV A;  3IN5 A;  4ZVR B;  4ZKA A;  3D66 A;  1XR6 A;  3DOL B;  3LAL A;  4I2P A;  4X65 J;  2VOP A;  1REV B;  1RQ0 A;  2DD8 S;  1FKA F;  2QSF A;  4DUZ F;  1RT5 B;  2ZH4 A;  1DTQ A;  1UCN A;  2KVQ E;  2P6T A;  2Y0B B;  4LIW A;  4MK8 A;  4IUF A;  1S9E B;  1EKR A;  2QLW A;  1X9M A;  5E41 A;  2H51 B;  3UFC X;  2C2E A;  3KLH A;  1YK9 A;  2B3T B;  3OFE A;  2H5I B;  3EGW B;  1H74 A;  4LR7 A;  1RT1 A;  5KT4 A;  4NLV A;  2VBY A;  2HLT A;  3M7V A;  5J2M A;  2R3V A;  5KFJ A;  5HQM A;  1HYS A;  4H4M B;  5CYM B;  3TOQ A;  2FPH X;  1K8A T;  2IRX A;  1T8E A;  2XBP A;  4NX9 A;  5EHH A;  3OFG A;  3CD6 S;  2EC0 A;  3THP A;  2C2M B;  3BGF A;  2XLJ A;  1BQN B;  3T5H A;  1HBU A;  1HW8 A;  4YR0 A;  1D1U A;  4ZS6 A;  3KLI A;  4NE9 C;  2YWW A;  1N33 F;  3F41 A;  3RJM B;  2VDH A;  2XWY A;  3A3O B;  3DOM A;  3PFO A;  4KGK A;  4DZD A;  4YY3 J;  2HQC A;  3BQ0 A;  3TUI C;  4FS2 A;  2XY7 A;  4RNO A;  2Y3Y A;  3X1L B;  4D3G A;  3GYN A;  3Q8V A;  2GVD A;  3ETO A;  4OLP A;  3GYX B;  3JQJ A;  4OHW A;  2G1H A;  1KQK A;  4Q8E A;  2KZM A;  3TQE A;  1WKJ A;  4MK9 A;  4PKD B;  2ZE2 A;  1R0A B;  4X4Q A;  3I82 A;  3ZTO A;  3TUJ C;  1Q78 A;  1RTI A;  1FKP A;  1MN7 A;  2QX0 A;  1SKW A;  4NLX A;  2C1E B;  2FIU A;  4ZP8 A;  2LEB A;  2UXC J;  2PSZ A;  1G6B A;  1RGV A;  2E1M C;  3OSN A;  3M30 A;  1V6H A;  3JAM Y;  3J7Z 5;  2ASD A;  3NNC A;  1X4C A;  4BC7 A;  3UD4 P;  2AD9 A;  2ALZ A;  1VC5 A;  3R8Y A;  1T9Y A;  3D2W A;  3BO4 A;  3NL0 A;  1C2P A;  5KFQ A;  2RDD A;  1I51 B;  5DZ7 A;  1VRQ C;  5CYJ A;  2XI2 A;  1HBM B;  2FQQ B;  3TJ8 A;  2YNI A;  4KGV B;  2D3O 1;  3BO3 A;  3KHH A;  3S8S A;  3JSB A;  1SJ4 P;  3OVB A;  2BE9 B;  3HHL D;  5KG1 A;  4PRF A;  1VQ9 S;  1Q95 G;  4M5G A;  3M9N B;  3TVY A;  4LF9 J;  4TU7 A;  2M8H A;  3I96 A;  2GX8 A;  3CD0 A;  4KYZ A;  4JI1 F;  4C3L A;  4DWI A;  2AKW B;  1U6F A;  1BC6 A;  1B99 A;  4V1A k;  3US5 A;  2DXD A;  4CH1 A;  4F0K A;  2W7P A;  3DRR B;  4B3M J;  2J7W A;  2IJR A;  4ZCK A;  5HVG A;  1AW0 A;  1HI0 P;  5BYQ A;  2R42 A;  4NCB A;  1RAC B;  4G1I A;  1WF1 A;  5A2Q U;  2VIH A;  5A8K A;  1S1V A;  2CJK A;  4JI1 J;  1MN9 A;  1S4F A;  2DGV A;  2GS8 A;  2LEA A;  3EGV A;  3MM8 B;  4HLB A;  5GAH I;  3DN9 A;  2CJY B;  2J9C A;  4KGM A;  3K17 A;  1G1X A;  2B8P A;  5KFK A;  1DLO A;  1JKH A;  5D4P A;  4WFA Q;  2UUA F;  1TEL A;  5CD4 A;  1LEO A;  3NMR A;  2AEJ A;  2HZC A;  3C15 B;  3GIR A;  5HRO B;  1RU1 A;  1FRI A;  5F8L A;  1NZA A;  2OPS A;  3POT B;  1F3F A;  5C2C A;  6FD1 A;  4DF4 A;  4I2Q B;  2DO0 A;  1RWU A;  4WTY A;  4X4R A;  2ZD1 A;  4X2B A;  2BA9 A;  1U6Z A;  1NDK A;  1TUV A;  1W7W A;  3PG9 A;  2IHR 1;  2W2M P;  4M5L A;  2J6U A;  4OLO A;  2M7S A;  3ENV A;  3ZZT A;  1FX2 A;  3O8W A;  3TAM A;  2JC1 A;  4PXE A;  5K20 B;  4DMZ A;  5I42 B;  1VOM A;  1N32 J;  3CJQ A;  2EFN A;  2BE2 A;  1QTM A;  2DNO A;  3QFW A;  5GAH U;  1YJT A;  4IO1 A;  2MKC A;  4R0J A;  1JJ2 R;  3D7S B;  5LOQ A;  4CI0 B;  4OJ3 A;  1JLB B;  4TY9 A;  1IUJ A;  2N3L A;  4ED5 A;  1HYS B;  4KO0 A;  1QAX A;  2GO8 A;  1PIL A;  4DR7 J;  2QYG A;  3OL6 A;  2DYA A;  4WXW A;  5E33 A;  3ZFV A;  3H2V E;  1S6Q B;  4OI2 A;  5D0R A;  4Q5V A;  4LF8 F;  1JK9 B;  1APS A;  3QGG A;  3GJS B;  1TFY A;  3MOZ A;  3MMA A;  5A6W A;  1K1Q A;  2N7Y A;  1YZ7 A;  4N77 A;  4AT1 B;  3D1Q A;  4USH A;  4UOH A;  1S76 D;  3AD9 C;  3VR1 A;  2J7K A;  1IR1 A;  1K1S A;  1EQM A;  1U1O A;  1J27 A;  2XSJ B;  5HBM A;  1WWH A;  4P10 A;  4IO9 Q;  3QT8 A;  5KG4 A;  4ECU A;  1I3O B;  1QAJ A;  1VGY A;  3E01 A;  1URR A;  4WXO A;  4BLG A;  3AB2 B;  3CMQ A;  1HBM A;  2VG6 A;  3MF5 A;  4OZL A;  3JYT A;  3IAS 9;  2FHK A;  3KJN B;  3UCZ P;  1WSV A;  1RWV B;  2QC3 A;  4YHH F;  1A9N B;  1REG X;  1KKH A;  3HHK A;  1TKT B;  3MEK A;  1BLU A;  3R5C A;  5CAA A;  1N4L A;  2FJV A;  3PO5 A;  2BJE A;  3RBE A;  5LXY A;  4ZVE A;  2V4Q A;  2DPJ A;  2UUB F;  3MD1 A;  2OAU A;  3BZQ A;  1ITP A;  3CC2 S;  3MGJ A;  3M8Q A;  3OR2 A;  3OTD A;  4RW9 A;  4TLR A;  5HJX A;  2MQO A;  2ZWP A;  4F4Z A;  1FK9 B;  4B3T F;  4JV5 F;  1PJ7 A;  4P73 A;  4CQ1 A;  5LMU J;  1U1Q A;  1FES A;  2W7A A;  1QUV A;  2C42 A;  2FY8 A;  3JTO A;  4FF4 A;  1GQE A;  2BKP A;  4XPC A;  2M0G B;  1X5S A;  2PEH A;  3AXK A;  4NLQ A;  3EZO A;  4PYD A;  4OX6 A;  1KQF B;  1GXU A;  2HGL A;  3I0S B;  1JLQ A;  2W01 A;  5D8H B;  1FXR A;  2CRL A;  2W2O P;  3MM6 B;  3TZW A;  4C48 A;  1JLG A;  2AJF E;  2DH8 A;  2ROG A;  4GC7 A;  1ZM3 A;  2AIR B;  2OO4 A;  1Z2Z A;  1T9W A;  3NY0 A;  3VZH A;  5KFN A;  5KG2 A;  4H4O B;  2DXF A;  3OTO J;  3HPO A;  4NA3 A;  1CEZ A;  3BR9 A;  4C97 A;  3O44 A;  4A8W A;  3AOD A;  2CQ2 A;  3D6H B;  4OI6 A;  5GMD A;  3EX7 B;  1DAR A;  1MWZ A;  4OHZ A;  3HK2 A;  3HHE A;  4LSZ B;  3JTP A;  5KFL A;  2MKY A;  3QBC A;  2W2P P;  2MB0 B;  2R8G A;  2VFU A;  3IMQ J;  4NOH A;  1M5H A;  3A8I A;  4X4P A;  1GX5 A;  3VAK A;  1TKZ B;  2VV5 A;  3UDE A;  2VQF J;  2IBK A;  2UXD F;  1W26 A;  2XO7 A;  3OJS A;  3QT5 A;  3BO2 A;  4RWX A;  1XJW B;  1DTQ B;  3HHL A;  1WHV A;  2XMK A;  2RIJ A;  3UR0 A;  3IR7 B;  4TQS A;  1HPZ A;  4FDF A;  3GIJ A;  4U7U K;  4QZV B;  1RAJ A;  2VJV A;  3A3P B;  2C28 A;  3TA0 A;  1RJJ A;  2VAS A;  1KHV A;  3Q8Y A;  1KVI A;  2MJU A;  2OFG X;  1I6J A;  3BGR A;  2W1B A;  5JMN A;  3L9Z A;  2FC9 A;  2B7C B;  2MSS A;  1UW9 A;  5G0R B;  1N88 A;  3TZZ A;  4JI7 F;  3PW5 A;  1UA1 A;  1WEY A;  2JFK A;  1NO8 A;  1QTN B;  1Z1Z A;  2WON A;  2XHC A;  4I64 A;  4IDK B;  4AL5 A;  3LO3 A;  1Y0H A;  2OTJ S;  1VJQ A;  3RRH A;  4PG6 A;  3EXY A;  4UOF A;  2ASL A;  1X0P A;  4LFB F;  3O2I A;  2GCF A;  3C6T A;  1F6T A;  4EO8 A;  4B9L A;  3G86 A;  2FHJ A;  4TLQ A;  4LBI A;  2R7W A;  2DNH A;  1KRP A;  1HNX F;  4HH0 A;  1Q4R A;  2QV6 A;  4R8U A;  3VTI A;  4U95 A;  3HM9 A;  2HHX A;  4DL6 A;  2K3K A;  4RKU C;  4NZ6 A;  4MKY A;  2GZO A;  4Z2X A;  2OIH A;  1RTH B;  1R0C B;  3DM2 A;  1CJT B;  1Q0N A;  4O23 A;  1VCT A;  4OYZ A;  1RCX B;  2QO3 A;  5DLF A;  2ATC B;  1GTE A;  3V81 B;  4J9K A;  1VC6 A;  3D9B A;  3KDN A;  2FB0 A;  3ZXW A;  3MXH P;  4GVL A;  1UEK A;  4D3H A;  4G1Q B;  1FWP A;  1T9U A;  3C15 A;  2OML A;  5HRO A;  2GJF A;  3ADA C;  3TJ9 A;  3EPG A;  3LP1 A;  1LWE B;  4QR2 A;  4C11 A;  2QEX S;  4EWT A;  2Q66 A;  5IS2 A;  3V5R A;  1IN0 A;  4YOE A;  4U8V A;  2D9O A;  4O3P A;  2AJ4 A;  2V8H A;  4OJG A;  4TN2 A;  2QMX A;  4A8M P;  2NQP A;  4I7F A;  3MOJ B;  2RHQ B;  2Z2M A;  1KNZ A;  2HVD A;  3Q8P B;  3NWG A;  3N28 A;  3AXM A;  2CUY A;  4J7C A;  2VFT A;  4IH6 A;  3OV7 A;  2KG1 A;  3MR3 A;  3AJ1 A;  4BDP A;  5B09 A;  2AWZ A;  1U1K A;  4IFV B;  1T9T A;  3BBC A;  3DYA A;  3M32 B;  4KPC A;  3UQS A;  5CAB A;  3OTO F;  4PXB A;  2F4V J;  2BJ9 A;  1UP1 A;  4CWB A;  3FVY A;  3D0I E;  4ATN A;  5IT9 Y;  1SC4 B;  1QUP A;  1Y00 A;  3BB5 A;  3DHX A;  3EXC X;  4RBT A;  2J6S A;  4N47 A;  1O6X A;  1XK8 A;  1I1G A;  4A8K A;  2UVV A;  1UMJ A;  1UZD A;  3QID A;  4PPZ A;  3CDE A;  4HVZ A;  4AE5 A;  2ZVS A;  4NZ0 A;  2SXL A;  1W2I A;  3VAG A;  2NPI A;  3R5J B;  2L41 A;  5H9F J;  3I0S A;  4CO2 A;  1FF2 A;  1WG5 A;  2NSB A;  3JQM A;  3PHE A;  2R9L A;  4KHP F;  2BAC A;  3UCU P;  1BHN A;  1X0F A;  5KFG A;  3G87 A;  1H73 A;  2LQ8 A;  2EKN A;  4M5D A;  4N5S A;  2YKM B;  1XWL A;  2HG4 A;  5B0E A;  2UUB J;  1M1G A;  4F0M A;  3OHA A;  4GVB B;  2AQ4 A;  2IA0 A;  2MQ8 A;  2HS0 A;  1M5V C;  3P4U B;  5G0R A;  3ENA A;  1UPP A;  4Y2C A;  2XMV A;  1Y7P A;  5DO2 A;  2XGP A;  5I3U A;  2NRE A;  1J5O B;  3K5O A;  4QYZ J;  1FA0 A;  1RT7 B;  4CLS A;  5DJB A;  4IRK A;  5ETR A;  1YTY A;  4EO6 A;  4DFJ A;  3R97 A;  4DU7 A;  2KO1 A;  2OPP B;  3EVO A;  3RW7 A;  3BSN A;  4DX5 A;  2FVP A;  4PYA A;  1UVN A;  1GH8 A;  2ZH2 A;  4DV4 J;  3HI9 A;  2CZV C;  1FNO A;  2KRR A;  4AL6 A;  1WG4 A;  2LFV A;  3HDS A;  3MUR P;  1WF2 A;  4X4S A;  3OXG A;  2RJZ A;  2XB2 D;  3GFX A;  2MLY A;  5FDL A;  2WCX A;  2BBE A;  2AF6 A;  4CIO A;  2W9B B;  2H1Y A;  4DV7 J;  2RQK A;  4C8L A;  5D0H A;  4DBQ A;  1FT8 A;  4EMD A;  3C16 B;  4ECV A;  3G8T A;  1WAC A;  4IH7 A;  1ELO A;  4YB6 A;  3CUL A;  2HBZ B;  5LT5 A;  3BGO P;  5KFI A;  3CCU S;  4DV6 F;  2RT3 A;  2F63 A;  4M5M A;  3D1H A;  2EFV A;  2CYY A;  4YDD B;  2HHU A;  4ZPT R;  4PAB A;  1SQE A;  1X7V A;  2G2Y A;  4OV6 A;  3V4I A;  3H25 A;  5DG7 A;  3V6H A;  1GMW A;  2AZ3 A;  3FSX A;  3LTO A;  2KRB A;  3M8Q B;  4DX7 A;  2QL7 B;  3IBW A;  2ZH8 A;  1Q8B A;  5E7O B;  2OFH X;  2BAB A;  1BGX T;  2X1G A;  1NB2 A;  4QR0 A;  2MDA A;  2CQ0 A;  2K8G A;  4ICL B;  5L38 A;  3PXG a;  5A6P A;  4ECR A;  4KTQ A;  4CLT A;  2HHT A;  3GJR B;  2DRD A;  4ZCL A;  3UDC A;  4WIQ A;  2UXB F;  9ATC B;  4ZDN A;  3BQ2 A;  2DHG A;  3B78 A;  2ZH3 A;  2MLX A;  2ZHB A;  4RW4 A;  2ILY A;  3PEH A;  2MZR A;  3F0N A;  2CWK A;  3LWM A;  2CXE A;  2HLU A;  3OPK A;  4DS5 A;  4ZPD A;  5HI7 A;  4PG8 A;  2B4O A;  4PG7 A;  1LOU A;  3LAM A;  3LP0 B;  3OR2 B;  4RW9 B;  4CM0 A;  4YEA A;  5CCL A;  4ZK7 M;  3Q8S B;  1T05 B;  4OL8 A;  3ENW A;  4I67 A;  4FYD A;  4WF9 Q;  4PWU A;  2DR6 A;  2W8L A;  3DRP B;  1LW0 A;  2CQ3 A;  3H5S A;  2E1R A;  2CQB A;  2NR0 A;  1IWA A;  1CJU B;  1NLK L;  1SJR A;  2V8G A;  1R6Y A;  3QPI A;  2C2D A;  1MU2 B;  1FER A;  3HVT B;  1SL0 A;  1S10 A;  5KT6 A;  1NJX A;  2XY6 A;  2XUL A;  3HCX A;  4DR1 J;  2OEJ A;  3T1H F;  3IG1 A;  4X4U A;  4U7U D;  1OPZ A;  5B0C A;  4LF9 F;  1K0T A;  5KFU A;  1TV6 B;  1LKZ A;  4OHX A;  2RH3 A;  5DG8 A;  2Q1L A;  1PKU A;  2U2F A;  3O3L A;  1DBD A;  1SC1 B;  5E3Q A;  2CAJ A;  2R7Q A;  5B08 A;  1U26 A;  3NGK A;  1IBM F;  4C9D A;  5CH7 B;  2E5L F;  2F8H A;  1B0P A;  1MW7 A;  1FD8 A;  1N5Q A;  3ILL A;  2OP5 A;  1N5Y A;  3MCS A;  1NHK L;  1NK4 A;  1HWI A;  2UXC F;  1N0U A;  2K1R A;  1U2C A;  2QLB B;  1K47 A;  2VC0 A;  1TKX B;  2CVE A;  3LPE A;  3SXL A;  3P5T L;  4OFZ A;  3TVK A;  1C4A A;  1VRU A;  1BQM B;  1O8B A;  4I68 A;  4KC5 A;  3MFI A;  4LRF A;  3MM7 B;  5D4L A;  4QWC A;  3I55 S;  2HNZ A;  1G3O A;  3KK2 A;  4NXN F;  1NEE A;  1RE1 B;  3TO8 A;  1RTD A;  2E7V A;  2GIR A;  2QZ8 A;  2Y1I A;  2GNK A;  5CYQ A;  1BMQ B;  2W9C B;  4J9M A;  2H4Y B;  4ALZ A;  4NA1 A;  4CNY A;  3B4M A;  3IWX A;  3FRZ A;  5EUH A;  2BOP A;  1N33 J;  4ZOS A;  3I5A A;  4RPF A;  1UVJ A;  2IM2 A;  1RIS A;  2CZ9 A;  1RP5 A;  2VPZ B;  3KG0 A;  1YJ9 S;  2PFD A;  3DGP A;  3CCJ S;  2M52 A;  4K2J A;  1IBL F;  1KVJ A;  4P75 A;  1FCA A;  2MZS A;  3AD7 C;  2AYB A;  1H2V Z;  1CS4 A;  3GFH A;  3R9L A;  5AXM A;  1HNW J;  1X4G A;  3AA9 A;  1P6T A;  1RBL A;  1HKA A;  1ZS6 A;  3M9M B;  2VPX B;  2FVC A;  2P8I A;  1HNI B;  2IJF A;  3MM9 A;  3MM5 A;  4HH1 A;  2B8Q A;  4WBF A;  4CLF A;  4BWJ A;  2XGQ A;  5IWA J;  4IG3 B;  2QA1 A;  3IR6 B;  3IS9 A;  1NCL A;  2DR7 A;  3KHR A;  2D74 B;  2FJA B;  2ZJQ Q;  1NUE A;  2YX4 A;  2ZJR Q;  1HL6 A;  1P1T A;  4JI3 J;  4UOC A;  1SH0 A;  5JJB A;  2BJ1 A;  2FZC B;  1OYD A;  3MMB A;  4I0W A;  1HQU B;  1XTZ A;  4C8Y A;  1EET B;  3NCQ A;  3TEG A;  2NS1 B;  4DUZ J;  4DL5 A;  4ZVF A;  4B9T A;  3N01 A;  3NNH A;  2G4B A;  4ES1 A;  4N56 A;  2V63 A;  4ID5 A;  3BGU A;  1XNR J;  3QZ7 A;  2JEG A;  2MZJ A;  1T0T V;  3E3X A;  3ET6 B;  2YPZ A;  8AT1 B;  2BKN A;  4RW7 A;  3SYZ A;  2A10 A;  2F65 A;  1H2T Z;  2VPY B;  4X84 A;  4K4U A;  1RWO B;  1YZ6 A;  2OSR A;  2HW3 A;  4C6A A;  1S1X B;  3RRK A;  3NGU A;  1VK3 A;  3MHY A;  3W5X A;  3Q83 A;  4WZM A;  2CIM A;  2E1P A;  1XMQ F;  2I2Y A;  2LU2 A;  2Y8Y A;  3C14 B;  5I4M A;  2JHE A;  2E7W A;  2WVE A;  2G0I A;  1TL3 A;  3AH6 A;  4C8M A;  2MXY A;  4DR6 J;  2VKZ G;  2W9B A;  1HBO A;  2NYH A;  1PGZ A;  3G6X A;  3UVJ A;  5KFA A;  3NEK A;  1WHW A;  1U1P A;  2LXI A;  2M8D B;  1RXO B;  3KTQ A;  1FRX A;  3MMC B;  1AFI A;  1XER A;  3C16 A;  1NH7 A;  1RHK B;  4TVA B;  2YBV A;  3LAN A;  3NGT A;  2AYM A;  3GFY A;  2MGZ B;  4C3M A;  2YKQ A;  2OPP A;  4YUD A;  1M5P C;  2DIT A;  1SPB P;  5C24 A;  2AP6 A;  3ZTR A;  4F3M A;  4QPX A;  3M9O B;  1TV6 A;  2D7S A;  2M2B A;  1XMB A;  4EZ9 A;  3CDU A;  2D9P A;  3D5M A;  2J6T A;  3Q24 A;  3BKU A;  4ED2 A;  2CPX A;  1WTB A;  2WVC A;  2RKI B;  2R7S A;  3FZ2 A;  5CYQ B;  2C22 A;  4QYZ K;  2WW8 A;  5FDL B;  1FI4 A;  5LMN F;  4RL1 A;  4B17 A;  1LFP A;  2GAG C;  3W64 A;  3UO0 A;  1GXL A;  1CVJ A;  2IY5 B;  5KG0 A;  1D8Y A;  4X64 F;  5IT4 A;  1YIT S;  2NXJ A;  2C3U A;  1LW2 B;  5A2Q Y;  1KFD A;  2EK6 A;  3VF0 B;  2KG0 A;  3U1L A;  3DI6 B;  4LSL A;  1Y5N B;  4FS1 A;  1S0N A;  2PT0 A;  2HHQ A;  3UNY A;  3W5Y A;  2XNR A;  4NZ7 A;  3I6P A;  3VGV A;  2HVH A;  1X4D A;  5IV4 A;  4X4V A;  1NPR A;  1YJW S;  1LV5 A;  3ITH B;  5C2G A;  2DNK A;  1EP4 A;  2E5H A;  4CLL A;  2HNZ B;  2I8E A;  3KK2 B;  1RHM B;  3ILI A;  4KSE B;  2YH1 A;  2BW2 A;  1YLX A;  3FQK A;  1UEV A;  2W4C A;  2VUG A;  2ZC3 A;  1M1K T;  1SH2 A;  2CG8 A;  2V5H G;  3CJ3 A;  4MKA A;  3CJS A;  3G71 S;  1T05 A;  3BN7 A;  1B4S A;  1RB0 A;  3KUG A;  7AT1 B;  1JWW A;  2V9K A;  3W60 A;  1M5O C;  2J0X A;  4QIW D;  4PUO B;  1CC8 A;  3SCK E;  1JLE B;  3NAH A;  3K5L A;  4DSL A;  3GIK A;  3OFF A;  3GP9 A;  4HEA 9;  4W4M A;  2IJN A;  1G7C B;  3FCH A;  4HHU A;  1RWP B;  1HD0 A;  2GGP B;  4ZIW A;  3PX0 A;  4NLW A;  1N48 A;  2BRK A;  1HWL A;  1SV5 A;  4IQM A;  4YP3 A;  3QWU A;  2Y8W A;  4IFY A;  4ZMM A;  2DKO B;  4ECT A;  1F9H A;  2JFD A;  3NBP B;  3V4I B;  5HAN A;  4JI6 F;  2FYX A;  3BR8 A;  2AX1 A;  1UVL A;  4ZPV R;  2MLZ A;  2Z0G A;  2UV8 A;  3O5T B;  4QR1 A;  4USK A;  1WC3 A;  3SQG B;  5HMW A;  4CDI A;  3BSO A;  2XY5 A;  2C3P A;  2C2Z B;  2IRY A;  3DU5 A;  2OJ3 A;  1UFL A;  3DHW C;  1A0O B;  4O44 A;  3ZZR A;  3PW0 A;  2RRA A;  1O5J A;  4JI5 J;  3SV4 A;  1TP7 A;  3CCZ A;  2E1C A;  2MHN A;  3ULH A;  3TVZ A;  1LWX A;  2YWH A;  3MD3 A;  4JBC A;  4YME A;  4ED7 A;  2XTJ P;  3KNG A;  5JXS A;  3PFE A;  1IBK J;  4QWA A;  1HIY A;  4QOT A;  2HEK A;  1FNX H;  2NZC A;  2J0S D;  4GKJ F;  4RUA A;  1IVZ A;  1H7W A;  1NND A;  2P6S A;  2I38 A;  2E9Z A;  2D1C A;  3GZ7 A;  1J5E F;  1IM6 A;  5IZH A;  3P96 A;  4RJV A;  5HL7 Q;  2LXF A;  3IFE A;  4RUB A;  3UR3 C;  3ZNJ 1;  4EGL A;  3OR1 A;  4CCH A;  4A8X A;  2ABY A;  1RTI B;  4O4R A;  4W92 B;  1UAW A;  2H9Z A;  1VFJ A;  3NRB A;  2VOD A;  3LWL A;  4X66 F;  3F56 A;  3JB9 k;  3CXC R;  4P7V A;  1BUX A;  5E3A A;  1HQE A;  4X4T A;  1WOS A;  2YH0 A;  4J5O A;  4IR1 A;  3CJT A;  2X1F A;  4YDX A;  4F4X A;  3A12 A;  1Q8K A;  2BE7 D;  5C7P A;  3MM7 A;  3OHB A;  4ZVH A;  3AD8 C;  1YJU A;  1WNE A;  1FHT A;  4HKQ A;  2FVS A;  2HFZ A;  3U1M A;  4OX9 J;  1MMN A;  4B9U A;  4DL3 A;  2Z2L A;  4ENO A;  2C2R A;  1BQN A;  2JZ5 A;  4NYZ A;  1AXQ A;  2X51 A;  3CCM S;  2JH3 A;  5KT5 A;  2MGZ A;  4LF4 J;  2KFN A;  2JVO A;  3H20 A;  2AMC B;  3BM7 A;  2HRY A;  2DHS A;  3TW0 A;  4USV A;  1Q7Y T;  4B3O A;  2IVM A;  3M2U B;  2NSC A;  4KGX B;  2V8D A;  2F4V F;  1IR2 A;  2AX0 A;  3E8O A;  3DGP B;  3QIP B;  4Y34 A;  3NNA A;  2AGQ A;  2DR9 A;  2IA6 A;  3L7O A;  5MLC V;  2FGC A;  4CTA B;  2RQM A;  2V2K A;  5EX3 A;  4RBV A;  5HJY A;  4UW2 A;  4PQU A;  3QRQ A;  1WC5 A;  2BQ3 A;  1ZPV A;  2YNF B;  2XC9 A;  3PO4 A;  3MEG A;  1SXL A;  1OY8 A;  4U8Y A;  4LF1 A;  2ERR A;  2V67 A;  2V8V A;  4ZIT A;  5HP1 B;  1H2U X;  4RNM A;  4C4W A;  3IS9 B;  3QMQ A;  1GNK A;  1V9O A;  2VD3 A;  3QGH A;  1T9X A;  2AJ0 A;  3K2Y A;  1AZS B;  3P8B B;  2XCA A;  4DV2 J;  4RZR A;  1DAX A;  3UDV A;  1NDP A;  5T7L A;  2MKK A;  2HND A;  1YWX A;  3HKW A;  1YBA A;  4TNO A;  5A0Y A;  2JEI A;  5KFX A;  1U09 A;  3R5B A;  4F26 A;  3VAM A;  5J1E A;  5JVG Q;  4G3I A;  1S0V A;  2AYE A;  1FVS A;  3NAI A;  4IR9 A;  2DNQ A;  2EW9 A;  2LQ9 A;  2QFI A;  3D6F B;  1PYS B;  3PR4 A;  5KFD A;  4RW7 B;  1GMU A;  5KFS A;  1ZYQ A;  4KQZ A;  4QIE A;  2F7V A;  1T03 B;  2CVI A;  2QLX A;  4LF5 J;  2VC1 A;  3VWS A;  2V2Z A;  3R7B B;  1PC4 A;  1UWA A;  4UF4 A;  3UWT A;  1FRL A;  4F0H A;  1KTQ A;  3KMQ A;  3DLK A;  3QRP A;  2YWK A;  4L73 A;  4LQ9 A;  4LF7 J;  1HFE L;  5H9E K;  2W2N P;  1KOO A;  2PDA A;  5B7W A;  1F60 B;  3M2V B;  3DXS X;  2HRT A;  4DG1 A;  3D4J A;  2F9D A;  2WAQ D;  4DL4 A;  4JV0 A;  3DLB A;  3RG6 A;  3C3L A;  2XS5 A;  4B3R F;  1OIA A;  2E5J A;  1AFJ A;  3MTK A;  2NCK L;  2X1A A;  3I0R A;  2MKI A;  2WB4 A;  3W8P A;  3KJV A;  2AZ1 A;  3MZI A;  1EB0 A;  5LM7 E;  1DTT B;  1RT6 B;  2FZG B;  2HNY A;  4MK7 A;  1U2F A;  1EX8 A;  3P49 B;  1NZ8 A;  3M05 A;  4ILR A;  3JAM U;  1S59 A;  1P1L A;  4WFZ A;  3U7J A;  1NK8 A;  3IRX A;  2A2C A;  4B3S J;  1WC0 A;  1YDL A;  3QSY B;  1B0T A;  1E6Y A;  1JLF B;  3DU6 A;  4FKY A;  4OYM A;  2Q43 A;  1PBU A;  1X5P A;  4QBU A;  3C66 A;  5KOX A;  2ZJP Q;  1KOH A;  4LT6 A;  1NKC A;  2G13 A;  3LAK A;  2MZQ A;  1VQP S;  2I6W A;  2PGC A;  3DI6 A;  4LSL B;  1SJ3 P;  5F0W A;  3OT9 A;  1X5T A;  2YQ3 A;  2BAN A;  1CSJ A;  4QJV A;  4PQU B;  1UJ4 A;  2ZFH A;  1EP4 B;  2HHW A;  2IMO A;  3WX4 A;  4HI2 A;  1SQG A;  2LP4 A;  3IGN A;  3MEG B;  4PZV A;  3I5C A;  4A4J A;  2UUC F;  3CC4 S;  2DY9 A;  3N6N A;  2QG9 B;  3BJY A;  1VYA A;  4IOC Q;  1Y9O A;  4B9S A;  4LF2 A;  1XQI A;  5AXL A;  2BM0 A;  1Q8L A;  2YWE A;  2AEF A;  4LRB A;  5F8G A;  1ROF A;  1FKP B;  4Y0F A;  2FZK B;  4DPY A;  2K2P A;  3HLU A;  3A4T A;  1Y10 A;  2H65 B;  2OPS B;  1EKS A;  2UZA A;  1VQY A;  3N4W A;  3RBX A;  2YQ1 A;  2QJ3 A;  5KFW A;  3FMW A;  4BCA A;  4AFF A;  1ZBT A;  3KLE B;  4QIV A;  5IV3 A;  3T9N A;  1KEK A;  4ZHR B;  3NWR A;  4RU2 A;  3AA8 A;  1S48 A;  2N4C A;  3N79 A;  4MIA A;  4N8O A;  2DVI A;  4UY8 5;  4OZ3 A;  1ZAW A;  4Z37 A;  3W9J A;  1KHW A;  3H90 A;  4QU6 A;  3KLV A;  3EJM A;  3NG8 A;  3KUE A;  4MKV A;  2DNN A;  2R7R A;  2F8E X;  2W2Q P;  4H4O A;  2HQI A;  3UNG C;  2DR5 A;  2ALY B;  1XNQ J;  2HQG A;  5ITH A;  2B6A B;  1HQE B;  4X4O A;  2FLO A;  1RT3 B;  2WBR A;  2RAQ A;  5DS7 A;  4ZP6 A;  1B70 B;  3FFI B;  4GMK A;  3SFG A;  1UKU A;  4CLZ A;  3T19 A;  3S6E A;  5J2N B;  3KFW X;  4DPW A;  3P6Y C;  4CO4 A;  1RBO B;  3W7B A;  4UOG A;  3K5M A;  1VLY A;  2X3D A;  5F3T A;  3TEH B;  4RBU A;  3VGU A;  5M2P A;  3K58 A;  3Q23 A;  3AT1 B;  4EBC A;  1S6Q A;  4DL2 A;  4NPO A;  4RW6 B;  4O0N A;  3H2L A;  5DET A;  2CNK B;  3QZ8 A;  4B9V A;  3UPF A;  1FFS B;  4F3Q A;  2M88 A;  3T41 A;  1B7F A;  2PA3 A;  2E44 A;  3DKD A;  4OZ5 A;  4NI2 A;  2CQI A;  5L1I A;  3ILO A;  3M2R A;  4GC6 A;  2Z30 B;  3A8E A;  2M9K A;  3RGI A;  3TNV A;  2RQ4 A;  2EFG A;  3FBE A;  3MEE A;  3R7N B;  2UVR A;  2VON A;  4DSK A;  1RSC A;  2ZZM A;  4ZJQ A;  3G2X A;  3J81 U;  3CME S;  1AUS L;  1IKV B;  1WDT A;  4KPY A;  1LFW A;  5D4N A;  3HJV A;  4P72 A;  4JB8 B;  2R7T A;  1U7L A;  3PKY A;  1NSA A;  3HD2 A;  2R4F A;  2GJI A;  3J7Z T;  2HBQ B;  2V68 A;  4Q0B A;  4DCO B;  2IM0 A;  1UW4 A;  2B5J B;  2BQR A;  1HPZ B;  1P9Q C; 
#chains in the Genus database with same CATH homology
 3KJF B;  1BMQ B;  2P2C B;  3KJQ B;  2H4Y B;  3GJT B;  2DKO B;  3P45 B;  2CNL B;  3P4U B;  1I51 B;  1GFW B;  2FQQ B;  2C2Z B;  1RHJ B;  1RHU B;  3D6M B;  3D6H B;  2CNO B;  2QLJ B;  4LSZ B;  5IC6 B;  3IBC B;  1RWW B;  2H5J B;  1RHQ B;  1RWX B;  1F9E B;  1PAU B;  3GJQ B;  4ZVT B;  4ZVS B;  2XZT B;  1IBC B;  2CJY B;  3R6G B;  2HBZ B;  2CDR B;  1RWK B;  2QL5 B;  4ZVP B;  4ZVQ B;  1QTN B;  4DCJ B;  3NS7 B;  1RWO B;  2XZD B;  5IC4 B;  3EDR B;  1RWM B;  2CNN B;  2H65 B;  3EDQ B;  5K20 B;  3GJR B;  4ZVR B;  1RHK B;  2CJX B;  2HBR B;  2Y0B B;  2XYP B;  2H51 B;  1RHR B;  1RWN B;  3IBF B;  3R7S B;  2H5I B;  3GJS B;  2C2K B;  1SC3 B;  1I3O B;  2CNK B;  2C2M B;  3R6L B;  2HBY B;  1QDU B;  1SC1 B;  2XYH B;  2XYG B;  2QL9 B;  1PYO B;  3KJN B;  2C2O B;  1RWV B;  1SC4 B;  2H48 B;  4ZVO B;  3RJM B;  2Y1L B;  1RHM B;  2H54 B;  3D6F B;  3R7N B;  2QLF B;  2H4W B;  4DCP B;  1NME B;  2QLB B;  3R5J B;  4ZVU B;  3R7B B;  4JB8 B;  3SIP B;  1ICE B;  2HBQ B;  3QNW B;  4DCO B;  1RE1 B;  2QL7 B;  2C1E B;  1RWP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...