2HBQB

Crystal structure of wildtype human caspase-1 in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title A Common Allosteric Site and Mechanism in Caspases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 17
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2hbqB00
2CJXB 3GJRB 1RHKB 2QLJB 1RHMB 3QNWB 1IBCB 3EDQB 2H65B 1ICEB 3R6LB 2Y0BB 1PAUB 3RJMB 2Y1LB 2QL7B 5K20B 3D6FB 2XZDB 1QDUB 2QLBB 2H5JB 2C2MB 3KJNB 2CDRB 2CJYB 1RWPB 3R7BB 4ZVUB 2C2OB 2H51B 3KJQB 2QLFB 3EDRB 3SIPB 1RHUB 2HBRB 1I3OB 1RWKB 2QL9B 2CNLB 1SC1B 2H5IB 2HBZB 2P2CB 3R7NB 3GJQB 2C2ZB 3D6MB 3GJTB 1BMQB 3D6HB 1RHRB 5IC6B 4ZVOB 3R7SB 1SC4B 1F9EB 2H54B 1RWOB 2CNOB 1QTNB 2XZTB 4ZVPB 1NMEB 2C2KB 2HBQB 3P4UB 1RWNB 1RWVB 4ZVSB 1GFWB 5IC4B 3IBCB 1PYOB 2FQQB 4ZVRB 1RWXB 2H4WB 3GJSB 1SC3B 2CNNB 2XYHB 2XYGB 4JB8B 2XYPB 4ZVTB 3R6GB 1RHJB 3P45B 2C1EB 4DCJB 1I51B 2CNKB 4ZVQB 2DKOB 4LSZB 2HBYB 3NS7B 2H4YB 1RHQB 3KJFB 2H48B 4DCOB 3R5JB 1RE1B 2QL5B 4DCPB 1RWMB 3IBFB 1RWWB
chains in the Genus database with same CATH superfamily
1GXLA 2FTRA 3GE9A 3ISNC 1RTDA 3TEGA 4JBCA 3CSKA 3FMWA 4QIFA 2VBXA 2B4OA 2LXUA 3HT0A 1RU2A 1E6VA 4NA2A 3K0JA 2C2MB 5DG7A 2FY1A 4I7FA 3TUZC 5HJXA 4M8LA 5D8HB 1XR5A 1WHYA 2XI2A 2MLYA 2VC1A 5D4OA 4N7TA 1CC8A 1GXUA 1LK7A 2P2CB 3CC2S 1N8RT 4QWEA 5J2PB 4ALZA 3DRSB 2CNOB 2NSBA 4ELUA 2Q6BA 5KG0A 1FJCA 2YNFB 2C3YA 2D7SA 3AB2B 2PC6A 4UOHA 2YNIA 3AFGA 2W2OP 2G0IA 5E3CA 1Z1ZA 2M8DB 8ATCB 1BD6A 2OHDA 2ATLA 3DM2B 3KWMA 3RAXA 1NBEB 1ZETA 1ELOA 1RHQB 2F40A 3H2UB 4X4PA 1SL0A 3ZNUA 3HKZD 1S9EB 1C0UA 4FS1A 1WG5A 2HEKA 3QIDA 1M5KC 3MMAA 4OHVA 2ZHAA 2R7QA 1JLBA 2WVFA 4J9PA 4WU2A 3ENAA 1L3TA 1KBRA 1N36J 1RWPB 2V8PA 3KHHA 2VG7A 2YY3A 2C28A 3HHLB 1REVA 5C42B 4XDDA 1N36F 2QA2A 4OX8A 4UF4A 4NLOA 4V19J 5KFQA 1IKXA 2NXCA 4PQUA 3JSYA 2R9LA 3CD0A 1VQ8S 2AV5A 5HQ8A 2IVMA 4QWBA 3OTDA 1FRLA 4KH1B 2GJFA 1WTBA 5KOWA 4DUTA 4RU2A 3MF5A 3TANA 5CD4A 2GNKA 2MB0B 1VRUB 4J9UE 1NCLA 5J2NA 5IWAJ 3S7RA 3CDWA 3ILLA 2F8HA 3KG0A 2OAUA 3EZUA 3D9BA 5IWAF 2MQ8A 2RSQA 1CVJA 2CQIA 2WSFC 4B9SA 2CZVC 4ECVA 1F3VA 3BGLA 2CJBA 3KHLA 4K5SA 2XLJA 4NE9C 3ISZA 1Y11A 4ED4A 3EE3A 2QX0A 2J9DA 1HL6A 2FY8A 2MKIA 2YNGA 1TKTA 3JSMA 5DO2A 4KGZB 1Y3KA 5F0UA 1F5AA 2VKZG 4NZ7A 2AMCB 4HT7A 2HYIB 3ZZYA 3LH2S 2RUGA 4I69A 1R0CB 2K7KA 2W1BA 4ID5A 1TP7A 2A2DA 2KZMA 3LA0A 3W3SA 1TTHB 2YKAA 1VMBA 3CPWR 1FDAA 5HLFA 5HMZA 3CJ4A 1VBXA 2AZ1A 4JI7J 2HNZA 4CT8A 1NAQA 3HJFA 3B6BA 4N76A 2LYVA 4KQZA 1RWVB 1MW7A 4JI7F 5IC4B 3UVJB 1PYOB 3DOMA 4MKVA 2R8GA 2LLZA 4FYDA 2B6AA 1IBLJ 2JEJA 2R8IA 1IUJA 1FCAA 4DPWA 1IBLF 2YWHA 2VA3A 3NGKA 3W66A 5CAAA 5A8KA 2ZDOA 3NMAA 4C8OA 2FHJD 2FJAB 4RJVA 3BBFA 1PAUB 5J2MB 1FO1A 2I8EA 2EBGA 2L9DA 2DNYA 5F8IA 3VAMA 4DQPA 1H38A 3ENQA 4H4OA 3SCLE 2HQIA 4FPRA 3FEZA 1NHKL 4R5PA 1R0BG 1RWKB 1UPMB 2BJEA 1NDCA 1JLAA 1AA1B 3W1YC 4AT1B 4I68A 3L7OA 3IFEA 3QO9B 4OZJA 2L08A 2H9ZA 3HVWA 3ZZ0A 1GTEA 4FNIA 2KT2A 2W2MP 1X9WA 1HHQA 2DO0A 3C46A 1F2HA 3EGZA 1YBUA 2DK2A 3OUYB 3MMJA 4WFXA 3GV7B 2ALZA 3ILJA 5B09A 4DZDA 4EO6A 3Q24A 3HD1A 5A0YA 3U1MA 2HVHA 5GAEU 1EKRA 1H3DA 2GIQA 3NGUA 3ENVA 1Y9OA 1CEZA 1VOMA 1K8AT 1HBUB 1VK8A 3DRRA 1MSWD 2CIMA 4B9LA 4UOCA 2Z2MA 5AE3A 2PSZA 3CE8A 2ZD1B 2A18A 3VAJA 4F3QA 5LSRA 2GVZB 2QL7B 3VTIA 3FSIA 3O3LA 4K4TA 1CJVB 1TMJA 4CQ1A 2OPPB 5DDRC 3PVXA 1DQAA 3QIPB 4C8KA 3P49B 3GPAA 3QGGA 2DNOA 1IBKJ 3J81U 5E0OA 1NJWA 3KHGA 3L09A 3PRVA 1IBKF 2VZ9A 2M0GB 2CVIA 1T7PA 4B02A 2MKCA 2GHVC 2KL8A 1DQ8A 3FFIB 1NMEB 3OFGA 1YKWA 2FHJA 3D68A 5CYJA 5EX3A 3NGSA 3LAMA 3M2RA 3FDSA 1QSLA 2HURA 3EVWA 3E01B 1FFSB 4JI8J 3VGSA 3JYTA 2MZSA 4DL5A 5CZXA 2XY5A 3DCAA 3CJKB 2LFVA 1D8ZA 5E3QA 2W24A 2PEBA 1KVJA 2M8HA 4JI8F 2HBYB 1WC0A 5J1PA 2WRMA 4OHWA 1U2CA 1RWMB 3MFHA 1N4LA 4OX6A 4P73A 4ZMMA 2BJ7A 4IR9A 4U9RA 4DV7J 1QD1A 4X4QA 1VFJA 2CPIA 3G96A 2XSJA 1YX2A 4PWDA 5IT4A 4NLVA 2FJBB 1SJFA 1I6JA 4KT0C 4DV7F 1N0UA 2XS2A 4NOHA 6FDRA 3TX0A 3X1LB 4F2SA 1QJHA 4ITSA 1T0TV 2RDDA 1IBMJ 4OHYA 4DI6A 1RKIA 1WDDA 2QG9B 4C4WA 2FHOB 1OY9A 3QSIA 4X64J 1IBMF 2HHSA 2H5IB 2AD9A 1X7VA 2E29A 4AYBD 3LWLA 3MCMA 1WUUA 2ZH4A 3GJTB 2G2ZA 4X64F 1TL3B 3D54A 5FJ4A 2W4PA 4Q45A 3GWCA 5DLGA 4ZVRB 2AGQA 1SC3B 2LQ5A 3MEEB 2XNQA 2DH8A 1DTQB 4ZPWR 1LWFA 4BS2A 4KBIA 2DGTA 3R8YA 2R8HA 2D1CA 3F0NA 2MY8A 3MEGB 4OZ3A 2WONB 2HHHJ 3CJ0A 1KVKA 5KFLA 4WK3A 5H9FJ 1FRIA 4X65J 3PW0A 1N5SA 3TUPA 2HHHF 2O67A 5DJBA 1ICEB 5J2QA 2B4VA 2BQ3A 3M05A 4PG4A 4USIA 4X65F 3TUIC 3H90A 4OYIA 4ECSA 3OHBA 4W90B 3AY0A 2XBPA 5DETA 3FBCA 3FQLA 1RWUA 4RW8A 3N0VA 3BGRB 1VJQA 4CWBA 2IYIA 1CJTA 2RDIA 1R8BA 3MECA 1FD2A 2K8GA 1YRUA 4EEYA 1FWLA 1O0PA 3EXYA 3G8QA 1B64A 2KTQA 3VAGA 3DMJB 3DOKA 3RB6A 1W2IA 5K9FA 4LBHA 1OMSA 3HSJA 4USKA 1UZDA 4JV0A 1N88A 3PEJA 4Y6IA 5A8RA 1RYSA 4XIUA 2NQPA 5T7LB 2HAIA 3TAPA 3SQGB 1JKHA 1EP4A 2YWKA 4MIAA 4DPUA 2ZM6J 5J1EA 1BQMA 3AQOA 2OPSA 1XNRJ 3WDOA 4U7CA 1PKUA 2ZM6F 2VQEJ 4J37A 1B7YB 2OTLS 1RU1A 3BSNA 1XNRF 2VQEF 4QWDA 2W25A 3OFEA 2GGPA 1FKPA 4A8WA 3GIMA 4Q7AA 2CQ1A 1FTRA 3QGHA 4OYBA 1WHXA 4ZCKA 2PFDA 3TJ9A 4DF4A 3R2CJ 3RRHA 1FRMA 3CT9A 4JYAF 4H4KC 1X60A 3PRBA 3W8PA 2ABYA 2LQ9A 5C7PA 4Q8EA 2E9TA 3QLHA 3DFEA 2QE5A 2PI4A 1TELA 3I82A 1HNIB 2UV8A 4N8NA 4MFBB 3J7ZT 2CJQA 4CO4A 4LF6J 1RP5A 1VQ9S 3BV8A 2EC2A 3ITHA 2VPXB 4LF6F 3V2UC 1U2FA 3J81Y 1R89A 3IR5B 1M1KT 2HSEB 2IM1A 3NCRA 2CQHA 4RUAA 1CS4B 1LW0A 4F4KA 3EXCX 3B4DA 3QQCD 3OVBA 2LMIA 2M9KA 2YKMB 2Z56B 3UFCX 2CAJA 2LKZA 3Q22A 1X4DA 5KOXA 3CW2C 2NUUG 3UDEA 5HP1A 2X3DA 3ZTOA 1D9FA 1BY9A 3W2WB 3MMBA 3TA1A 4YQWA 1VQYA 4PABA 2OFGX 1FTCA 4HI1A 1U2RA 1JLGA 4Y00A 2VFSA 4B3TF 3D1OA 4Q44A 3DLJA 3GSDA 3M8ZA 4FXWA 1MNEA 1U1QA 3GIRA 1XWLA 3I0RA 3VZHA 3UWTA 3G86A 1IXKA 4NEYA 2XQCA 2YKOA 2VJUA 4G3IA 2V2VA 1FDDA 1D0EA 3R6GB 4DU7A 1NXIA 3MM6B 2BANB 4CM0A 3DRPA 1LNQA 4DV5J 2Y3YA 3MPDA 1U1MA 2P5VA 2HQFA 3R5JB 1H2VZ 4B3OA 3I4HX 3K5LA 3WQPA 1AYEA 1LK5A 2AW0A 1W25A 2RB7A 1N5YA 5B0FA 3DN9A 5HANA 3DLGB 2B3TB 3EICA 4L6V3 4K4UA 1Q16B 4WFYA 5H9FK 3D0IE 3MM7B 4A8XA 4CRJA 5GMKa 2OLWA 4WBFA 3M6VA 2ZE2B 5KTQA 4OMFG 2DXDA 4I2QB 1RT7B 1C2PA 4WYWA 4P52A 2DGWA 2CWXA 2RIJA 3OW2R 4UOGA 4I1TA 4CTAA 3PACA 3CD6S 4ATNA 1IKVA 4TU7A 2BABA 3S01A 4KAIA 2WW8A 4OI3A 1YJ9S 4FYVB 4YY3J 2NXUA 1X5TA 3IWLA 2EBEA 4KIAA 4YY3F 1BLUA 4AXIA 4M94A 1BGXT 1NK9A 4DR6J 1NSPA 3MR3A 4F4YA 1T9VA 4UZCA 3NS7B 4DR6F 2DXFA 2X1BA 2XNRA 4Z37A 3BEGB 1PJ6A 2CQ0A 3OR1B 4M5IA 3TR5A 2D69A 2UXCF 5J2PA 4TLRA 2NXNA 3DRSA 3D3BJ 4LT6A 2OD4A 4A8FA 4HR2A 4ES1A 2UXDJ 3D6FB 4BC7A 8AT1B 2Y1JA 2YNFA 1S0VA 3DNCA 1NH7A 2ZBPA 5KG3A 4OYOA 1TU0B 4YB1P 2IMOA 2G0JA 1IKYA 2UXDF 3KK1B 2LA4A 2V9KA 4Y3CA 4UZBA 3OTEA 2GQQA 4ZVGA 4ZKAA 4RUHA 2FZGB 3DM2A 1KFDA 5IS2A 3BKTA 3IN5A 4LF5J 4PRFA 1IJEB 5IT9U 2ATCB 2AYEA 3GFZA 3ENWA 1FXDA 4RL1A 3QYYA 2H54B 1I1GA 2BM0A 4JI3J 1S9EA 4RBTA 2M4MA 3KKFA 1JMTA 1EQMA 3W5ZA 2KG1A 1VBYA 3HZGA 5JXSA 5K14B 1RTHB 4F04B 4NLGA 4JI3F 2OP5A 5AXKA 5KFOA 1UVLA 3NS6A 2VOOA 2E9RX 1VGYA 3K17A 3JB9k 2B5JB 4ZN3A 3FC9A 4OI1A 3ZTRA 4DSKA 3HVAA 1CG2A 1SVDA 5C42A 2E9ZA 3BS9A 2MZTA 4DOZA 4USVA 3N5FA 2DGSA 2I9SA 1TK0A 1ZYQA 1WACA 4B3MF 5F8MA 1LWXA 1TVRB 2HS3A 3POTB 2O5DA 1HMVB 1KR4A 2MQPA 2AWZA 4EBEA 2NZCA 3Q8VA 2G0CA 4M5HA 2F4FA 2OPRA 3JTNA 3PR4A 5A8WB 2ZUGA 4O3PA 1VRUA 3Q8SB 5HVGA 3FZBA 2C2OB 1OSDA 2KYXA 4O3NA 1EIYB 3TQ1A 3NGRA 4P7VA 4XPEA 3BQ1A 4DU8A 5HMWA 4ZP6A 3CCSS 1FNOA 3IGNA 4UUWA 2K3KA 4K2JA 5HBMB 5KFEA 2WVCA 5H9EJ 4FF1A 4O4RA 2YX1A 3GSIA 1RBLA 2O66A 4WKYA 4YB7A 2XM3A 2EXUA 3M8PB 4F4WA 3OFFA 4AD6A 4KJIA 4C0HA 1Y0HA 1WC6A 4TQRA 1F60B 2HK2A 3CB4A 4E8UA 1RLDA 1ZH5A 1SCJB 3O5TB 3P6YC 3D1QA 2GO9A 1CJUB 1S5ZA 2BKPA 4USUA 4ZCMA 3W64A 3KK3B 2V2KA 4FKYA 3QT7A 2M3DA 2C3OA 4K8RA 4C8LA 2XS7A 2B4PA 3UVJA 1D09B 4FS2A 3D4JA 2WBMA 3BGUA 3IWNC 1Z2ZA 1N5VA 2RRNA 4DSJA 4IUFA 2QYCA 1X4CA 1RTIA 2PE8A 4DV2J 3DLEB 1MG7A 1GX5A 2AJFE 4KYZA 4LMZA 4PXEA 4DV2F 5J2MA 3PJWA 2KVIA 2LEAA 1Y5NB 2MQNA 1VJWA 2ZWPA 4K4SA 1WC4A 1IWAA 1RZMA 4DFMA 1NK0A 1KQKA 2LDIA 5T41A 4WPAA 2HWHA 2JEGA 1JXVA 3TW0A 3VF0B 3QO9A 1CC7A 1G6BA 2V8VA 3V6KA 2DHHA 3ZZOA 3QT5A 3CJ2A 4UQTA 4JI1F 5CYMB 4LRBA 2ZDPA 4EZ9A 2MQOA 4NWBA 5EWEA 1FK9B 3THPA 2IC3B 2VG6B 5F8GA 3HKWA 4BWJA 5J1NA 3D1HA 1YI2S 4ZLNA 1AT1B 4ZVHA 3MAAB 1HBUA 1NNDA 5L9XA 4YUDA 2FJWA 1SIWB 2V63A 4JV2A 2PI5A 2ZD1A 2J6SA 5C5JA 1WD6A 1W2BR 2HNYB 3CDUA 2AZ3A 1CJVA 2ERRA 4P71A 4OQJA 2GV1A 5HQLA 3UNGC 2VPYB 3QIPA 1RDRA 1N32J 2CWKA 2V34A 1RTJB 5IT9Y 2Q43A 1QM9A 4PXBA 2DR9A 3M32A 1N32F 2DR7A 3IBFB 4DBQA 4O3RA 2YKNB 4LF7F 3OV7A 4M95A 2XSFA 3A8IA 2HFZA 1NDPA 2E5LJ 4OZNA 2QIFA 3IWXA 2VU5A 3PX4A 2E5LF 5E41A 3NAIA 3KHRA 1RCOB 4CYUB 4L74A 3L3CA 1RT2B 1B0VA 3E01A 1GMWD 3RBXA 3V6DB 4K5RA 1SKSA 3LGHA 2AYBA 5ETTA 4Z7CA 2N3LA 2F8EX 1V5VA 2MDAA 4LF1A 2K7JA 4WZMA 3CJKA 1U47A 1OQ6A 1SJ3P 4J9KA 2BW2A 2AJQA 1RUSA 1S6QB 3ZZRA 3OBIA 2DGVA 1YVFA 4HDHA 1ZA2B 3JQJA 1J2VA 4ERDA 4ILLA 2UVRA 3MXHP 5IT0A 3GFHA 1Y7PA 3BF4A 2P6TA 5H9EK 1HPZB 3H0PA 2FVCA 1P1LA 2FDNA 2H4YB 5DLFA 1FX2A 4KPYA 2Z8QA 3GFYA 2UUCJ 4OLPA 2XEXA 4RU9A 1RHKB 5ETQA 2B7CB 5KFDA 3T1HF 1TL3A 4H4MB 2UUCF 1SC6A 3ZFVA 2KHDA 1FJ7A 2CRLA 2CFXA 1S12A 1VIXA 1RK8A 1TFWA 2GQ2A 3X3UA 1YJRA 3C15B 3IG1B 3NCQA 1S99A 3A3PB 4DR5J 2MLZA 2XGQA 3MEEA 2HBRB 1DTQA 5EX0A 4M5MA 2CXEA 4QPXA 4HHHA 3MEGA 4ZJLA 4K4VA 3CCJS 3DU6A 4Q5VA 2JFKA 1JWWA 1UW9A 5LXYA 3NNCA 2BBEA 3CCRS 4ECUA 1D1UA 4DS5A 1T94A 1KLNA 3AD9C 4MKYA 4B08A 2XGPA 2XHCA 4LF8J 4Q2MA 2HIYA 3N5BA 4RLEA 3BGRA 1UFKA 2W9AA 4LF8F 1GMWA 1NSQA 3QRQA 4RKUC 5KG2A 3IM8A 5BYRA 2CPZA 3AJ1A 1HWIA 3RB3A 2COLA 2FVRA 3GR0A 1GMUA 3ICLA 3DMJA 4O3OA 2BZ2A 2EKNA 3NLCA 2M88A 2HRTA 1CULB 5F3TA 9RUBA 1Q8IA 2B9XA 1QLNA 3UDVA 3HF5A 5T7LA 2GMHA 2J5AA 3SQGA 1VBZA 4OI6A 3LP0B 4DPOA 5I42B 2P9GA 4RNFA 2A0FB 2MXYA 5ETPA 3ZTSA 2HQGA 3QJLA 3UD5A 4LBPA 3FQKA 1HNVB 3QFHA 2K06A 3TAQA 2QN6B 4TLQA 2WVDA 4LRDA 1S1VA 2W4DA 3H2LA 5HVHA 3CVKA 2VODA 3J81j 3QRPA 5G0RA 2OIHA 4C11A 4ZLPA 1HNWJ 4YOEA 4J9NA 1HNWF 3M8RA 1RYRA 4MFBA 4K4XA 1JXLA 3MPUB 1T11A 3M4XA 2QEXS 1VC0A 1YJWS 1RTDB 3GMGA 1TKZB 3QSYB 2LCWA 3BGFA 1S9GB 4RZRA 1PAEX 4IG0A 4USTA 1TK5A 3H5XA 2KJWA 3K2YA 2YKMA 3R7SB 2A6MA 2AF6A 4Y34A 1R8CA 3QPIA 1VR6A 4X4SA 5KT7A 4DL6A 4A46A 4DL7A 2IM3A 2A3JA 3EZOA 4ED2A 4F4XA 4M5KA 3K8WA 4PWWA 3ZTQA 3D6TB 4XPCA 2B9EA 5KG6A 3W2WA 2WSEC 2JSXA 5B0BA 1APSA 1EQ0A 5LMNJ 1U0SA 2YNHB 4NLPA 4I0WA 4LRCA 4GMKA 2JNJA 4RW7A 2YNIB 4U6PA 5LMNF 1RE1B 2J7UA 3DOLB 3HMJG 4LQ9A 4OZ1A 1F9FA 3M6WA 2DNMA 4PXDA 1ULRA 3BB5A 1M90T 4ZHRB 1ACMB 5HK4A 5KFTA 5HN0A 3PHEA 5FDLB 2EWHA 1X4HA 2DYAA 4JV1A 2M7SA 1VK3A 3AH6A 4A4JA 3CJTA 3MOZA 4FVCA 2AX1A 3EM1A 4ZLLA 1ZAVA 2B8PA 3MM6A 2ZJQQ 2BANA 4LIRA 3T5KA 2A10A 2QTWA 1JX4A 3CWJA 3HP6A 2OKQA 4WFNQ 3D6HB 1REVB 4CDIA 4RBVA 3VAFA 1LWEB 1N0VC 4OHZA 5T14A 3DLGA 3MEKA 3UW1A 3T6JA 5KFZA 3DGVA 4DZ6A 4ZIVA 1MN7A 3J7YI 4J9SA 3NGTA 2VB6A 3MM7A 1TL5A 4P7TA 5J2NB 2ZE2A 1JJ2R 2DHGA 4I2QA 4FNHA 4OI4A 2J76E 5SZTA 2KJVA 3IAM9 2B8QA 3HVRA 2QLBB 4OJ3A 4MTPA 2CDRB 4WZQA 1R6VA 1U6BA 2XY7A 4X4OA 4CO2A 4CO0A 4EGLA 4EYHB 1KNZA 5HATA 1ZA1B 2RU9A 2N7YA 2KG0A 2LA6A 1P9QC 3I4PA 2FGOA 3H25A 3OR1A 1YK9A 2WK4A 3HFKA 3WBZA 2RJZA 1MMDA 2XWYA 5KFWA 3OLAA 2V0NA 1LV5A 4WIQA 1VHFA 3BREA 3G9CA 2KO1A 4PYAA 2V4QA 2HNZB 2VD3A 1I51B 5F8LA 2ROEA 5C25B 3GCXP 2JZ5A 3IC1A 3OT9A 2C2NA 2BVZA 3HFZB 1YWXA 4USJC 5IOLA 4CLKA 1GX6A 3H7HB 3KLHB 4AQYF 3PW5A 1K1QA 3AD8C 1U09A 1ZAWA 3FBFA 4EYIB 5HO4A 2I5JB 5A8KB 4P2XA 5K14A 3PX6A 5DM6Q 2HPUA 2AJ4A 1SUQB 2B5JA 3MOJB 3VGVA 5ETNA 4UTGA 3RBZA 1HQUA 1WOSA 2HBZB 4B9MA 2OD6A 1TAUA 3N79A 1ZPVA 2V4RA 2BUNA 1KTVA 1JLAB 1PBAA 3PTWA 1HMVA 4EFAC 1CPZA 4JP8A 2YQ3A 4F25A 1DJ0A 3L9ZA 1FXLA 2DNQA 4XTTA 5A8WA 1U49A 2XMUA 3GQCA 4N8OA 2XO6A 2DHXA 4F36A 1JLFA 3T5JA 2DITA 2GCFA 4NLXA 1PSDA 2YX4A 4YB5A 3PYEA 1LXNA 4HYKA 2EW9A 3VALA 4WXOA 3NNAA 3L7UA 3KFWX 2BJ3A 2G2YA 5HBMA 2WW4A 1U7LA 2KT5A 3R5BA 3M8PA 2HKEA 3M2UB 4JI6J 5E3PA 3VQTA 3M9OB 4JI6F 3RU0A 1VRTB 4CLFA 2HVZA 3D0HE 4LSLB 3EDRB 1CQMA 3MZIA 5B0AA 5A2QU 1ZBTA 1OPZA 2CPJA 3DLBA 1UWAA 3MURP 3EPGA 2VF3A 4IFVB 1CJUA 1OS5A 3MAQA 2QSWA 3SSQA 4DUZJ 3KK3A 3I56S 4S0MA 4DUZF 3IAS9 1S0OA 3O44A 3C3LA 3MM9B 4D3HA 2WTFA 4PG7A 1RABB 2PFFB 1JK9B 1RT4B 1KFSA 1TUWA 3F73A 5KFAA 3CJSA 3RW6A 2AT1B 1JLEB 5AXNA 3ET6A 2MSSA 3ZZPA 1KHWA 5KFFA 3R6LB 2MKKA 3DLEA 4LF4J 1HBMA 3RB4A 1VQ6S 3SSRA 3H5SA 3AT1B 4LF4F 4WJBA 5RUBA 2DRBA 1KC8T 4ECTA 3CDBA 3CJ8A 1UVJA 4R8UA 2DRDA 4P2SA 2ADCA 5DGAA 2C3UA 1U8WA 4JUZA 2RQCA 1NK4A 4PWDB 1JJCB 1QSSA 2WB1D 3VVUA 2Y8YA 5E5NA 4X62J 4HL9A 1FJEB 2AYGA 1S7IA 2VKRA 4HT5A 5H1SV 4O23A 1WHVA 1YG0A 1KLMB 2AX0A 5G4DA 1VYAA 4KH0B 2KXNB 1Q53A 1TV6B 1GFWB 5CYMA 4WIIA 2GMLA 2XYGB 3V4IB 3IO1A 1AW0A 2IC3A 1X8DA 1H73A 2AEJA 1N52B 2VG6A 3TA2A 5CQGA 4DN9A 1U6FA 2BJ9A 1XNQF 1S1WB 1RKJA 5KFHA 2HVEA 4WXWA 3UQSA 2XWXA 3M8SA 5KFGA 3E3XA 3QT8A 2VHGA 1N6QB 4P74A 3V81A 1S1XB 4FXDA 2CG4A 2H65B 4TU8A 2CPYA 4ED5A 3BKFA 3VWSA 1UCNA 3UCGA 3WX4A 4M5JA 2J0QD 4UOFA 1BQNB 1Q81T 2OGUA 2VG5B 5C2CA 3KJVA 1UETA 4TQSA 1VQKS 3PYFA 4L3NA 3I5CA 2JH3A 2X1GA 4MK9A 1YJ7A 1RTJA 4ID8A 2MEWA 1J5EJ 4RW8B 5GAHU 4RNMA 4B9UA 1P27B 1J5EF 4RO0A 1ZZFA 2YKNA 1FNMA 3RB0A 4JI4J 3WIVA 5THWA 1KOHA 4ETXA 1X5SA 2ZFHA 4ANDA 2GMJA 1RT2A 2V8DA 5KFMA 1EZZB 4LFBJ 3V6DA 4X4NA 3A4TA 2DRAA 4IKAA 5SUHA 4LFBF 2ZVSA 1FWKA 4RR5A 4PG5A 1EP4B 4ETZA 1S6QA 4YP3A 5J1EB 4J90A 2Y1RI 1URRA 5K20B 2EG2A 1FFGB 4RWWA 1V5IB 1IM6A 3SSSA 3H59A 4X4VA 2Z2YB 2KB2A 2PMWA 3OR2B 3MI7X 1HI1A 3OL6A 4F4ZA 3B54A 1FKPB 3ETOA 3HM9A 1Z2LA 4NRTA 4URQU 2VFRA 2V50A 5LM7E 2CQDA 5DQIA 2MQMA 4ZCIA 3B8HA 4DJBA 4H4MA 1BHNA 3C66A 3VGUA 1WI6A 1XMQJ 2V6AA 4CO3A 3CXCR 2GS8A 3ULHA 2DGOA 4H4KA 1XMQF 2ASJA 1NSKL 3W61A 3C15A 3IG1A 2HNDB 3LANA 5A2QY 4CO5A 3JAMY 2Q3PA 1NEEA 3IXQA 1R7IA 3Q8QB 2DNLA 3JSRA 2R7RA 2QFJA 5KG7A 3UO0A 4WP8A 4IOCQ 4Y2MA 3C16B 2KYZA 4CZCA 1T8EA 5CD4H 2WOMB 1S7HA 1EKSA 3T1AA 2DHAA 2QLFB 4P2MA 4FBUA 1XN9A 2RDJA 2CUYA 5CYQB 1FRHA 3D5MA 3NXZA 4MAKA 1DY3A 4DSIA 3FZ2A 1VLOA 3NOCA 1P9YA 3UD4P 1PCAA 1PIEA 3LALA 8RUCA 2CQBA 1VBKA 4FVMA 1FDNA 1KWMA 4DLEA 5C2GA 3P8BB 1N5TA 3DLKA 2UZAA 1DFDA 2JJ4D 4IO1A 1R0AB 1CULA 4X66J 2BE7D 2VICA 1NDKA 5L39A 1PJ5A 2LQ8A 3BGOP 5DQHA 4X66F 4DPTA 1YRXA 1U25A 5HSPA 3LP0A 1B3TA 5CCLA 4F0HA 2D41A 4NI2B 5I42A 2MJUA 1A0OB 1DZ5A 4J9MA 2WCXA 3MD3A 3HXMA 1HNVA 4TY9A 3PZPA 4MH8A 3JS9A 3IBWA 4ZVUB 3O8WA 4ZLJA 4B9NA 4UY85 2HFNA 3ZZZA 4ZPDA 4CLLA 5IQ6A 1LEOA 1WC3A 5EWFA 4PAAA 5KFRA 3VZIA 2B9YA 1LW2B 4DPXA 3MMCA 5IC6B 2RRAA 4TNOA 4NA1A 2KKHA 3M8WA 2ACYA 1SKWA 1T9TA 3AJ2A 3GB0A 4CTAB 4CLUA 2VUGA 2ZITA 5I4MA 3DU5A 1VIOA 3EJMA 2VFVA 1TKZA 3KLFB 2IFXA 1S9GA 4ZIWA 2HQ3A 1HKAA 5A6PA 4OYMA 4B9VA 4DCOB 1S72S 3LQVA 1B0PA 2BE2B 5L1JA 2FHKA 2RHQB 2Q1LA 4FF3A 1JLQB 2J0WA 5KT2A 2D3OR 3C14B 2R3VA 1NJYA 4YS2A 3TZZA 2H5JB 2Y8WA 3A8EA 4QU6A 2FB0A 5E3RA 2R8JA 3EGWB 2H51B 3A1YG 5JJBA 1GK8A 1GQEA 1RT3B 2R42A 1OYEA 4HACB 2G13A 4F50A 2YNHA 2V69A 1UMJA 1IKYB 4PZVA 1S10A 2QLWA 4A8YA 2DD8S 3DOLA 3PO5A 2G4BA 1HHTP 3BO2A 4DS4A 1HQ2A 4W98A 2HMIA 4FYWB 2FHMA 1X4AA 2RF2A 3IRWP 4PUOB 2WAQD 3CCZA 4ZHRA 1UW4A 3HJVA 5FDLA 1WI8A 1L5UA 3UE2A 2Q79A 3MPWA 2L9NA 2DGUA 3PIPQ 3G6XA 3HHNB 1TL4A 1U0HB 2BJ8A 3KDNA 2VA2A 2HGLA 3PV8A 2GIRA 1NSAA 3B78A 2RMLA 4EWTA 4DFJA 2SXLA 4TYAA 2W9BB 3RJMB 1LWEA 1GT8A 3IP0A 2R8KA 1P6TA 7FDRA 4UT4A 2XZDB 2XY6A 5AE2A 3DHXA 1NJZA 1TR0A 1Q1KA 4RW4B 2KI2A 3JTOA 5DG9A 4DWIA 3UD3P 2OPRB 1OY8A 1X0PA 5HVFA 3HD2A 5HJYA 2V2ZA 1M5OC 1PBUA 4DLGA 4A8OA 1U4BA 4C97A 4X4UA 3W9HA 3RR7A 1XEZA 2ZBRA 3DGPB 4GO5X 3HFVA 1TKXB 3KNAA 2L41A 2FC8A 3M8YA 1UJ5A 4KSEB 4F8RA 3MHYA 3K57A 3J7AN 1NB2A 2FVSA 1JB0C 2J9CA 2ROGA 4I2PB 3OXFA 3NMRA 1UWBB 4YMEA 1SKRA 4QIGA 1C1BA 1DLOB 2DEIA 2DNPA 5GAGI 3LO3A 4YHHJ 2IBKA 2OJ3A 3G8TA 1TK8A 3I87A 2IJFA 2JC0A 2EI5A 4YHHF 4K7QA 2V5HG 4JV5J 4DSEA 3T41A 5L9NA 4DR2J 2CZ9A 4ER8A 5GMDA 4JV5F 2Y9HA 4DR2F 5C25A 2C42A 1YJTA 5KFYA 4NEZA 4B3RJ 3UR3C 3R97A 5HI7A 1SJRA 3KLHA 3OTCA 2VPWB 4B3RF 3WHIA 2NCKL 2J9EA 3U1NA 2FJVA 2B9WA 1RTIB 2I5JA 4U96A 5LSOA 4BHQA 3SV4A 2X3GA 1YDLA 5BR8J 4Q0BB 4N47A 1YZ6A 5AE1A 1SUQA 2ZOMA 4LSZB 1R8AA 2YH0A 3Q8UA 3J80Y 1N34J 3SEOA 1WKLA 3GJRB 3D0GE 1FD8A 1N34F 4K59A 1FRXA 2V8HA 4IOBA 4IFYA 4DG1B 2HRUA 3OL9A 2HHUA 1O6XA 2YWEA 3HSZA 4U95A 3MR2A 3CDAA 1KVIA 3GV5B 2CQCA 3MEDB 4F4AA 4NZ0A 3ELHA 1U02A 2JC1A 4O0IA 3KK2B 4M5DB 1KD1T 7FD1A 3VGTA 1VQ5S 4URGA 1UA1A 1TL7B 3US5A 4ED6A 4KC5A 4WFZA 4DL3A 4WP9A 2D3O1 4HKQA 1N54B 2IM0A 1NJXA 2WB4A 3Q8YA 2LXFA 2HQCA 3M2UA 3R1HA 3GONA 1S1TB 1NK7A 1VRTA 2ZJRQ 4LSLA 1QUVA 2LDYA 3PDNA 4LF9J 3Q89A 5ETVA 1RB0A 1RTZA 4ZP8A 3AA8A 4ZPVR 5KFXA 2OO4A 3AXKA 2XLIA 4LF9F 4IFVA 1GAOA 1SL2A 3U1LA 3M32B 2QZ8A 2QA1A 3LGNA 4IG3B 2KT3A 1GH8A 2B7BB 1BWEA 1U1OA 4W92B 1QAJA 2ZUAA 3DDKA 1DURA 3RBDA 2HS4A 3MM9A 1U1NA 1G1XA 4MIWA 5F0WA 2IYGA 2VDIA 1RT4A 3PX0A 2AYMA 3A3OB 1EX8A 2PD1A 4ED3A 1WTFA 1ZTWA 1JLEA 4G1PA 3TRGA 4PR6A 4RNHA 2C2KB 4NCBA 1NPRA 1KEKA 3V6HA 5ITHA 3CMAS 3I5AA 3A13A 4R25A 2YQ0A 3DRXA 2DCLA 3LTOA 5KFBA 3QAEA 1J27A 2AJ0A 1NHVA 1WSVA 4N41A 4LR8A 2DHSA 2HVDA 3V6JA 4YB6A 4LR9A 2CJXB 3FSYA 5L1LA 4JI2J 1HIYA 3AAWB 3QZ7A 1AZSB 4DL4A 3M6XA 2W4CA 4LIWA 3LWMA 3I6PA 1KLMA 1UVMA 4WU3A 4JI2F 1W26A 3E2EA 2CQGA 4K50A 1TV6A 2CADA 1VC5A 2YBVA 1QE1B 4P2FA 2LU2A 3V4IA 3DI6A 3P96A 3EMTA 2H1YA 3OSNA 2FLLA 1S1WA 2VL1A 1Q5YA 5F3ZA 2Z4PA 2DY9A 3MUMP 2GIFA 3PKMA 1MMLA 2KRBA 2FJXA 3RYLA 2VC0A 1N6QA 5U47A 1VLYA 1S1XA 3CTRA 2DNZA 4W4MA 2VONA 3SQOP 1BQNA 4C8MA 3UDLA 2VG5A 4ZVTB 3CNQP 4A48A 5B08A 2BM1A 1ROFA 4USHA 1BWVA 2G1HA 4ILRA 2E7XA 3H8YA 5CCMA 4LQ3A 1S9FA 2W7AA 2MQQA 3CO9A 4OV1A 4KO0B 2CZ4A 5F8JA 1KQGB 4I64A 3PW2A 4ZVEA 2V9WA 1LWCB 2F9DA 4UUXA 1J5OB 1PJ7A 2R2SA 4MT1A 2N3OA 4KHPJ 2CVEA 2JLGA 2N4CA 5K5MA 2W7PA 3PYDA 4KHPF 5GADI 2FJEB 5HL7Q 3MTJA 2KH9A 3LP1B 1SQGA 1SC4B 3UDCA 4ECYA 3VQSA 4ZCLA 3A8KA 1NKCA 5HAOA 1FKAF 2IJRA 2OPQB 4Y2AA 1S6PB 4BLGA 2MZQA 2UUBJ 4DR7J 3HI9A 3HHKA 5ETSA 2IY5B 3EPIA 2XI3A 2DKOB 3OR2A 5D0GA 2BOPA 3CD5A 2UVVA 3LOUA 1U1LA 2RS2A 3D28A 5M2PA 3CMQA 4HLBA 3DHWC 2CDQA 5ETLA 1S1VB 5HROB 3LPEA 3KTQA 1CJKB 2WZ1A 3BR8A 5G0RB 3GR1A 3O1LA 1DTTB 2Y0BB 4C11B 4DV1J 1U24A 4QYZJ 2MKHA 3QT6A 2CQPA 4DV1F 2HAFA 1S0NA 5LXRA 3BH7B 4C8NA 2HNDA 2CNLB 3M9MB 2MKJA 2V68A 2HHTA 2LU1A 3W5XA 2NYHA 1RLCL 2VBYA 3MGJA 1Q95G 1A7GE 1ZOTA 4RW9B 5JVGQ 1RI7A 1RWOB 4IG0B 3SBMA 4ICLA 5DDPC 1SBRA 3MR6A 6AT1B 2NXEA 3FEYB 4K4ZA 4U67Q 2W9CA 2ASLA 2OELA 3C16A 4JB8B 1HNXJ 2WOMA 4WP3A 1HNXF 3PW7A 3LUYA 3UN3A 4IRCA 2F7VA 3SFUA 5CYQA 3FRZA 1MWQA 3MAHA 2JEFA 4NXMJ 1X31C 5EUHA 4RW7B 2C22A 2GJIA 1FRJA 2ALYB 2CG8A 2HHQA 1R0AA 2DB1A 2XO7A 4AUKA 1HLWA 4CLZA 4YFUA 4CP5A 3BDEA 2QRRA 4KRWA 2IIHA 4C8YA 3MWBA 4NI2A 3RGIA 3CUNA 3FJ2A 3FBEA 4QR1A 3K5MA 1BXNA 4GO7X 3N01A 2VFTA 4DV5F 1IM4A 4J9LA 1DRZA 1NO8A 2HK3A 1R8PA 4LR7A 2PT0A 2JX2A 1S49A 2MY7A 3R5AA 3CCUS 1IQZA 4DCPB 2ZOGA 1GTHA 2M2BA 4ZOSA 1LW2A 2NR0A 2MZJA 4WYLA 1SL1A 1ZM9A 4KR0B 2DNKA 3CD7A 4U7UK 2HQDA 4OV6A 1M1HA 1VQPS 2VASA 3TAMA 4RPFA 1KN6A 1NU4A 1YRTA 3KJQB 4U8YA 3BO3A 3KLFA 2DNHA 2DNRA 3TWZA 2GW8A 2ZNYA 2ZH6A 4LREA 2Z58B 1DHMA 3D6MB 3M8QA 5E7OB 4DHVA 2K1RB 3K5NA 3ADAC 2IRUA 1RHRB 1FT8A 4NL5A 1T95A 2BE2A 1XQIA 4O44B 1JLQA 2CPXA 4NYOA 4DEZA 2E44A 3MTKA 3C14A 2XMWA 3GU0A 2FPHX 4RUCA 1F9HA 3TP2A 2Z0GA 2K3IA 5B0CA 2MLXA 4IDKA 1RT3A 4HACA 2R7SA 3DC2A 1FVQA 1FDBA 1FX4A 2RNEA 4DUYJ 2B43A 1RISA 2HHPA 4Z2XA 5MLCV 2IRXA 4DUYF 3EVOA 1HD1A 1M5PC 4ZP9A 2EG1A 4PUOA 3T5HA 4TYBA 3MFIA 1K47A 2CJYB 1T05B 3PG9A 4LF5F 2VV5A 4IH7A 2F5GA 2IHR1 1C4AA 3TX8A 1HW8A 4QYZK 2O1PA 1U0HA 3HVTB 1VCTA 2FYXA 4OHXA 3VAHA 2E1MC 4KHMA 4ZDNA 4GC7A 4GVBA 3ZO7A 4BCAA 1FWPA 2ILZA 2OSQA 1HQUB 3MPVA 2C3MA 2W9BA 4QOTA 4HI2A 1MN9A 4RW4A 4QW8A 3TYTA 2CNKB 1N56A 1UL3A 3CMES 4XDCA 1XR6A 4MYUA 3Q2TC 2BXJA 3N6LA 3CCQS 3D67A 4Y2CA 1GNKA 4G65A 4KPCA 1VI7A 1AXQA 3HZEA 1FA0A 5KFPA 4YDXA 1IR2A 1QSYA 1JLFB 4KHRA 2RU3A 3NP5A 1QVGR 3H5UA 3RAQA 1IVZA 4FBTA 5D0RA 4NCGB 3EVMA 4ZJQA 3DGPA 1JLCB 3C6TB 2N7CA 4GVLA 2CJKA 5HMXA 1TKXA 4CLWA 1UEUA 4GRSA 3DDNA 1VQ7S 4KV8B 3O2IA 3KXDA 4QQBA 3Q8PB 2R2RA 2C3PA 3DYAB 2W8LA 5E2QA 9ATCB 2MGZB 2HZAA 4I2PA 1K9MT 3KLIB 1UWBA 2JL9A 5F8HA 2FC9A 3KMSA 5AXLA 4PG8A 4HVZA 4DX7A 1DLOA 2W01A 3J7Z5 5EHHA 4F2RA 2MHNA 5L1IA 1UAWA 1YIJS 1U8SA 4IOAQ 2FQQB 1GMVA 2E1AA 3OJUA 4MK7A 1T9XA 2CNNB 3D3CJ 4MMOA 2V4JB 4H54A 3PJXA 4Y65A 2ZVIA 1L3KA 3FVYA 4ZP7A 5KFJA 4F02A 1KRPA 2CJ9A 1RACB 3GYGA 3AXMA 1G4CA 3CJ3A 1RAHB 4QWAA 1C0TB 3RAMA 1I94J 4EBDA 2Y1LB 3NCPA 2XMMA 2L48A 4I6WA 2R7VA 2GFFA 2EFNA 4J91A 3W2VB 2KU7A 1H2UX 3ET6B 1I94F 2IA6A 3MM8B 3BZQA 4QCLA 1CSJA 4WTYA 2FUG9 1HBMB 4Q0BA 4QIEA 1RHUB 4Z7YA 3TOQA 1UVKA 2XC9A 1S4FA 4QU7A 3LGMA 3UN5A 1WSRA 1OY6A 4R8UB 4FF4A 1S4EA 3HLUA 5ETOA 1RAOA 1OWXA 1X4FA 4RW6A 1F1BB 1WNEA 5B7WA 4FKXA 1M5HA 4DG1A 2BR0A 1H72C 1HFEL 3T1YJ 1KONA 2PN6A 2YKQA 3ZC4A 3OVAA 2ZKUA 3MCNA 2GO8A 3T1YF 2KFYA 2IA0A 1GXTA 3NG8A 2AEMA 2PDAA 2YH1A 4RNNA 3FKBA 3H2VE 3NOGA 2R7TA 3MEDA 2LQBA 2VBZA 3UN2A 2MJNA 4NLWA 3KK2A 2Z2ZA 1NZ8A 4M5DA 3OFHA 1TL7A 2PMZD 2BE9B 4CH1A 4IRKA 3NWRA 2PA3A 2JFDA 1NRKA 3CGIA 3V81B 1SH2A 3CJRA 5M2UA 4RBUA 2EKYA 5LJ5Y 2ZZTA 2LECA 4O3QA 3C2PA 1HWLA 2CYYA 1S1TA 3R2DJ 2NREA 2BJ1A 2EFQA 4FYYB 3KJVB 4DR1J 3R27A 2I6WA 1VRQC 4FZVA 4CLPA 1EETB 4DR1F 4TXSA 2MKSA 1JJHA 1T9UA 2HS0A 2RE1A 1K0TA 4M5LA 1EHWA 4OI2A 2GHWA 3GZ7A 2ZH2A 1UFLA 3OL8A 3BN4A 1SQEA 4IG3A 5HQMA 2V94A 4G1QB 2XS5A 3EUNA 4RNOA 2X7IA 2OFHX 2P9CA 4IR1A 3OTOJ 1Q8LA 3Q83A 2FLNA 2XMJA 5L8RC 1B70B 1U1PA 2NYIA 4NRUA 5LL6d 3CC7S 3PRDA 4IYQA 4LSNB 3OTOF 1FXRA 4DDFA 4I6AA 1KTQA 2IM2A 2PEHA 3GILA 4DX8H 3L4BC 2DIVA 5C24B 3TJAA 3KLEB 1QDUB 3MUVP 4E98A 4ED7A 4L3KA 4P75A 3MD1A 3R5CA 3KLVA 3IRXB 1JNRB 3D7SB 1AB8A 2MMYA 5I3UB 4WCEQ 3HSDA 5E33A 2P6SA 4ZN1A 2ZBIA 2KVQE 4U8VA 3JSBA 4USWA 1K44A 1BMQB 4R0JA 1DBDA 3L7PA 1RSCA 2QC3A 2LVWA 1HNZJ 2HGNA 1AZSA 3H42A 4KE5A 2PMHA 1X5PA 4O4GB 1HNZF 5KFVA 2QFIA 4DQSA 2XMAA 5I3PA 3HULA 1R27B 1QE1A 1OPIA 1HARA 1Y4ZB 3P5BP 1PYSB 3D2WA 1FHTA 4IRDA 3B4MA 5KFUA 4AL5A 5D4PA 1I5OB 2YQ1A 1OIAA 1M0SA 5GAEI 1FRKA 4X2BA 2XLKA 1VC6A 4DR5F 4ECXA 4CNYA 2BYCA 5LT5A 1YITS 3BM7A 5EWGA 2J7KA 1DAXA 3QWPA 1EJ7L 2D9PA 1TFYA 2Q66A 1WF2A 4OX9J 2ZHOA 5JVHQ 3N4WA 5DS7A 2ASDA 4ELVA 1A6LA 4OX9F 2OH2A 4KO0A 3ZZUA 1Y00A 2LEPA 4C3KA 3DKDA 1PC5A 3TUJC 1FESA 2E7VA 1D9AA 1G2EA 4BBYA 2OEMA 2KXFA 1LWCA 1Z4UA 1NHUA 3U7JA 2XYHB 2XZWA 1J5OA 1NK5A 5D15A 1SB6A 1KHVA 1XBWA 2K2PA 3RG6A 3I96A 3RR8A 3DLKB 3NKYA 2Z57B 2KM8C 5KFCA 3KJFB 4GKJJ 2JDJA 1RBOB 2XMKA 2YTCA 3GIKA 4JOUA 1Q4RA 4GKJF 3LP1A 1VDHA 1P1TA 2G9OA 1RA6A 3HO1A 5ETRA 3UCUP 2GZOA 4F3OA 2AHOB 3QMQA 1PILA 2OPQA 3K5PA 2ROPA 1S6PA 2OEJA 4WF9Q 4LF2A 3PJ9A 3AOBA 3M2VB 3IR6B 3BH6B 1FFWB 2F1FA 1SJQA 2OTJS 2Y1IA 2I38A 3O6QA 4KTQA 1Q79A 2OI2A 4TVAB 2D74B 1K0VA 3GG1A 2BEFA 3H4BA 5HROA 4C8ZA 1YBTA 1CJKA 3GCWP 1DTTA 5D4NA 3BR9A 1ZS6A 1RBAA 4C98A 4DV3J 3MMCB 3GLJA 4CCHA 1YBAA 1SJ1A 4BDPA 4DV3F 2FZKB 1H0HB 4L76A 3ETMA 3B82A 3WC2A 3PNIA 2EFGA 3RRGA 3T5LA 5IM0B 2ZH9A 1M5VC 2FVQA 3TVKA 2VOPA 3MPYA 4RW9A 1UTAA 4WTOB 2WVEA 1RA7A 1Q0NA 4OYPA 4MJKA 3GIIA 4ED8A 1NJIT 5GVQA 2DNGA 1WORA 4OYZA 4QYRA 3BSOA 1HWKA 5D6GA 5F8NA 3FNNA 1WKJA 1B4SA 1MWZA 1S0MA 4NCAA 2BA9A 3WC0A 2FLOA 1Q86T 4JYAJ 3OTBA 1RADB 3J7YU 3VR1A 2HG4A 1LOUA 2XZTB 4DQRA 1SH0A 1FEEA 1OSCA 4M63A 3EZ5A 4L72B 3OLBA 1NB7A 3BBCA 1B7FA 2VFUA 1VQ4S 1ZZNA 2HMIB 2ZC3A 2RF2B 1O8BA 4ZPTR 5K8PA 4XO0A 3RRKA 5KFNA 3Q8RB 4Q2LA 3TZWA 4N56A 1T9YA 5A6WA 1URNA 1FE0A 1S76D 5I3QA 2X1FA 1S1UB 2DJWA 2RT3A 2E5JA 1QAXA 3TI0A 5D3GA 4NYPA 3H40A 4ZPCA 2ZKTA 4FDFA 3BJYA 4KB7A 4HTIA 2DGXA 2CQ3A 3FSXA 3HCXA 2GHPA 1N48A 4YR2A 2ZH7A 3SIPB 3CCMS 2ZH3A 2MSTA 2BACA 4KGXB 1HQEB 1OJ4A 3FCVA 1PC4A 5L38A 1X5OA 4NASA 1RAFB 2N82B 4B3TJ 3K8VA 2HFOA 1HHSA 3THVA 2B56A 4WE1B 4CI0B 1F0XA 1M5SA 1AROP 4NYZA 3U27A 5FIIA 2EPIA 2R2UA 3H20A 2DXEA 1ZM3A 2VJVA 3SCJE 2IVYA 1CBKA 4PCQA 3KMQA 3S1TA 5B0EA 4L73A 2RILA 3M30B 3NAHA 5B0GA 3OXGA 1YJNS 4MKBA 4I67A 1FKOA 2K1RA 4J5OA 4EK2A 1HYSB 2HIQA 4O44A 3PEHA 1QTMA 1X4EA 3G82B 2WHOA 3KNGA 4NA3A 5K8NA 1C1BB 4NXNJ 3MR7A 2D3ZA 1ZTTA 2ZOFA 4NXNF 1U26A 2U1AA 3K5OA 3R1LA 3GP9A 3E8OA 3SMZA 5DZ6A 1DQ9A 1SC1B 2NS1B 1LKZA 4ED0A 2YKPA 1WEXA 5IFMA 3HHLD 1U1KA 4UQGA 1K73T 2DT9A 1X0FA 3VHQA 5AJ3J 2RKIB 4V19X 2YWWA 1F5BA 5LMUJ 4Y28C 5AJ3F 4V1Ak 4FN5A 4AXJA 2J8AA 4ZA1A 5LMUF 1RAIB 1T05A 2E5HA 2AKWB 2CPEA 4EZ6A 5K8OA 3OJSA 4CH0S 4RX6A 2DH7A 3T9ZA 1YHQS 5KFIA 2C2RA 3HVTA 1T02A 4PKDB 3GG0A 1NKEA 2G1DA 3R3TA 3SXLA 2A1BA 5CABA 2OMOA 4QJVA 5IV3A 5KT3A 1DARA 2UXCJ 1TL1B 5KFSA 2M52A 3OQ2A 1MMNA 1PGZA 1T03B 4IFYB 1WF1A 3CCES 1F3FA 2QL9B 3CCLS 2R7XA 2GX8A 2RUSA 3R7NB 3G2XA 1QAYA 2HVIA 2ZZMA 3TZXA 4WFBQ 3VAKA 3FBBA 2VIHA 1X4GA 4NZ6A 4DF8A 2XMVA 3KDOA 4KY3A 4OFZA 1O5JA 4DR3J 3W65A 4NCGA 3NEKA 1JLCA 2EFOA 3C6TA 1XR7A 4DR3F 1Y3JA 2MKYA 1IKWB 5EDWA 4C7QA 1AFJA 4KV8A 1X9MA 2EK1A 3BO4A 3KUHA 1HBNB 2CJAA 3DYAA 3WX8A 2MGZA 1WEYA 4DL2A 1G3OA 3LF0A 3KLIA 1RHMB 1WELA 1Q78A 1TUGB 3AOCA 3V4MA 2BX6A 5CH7B 2UUWA 3K89A 3NRBA 3HHLA 1HD0A 2UXBJ 4B3MJ 1T9WA 3JAMU 3R9LA 5FD1A 2BMBA 3KJNB 1SH3A 3AA9A 1AFIA 3QFWA 4A8SA 3ZZTA 1WEZA 5D0EA 4FYXB 3R5GA 2UXBF 1JXEA 1R43A 1VQLS 2V4JA 1EARA 4F0MA 3SDEB 1GEHA 4NLYA 1YJUA 1WG1A 2RVJA 3KUGA 1JIHA 5LSLA 5CA5A 1MU2B 4DSFA 2DO4A 4B17A 1X4BA 4EBCA 1C0TA 2J7WA 4O3SA 1JNZB 1KQFB 1YJVA 3IBCB 1TUVA 2ILYA 3W2VA 2UUAJ 2CPHA 2QMWA 2AQ4A 3MM8A 1B99A 2LP4A 1RCXB 2AJ2A 3LP2B 2OSRA 4ZVQB 2APOA 3CCWA 2UUAF 2YX7A 4DX6A 1NPKA 5F41A 4HEA9 4HH0A 3HDSA 3HSGA 1W7WA 3QJJA 2FJDB 2P8IA 1XK8A 5BJRA 4DX5A 3S6EA 3CF5Q 1QAIA 5ETMA 2L3MA 4RWXA 2AJ1A 2XHWA 4X62F 2AIRB 4ECRA 6FD1A 1A9NB 3QBCA 1RT6B 3M1VB 5ADZA 2F4VJ 2O3DA 2KDOA 3A12A 3FCHA 3TZYA 1Q82T 2A6OA 4CH7A 1FJGJ 2RH3A 3DI6B 2F4VF 3RW7A 4QPTA 3THTA 3W9IA 2WVBA 1VQNS 1FJGF 3W60A 5CZVA 4YR0A 2V67A 4CT9A 4LBIA 4UW2A 2AGPA 2AU0A 2EK6A 2VQFJ 2BW7A 1EB0A 4P10A 2XYPB 3T3FA 1NLKL 4DFKA 2XMTA 2VQFF 3NNHA 2EFVA 3H4DA 2FD2A 3I0SB 3W8GA 4EI2A 2DPIA 3QGPA 3VV2B 1HWJA 1RJJA 3VAIA 1BQXA 3JXOA 4J7CA 1EETA 1KSPA 1LXJA 3EDQB 2E66A 1WOOA 5DRKA 4L75A 2FIUA 2VBWA 2VPZB 1S57A 4ES2A 2V8GA 4WFAQ 2LQJA 4G1QA 1JQGA 3N6MA 3SV3A 2CA9A 4JI1J 4FXVA 3CCTA 4E2FB 3CIZA 2YPYA 3MDFA 3OUYA 4JI4F 3I9ZA 3MM5B 2MTLA 1F5CA 1VQMS 2J0SD 3A8JA 2YXLA 2F65A 4TY8B 4LSNA 3PFOA 2RD5C 1RWNB 3GYNA 5BXIA 3BPDA 3GV8B 1HR0J 4OIXA 4DV4J 5C24A 3JTPA 3KLEA 2KM8B 2ZBCA 3GJSB 1S48A 3CULA 5E3AA 1D3WA 1HR0F 1RHJB 4U7UD 4DV4F 1H7WA 2BOAA 3IRXA 5I3UA 5DDQC 3EYZA 4NLSA 2GVZA 4HDGA 1LQ9A 2BJDA 3PR5B 4A47A 3I31A 3NY0A 2OPPA 1SQFA 4HH1A 3TO8A 3PCOB 1PG5B 2MQLA 4OZ5A 1WWHA 3IS9B 5DDOC 3Q0AA 4LF7J 4O4GA 4HTJA 5KG1A 3FFIA 3ZNJ1 3N6NA 4KFBB 1F2GA 2FZCB 3P3DA 4OZLA 3FMBA 5KG4A 2NUHA 4AE5A 2AP6A 3W62A 2GA7A 2CKWA 3T9NA 1UVIA 1CLFA 1BC6A 2D9OA 3SCKE 1MROB 2QV6A 3CCVS 2OMLA 4ZS6A 4ICLB 2LXIA 4C48A 4I4BA 4KKOB 4IO9Q 2BRLA 3F44A 2F9JA 2IAJB 2DH9A 5F9LA 3N9UC 2W9CB 4ZJOA 3KLGB 5LOQA 2QLJB 1RT1B 4P6QA 1LFPA 5A76A 1WKKA 3RBEA 1M1GA 3BKUA 1ITPA 4Y2IA 4DXLA 1HW9A 3T1HJ 3K7RA 4M5GA 2HLUA 3WIUA 3SZ2A 2UVWA 1NK8A 4NX9A 4IQXA 1UVNA 2QT7A 5EGYA 3CC4S 1PYTA 2C2DA 1SXLA 3C6UB 1H98A 5CXTA 2AGOA 3AQPA 5IZHA 1RXOB 3PW4A 1YLXA 3P4UB 2CPFA 3LAKA 2F3JA 3L95X 2F8MA 1WDTA 3UI3A 2WONA 2RQ4A 2MZ1A 3BSCA 2C1EB 2KN4A 3M2VA 1WF0A 5F9NA 5LJ3Y 2IBOA 1S77D 2HGMA 1FE4A 1IBCB 4CIOA 4QR0A 4PYDA 1XERA 3ISND 2U2FA 1KQSR 4Y2KA 2I2YA 4QW9A 4G1IA 4TU9A 1SV5B 2M70A 1O51A 1S6UA 1HI0P 3J80U 1LFWA 3BSAA 4EMDA 1BUXA 1HI8A 2L9WA 3QATA 2E5IA 3SCIE 2QGFB 3DLLQ 1IR1A 4IH6A 4ZPAA 4LUBA 2NPFA 2KHCA 1RT5B 3JQKA 3PIOQ 4A8MP 2GVDB 4X84A 4D3GA 2MZRA 3TAMB 2Z30B 2BQUA 5IM0A 3I55S 4AL7A 3NL0A 3KG4A 4Y0FA 2JOQA 3AOAA 3NS5A 1E6YB 2X51A 1P8GA 3HHEA 4C3MA 1V9OA 3M8QB 4I6YA 4EO8A 4Q43A 2ZHBA 2YWGA 4DPYA 1D9DA 4EU0A 2PO4A 1NK6A 2DR8A 2KFNA 3KG1A 1Q7YT 2WSCC 3NBPB 2KXHA 3CDEA 3FEXB 3BQ0A 4I56A 4DCJB 3BDPA 4R0EA 4ZK7M 3Q2SC 3H5YA 1RAJA 2DIUA 2IDLA 1RWWB 2P9EA 1C1CB 4WKRA 4IDKB 3H98A 1HBOB 4ECZA 3V5RA 1UA0A 1FI4A 4BC9A 4J9VA 1HNIA 2XCAA 4M1KA 3BYPA 1I3OB 2D3UA 2X1AA 3UPFA 2B4UA 3KUEA 5IQQA 1NPPA 1V6HA 1Q8KA 1IN0A 4ZVOB 5L1KA 1L3UA 2DEJA 4J9QA 1Q8BA 3EGNA 2JVOA 1N33J 2HBQB 2PA8D 1UEKA 1E6VB 1T3NA 3CO0P 4I7FB 1CS4A 1BE4A 4DSLA 1N33F 4P72A 1S1UA 2NXJA 3K58A 4GVBB 1REGX 4FPIA 4NMLA 1YQHA 5GAGU 2KZZA 1U6ZA 1VHIA 2G2OA 2R7OA 3JQMA 2KRRA 2UVUA 2QJ3A 3PHTA 1OO0B 1HQEA 1NDLA 1SIZA 1NUEA 4MYTA 2R7UA 2HLTA 5DGBA 5KT4A 1SI9A 3HPOA 5IV4A 3QWUA 4WE1A 4IH5A 1Q5VA 4NLTA 4ANCA 3OHAA 5B0DA 3C8YA 1V3SA 5KT6A 3RTVA 2ZWOA 3KYLA 4URSA 2BKOA 4DL0C 1VQOS 4OZ0A 2E1CA 4ED1A 3MCOA 3LPYA 3G71S 1R3NA 2FGCA 2CQ2A 4DFPA 3K59A 3M30A 2NLWA 3PM9A 1XIQA 5BYSA 2E7WA 1C0UB 3CIMA 2B0GA 1QTNB 4K0KJ 4ECQA 1HYSA 3MMAB 1QUPA 1JLBB 2HFSA 4K0KF 3G82A 2VG7B 7AT1B 4F0KA 2QO3A 3G6ES 3I32A 4K4YA 4C3LA 4A8QA 3M9NB 1IKXB 2DGQA 5D0HA 4FP9A 4PQUB 2HW3A 4CNZA 3Q86A 4QR2A 5DQGA 3PFEA 1ZAXA 2RQKA 1Q7LB 4RUBA 3UR0A 2E5GA 2YWFA 1Y5IB 1RQ0A 3CEDA 5AT1B 4NMXA 3W9JA 4C9DA 3I5BA 4OJ1A 3BYRA 2RKIA 3E51A 3UNYA 1V3ZA 1RT7A 3IR7B 2HFUA 4ECWA 2I1RA 4GC6A 2RS8A 2QA4G 1B0TA 2IPOB 2RQMA 3ILIA 2GJ2A 4E0DA 3DXSX 2FVPA 3TJ8A 1WOPA 5KFKA 4DR4J 3GFXA 2CPDA 2YNGB 1TKTB 3JSMB 5BR8F 1S79A 1S59A 4DR4F 3HHDA 1FF2A 4KGMA 4IQMA 4PPDA 3PYGA 4DQQA 3OPKA 1TL1A 4RW6B 5MAOA 4YR3A 4CO1A 2ZJPQ 1T03A 2BQRA 4ID5B 4DMZA 1MWYA 3PY8A 2MPUA 4DQIA 5HLFB 1RGVA 3AHPA 1AUSL 3EGVA 1JJ4A 3QAUA 3ONQA 2W2NP 3P5TL 2W2QP 3KK1A 2EVZA 3C19A 4ILMA 3ZXWA 4AQYJ 3AB4B 3DOMB 3FRYA 4USMA 2HFVA 2B6AB 4B3SJ 1MLAA 1S6OA 1IKWA 3RZAA 2XG8A 4B3SF 3DLHA 1XMBA 3KOAA 2BKNA 1HBNA 2DNNA 1RTHA 4O0NA 3HHLC 2DPJA 3HK2A 1F9EB 4DN0A 1TZ0A 2M5YA 1UJ4A 2XB2D 3ILOA 1KP6A 4H4OB 2NPIA 2ZEJA 4R5PB 1FERA 1TVRA 1UPPA 3POTA 3PKYA 5DZ7A 2H48B 3SDEA 2IDEA 3MR5A 3QZ8A 4LRAA 1IJFB 4QIWD 2DTJA 1KKHA 1HWUA 3BQ2A 2DBBA 2ACMA 1MU2A 2OEKA 3BN7A 3W63A 2LEBA 5FLXU 5IXUA 2DY1A 4OX7A 2XCPA 4KGKA 3A3NB 1NH8A 2JLEA 5A0YB 1RAEB 4TN2A 2IRYA 1NM2A 4LVNP 2ZH8A 3LP2A 3EWGA 3DRRB 2DCUB 5CHCB 1UZHA 1OQ3A 2C2ZB 1QVFR 5KAKA 2POKA 2QA4S 2UP1A 2N4DA 4HHUA 1Y5LB 3W7BA 2J6TA 2ZBQA 2ZC4A 2DR5A 4G6VB 1C4CA 1IQTA 3SYZA 5AXMA 4B9TA 4EUVA 1SPBP 4CLYA 4J9OA 2IMWP 2FLPA 1R8HA 3UCZP 4CM2A 2DISA 1RT6A 3TEHB 3D66A 4F7VA 3M1VA 1WC1A 3U02A 4K4WA 4MIBA 1D8YA 5M2RA 4NLDA 1TQLA 3M2RB 3HX9A 4NPOA 5GADU 2QLXA 5JUMA 1WG4A 2QMXA 3G87A 1G7CB 4LJMA 2GC8A 4XK8C 4UY8T 3FCWA 4LFCJ 3JYTB 2UU9J 4OL8A 1PO6A 3NWGA 4LFCF 3W5YA 4NLRA 3SI8A 2UU9F 2H3EB 3I0SA 4NLUA 4ZPBA 2W7OA 3DDIA 3MUTP 2QMUB 2XSJB 5L46A 4OZ2A 5HMYA 4CLTA 3DXBA 4OLOA 1ZPWX 1VQSA 2GAHC 2R4FA 3VVTA 2WBRA 4BWMA 4C6AA 4ZVSB 2F63A 4OYWA 4M5NA 3GYXB 2UV8G 3PXGa 2ASYA 4ENOA 3G6VA 3BPSP 3P45B 4F3MA 4PQAA 5JMNA 4OJGA 1H2TZ 1R6YA 2HZCA 2GAGC 1F6TA 4F67A 2XTJP 1CQNA 2QSFA 2MHEA 3MM5A 2C2EA 3IMQJ 1XNQJ 1KOOA 4AL6A 4TY8A 1FK9A 2A2CA 3MCSA 1YGYA 1Y10A 4MKAA 3TA0A 1OYDA 3MAAA 4TKTA 2JVRA 3R5DA 4HHJA 1LWFB 3FK4A 3TARA 2GQCA 2EEYA 3OD2A 3T19A 1SKUB 1R31A 4QZVB 3NGDA 2HNYA 3TNVA 2JHEA 1EAYC 4QBUA 4DV0J 5J2QB 2UUBF 3VCDA 4DR7F 3I9V9 4DV0F 2HHVA 3IA0A 4PPZA 2RHSB 2YPZA 3LW5C 1XC9A 3IS9A 2HZVA 4ELTA 5EN1A 4LFAJ 2Z2LA 5BYQA 3TQEA 1CJTB 3MECB 4WK1A 1TMMA 4LFAF 1VS3A 2E1RA 4OYXA 2XULA 2BRKA 3FGVA 2H5EA 4WWSA 2HWIA 2W8KA 4KFBA 2QL5B 2BDPA 1WC5A 3DOKB 4CYUA 4A8KA 1H7XA 3GTYX 4KGVB 4JI0J 2ADBA 5A8RB 4FF2A 2RRBA 4JI0F 1MROA 2JEIA 1JKHB 1FEHA 2ZH5A 1RAGB 4KKOA 1BQMB 4MK8A 2IAJA 2OPSB 1NKBA 4PXCA 3IM9A 4DV6J 4YDDB 2JRSA 3IGVA 3OXLA 1NZAA 3KLGA 1V3RA 4NLQA 4ZVFA 2Q6CA 5FLXY 4DV6F 2IJNA 3M7VA 4QIVA 4ES3A 4J9RA 1RT1A 1XMOJ 2GGPB 2DVIA 4ZITA 1T3OA 3N28A 1HPZA 2VH7A 4CLSA 5GAHI 1XMOF 4C0OC 2NSCA 2H4WB 3F56A 4P9SA 2V2QA 3OVSA 1YTYA 2HHXA 1ZM2A 2NZ4A 2HRYA 3QLHB 3G4SS 1K1SA 3TVZA 3GIJA 1U1RA 4NXMF 2ZZNA 1L3SA 2J0XA 3QGIA 3J7A1 3C6UA 3AD7C 2R2TA 4X4RA 4Q8FA 2HWTA 4LVOP 3ITHB 1X9SA 2JLFA 4ANEA 2CQ4A 2PIIA 1SJ4P 3QJPA 2VDHA 1YSJA 5DG8A 3PO4A 2BV3A 1N5QA 2ZH1A 1WJ9A 2EC0A 1LW0B 2RAQA 4YEAA 5DM7Q 2OUGA 5D3GB 3AJDA 3GJQB 2PGCA 4C0BA 2KFZA 2ZNZA 4OI0A 4C2MA 2JWNA 3FUYA 4ZVPB 5HP1B 3S8SA 2J8SA 4LRFA 1UKUA 2W2PP 1KDNA 2UUTA 5K8MA 1U48A 1SV5A 3MMBB 4F26A 1UJ6A 3T6BA 4N77A 1QY7A 3F41A 1JLGB 5KG5A 4PG6A 4X4TA 3SFGA 3BBBA 3OL7A 2E1PA 1U45A 1H6KX 1AUDA 1RT5A 1XTZA 1RAAB 3WZ0A 2DR6A 2GVDA 3QRRA 3I0RB 3QNWB 4N5SA 2R7WA 4XAKA 1FNXH 1E6YA 2J6UA 1IR0A 4AFFA 1FKOB 1FVSA 3HT3A 3R7BB 2QYGA 4GKKJ 3G8SA 5KT5A 3NBPA 3DRPB 2HHWA 2MYFA 2IVFB 1H74A 4GKKF 4OYAA 1ZM4A 1YZ7A 5D77A 1VISA 3G6YA 4B3OB 1S97A 1N5YB 1XJWB 2EFPA 3CJQA 4PWUA 4QWCA 1C1CA 4K2XA 5D4LA 1IWGA 1L3VA 1UFWA 4PEOA 4JI5J 1HBOA 1HA1A 1TKDA 1RWXB 1TAQA 3TVYA 1WHWA 3M6UA 4YN3B 2O01C 5D78A 2Y0SD 3Q23A 4JI5F 2I0XA 3ZTPA 2YVSA 2AEFA 3DRYA 4OJHA 1UP1A 1KS2A 3CJ5A 3AODA 1UEVA 3OSPA 3EX7B 3RUBL 2J9DE 2B51A 5ETKA 1IKVB 5GMEA
chains in the Genus database with same CATH topology
2CJXB 3GJRB 1RHKB 2QLJB 1RHMB 3QNWB 1IBCB 3EDQB 2H65B 1ICEB 3R6LB 2Y0BB 1PAUB 3RJMB 2Y1LB 2QL7B 5K20B 3D6FB 2XZDB 1QDUB 2QLBB 2H5JB 2C2MB 3KJNB 2CDRB 2CJYB 1RWPB 3R7BB 4ZVUB 2C2OB 2H51B 3KJQB 2QLFB 3EDRB 3SIPB 1RHUB 2HBRB 1I3OB 1RWKB 2QL9B 2CNLB 1SC1B 2H5IB 2HBZB 2P2CB 3R7NB 3GJQB 2C2ZB 3D6MB 3GJTB 1BMQB 3D6HB 1RHRB 5IC6B 4ZVOB 3R7SB 1SC4B 1F9EB 2H54B 1RWOB 2CNOB 1QTNB 2XZTB 4ZVPB 1NMEB 2C2KB 2HBQB 3P4UB 1RWNB 1RWVB 4ZVSB 1GFWB 5IC4B 3IBCB 1PYOB 2FQQB 4ZVRB 1RWXB 2H4WB 3GJSB 1SC3B 2CNNB 2XYHB 2XYGB 4JB8B 2XYPB 4ZVTB 3R6GB 1RHJB 3P45B 2C1EB 4DCJB 1I51B 2CNKB 4ZVQB 2DKOB 4LSZB 2HBYB 3NS7B 2H4YB 1RHQB 3KJFB 2H48B 4DCOB 3R5JB 1RE1B 2QL5B 4DCPB 1RWMB 3IBFB 1RWWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJX B;  3GJR B;  1RHK B;  2QLJ B;  1RHM B;  3QNW B;  1IBC B;  3EDQ B;  2H65 B;  1ICE B;  3R6L B;  2Y0B B;  1PAU B;  3RJM B;  2Y1L B;  2QL7 B;  5K20 B;  3D6F B;  2XZD B;  1QDU B;  2QLB B;  2H5J B;  2C2M B;  3KJN B;  2CDR B;  2CJY B;  1RWP B;  3R7B B;  4ZVU B;  2C2O B;  2H51 B;  3KJQ B;  2QLF B;  3EDR B;  3SIP B;  1RHU B;  2HBR B;  1I3O B;  1RWK B;  2QL9 B;  2CNL B;  1SC1 B;  2H5I B;  2HBZ B;  2P2C B;  3R7N B;  3GJQ B;  2C2Z B;  3D6M B;  3GJT B;  1BMQ B;  3D6H B;  1RHR B;  5IC6 B;  4ZVO B;  3R7S B;  1SC4 B;  1F9E B;  2H54 B;  1RWO B;  2CNO B;  1QTN B;  2XZT B;  4ZVP B;  1NME B;  2C2K B;  2HBQ B;  3P4U B;  1RWN B;  1RWV B;  4ZVS B;  1GFW B;  5IC4 B;  3IBC B;  1PYO B;  2FQQ B;  4ZVR B;  1RWX B;  2H4W B;  3GJS B;  1SC3 B;  2CNN B;  2XYH B;  2XYG B;  4JB8 B;  2XYP B;  4ZVT B;  3R6G B;  1RHJ B;  3P45 B;  2C1E B;  4DCJ B;  1I51 B;  2CNK B;  4ZVQ B;  2DKO B;  4LSZ B;  2HBY B;  3NS7 B;  2H4Y B;  1RHQ B;  3KJF B;  2H48 B;  4DCO B;  3R5J B;  1RE1 B;  2QL5 B;  4DCP B;  1RWM B;  3IBF B;  1RWW B; 
#chains in the Genus database with same CATH topology
 1GXL A;  2FTR A;  3GE9 A;  3ISN C;  1RTD A;  3TEG A;  4JBC A;  3CSK A;  3FMW A;  4QIF A;  2VBX A;  2B4O A;  2LXU A;  3HT0 A;  1RU2 A;  1E6V A;  4NA2 A;  3K0J A;  2C2M B;  5DG7 A;  2FY1 A;  4I7F A;  3TUZ C;  5HJX A;  4M8L A;  5D8H B;  1XR5 A;  1WHY A;  2XI2 A;  2MLY A;  2VC1 A;  5D4O A;  4N7T A;  1CC8 A;  1GXU A;  1LK7 A;  2P2C B;  3CC2 S;  1N8R T;  4QWE A;  5J2P B;  4ALZ A;  3DRS B;  2CNO B;  2NSB A;  4ELU A;  2Q6B A;  5KG0 A;  1FJC A;  2YNF B;  2C3Y A;  2D7S A;  3AB2 B;  2PC6 A;  4UOH A;  2YNI A;  3AFG A;  2W2O P;  2G0I A;  5E3C A;  1Z1Z A;  2M8D B;  8ATC B;  1BD6 A;  2OHD A;  2ATL A;  3DM2 B;  3KWM A;  3RAX A;  1NBE B;  1ZET A;  1ELO A;  1RHQ B;  2F40 A;  3H2U B;  4X4P A;  1SL0 A;  3ZNU A;  3HKZ D;  1S9E B;  1C0U A;  4FS1 A;  1WG5 A;  2HEK A;  3QID A;  1M5K C;  3MMA A;  4OHV A;  2ZHA A;  2R7Q A;  1JLB A;  2WVF A;  4J9P A;  4WU2 A;  3ENA A;  1L3T A;  1KBR A;  1N36 J;  1RWP B;  2V8P A;  3KHH A;  2VG7 A;  2YY3 A;  2C28 A;  3HHL B;  1REV A;  5C42 B;  4XDD A;  1N36 F;  2QA2 A;  4OX8 A;  4UF4 A;  4NLO A;  4V19 J;  5KFQ A;  1IKX A;  2NXC A;  4PQU A;  3JSY A;  2R9L A;  3CD0 A;  1VQ8 S;  2AV5 A;  5HQ8 A;  2IVM A;  4QWB A;  3OTD A;  1FRL A;  4KH1 B;  2GJF A;  1WTB A;  5KOW A;  4DUT A;  4RU2 A;  3MF5 A;  3TAN A;  5CD4 A;  2GNK A;  2MB0 B;  1VRU B;  4J9U E;  1NCL A;  5J2N A;  5IWA J;  3S7R A;  3CDW A;  3ILL A;  2F8H A;  3KG0 A;  2OAU A;  3EZU A;  3D9B A;  5IWA F;  2MQ8 A;  2RSQ A;  1CVJ A;  2CQI A;  2WSF C;  4B9S A;  2CZV C;  4ECV A;  1F3V A;  3BGL A;  2CJB A;  3KHL A;  4K5S A;  2XLJ A;  4NE9 C;  3ISZ A;  1Y11 A;  4ED4 A;  3EE3 A;  2QX0 A;  2J9D A;  1HL6 A;  2FY8 A;  2MKI A;  2YNG A;  1TKT A;  3JSM A;  5DO2 A;  4KGZ B;  1Y3K A;  5F0U A;  1F5A A;  2VKZ G;  4NZ7 A;  2AMC B;  4HT7 A;  2HYI B;  3ZZY A;  3LH2 S;  2RUG A;  4I69 A;  1R0C B;  2K7K A;  2W1B A;  4ID5 A;  1TP7 A;  2A2D A;  2KZM A;  3LA0 A;  3W3S A;  1TTH B;  2YKA A;  1VMB A;  3CPW R;  1FDA A;  5HLF A;  5HMZ A;  3CJ4 A;  1VBX A;  2AZ1 A;  4JI7 J;  2HNZ A;  4CT8 A;  1NAQ A;  3HJF A;  3B6B A;  4N76 A;  2LYV A;  4KQZ A;  1RWV B;  1MW7 A;  4JI7 F;  5IC4 B;  3UVJ B;  1PYO B;  3DOM A;  4MKV A;  2R8G A;  2LLZ A;  4FYD A;  2B6A A;  1IBL J;  2JEJ A;  2R8I A;  1IUJ A;  1FCA A;  4DPW A;  1IBL F;  2YWH A;  2VA3 A;  3NGK A;  3W66 A;  5CAA A;  5A8K A;  2ZDO A;  3NMA A;  4C8O A;  2FHJ D;  2FJA B;  4RJV A;  3BBF A;  1PAU B;  5J2M B;  1FO1 A;  2I8E A;  2EBG A;  2L9D A;  2DNY A;  5F8I A;  3VAM A;  4DQP A;  1H38 A;  3ENQ A;  4H4O A;  3SCL E;  2HQI A;  4FPR A;  3FEZ A;  1NHK L;  4R5P A;  1R0B G;  1RWK B;  1UPM B;  2BJE A;  1NDC A;  1JLA A;  1AA1 B;  3W1Y C;  4AT1 B;  4I68 A;  3L7O A;  3IFE A;  3QO9 B;  4OZJ A;  2L08 A;  2H9Z A;  3HVW A;  3ZZ0 A;  1GTE A;  4FNI A;  2KT2 A;  2W2M P;  1X9W A;  1HHQ A;  2DO0 A;  3C46 A;  1F2H A;  3EGZ A;  1YBU A;  2DK2 A;  3OUY B;  3MMJ A;  4WFX A;  3GV7 B;  2ALZ A;  3ILJ A;  5B09 A;  4DZD A;  4EO6 A;  3Q24 A;  3HD1 A;  5A0Y A;  3U1M A;  2HVH A;  5GAE U;  1EKR A;  1H3D A;  2GIQ A;  3NGU A;  3ENV A;  1Y9O A;  1CEZ A;  1VOM A;  1K8A T;  1HBU B;  1VK8 A;  3DRR A;  1MSW D;  2CIM A;  4B9L A;  4UOC A;  2Z2M A;  5AE3 A;  2PSZ A;  3CE8 A;  2ZD1 B;  2A18 A;  3VAJ A;  4F3Q A;  5LSR A;  2GVZ B;  2QL7 B;  3VTI A;  3FSI A;  3O3L A;  4K4T A;  1CJV B;  1TMJ A;  4CQ1 A;  2OPP B;  5DDR C;  3PVX A;  1DQA A;  3QIP B;  4C8K A;  3P49 B;  3GPA A;  3QGG A;  2DNO A;  1IBK J;  3J81 U;  5E0O A;  1NJW A;  3KHG A;  3L09 A;  3PRV A;  1IBK F;  2VZ9 A;  2M0G B;  2CVI A;  1T7P A;  4B02 A;  2MKC A;  2GHV C;  2KL8 A;  1DQ8 A;  3FFI B;  1NME B;  3OFG A;  1YKW A;  2FHJ A;  3D68 A;  5CYJ A;  5EX3 A;  3NGS A;  3LAM A;  3M2R A;  3FDS A;  1QSL A;  2HUR A;  3EVW A;  3E01 B;  1FFS B;  4JI8 J;  3VGS A;  3JYT A;  2MZS A;  4DL5 A;  5CZX A;  2XY5 A;  3DCA A;  3CJK B;  2LFV A;  1D8Z A;  5E3Q A;  2W24 A;  2PEB A;  1KVJ A;  2M8H A;  4JI8 F;  2HBY B;  1WC0 A;  5J1P A;  2WRM A;  4OHW A;  1U2C A;  1RWM B;  3MFH A;  1N4L A;  4OX6 A;  4P73 A;  4ZMM A;  2BJ7 A;  4IR9 A;  4U9R A;  4DV7 J;  1QD1 A;  4X4Q A;  1VFJ A;  2CPI A;  3G96 A;  2XSJ A;  1YX2 A;  4PWD A;  5IT4 A;  4NLV A;  2FJB B;  1SJF A;  1I6J A;  4KT0 C;  4DV7 F;  1N0U A;  2XS2 A;  4NOH A;  6FDR A;  3TX0 A;  3X1L B;  4F2S A;  1QJH A;  4ITS A;  1T0T V;  2RDD A;  1IBM J;  4OHY A;  4DI6 A;  1RKI A;  1WDD A;  2QG9 B;  4C4W A;  2FHO B;  1OY9 A;  3QSI A;  4X64 J;  1IBM F;  2HHS A;  2H5I B;  2AD9 A;  1X7V A;  2E29 A;  4AYB D;  3LWL A;  3MCM A;  1WUU A;  2ZH4 A;  3GJT B;  2G2Z A;  4X64 F;  1TL3 B;  3D54 A;  5FJ4 A;  2W4P A;  4Q45 A;  3GWC A;  5DLG A;  4ZVR B;  2AGQ A;  1SC3 B;  2LQ5 A;  3MEE B;  2XNQ A;  2DH8 A;  1DTQ B;  4ZPW R;  1LWF A;  4BS2 A;  4KBI A;  2DGT A;  3R8Y A;  2R8H A;  2D1C A;  3F0N A;  2MY8 A;  3MEG B;  4OZ3 A;  2WON B;  2HHH J;  3CJ0 A;  1KVK A;  5KFL A;  4WK3 A;  5H9F J;  1FRI A;  4X65 J;  3PW0 A;  1N5S A;  3TUP A;  2HHH F;  2O67 A;  5DJB A;  1ICE B;  5J2Q A;  2B4V A;  2BQ3 A;  3M05 A;  4PG4 A;  4USI A;  4X65 F;  3TUI C;  3H90 A;  4OYI A;  4ECS A;  3OHB A;  4W90 B;  3AY0 A;  2XBP A;  5DET A;  3FBC A;  3FQL A;  1RWU A;  4RW8 A;  3N0V A;  3BGR B;  1VJQ A;  4CWB A;  2IYI A;  1CJT A;  2RDI A;  1R8B A;  3MEC A;  1FD2 A;  2K8G A;  1YRU A;  4EEY A;  1FWL A;  1O0P A;  3EXY A;  3G8Q A;  1B64 A;  2KTQ A;  3VAG A;  3DMJ B;  3DOK A;  3RB6 A;  1W2I A;  5K9F A;  4LBH A;  1OMS A;  3HSJ A;  4USK A;  1UZD A;  4JV0 A;  1N88 A;  3PEJ A;  4Y6I A;  5A8R A;  1RYS A;  4XIU A;  2NQP A;  5T7L B;  2HAI A;  3TAP A;  3SQG B;  1JKH A;  1EP4 A;  2YWK A;  4MIA A;  4DPU A;  2ZM6 J;  5J1E A;  1BQM A;  3AQO A;  2OPS A;  1XNR J;  3WDO A;  4U7C A;  1PKU A;  2ZM6 F;  2VQE J;  4J37 A;  1B7Y B;  2OTL S;  1RU1 A;  3BSN A;  1XNR F;  2VQE F;  4QWD A;  2W25 A;  3OFE A;  2GGP A;  1FKP A;  4A8W A;  3GIM A;  4Q7A A;  2CQ1 A;  1FTR A;  3QGH A;  4OYB A;  1WHX A;  4ZCK A;  2PFD A;  3TJ9 A;  4DF4 A;  3R2C J;  3RRH A;  1FRM A;  3CT9 A;  4JYA F;  4H4K C;  1X60 A;  3PRB A;  3W8P A;  2ABY A;  2LQ9 A;  5C7P A;  4Q8E A;  2E9T A;  3QLH A;  3DFE A;  2QE5 A;  2PI4 A;  1TEL A;  3I82 A;  1HNI B;  2UV8 A;  4N8N A;  4MFB B;  3J7Z T;  2CJQ A;  4CO4 A;  4LF6 J;  1RP5 A;  1VQ9 S;  3BV8 A;  2EC2 A;  3ITH A;  2VPX B;  4LF6 F;  3V2U C;  1U2F A;  3J81 Y;  1R89 A;  3IR5 B;  1M1K T;  2HSE B;  2IM1 A;  3NCR A;  2CQH A;  4RUA A;  1CS4 B;  1LW0 A;  4F4K A;  3EXC X;  3B4D A;  3QQC D;  3OVB A;  2LMI A;  2M9K A;  2YKM B;  2Z56 B;  3UFC X;  2CAJ A;  2LKZ A;  3Q22 A;  1X4D A;  5KOX A;  3CW2 C;  2NUU G;  3UDE A;  5HP1 A;  2X3D A;  3ZTO A;  1D9F A;  1BY9 A;  3W2W B;  3MMB A;  3TA1 A;  4YQW A;  1VQY A;  4PAB A;  2OFG X;  1FTC A;  4HI1 A;  1U2R A;  1JLG A;  4Y00 A;  2VFS A;  4B3T F;  3D1O A;  4Q44 A;  3DLJ A;  3GSD A;  3M8Z A;  4FXW A;  1MNE A;  1U1Q A;  3GIR A;  1XWL A;  3I0R A;  3VZH A;  3UWT A;  3G86 A;  1IXK A;  4NEY A;  2XQC A;  2YKO A;  2VJU A;  4G3I A;  2V2V A;  1FDD A;  1D0E A;  3R6G B;  4DU7 A;  1NXI A;  3MM6 B;  2BAN B;  4CM0 A;  3DRP A;  1LNQ A;  4DV5 J;  2Y3Y A;  3MPD A;  1U1M A;  2P5V A;  2HQF A;  3R5J B;  1H2V Z;  4B3O A;  3I4H X;  3K5L A;  3WQP A;  1AYE A;  1LK5 A;  2AW0 A;  1W25 A;  2RB7 A;  1N5Y A;  5B0F A;  3DN9 A;  5HAN A;  3DLG B;  2B3T B;  3EIC A;  4L6V 3;  4K4U A;  1Q16 B;  4WFY A;  5H9F K;  3D0I E;  3MM7 B;  4A8X A;  4CRJ A;  5GMK a;  2OLW A;  4WBF A;  3M6V A;  2ZE2 B;  5KTQ A;  4OMF G;  2DXD A;  4I2Q B;  1RT7 B;  1C2P A;  4WYW A;  4P52 A;  2DGW A;  2CWX A;  2RIJ A;  3OW2 R;  4UOG A;  4I1T A;  4CTA A;  3PAC A;  3CD6 S;  4ATN A;  1IKV A;  4TU7 A;  2BAB A;  3S01 A;  4KAI A;  2WW8 A;  4OI3 A;  1YJ9 S;  4FYV B;  4YY3 J;  2NXU A;  1X5T A;  3IWL A;  2EBE A;  4KIA A;  4YY3 F;  1BLU A;  4AXI A;  4M94 A;  1BGX T;  1NK9 A;  4DR6 J;  1NSP A;  3MR3 A;  4F4Y A;  1T9V A;  4UZC A;  3NS7 B;  4DR6 F;  2DXF A;  2X1B A;  2XNR A;  4Z37 A;  3BEG B;  1PJ6 A;  2CQ0 A;  3OR1 B;  4M5I A;  3TR5 A;  2D69 A;  2UXC F;  5J2P A;  4TLR A;  2NXN A;  3DRS A;  3D3B J;  4LT6 A;  2OD4 A;  4A8F A;  4HR2 A;  4ES1 A;  2UXD J;  3D6F B;  4BC7 A;  8AT1 B;  2Y1J A;  2YNF A;  1S0V A;  3DNC A;  1NH7 A;  2ZBP A;  5KG3 A;  4OYO A;  1TU0 B;  4YB1 P;  2IMO A;  2G0J A;  1IKY A;  2UXD F;  3KK1 B;  2LA4 A;  2V9K A;  4Y3C A;  4UZB A;  3OTE A;  2GQQ A;  4ZVG A;  4ZKA A;  4RUH A;  2FZG B;  3DM2 A;  1KFD A;  5IS2 A;  3BKT A;  3IN5 A;  4LF5 J;  4PRF A;  1IJE B;  5IT9 U;  2ATC B;  2AYE A;  3GFZ A;  3ENW A;  1FXD A;  4RL1 A;  3QYY A;  2H54 B;  1I1G A;  2BM0 A;  4JI3 J;  1S9E A;  4RBT A;  2M4M A;  3KKF A;  1JMT A;  1EQM A;  3W5Z A;  2KG1 A;  1VBY A;  3HZG A;  5JXS A;  5K14 B;  1RTH B;  4F04 B;  4NLG A;  4JI3 F;  2OP5 A;  5AXK A;  5KFO A;  1UVL A;  3NS6 A;  2VOO A;  2E9R X;  1VGY A;  3K17 A;  3JB9 k;  2B5J B;  4ZN3 A;  3FC9 A;  4OI1 A;  3ZTR A;  4DSK A;  3HVA A;  1CG2 A;  1SVD A;  5C42 A;  2E9Z A;  3BS9 A;  2MZT A;  4DOZ A;  4USV A;  3N5F A;  2DGS A;  2I9S A;  1TK0 A;  1ZYQ A;  1WAC A;  4B3M F;  5F8M A;  1LWX A;  1TVR B;  2HS3 A;  3POT B;  2O5D A;  1HMV B;  1KR4 A;  2MQP A;  2AWZ A;  4EBE A;  2NZC A;  3Q8V A;  2G0C A;  4M5H A;  2F4F A;  2OPR A;  3JTN A;  3PR4 A;  5A8W B;  2ZUG A;  4O3P A;  1VRU A;  3Q8S B;  5HVG A;  3FZB A;  2C2O B;  1OSD A;  2KYX A;  4O3N A;  1EIY B;  3TQ1 A;  3NGR A;  4P7V A;  4XPE A;  3BQ1 A;  4DU8 A;  5HMW A;  4ZP6 A;  3CCS S;  1FNO A;  3IGN A;  4UUW A;  2K3K A;  4K2J A;  5HBM B;  5KFE A;  2WVC A;  5H9E J;  4FF1 A;  4O4R A;  2YX1 A;  3GSI A;  1RBL A;  2O66 A;  4WKY A;  4YB7 A;  2XM3 A;  2EXU A;  3M8P B;  4F4W A;  3OFF A;  4AD6 A;  4KJI A;  4C0H A;  1Y0H A;  1WC6 A;  4TQR A;  1F60 B;  2HK2 A;  3CB4 A;  4E8U A;  1RLD A;  1ZH5 A;  1SCJ B;  3O5T B;  3P6Y C;  3D1Q A;  2GO9 A;  1CJU B;  1S5Z A;  2BKP A;  4USU A;  4ZCM A;  3W64 A;  3KK3 B;  2V2K A;  4FKY A;  3QT7 A;  2M3D A;  2C3O A;  4K8R A;  4C8L A;  2XS7 A;  2B4P A;  3UVJ A;  1D09 B;  4FS2 A;  3D4J A;  2WBM A;  3BGU A;  3IWN C;  1Z2Z A;  1N5V A;  2RRN A;  4DSJ A;  4IUF A;  2QYC A;  1X4C A;  1RTI A;  2PE8 A;  4DV2 J;  3DLE B;  1MG7 A;  1GX5 A;  2AJF E;  4KYZ A;  4LMZ A;  4PXE A;  4DV2 F;  5J2M A;  3PJW A;  2KVI A;  2LEA A;  1Y5N B;  2MQN A;  1VJW A;  2ZWP A;  4K4S A;  1WC4 A;  1IWA A;  1RZM A;  4DFM A;  1NK0 A;  1KQK A;  2LDI A;  5T41 A;  4WPA A;  2HWH A;  2JEG A;  1JXV A;  3TW0 A;  3VF0 B;  3QO9 A;  1CC7 A;  1G6B A;  2V8V A;  3V6K A;  2DHH A;  3ZZO A;  3QT5 A;  3CJ2 A;  4UQT A;  4JI1 F;  5CYM B;  4LRB A;  2ZDP A;  4EZ9 A;  2MQO A;  4NWB A;  5EWE A;  1FK9 B;  3THP A;  2IC3 B;  2VG6 B;  5F8G A;  3HKW A;  4BWJ A;  5J1N A;  3D1H A;  1YI2 S;  4ZLN A;  1AT1 B;  4ZVH A;  3MAA B;  1HBU A;  1NND A;  5L9X A;  4YUD A;  2FJW A;  1SIW B;  2V63 A;  4JV2 A;  2PI5 A;  2ZD1 A;  2J6S A;  5C5J A;  1WD6 A;  1W2B R;  2HNY B;  3CDU A;  2AZ3 A;  1CJV A;  2ERR A;  4P71 A;  4OQJ A;  2GV1 A;  5HQL A;  3UNG C;  2VPY B;  3QIP A;  1RDR A;  1N32 J;  2CWK A;  2V34 A;  1RTJ B;  5IT9 Y;  2Q43 A;  1QM9 A;  4PXB A;  2DR9 A;  3M32 A;  1N32 F;  2DR7 A;  3IBF B;  4DBQ A;  4O3R A;  2YKN B;  4LF7 F;  3OV7 A;  4M95 A;  2XSF A;  3A8I A;  2HFZ A;  1NDP A;  2E5L J;  4OZN A;  2QIF A;  3IWX A;  2VU5 A;  3PX4 A;  2E5L F;  5E41 A;  3NAI A;  3KHR A;  1RCO B;  4CYU B;  4L74 A;  3L3C A;  1RT2 B;  1B0V A;  3E01 A;  1GMW D;  3RBX A;  3V6D B;  4K5R A;  1SKS A;  3LGH A;  2AYB A;  5ETT A;  4Z7C A;  2N3L A;  2F8E X;  1V5V A;  2MDA A;  4LF1 A;  2K7J A;  4WZM A;  3CJK A;  1U47 A;  1OQ6 A;  1SJ3 P;  4J9K A;  2BW2 A;  2AJQ A;  1RUS A;  1S6Q B;  3ZZR A;  3OBI A;  2DGV A;  1YVF A;  4HDH A;  1ZA2 B;  3JQJ A;  1J2V A;  4ERD A;  4ILL A;  2UVR A;  3MXH P;  5IT0 A;  3GFH A;  1Y7P A;  3BF4 A;  2P6T A;  5H9E K;  1HPZ B;  3H0P A;  2FVC A;  1P1L A;  2FDN A;  2H4Y B;  5DLF A;  1FX2 A;  4KPY A;  2Z8Q A;  3GFY A;  2UUC J;  4OLP A;  2XEX A;  4RU9 A;  1RHK B;  5ETQ A;  2B7C B;  5KFD A;  3T1H F;  1TL3 A;  4H4M B;  2UUC F;  1SC6 A;  3ZFV A;  2KHD A;  1FJ7 A;  2CRL A;  2CFX A;  1S12 A;  1VIX A;  1RK8 A;  1TFW A;  2GQ2 A;  3X3U A;  1YJR A;  3C15 B;  3IG1 B;  3NCQ A;  1S99 A;  3A3P B;  4DR5 J;  2MLZ A;  2XGQ A;  3MEE A;  2HBR B;  1DTQ A;  5EX0 A;  4M5M A;  2CXE A;  4QPX A;  4HHH A;  3MEG A;  4ZJL A;  4K4V A;  3CCJ S;  3DU6 A;  4Q5V A;  2JFK A;  1JWW A;  1UW9 A;  5LXY A;  3NNC A;  2BBE A;  3CCR S;  4ECU A;  1D1U A;  4DS5 A;  1T94 A;  1KLN A;  3AD9 C;  4MKY A;  4B08 A;  2XGP A;  2XHC A;  4LF8 J;  4Q2M A;  2HIY A;  3N5B A;  4RLE A;  3BGR A;  1UFK A;  2W9A A;  4LF8 F;  1GMW A;  1NSQ A;  3QRQ A;  4RKU C;  5KG2 A;  3IM8 A;  5BYR A;  2CPZ A;  3AJ1 A;  1HWI A;  3RB3 A;  2COL A;  2FVR A;  3GR0 A;  1GMU A;  3ICL A;  3DMJ A;  4O3O A;  2BZ2 A;  2EKN A;  3NLC A;  2M88 A;  2HRT A;  1CUL B;  5F3T A;  9RUB A;  1Q8I A;  2B9X A;  1QLN A;  3UDV A;  3HF5 A;  5T7L A;  2GMH A;  2J5A A;  3SQG A;  1VBZ A;  4OI6 A;  3LP0 B;  4DPO A;  5I42 B;  2P9G A;  4RNF A;  2A0F B;  2MXY A;  5ETP A;  3ZTS A;  2HQG A;  3QJL A;  3UD5 A;  4LBP A;  3FQK A;  1HNV B;  3QFH A;  2K06 A;  3TAQ A;  2QN6 B;  4TLQ A;  2WVD A;  4LRD A;  1S1V A;  2W4D A;  3H2L A;  5HVH A;  3CVK A;  2VOD A;  3J81 j;  3QRP A;  5G0R A;  2OIH A;  4C11 A;  4ZLP A;  1HNW J;  4YOE A;  4J9N A;  1HNW F;  3M8R A;  1RYR A;  4MFB A;  4K4X A;  1JXL A;  3MPU B;  1T11 A;  3M4X A;  2QEX S;  1VC0 A;  1YJW S;  1RTD B;  3GMG A;  1TKZ B;  3QSY B;  2LCW A;  3BGF A;  1S9G B;  4RZR A;  1PAE X;  4IG0 A;  4UST A;  1TK5 A;  3H5X A;  2KJW A;  3K2Y A;  2YKM A;  3R7S B;  2A6M A;  2AF6 A;  4Y34 A;  1R8C A;  3QPI A;  1VR6 A;  4X4S A;  5KT7 A;  4DL6 A;  4A46 A;  4DL7 A;  2IM3 A;  2A3J A;  3EZO A;  4ED2 A;  4F4X A;  4M5K A;  3K8W A;  4PWW A;  3ZTQ A;  3D6T B;  4XPC A;  2B9E A;  5KG6 A;  3W2W A;  2WSE C;  2JSX A;  5B0B A;  1APS A;  1EQ0 A;  5LMN J;  1U0S A;  2YNH B;  4NLP A;  4I0W A;  4LRC A;  4GMK A;  2JNJ A;  4RW7 A;  2YNI B;  4U6P A;  5LMN F;  1RE1 B;  2J7U A;  3DOL B;  3HMJ G;  4LQ9 A;  4OZ1 A;  1F9F A;  3M6W A;  2DNM A;  4PXD A;  1ULR A;  3BB5 A;  1M90 T;  4ZHR B;  1ACM B;  5HK4 A;  5KFT A;  5HN0 A;  3PHE A;  5FDL B;  2EWH A;  1X4H A;  2DYA A;  4JV1 A;  2M7S A;  1VK3 A;  3AH6 A;  4A4J A;  3CJT A;  3MOZ A;  4FVC A;  2AX1 A;  3EM1 A;  4ZLL A;  1ZAV A;  2B8P A;  3MM6 A;  2ZJQ Q;  2BAN A;  4LIR A;  3T5K A;  2A10 A;  2QTW A;  1JX4 A;  3CWJ A;  3HP6 A;  2OKQ A;  4WFN Q;  3D6H B;  1REV B;  4CDI A;  4RBV A;  3VAF A;  1LWE B;  1N0V C;  4OHZ A;  5T14 A;  3DLG A;  3MEK A;  3UW1 A;  3T6J A;  5KFZ A;  3DGV A;  4DZ6 A;  4ZIV A;  1MN7 A;  3J7Y I;  4J9S A;  3NGT A;  2VB6 A;  3MM7 A;  1TL5 A;  4P7T A;  5J2N B;  2ZE2 A;  1JJ2 R;  2DHG A;  4I2Q A;  4FNH A;  4OI4 A;  2J76 E;  5SZT A;  2KJV A;  3IAM 9;  2B8Q A;  3HVR A;  2QLB B;  4OJ3 A;  4MTP A;  2CDR B;  4WZQ A;  1R6V A;  1U6B A;  2XY7 A;  4X4O A;  4CO2 A;  4CO0 A;  4EGL A;  4EYH B;  1KNZ A;  5HAT A;  1ZA1 B;  2RU9 A;  2N7Y A;  2KG0 A;  2LA6 A;  1P9Q C;  3I4P A;  2FGO A;  3H25 A;  3OR1 A;  1YK9 A;  2WK4 A;  3HFK A;  3WBZ A;  2RJZ A;  1MMD A;  2XWY A;  5KFW A;  3OLA A;  2V0N A;  1LV5 A;  4WIQ A;  1VHF A;  3BRE A;  3G9C A;  2KO1 A;  4PYA A;  2V4Q A;  2HNZ B;  2VD3 A;  1I51 B;  5F8L A;  2ROE A;  5C25 B;  3GCX P;  2JZ5 A;  3IC1 A;  3OT9 A;  2C2N A;  2BVZ A;  3HFZ B;  1YWX A;  4USJ C;  5IOL A;  4CLK A;  1GX6 A;  3H7H B;  3KLH B;  4AQY F;  3PW5 A;  1K1Q A;  3AD8 C;  1U09 A;  1ZAW A;  3FBF A;  4EYI B;  5HO4 A;  2I5J B;  5A8K B;  4P2X A;  5K14 A;  3PX6 A;  5DM6 Q;  2HPU A;  2AJ4 A;  1SUQ B;  2B5J A;  3MOJ B;  3VGV A;  5ETN A;  4UTG A;  3RBZ A;  1HQU A;  1WOS A;  2HBZ B;  4B9M A;  2OD6 A;  1TAU A;  3N79 A;  1ZPV A;  2V4R A;  2BUN A;  1KTV A;  1JLA B;  1PBA A;  3PTW A;  1HMV A;  4EFA C;  1CPZ A;  4JP8 A;  2YQ3 A;  4F25 A;  1DJ0 A;  3L9Z A;  1FXL A;  2DNQ A;  4XTT A;  5A8W A;  1U49 A;  2XMU A;  3GQC A;  4N8O A;  2XO6 A;  2DHX A;  4F36 A;  1JLF A;  3T5J A;  2DIT A;  2GCF A;  4NLX A;  1PSD A;  2YX4 A;  4YB5 A;  3PYE A;  1LXN A;  4HYK A;  2EW9 A;  3VAL A;  4WXO A;  3NNA A;  3L7U A;  3KFW X;  2BJ3 A;  2G2Y A;  5HBM A;  2WW4 A;  1U7L A;  2KT5 A;  3R5B A;  3M8P A;  2HKE A;  3M2U B;  4JI6 J;  5E3P A;  3VQT A;  3M9O B;  4JI6 F;  3RU0 A;  1VRT B;  4CLF A;  2HVZ A;  3D0H E;  4LSL B;  3EDR B;  1CQM A;  3MZI A;  5B0A A;  5A2Q U;  1ZBT A;  1OPZ A;  2CPJ A;  3DLB A;  1UWA A;  3MUR P;  3EPG A;  2VF3 A;  4IFV B;  1CJU A;  1OS5 A;  3MAQ A;  2QSW A;  3SSQ A;  4DUZ J;  3KK3 A;  3I56 S;  4S0M A;  4DUZ F;  3IAS 9;  1S0O A;  3O44 A;  3C3L A;  3MM9 B;  4D3H A;  2WTF A;  4PG7 A;  1RAB B;  2PFF B;  1JK9 B;  1RT4 B;  1KFS A;  1TUW A;  3F73 A;  5KFA A;  3CJS A;  3RW6 A;  2AT1 B;  1JLE B;  5AXN A;  3ET6 A;  2MSS A;  3ZZP A;  1KHW A;  5KFF A;  3R6L B;  2MKK A;  3DLE A;  4LF4 J;  1HBM A;  3RB4 A;  1VQ6 S;  3SSR A;  3H5S A;  3AT1 B;  4LF4 F;  4WJB A;  5RUB A;  2DRB A;  1KC8 T;  4ECT A;  3CDB A;  3CJ8 A;  1UVJ A;  4R8U A;  2DRD A;  4P2S A;  2ADC A;  5DGA A;  2C3U A;  1U8W A;  4JUZ A;  2RQC A;  1NK4 A;  4PWD B;  1JJC B;  1QSS A;  2WB1 D;  3VVU A;  2Y8Y A;  5E5N A;  4X62 J;  4HL9 A;  1FJE B;  2AYG A;  1S7I A;  2VKR A;  4HT5 A;  5H1S V;  4O23 A;  1WHV A;  1YG0 A;  1KLM B;  2AX0 A;  5G4D A;  1VYA A;  4KH0 B;  2KXN B;  1Q53 A;  1TV6 B;  1GFW B;  5CYM A;  4WII A;  2GML A;  2XYG B;  3V4I B;  3IO1 A;  1AW0 A;  2IC3 A;  1X8D A;  1H73 A;  2AEJ A;  1N52 B;  2VG6 A;  3TA2 A;  5CQG A;  4DN9 A;  1U6F A;  2BJ9 A;  1XNQ F;  1S1W B;  1RKJ A;  5KFH A;  2HVE A;  4WXW A;  3UQS A;  2XWX A;  3M8S A;  5KFG A;  3E3X A;  3QT8 A;  2VHG A;  1N6Q B;  4P74 A;  3V81 A;  1S1X B;  4FXD A;  2CG4 A;  2H65 B;  4TU8 A;  2CPY A;  4ED5 A;  3BKF A;  3VWS A;  1UCN A;  3UCG A;  3WX4 A;  4M5J A;  2J0Q D;  4UOF A;  1BQN B;  1Q81 T;  2OGU A;  2VG5 B;  5C2C A;  3KJV A;  1UET A;  4TQS A;  1VQK S;  3PYF A;  4L3N A;  3I5C A;  2JH3 A;  2X1G A;  4MK9 A;  1YJ7 A;  1RTJ A;  4ID8 A;  2MEW A;  1J5E J;  4RW8 B;  5GAH U;  4RNM A;  4B9U A;  1P27 B;  1J5E F;  4RO0 A;  1ZZF A;  2YKN A;  1FNM A;  3RB0 A;  4JI4 J;  3WIV A;  5THW A;  1KOH A;  4ETX A;  1X5S A;  2ZFH A;  4AND A;  2GMJ A;  1RT2 A;  2V8D A;  5KFM A;  1EZZ B;  4LFB J;  3V6D A;  4X4N A;  3A4T A;  2DRA A;  4IKA A;  5SUH A;  4LFB F;  2ZVS A;  1FWK A;  4RR5 A;  4PG5 A;  1EP4 B;  4ETZ A;  1S6Q A;  4YP3 A;  5J1E B;  4J90 A;  2Y1R I;  1URR A;  5K20 B;  2EG2 A;  1FFG B;  4RWW A;  1V5I B;  1IM6 A;  3SSS A;  3H59 A;  4X4V A;  2Z2Y B;  2KB2 A;  2PMW A;  3OR2 B;  3MI7 X;  1HI1 A;  3OL6 A;  4F4Z A;  3B54 A;  1FKP B;  3ETO A;  3HM9 A;  1Z2L A;  4NRT A;  4URQ U;  2VFR A;  2V50 A;  5LM7 E;  2CQD A;  5DQI A;  2MQM A;  4ZCI A;  3B8H A;  4DJB A;  4H4M A;  1BHN A;  3C66 A;  3VGU A;  1WI6 A;  1XMQ J;  2V6A A;  4CO3 A;  3CXC R;  2GS8 A;  3ULH A;  2DGO A;  4H4K A;  1XMQ F;  2ASJ A;  1NSK L;  3W61 A;  3C15 A;  3IG1 A;  2HND B;  3LAN A;  5A2Q Y;  4CO5 A;  3JAM Y;  2Q3P A;  1NEE A;  3IXQ A;  1R7I A;  3Q8Q B;  2DNL A;  3JSR A;  2R7R A;  2QFJ A;  5KG7 A;  3UO0 A;  4WP8 A;  4IOC Q;  4Y2M A;  3C16 B;  2KYZ A;  4CZC A;  1T8E A;  5CD4 H;  2WOM B;  1S7H A;  1EKS A;  3T1A A;  2DHA A;  2QLF B;  4P2M A;  4FBU A;  1XN9 A;  2RDJ A;  2CUY A;  5CYQ B;  1FRH A;  3D5M A;  3NXZ A;  4MAK A;  1DY3 A;  4DSI A;  3FZ2 A;  1VLO A;  3NOC A;  1P9Y A;  3UD4 P;  1PCA A;  1PIE A;  3LAL A;  8RUC A;  2CQB A;  1VBK A;  4FVM A;  1FDN A;  1KWM A;  4DLE A;  5C2G A;  3P8B B;  1N5T A;  3DLK A;  2UZA A;  1DFD A;  2JJ4 D;  4IO1 A;  1R0A B;  1CUL A;  4X66 J;  2BE7 D;  2VIC A;  1NDK A;  5L39 A;  1PJ5 A;  2LQ8 A;  3BGO P;  5DQH A;  4X66 F;  4DPT A;  1YRX A;  1U25 A;  5HSP A;  3LP0 A;  1B3T A;  5CCL A;  4F0H A;  2D41 A;  4NI2 B;  5I42 A;  2MJU A;  1A0O B;  1DZ5 A;  4J9M A;  2WCX A;  3MD3 A;  3HXM A;  1HNV A;  4TY9 A;  3PZP A;  4MH8 A;  3JS9 A;  3IBW A;  4ZVU B;  3O8W A;  4ZLJ A;  4B9N A;  4UY8 5;  2HFN A;  3ZZZ A;  4ZPD A;  4CLL A;  5IQ6 A;  1LEO A;  1WC3 A;  5EWF A;  4PAA A;  5KFR A;  3VZI A;  2B9Y A;  1LW2 B;  4DPX A;  3MMC A;  5IC6 B;  2RRA A;  4TNO A;  4NA1 A;  2KKH A;  3M8W A;  2ACY A;  1SKW A;  1T9T A;  3AJ2 A;  3GB0 A;  4CTA B;  4CLU A;  2VUG A;  2ZIT A;  5I4M A;  3DU5 A;  1VIO A;  3EJM A;  2VFV A;  1TKZ A;  3KLF B;  2IFX A;  1S9G A;  4ZIW A;  2HQ3 A;  1HKA A;  5A6P A;  4OYM A;  4B9V A;  4DCO B;  1S72 S;  3LQV A;  1B0P A;  2BE2 B;  5L1J A;  2FHK A;  2RHQ B;  2Q1L A;  4FF3 A;  1JLQ B;  2J0W A;  5KT2 A;  2D3O R;  3C14 B;  2R3V A;  1NJY A;  4YS2 A;  3TZZ A;  2H5J B;  2Y8W A;  3A8E A;  4QU6 A;  2FB0 A;  5E3R A;  2R8J A;  3EGW B;  2H51 B;  3A1Y G;  5JJB A;  1GK8 A;  1GQE A;  1RT3 B;  2R42 A;  1OYE A;  4HAC B;  2G13 A;  4F50 A;  2YNH A;  2V69 A;  1UMJ A;  1IKY B;  4PZV A;  1S10 A;  2QLW A;  4A8Y A;  2DD8 S;  3DOL A;  3PO5 A;  2G4B A;  1HHT P;  3BO2 A;  4DS4 A;  1HQ2 A;  4W98 A;  2HMI A;  4FYW B;  2FHM A;  1X4A A;  2RF2 A;  3IRW P;  4PUO B;  2WAQ D;  3CCZ A;  4ZHR A;  1UW4 A;  3HJV A;  5FDL A;  1WI8 A;  1L5U A;  3UE2 A;  2Q79 A;  3MPW A;  2L9N A;  2DGU A;  3PIP Q;  3G6X A;  3HHN B;  1TL4 A;  1U0H B;  2BJ8 A;  3KDN A;  2VA2 A;  2HGL A;  3PV8 A;  2GIR A;  1NSA A;  3B78 A;  2RML A;  4EWT A;  4DFJ A;  2SXL A;  4TYA A;  2W9B B;  3RJM B;  1LWE A;  1GT8 A;  3IP0 A;  2R8K A;  1P6T A;  7FDR A;  4UT4 A;  2XZD B;  2XY6 A;  5AE2 A;  3DHX A;  1NJZ A;  1TR0 A;  1Q1K A;  4RW4 B;  2KI2 A;  3JTO A;  5DG9 A;  4DWI A;  3UD3 P;  2OPR B;  1OY8 A;  1X0P A;  5HVF A;  3HD2 A;  5HJY A;  2V2Z A;  1M5O C;  1PBU A;  4DLG A;  4A8O A;  1U4B A;  4C97 A;  4X4U A;  3W9H A;  3RR7 A;  1XEZ A;  2ZBR A;  3DGP B;  4GO5 X;  3HFV A;  1TKX B;  3KNA A;  2L41 A;  2FC8 A;  3M8Y A;  1UJ5 A;  4KSE B;  4F8R A;  3MHY A;  3K57 A;  3J7A N;  1NB2 A;  2FVS A;  1JB0 C;  2J9C A;  2ROG A;  4I2P B;  3OXF A;  3NMR A;  1UWB B;  4YME A;  1SKR A;  4QIG A;  1C1B A;  1DLO B;  2DEI A;  2DNP A;  5GAG I;  3LO3 A;  4YHH J;  2IBK A;  2OJ3 A;  3G8T A;  1TK8 A;  3I87 A;  2IJF A;  2JC0 A;  2EI5 A;  4YHH F;  4K7Q A;  2V5H G;  4JV5 J;  4DSE A;  3T41 A;  5L9N A;  4DR2 J;  2CZ9 A;  4ER8 A;  5GMD A;  4JV5 F;  2Y9H A;  4DR2 F;  5C25 A;  2C42 A;  1YJT A;  5KFY A;  4NEZ A;  4B3R J;  3UR3 C;  3R97 A;  5HI7 A;  1SJR A;  3KLH A;  3OTC A;  2VPW B;  4B3R F;  3WHI A;  2NCK L;  2J9E A;  3U1N A;  2FJV A;  2B9W A;  1RTI B;  2I5J A;  4U96 A;  5LSO A;  4BHQ A;  3SV4 A;  2X3G A;  1YDL A;  5BR8 J;  4Q0B B;  4N47 A;  1YZ6 A;  5AE1 A;  1SUQ A;  2ZOM A;  4LSZ B;  1R8A A;  2YH0 A;  3Q8U A;  3J80 Y;  1N34 J;  3SEO A;  1WKL A;  3GJR B;  3D0G E;  1FD8 A;  1N34 F;  4K59 A;  1FRX A;  2V8H A;  4IOB A;  4IFY A;  4DG1 B;  2HRU A;  3OL9 A;  2HHU A;  1O6X A;  2YWE A;  3HSZ A;  4U95 A;  3MR2 A;  3CDA A;  1KVI A;  3GV5 B;  2CQC A;  3MED B;  4F4A A;  4NZ0 A;  3ELH A;  1U02 A;  2JC1 A;  4O0I A;  3KK2 B;  4M5D B;  1KD1 T;  7FD1 A;  3VGT A;  1VQ5 S;  4URG A;  1UA1 A;  1TL7 B;  3US5 A;  4ED6 A;  4KC5 A;  4WFZ A;  4DL3 A;  4WP9 A;  2D3O 1;  4HKQ A;  1N54 B;  2IM0 A;  1NJX A;  2WB4 A;  3Q8Y A;  2LXF A;  2HQC A;  3M2U A;  3R1H A;  3GON A;  1S1T B;  1NK7 A;  1VRT A;  2ZJR Q;  4LSL A;  1QUV A;  2LDY A;  3PDN A;  4LF9 J;  3Q89 A;  5ETV A;  1RB0 A;  1RTZ A;  4ZP8 A;  3AA8 A;  4ZPV R;  5KFX A;  2OO4 A;  3AXK A;  2XLI A;  4LF9 F;  4IFV A;  1GAO A;  1SL2 A;  3U1L A;  3M32 B;  2QZ8 A;  2QA1 A;  3LGN A;  4IG3 B;  2KT3 A;  1GH8 A;  2B7B B;  1BWE A;  1U1O A;  4W92 B;  1QAJ A;  2ZUA A;  3DDK A;  1DUR A;  3RBD A;  2HS4 A;  3MM9 A;  1U1N A;  1G1X A;  4MIW A;  5F0W A;  2IYG A;  2VDI A;  1RT4 A;  3PX0 A;  2AYM A;  3A3O B;  1EX8 A;  2PD1 A;  4ED3 A;  1WTF A;  1ZTW A;  1JLE A;  4G1P A;  3TRG A;  4PR6 A;  4RNH A;  2C2K B;  4NCB A;  1NPR A;  1KEK A;  3V6H A;  5ITH A;  3CMA S;  3I5A A;  3A13 A;  4R25 A;  2YQ0 A;  3DRX A;  2DCL A;  3LTO A;  5KFB A;  3QAE A;  1J27 A;  2AJ0 A;  1NHV A;  1WSV A;  4N41 A;  4LR8 A;  2DHS A;  2HVD A;  3V6J A;  4YB6 A;  4LR9 A;  2CJX B;  3FSY A;  5L1L A;  4JI2 J;  1HIY A;  3AAW B;  3QZ7 A;  1AZS B;  4DL4 A;  3M6X A;  2W4C A;  4LIW A;  3LWM A;  3I6P A;  1KLM A;  1UVM A;  4WU3 A;  4JI2 F;  1W26 A;  3E2E A;  2CQG A;  4K50 A;  1TV6 A;  2CAD A;  1VC5 A;  2YBV A;  1QE1 B;  4P2F A;  2LU2 A;  3V4I A;  3DI6 A;  3P96 A;  3EMT A;  2H1Y A;  3OSN A;  2FLL A;  1S1W A;  2VL1 A;  1Q5Y A;  5F3Z A;  2Z4P A;  2DY9 A;  3MUM P;  2GIF A;  3PKM A;  1MML A;  2KRB A;  2FJX A;  3RYL A;  2VC0 A;  1N6Q A;  5U47 A;  1VLY A;  1S1X A;  3CTR A;  2DNZ A;  4W4M A;  2VON A;  3SQO P;  1BQN A;  4C8M A;  3UDL A;  2VG5 A;  4ZVT B;  3CNQ P;  4A48 A;  5B08 A;  2BM1 A;  1ROF A;  4USH A;  1BWV A;  2G1H A;  4ILR A;  2E7X A;  3H8Y A;  5CCM A;  4LQ3 A;  1S9F A;  2W7A A;  2MQQ A;  3CO9 A;  4OV1 A;  4KO0 B;  2CZ4 A;  5F8J A;  1KQG B;  4I64 A;  3PW2 A;  4ZVE A;  2V9W A;  1LWC B;  2F9D A;  4UUX A;  1J5O B;  1PJ7 A;  2R2S A;  4MT1 A;  2N3O A;  4KHP J;  2CVE A;  2JLG A;  2N4C A;  5K5M A;  2W7P A;  3PYD A;  4KHP F;  5GAD I;  2FJE B;  5HL7 Q;  3MTJ A;  2KH9 A;  3LP1 B;  1SQG A;  1SC4 B;  3UDC A;  4ECY A;  3VQS A;  4ZCL A;  3A8K A;  1NKC A;  5HAO A;  1FKA F;  2IJR A;  2OPQ B;  4Y2A A;  1S6P B;  4BLG A;  2MZQ A;  2UUB J;  4DR7 J;  3HI9 A;  3HHK A;  5ETS A;  2IY5 B;  3EPI A;  2XI3 A;  2DKO B;  3OR2 A;  5D0G A;  2BOP A;  3CD5 A;  2UVV A;  3LOU A;  1U1L A;  2RS2 A;  3D28 A;  5M2P A;  3CMQ A;  4HLB A;  3DHW C;  2CDQ A;  5ETL A;  1S1V B;  5HRO B;  3LPE A;  3KTQ A;  1CJK B;  2WZ1 A;  3BR8 A;  5G0R B;  3GR1 A;  3O1L A;  1DTT B;  2Y0B B;  4C11 B;  4DV1 J;  1U24 A;  4QYZ J;  2MKH A;  3QT6 A;  2CQP A;  4DV1 F;  2HAF A;  1S0N A;  5LXR A;  3BH7 B;  4C8N A;  2HND A;  2CNL B;  3M9M B;  2MKJ A;  2V68 A;  2HHT A;  2LU1 A;  3W5X A;  2NYH A;  1RLC L;  2VBY A;  3MGJ A;  1Q95 G;  1A7G E;  1ZOT A;  4RW9 B;  5JVG Q;  1RI7 A;  1RWO B;  4IG0 B;  3SBM A;  4ICL A;  5DDP C;  1SBR A;  3MR6 A;  6AT1 B;  2NXE A;  3FEY B;  4K4Z A;  4U67 Q;  2W9C A;  2ASL A;  2OEL A;  3C16 A;  4JB8 B;  1HNX J;  2WOM A;  4WP3 A;  1HNX F;  3PW7 A;  3LUY A;  3UN3 A;  4IRC A;  2F7V A;  3SFU A;  5CYQ A;  3FRZ A;  1MWQ A;  3MAH A;  2JEF A;  4NXM J;  1X31 C;  5EUH A;  4RW7 B;  2C22 A;  2GJI A;  1FRJ A;  2ALY B;  2CG8 A;  2HHQ A;  1R0A A;  2DB1 A;  2XO7 A;  4AUK A;  1HLW A;  4CLZ A;  4YFU A;  4CP5 A;  3BDE A;  2QRR A;  4KRW A;  2IIH A;  4C8Y A;  3MWB A;  4NI2 A;  3RGI A;  3CUN A;  3FJ2 A;  3FBE A;  4QR1 A;  3K5M A;  1BXN A;  4GO7 X;  3N01 A;  2VFT A;  4DV5 F;  1IM4 A;  4J9L A;  1DRZ A;  1NO8 A;  2HK3 A;  1R8P A;  4LR7 A;  2PT0 A;  2JX2 A;  1S49 A;  2MY7 A;  3R5A A;  3CCU S;  1IQZ A;  4DCP B;  2ZOG A;  1GTH A;  2M2B A;  4ZOS A;  1LW2 A;  2NR0 A;  2MZJ A;  4WYL A;  1SL1 A;  1ZM9 A;  4KR0 B;  2DNK A;  3CD7 A;  4U7U K;  2HQD A;  4OV6 A;  1M1H A;  1VQP S;  2VAS A;  3TAM A;  4RPF A;  1KN6 A;  1NU4 A;  1YRT A;  3KJQ B;  4U8Y A;  3BO3 A;  3KLF A;  2DNH A;  2DNR A;  3TWZ A;  2GW8 A;  2ZNY A;  2ZH6 A;  4LRE A;  2Z58 B;  1DHM A;  3D6M B;  3M8Q A;  5E7O B;  4DHV A;  2K1R B;  3K5N A;  3ADA C;  2IRU A;  1RHR B;  1FT8 A;  4NL5 A;  1T95 A;  2BE2 A;  1XQI A;  4O44 B;  1JLQ A;  2CPX A;  4NYO A;  4DEZ A;  2E44 A;  3MTK A;  3C14 A;  2XMW A;  3GU0 A;  2FPH X;  4RUC A;  1F9H A;  3TP2 A;  2Z0G A;  2K3I A;  5B0C A;  2MLX A;  4IDK A;  1RT3 A;  4HAC A;  2R7S A;  3DC2 A;  1FVQ A;  1FDB A;  1FX4 A;  2RNE A;  4DUY J;  2B43 A;  1RIS A;  2HHP A;  4Z2X A;  5MLC V;  2IRX A;  4DUY F;  3EVO A;  1HD1 A;  1M5P C;  4ZP9 A;  2EG1 A;  4PUO A;  3T5H A;  4TYB A;  3MFI A;  1K47 A;  2CJY B;  1T05 B;  3PG9 A;  4LF5 F;  2VV5 A;  4IH7 A;  2F5G A;  2IHR 1;  1C4A A;  3TX8 A;  1HW8 A;  4QYZ K;  2O1P A;  1U0H A;  3HVT B;  1VCT A;  2FYX A;  4OHX A;  3VAH A;  2E1M C;  4KHM A;  4ZDN A;  4GC7 A;  4GVB A;  3ZO7 A;  4BCA A;  1FWP A;  2ILZ A;  2OSQ A;  1HQU B;  3MPV A;  2C3M A;  2W9B A;  4QOT A;  4HI2 A;  1MN9 A;  4RW4 A;  4QW8 A;  3TYT A;  2CNK B;  1N56 A;  1UL3 A;  3CME S;  4XDC A;  1XR6 A;  4MYU A;  3Q2T C;  2BXJ A;  3N6L A;  3CCQ S;  3D67 A;  4Y2C A;  1GNK A;  4G65 A;  4KPC A;  1VI7 A;  1AXQ A;  3HZE A;  1FA0 A;  5KFP A;  4YDX A;  1IR2 A;  1QSY A;  1JLF B;  4KHR A;  2RU3 A;  3NP5 A;  1QVG R;  3H5U A;  3RAQ A;  1IVZ A;  4FBT A;  5D0R A;  4NCG B;  3EVM A;  4ZJQ A;  3DGP A;  1JLC B;  3C6T B;  2N7C A;  4GVL A;  2CJK A;  5HMX A;  1TKX A;  4CLW A;  1UEU A;  4GRS A;  3DDN A;  1VQ7 S;  4KV8 B;  3O2I A;  3KXD A;  4QQB A;  3Q8P B;  2R2R A;  2C3P A;  3DYA B;  2W8L A;  5E2Q A;  9ATC B;  2MGZ B;  2HZA A;  4I2P A;  1K9M T;  3KLI B;  1UWB A;  2JL9 A;  5F8H A;  2FC9 A;  3KMS A;  5AXL A;  4PG8 A;  4HVZ A;  4DX7 A;  1DLO A;  2W01 A;  3J7Z 5;  5EHH A;  4F2R A;  2MHN A;  5L1I A;  1UAW A;  1YIJ S;  1U8S A;  4IOA Q;  2FQQ B;  1GMV A;  2E1A A;  3OJU A;  4MK7 A;  1T9X A;  2CNN B;  3D3C J;  4MMO A;  2V4J B;  4H54 A;  3PJX A;  4Y65 A;  2ZVI A;  1L3K A;  3FVY A;  4ZP7 A;  5KFJ A;  4F02 A;  1KRP A;  2CJ9 A;  1RAC B;  3GYG A;  3AXM A;  1G4C A;  3CJ3 A;  1RAH B;  4QWA A;  1C0T B;  3RAM A;  1I94 J;  4EBD A;  2Y1L B;  3NCP A;  2XMM A;  2L48 A;  4I6W A;  2R7V A;  2GFF A;  2EFN A;  4J91 A;  3W2V B;  2KU7 A;  1H2U X;  3ET6 B;  1I94 F;  2IA6 A;  3MM8 B;  3BZQ A;  4QCL A;  1CSJ A;  4WTY A;  2FUG 9;  1HBM B;  4Q0B A;  4QIE A;  1RHU B;  4Z7Y A;  3TOQ A;  1UVK A;  2XC9 A;  1S4F A;  4QU7 A;  3LGM A;  3UN5 A;  1WSR A;  1OY6 A;  4R8U B;  4FF4 A;  1S4E A;  3HLU A;  5ETO A;  1RAO A;  1OWX A;  1X4F A;  4RW6 A;  1F1B B;  1WNE A;  5B7W A;  4FKX A;  1M5H A;  4DG1 A;  2BR0 A;  1H72 C;  1HFE L;  3T1Y J;  1KON A;  2PN6 A;  2YKQ A;  3ZC4 A;  3OVA A;  2ZKU A;  3MCN A;  2GO8 A;  3T1Y F;  2KFY A;  2IA0 A;  1GXT A;  3NG8 A;  2AEM A;  2PDA A;  2YH1 A;  4RNN A;  3FKB A;  3H2V E;  3NOG A;  2R7T A;  3MED A;  2LQB A;  2VBZ A;  3UN2 A;  2MJN A;  4NLW A;  3KK2 A;  2Z2Z A;  1NZ8 A;  4M5D A;  3OFH A;  1TL7 A;  2PMZ D;  2BE9 B;  4CH1 A;  4IRK A;  3NWR A;  2PA3 A;  2JFD A;  1NRK A;  3CGI A;  3V81 B;  1SH2 A;  3CJR A;  5M2U A;  4RBU A;  2EKY A;  5LJ5 Y;  2ZZT A;  2LEC A;  4O3Q A;  3C2P A;  1HWL A;  2CYY A;  1S1T A;  3R2D J;  2NRE A;  2BJ1 A;  2EFQ A;  4FYY B;  3KJV B;  4DR1 J;  3R27 A;  2I6W A;  1VRQ C;  4FZV A;  4CLP A;  1EET B;  4DR1 F;  4TXS A;  2MKS A;  1JJH A;  1T9U A;  2HS0 A;  2RE1 A;  1K0T A;  4M5L A;  1EHW A;  4OI2 A;  2GHW A;  3GZ7 A;  2ZH2 A;  1UFL A;  3OL8 A;  3BN4 A;  1SQE A;  4IG3 A;  5HQM A;  2V94 A;  4G1Q B;  2XS5 A;  3EUN A;  4RNO A;  2X7I A;  2OFH X;  2P9C A;  4IR1 A;  3OTO J;  1Q8L A;  3Q83 A;  2FLN A;  2XMJ A;  5L8R C;  1B70 B;  1U1P A;  2NYI A;  4NRU A;  5LL6 d;  3CC7 S;  3PRD A;  4IYQ A;  4LSN B;  3OTO F;  1FXR A;  4DDF A;  4I6A A;  1KTQ A;  2IM2 A;  2PEH A;  3GIL A;  4DX8 H;  3L4B C;  2DIV A;  5C24 B;  3TJA A;  3KLE B;  1QDU B;  3MUV P;  4E98 A;  4ED7 A;  4L3K A;  4P75 A;  3MD1 A;  3R5C A;  3KLV A;  3IRX B;  1JNR B;  3D7S B;  1AB8 A;  2MMY A;  5I3U B;  4WCE Q;  3HSD A;  5E33 A;  2P6S A;  4ZN1 A;  2ZBI A;  2KVQ E;  4U8V A;  3JSB A;  4USW A;  1K44 A;  1BMQ B;  4R0J A;  1DBD A;  3L7P A;  1RSC A;  2QC3 A;  2LVW A;  1HNZ J;  2HGN A;  1AZS A;  3H42 A;  4KE5 A;  2PMH A;  1X5P A;  4O4G B;  1HNZ F;  5KFV A;  2QFI A;  4DQS A;  2XMA A;  5I3P A;  3HUL A;  1R27 B;  1QE1 A;  1OPI A;  1HAR A;  1Y4Z B;  3P5B P;  1PYS B;  3D2W A;  1FHT A;  4IRD A;  3B4M A;  5KFU A;  4AL5 A;  5D4P A;  1I5O B;  2YQ1 A;  1OIA A;  1M0S A;  5GAE I;  1FRK A;  4X2B A;  2XLK A;  1VC6 A;  4DR5 F;  4ECX A;  4CNY A;  2BYC A;  5LT5 A;  1YIT S;  3BM7 A;  5EWG A;  2J7K A;  1DAX A;  3QWP A;  1EJ7 L;  2D9P A;  1TFY A;  2Q66 A;  1WF2 A;  4OX9 J;  2ZHO A;  5JVH Q;  3N4W A;  5DS7 A;  2ASD A;  4ELV A;  1A6L A;  4OX9 F;  2OH2 A;  4KO0 A;  3ZZU A;  1Y00 A;  2LEP A;  4C3K A;  3DKD A;  1PC5 A;  3TUJ C;  1FES A;  2E7V A;  1D9A A;  1G2E A;  4BBY A;  2OEM A;  2KXF A;  1LWC A;  1Z4U A;  1NHU A;  3U7J A;  2XYH B;  2XZW A;  1J5O A;  1NK5 A;  5D15 A;  1SB6 A;  1KHV A;  1XBW A;  2K2P A;  3RG6 A;  3I96 A;  3RR8 A;  3DLK B;  3NKY A;  2Z57 B;  2KM8 C;  5KFC A;  3KJF B;  4GKJ J;  2JDJ A;  1RBO B;  2XMK A;  2YTC A;  3GIK A;  4JOU A;  1Q4R A;  4GKJ F;  3LP1 A;  1VDH A;  1P1T A;  2G9O A;  1RA6 A;  3HO1 A;  5ETR A;  3UCU P;  2GZO A;  4F3O A;  2AHO B;  3QMQ A;  1PIL A;  2OPQ A;  3K5P A;  2ROP A;  1S6P A;  2OEJ A;  4WF9 Q;  4LF2 A;  3PJ9 A;  3AOB A;  3M2V B;  3IR6 B;  3BH6 B;  1FFW B;  2F1F A;  1SJQ A;  2OTJ S;  2Y1I A;  2I38 A;  3O6Q A;  4KTQ A;  1Q79 A;  2OI2 A;  4TVA B;  2D74 B;  1K0V A;  3GG1 A;  2BEF A;  3H4B A;  5HRO A;  4C8Z A;  1YBT A;  1CJK A;  3GCW P;  1DTT A;  5D4N A;  3BR9 A;  1ZS6 A;  1RBA A;  4C98 A;  4DV3 J;  3MMC B;  3GLJ A;  4CCH A;  1YBA A;  1SJ1 A;  4BDP A;  4DV3 F;  2FZK B;  1H0H B;  4L76 A;  3ETM A;  3B82 A;  3WC2 A;  3PNI A;  2EFG A;  3RRG A;  3T5L A;  5IM0 B;  2ZH9 A;  1M5V C;  2FVQ A;  3TVK A;  2VOP A;  3MPY A;  4RW9 A;  1UTA A;  4WTO B;  2WVE A;  1RA7 A;  1Q0N A;  4OYP A;  4MJK A;  3GII A;  4ED8 A;  1NJI T;  5GVQ A;  2DNG A;  1WOR A;  4OYZ A;  4QYR A;  3BSO A;  1HWK A;  5D6G A;  5F8N A;  3FNN A;  1WKJ A;  1B4S A;  1MWZ A;  1S0M A;  4NCA A;  2BA9 A;  3WC0 A;  2FLO A;  1Q86 T;  4JYA J;  3OTB A;  1RAD B;  3J7Y U;  3VR1 A;  2HG4 A;  1LOU A;  2XZT B;  4DQR A;  1SH0 A;  1FEE A;  1OSC A;  4M63 A;  3EZ5 A;  4L72 B;  3OLB A;  1NB7 A;  3BBC A;  1B7F A;  2VFU A;  1VQ4 S;  1ZZN A;  2HMI B;  2ZC3 A;  2RF2 B;  1O8B A;  4ZPT R;  5K8P A;  4XO0 A;  3RRK A;  5KFN A;  3Q8R B;  4Q2L A;  3TZW A;  4N56 A;  1T9Y A;  5A6W A;  1URN A;  1FE0 A;  1S76 D;  5I3Q A;  2X1F A;  1S1U B;  2DJW A;  2RT3 A;  2E5J A;  1QAX A;  3TI0 A;  5D3G A;  4NYP A;  3H40 A;  4ZPC A;  2ZKT A;  4FDF A;  3BJY A;  4KB7 A;  4HTI A;  2DGX A;  2CQ3 A;  3FSX A;  3HCX A;  2GHP A;  1N48 A;  4YR2 A;  2ZH7 A;  3SIP B;  3CCM S;  2ZH3 A;  2MST A;  2BAC A;  4KGX B;  1HQE B;  1OJ4 A;  3FCV A;  1PC4 A;  5L38 A;  1X5O A;  4NAS A;  1RAF B;  2N82 B;  4B3T J;  3K8V A;  2HFO A;  1HHS A;  3THV A;  2B56 A;  4WE1 B;  4CI0 B;  1F0X A;  1M5S A;  1ARO P;  4NYZ A;  3U27 A;  5FII A;  2EPI A;  2R2U A;  3H20 A;  2DXE A;  1ZM3 A;  2VJV A;  3SCJ E;  2IVY A;  1CBK A;  4PCQ A;  3KMQ A;  3S1T A;  5B0E A;  4L73 A;  2RIL A;  3M30 B;  3NAH A;  5B0G A;  3OXG A;  1YJN S;  4MKB A;  4I67 A;  1FKO A;  2K1R A;  4J5O A;  4EK2 A;  1HYS B;  2HIQ A;  4O44 A;  3PEH A;  1QTM A;  1X4E A;  3G82 B;  2WHO A;  3KNG A;  4NA3 A;  5K8N A;  1C1B B;  4NXN J;  3MR7 A;  2D3Z A;  1ZTT A;  2ZOF A;  4NXN F;  1U26 A;  2U1A A;  3K5O A;  3R1L A;  3GP9 A;  3E8O A;  3SMZ A;  5DZ6 A;  1DQ9 A;  1SC1 B;  2NS1 B;  1LKZ A;  4ED0 A;  2YKP A;  1WEX A;  5IFM A;  3HHL D;  1U1K A;  4UQG A;  1K73 T;  2DT9 A;  1X0F A;  3VHQ A;  5AJ3 J;  2RKI B;  4V19 X;  2YWW A;  1F5B A;  5LMU J;  4Y28 C;  5AJ3 F;  4V1A k;  4FN5 A;  4AXJ A;  2J8A A;  4ZA1 A;  5LMU F;  1RAI B;  1T05 A;  2E5H A;  2AKW B;  2CPE A;  4EZ6 A;  5K8O A;  3OJS A;  4CH0 S;  4RX6 A;  2DH7 A;  3T9Z A;  1YHQ S;  5KFI A;  2C2R A;  3HVT A;  1T02 A;  4PKD B;  3GG0 A;  1NKE A;  2G1D A;  3R3T A;  3SXL A;  2A1B A;  5CAB A;  2OMO A;  4QJV A;  5IV3 A;  5KT3 A;  1DAR A;  2UXC J;  1TL1 B;  5KFS A;  2M52 A;  3OQ2 A;  1MMN A;  1PGZ A;  1T03 B;  4IFY B;  1WF1 A;  3CCE S;  1F3F A;  2QL9 B;  3CCL S;  2R7X A;  2GX8 A;  2RUS A;  3R7N B;  3G2X A;  1QAY A;  2HVI A;  2ZZM A;  3TZX A;  4WFB Q;  3VAK A;  3FBB A;  2VIH A;  1X4G A;  4NZ6 A;  4DF8 A;  2XMV A;  3KDO A;  4KY3 A;  4OFZ A;  1O5J A;  4DR3 J;  3W65 A;  4NCG A;  3NEK A;  1JLC A;  2EFO A;  3C6T A;  1XR7 A;  4DR3 F;  1Y3J A;  2MKY A;  1IKW B;  5EDW A;  4C7Q A;  1AFJ A;  4KV8 A;  1X9M A;  2EK1 A;  3BO4 A;  3KUH A;  1HBN B;  2CJA A;  3DYA A;  3WX8 A;  2MGZ A;  1WEY A;  4DL2 A;  1G3O A;  3LF0 A;  3KLI A;  1RHM B;  1WEL A;  1Q78 A;  1TUG B;  3AOC A;  3V4M A;  2BX6 A;  5CH7 B;  2UUW A;  3K89 A;  3NRB A;  3HHL A;  1HD0 A;  2UXB J;  4B3M J;  1T9W A;  3JAM U;  3R9L A;  5FD1 A;  2BMB A;  3KJN B;  1SH3 A;  3AA9 A;  1AFI A;  3QFW A;  4A8S A;  3ZZT A;  1WEZ A;  5D0E A;  4FYX B;  3R5G A;  2UXB F;  1JXE A;  1R43 A;  1VQL S;  2V4J A;  1EAR A;  4F0M A;  3SDE B;  1GEH A;  4NLY A;  1YJU A;  1WG1 A;  2RVJ A;  3KUG A;  1JIH A;  5LSL A;  5CA5 A;  1MU2 B;  4DSF A;  2DO4 A;  4B17 A;  1X4B A;  4EBC A;  1C0T A;  2J7W A;  4O3S A;  1JNZ B;  1KQF B;  1YJV A;  3IBC B;  1TUV A;  2ILY A;  3W2V A;  2UUA J;  2CPH A;  2QMW A;  2AQ4 A;  3MM8 A;  1B99 A;  2LP4 A;  1RCX B;  2AJ2 A;  3LP2 B;  2OSR A;  4ZVQ B;  2APO A;  3CCW A;  2UUA F;  2YX7 A;  4DX6 A;  1NPK A;  5F41 A;  4HEA 9;  4HH0 A;  3HDS A;  3HSG A;  1W7W A;  3QJJ A;  2FJD B;  2P8I A;  1XK8 A;  5BJR A;  4DX5 A;  3S6E A;  3CF5 Q;  1QAI A;  5ETM A;  2L3M A;  4RWX A;  2AJ1 A;  2XHW A;  4X62 F;  2AIR B;  4ECR A;  6FD1 A;  1A9N B;  3QBC A;  1RT6 B;  3M1V B;  5ADZ A;  2F4V J;  2O3D A;  2KDO A;  3A12 A;  3FCH A;  3TZY A;  1Q82 T;  2A6O A;  4CH7 A;  1FJG J;  2RH3 A;  3DI6 B;  2F4V F;  3RW7 A;  4QPT A;  3THT A;  3W9I A;  2WVB A;  1VQN S;  1FJG F;  3W60 A;  5CZV A;  4YR0 A;  2V67 A;  4CT9 A;  4LBI A;  4UW2 A;  2AGP A;  2AU0 A;  2EK6 A;  2VQF J;  2BW7 A;  1EB0 A;  4P10 A;  2XYP B;  3T3F A;  1NLK L;  4DFK A;  2XMT A;  2VQF F;  3NNH A;  2EFV A;  3H4D A;  2FD2 A;  3I0S B;  3W8G A;  4EI2 A;  2DPI A;  3QGP A;  3VV2 B;  1HWJ A;  1RJJ A;  3VAI A;  1BQX A;  3JXO A;  4J7C A;  1EET A;  1KSP A;  1LXJ A;  3EDQ B;  2E66 A;  1WOO A;  5DRK A;  4L75 A;  2FIU A;  2VBW A;  2VPZ B;  1S57 A;  4ES2 A;  2V8G A;  4WFA Q;  2LQJ A;  4G1Q A;  1JQG A;  3N6M A;  3SV3 A;  2CA9 A;  4JI1 J;  4FXV A;  3CCT A;  4E2F B;  3CIZ A;  2YPY A;  3MDF A;  3OUY A;  4JI4 F;  3I9Z A;  3MM5 B;  2MTL A;  1F5C A;  1VQM S;  2J0S D;  3A8J A;  2YXL A;  2F65 A;  4TY8 B;  4LSN A;  3PFO A;  2RD5 C;  1RWN B;  3GYN A;  5BXI A;  3BPD A;  3GV8 B;  1HR0 J;  4OIX A;  4DV4 J;  5C24 A;  3JTP A;  3KLE A;  2KM8 B;  2ZBC A;  3GJS B;  1S48 A;  3CUL A;  5E3A A;  1D3W A;  1HR0 F;  1RHJ B;  4U7U D;  4DV4 F;  1H7W A;  2BOA A;  3IRX A;  5I3U A;  5DDQ C;  3EYZ A;  4NLS A;  2GVZ A;  4HDG A;  1LQ9 A;  2BJD A;  3PR5 B;  4A47 A;  3I31 A;  3NY0 A;  2OPP A;  1SQF A;  4HH1 A;  3TO8 A;  3PCO B;  1PG5 B;  2MQL A;  4OZ5 A;  1WWH A;  3IS9 B;  5DDO C;  3Q0A A;  4LF7 J;  4O4G A;  4HTJ A;  5KG1 A;  3FFI A;  3ZNJ 1;  3N6N A;  4KFB B;  1F2G A;  2FZC B;  3P3D A;  4OZL A;  3FMB A;  5KG4 A;  2NUH A;  4AE5 A;  2AP6 A;  3W62 A;  2GA7 A;  2CKW A;  3T9N A;  1UVI A;  1CLF A;  1BC6 A;  2D9O A;  3SCK E;  1MRO B;  2QV6 A;  3CCV S;  2OML A;  4ZS6 A;  4ICL B;  2LXI A;  4C48 A;  4I4B A;  4KKO B;  4IO9 Q;  2BRL A;  3F44 A;  2F9J A;  2IAJ B;  2DH9 A;  5F9L A;  3N9U C;  2W9C B;  4ZJO A;  3KLG B;  5LOQ A;  2QLJ B;  1RT1 B;  4P6Q A;  1LFP A;  5A76 A;  1WKK A;  3RBE A;  1M1G A;  3BKU A;  1ITP A;  4Y2I A;  4DXL A;  1HW9 A;  3T1H J;  3K7R A;  4M5G A;  2HLU A;  3WIU A;  3SZ2 A;  2UVW A;  1NK8 A;  4NX9 A;  4IQX A;  1UVN A;  2QT7 A;  5EGY A;  3CC4 S;  1PYT A;  2C2D A;  1SXL A;  3C6U B;  1H98 A;  5CXT A;  2AGO A;  3AQP A;  5IZH A;  1RXO B;  3PW4 A;  1YLX A;  3P4U B;  2CPF A;  3LAK A;  2F3J A;  3L95 X;  2F8M A;  1WDT A;  3UI3 A;  2WON A;  2RQ4 A;  2MZ1 A;  3BSC A;  2C1E B;  2KN4 A;  3M2V A;  1WF0 A;  5F9N A;  5LJ3 Y;  2IBO A;  1S77 D;  2HGM A;  1FE4 A;  1IBC B;  4CIO A;  4QR0 A;  4PYD A;  1XER A;  3ISN D;  2U2F A;  1KQS R;  4Y2K A;  2I2Y A;  4QW9 A;  4G1I A;  4TU9 A;  1SV5 B;  2M70 A;  1O51 A;  1S6U A;  1HI0 P;  3J80 U;  1LFW A;  3BSA A;  4EMD A;  1BUX A;  1HI8 A;  2L9W A;  3QAT A;  2E5I A;  3SCI E;  2QGF B;  3DLL Q;  1IR1 A;  4IH6 A;  4ZPA A;  4LUB A;  2NPF A;  2KHC A;  1RT5 B;  3JQK A;  3PIO Q;  4A8M P;  2GVD B;  4X84 A;  4D3G A;  2MZR A;  3TAM B;  2Z30 B;  2BQU A;  5IM0 A;  3I55 S;  4AL7 A;  3NL0 A;  3KG4 A;  4Y0F A;  2JOQ A;  3AOA A;  3NS5 A;  1E6Y B;  2X51 A;  1P8G A;  3HHE A;  4C3M A;  1V9O A;  3M8Q B;  4I6Y A;  4EO8 A;  4Q43 A;  2ZHB A;  2YWG A;  4DPY A;  1D9D A;  4EU0 A;  2PO4 A;  1NK6 A;  2DR8 A;  2KFN A;  3KG1 A;  1Q7Y T;  2WSC C;  3NBP B;  2KXH A;  3CDE A;  3FEX B;  3BQ0 A;  4I56 A;  4DCJ B;  3BDP A;  4R0E A;  4ZK7 M;  3Q2S C;  3H5Y A;  1RAJ A;  2DIU A;  2IDL A;  1RWW B;  2P9E A;  1C1C B;  4WKR A;  4IDK B;  3H98 A;  1HBO B;  4ECZ A;  3V5R A;  1UA0 A;  1FI4 A;  4BC9 A;  4J9V A;  1HNI A;  2XCA A;  4M1K A;  3BYP A;  1I3O B;  2D3U A;  2X1A A;  3UPF A;  2B4U A;  3KUE A;  5IQQ A;  1NPP A;  1V6H A;  1Q8K A;  1IN0 A;  4ZVO B;  5L1K A;  1L3U A;  2DEJ A;  4J9Q A;  1Q8B A;  3EGN A;  2JVO A;  1N33 J;  2HBQ B;  2PA8 D;  1UEK A;  1E6V B;  1T3N A;  3CO0 P;  4I7F B;  1CS4 A;  1BE4 A;  4DSL A;  1N33 F;  4P72 A;  1S1U A;  2NXJ A;  3K58 A;  4GVB B;  1REG X;  4FPI A;  4NML A;  1YQH A;  5GAG U;  2KZZ A;  1U6Z A;  1VHI A;  2G2O A;  2R7O A;  3JQM A;  2KRR A;  2UVU A;  2QJ3 A;  3PHT A;  1OO0 B;  1HQE A;  1NDL A;  1SIZ A;  1NUE A;  4MYT A;  2R7U A;  2HLT A;  5DGB A;  5KT4 A;  1SI9 A;  3HPO A;  5IV4 A;  3QWU A;  4WE1 A;  4IH5 A;  1Q5V A;  4NLT A;  4ANC A;  3OHA A;  5B0D A;  3C8Y A;  1V3S A;  5KT6 A;  3RTV A;  2ZWO A;  3KYL A;  4URS A;  2BKO A;  4DL0 C;  1VQO S;  4OZ0 A;  2E1C A;  4ED1 A;  3MCO A;  3LPY A;  3G71 S;  1R3N A;  2FGC A;  2CQ2 A;  4DFP A;  3K59 A;  3M30 A;  2NLW A;  3PM9 A;  1XIQ A;  5BYS A;  2E7W A;  1C0U B;  3CIM A;  2B0G A;  1QTN B;  4K0K J;  4ECQ A;  1HYS A;  3MMA B;  1QUP A;  1JLB B;  2HFS A;  4K0K F;  3G82 A;  2VG7 B;  7AT1 B;  4F0K A;  2QO3 A;  3G6E S;  3I32 A;  4K4Y A;  4C3L A;  4A8Q A;  3M9N B;  1IKX B;  2DGQ A;  5D0H A;  4FP9 A;  4PQU B;  2HW3 A;  4CNZ A;  3Q86 A;  4QR2 A;  5DQG A;  3PFE A;  1ZAX A;  2RQK A;  1Q7L B;  4RUB A;  3UR0 A;  2E5G A;  2YWF A;  1Y5I B;  1RQ0 A;  3CED A;  5AT1 B;  4NMX A;  3W9J A;  4C9D A;  3I5B A;  4OJ1 A;  3BYR A;  2RKI A;  3E51 A;  3UNY A;  1V3Z A;  1RT7 A;  3IR7 B;  2HFU A;  4ECW A;  2I1R A;  4GC6 A;  2RS8 A;  2QA4 G;  1B0T A;  2IPO B;  2RQM A;  3ILI A;  2GJ2 A;  4E0D A;  3DXS X;  2FVP A;  3TJ8 A;  1WOP A;  5KFK A;  4DR4 J;  3GFX A;  2CPD A;  2YNG B;  1TKT B;  3JSM B;  5BR8 F;  1S79 A;  1S59 A;  4DR4 F;  3HHD A;  1FF2 A;  4KGM A;  4IQM A;  4PPD A;  3PYG A;  4DQQ A;  3OPK A;  1TL1 A;  4RW6 B;  5MAO A;  4YR3 A;  4CO1 A;  2ZJP Q;  1T03 A;  2BQR A;  4ID5 B;  4DMZ A;  1MWY A;  3PY8 A;  2MPU A;  4DQI A;  5HLF B;  1RGV A;  3AHP A;  1AUS L;  3EGV A;  1JJ4 A;  3QAU A;  3ONQ A;  2W2N P;  3P5T L;  2W2Q P;  3KK1 A;  2EVZ A;  3C19 A;  4ILM A;  3ZXW A;  4AQY J;  3AB4 B;  3DOM B;  3FRY A;  4USM A;  2HFV A;  2B6A B;  4B3S J;  1MLA A;  1S6O A;  1IKW A;  3RZA A;  2XG8 A;  4B3S F;  3DLH A;  1XMB A;  3KOA A;  2BKN A;  1HBN A;  2DNN A;  1RTH A;  4O0N A;  3HHL C;  2DPJ A;  3HK2 A;  1F9E B;  4DN0 A;  1TZ0 A;  2M5Y A;  1UJ4 A;  2XB2 D;  3ILO A;  1KP6 A;  4H4O B;  2NPI A;  2ZEJ A;  4R5P B;  1FER A;  1TVR A;  1UPP A;  3POT A;  3PKY A;  5DZ7 A;  2H48 B;  3SDE A;  2IDE A;  3MR5 A;  3QZ8 A;  4LRA A;  1IJF B;  4QIW D;  2DTJ A;  1KKH A;  1HWU A;  3BQ2 A;  2DBB A;  2ACM A;  1MU2 A;  2OEK A;  3BN7 A;  3W63 A;  2LEB A;  5FLX U;  5IXU A;  2DY1 A;  4OX7 A;  2XCP A;  4KGK A;  3A3N B;  1NH8 A;  2JLE A;  5A0Y B;  1RAE B;  4TN2 A;  2IRY A;  1NM2 A;  4LVN P;  2ZH8 A;  3LP2 A;  3EWG A;  3DRR B;  2DCU B;  5CHC B;  1UZH A;  1OQ3 A;  2C2Z B;  1QVF R;  5KAK A;  2POK A;  2QA4 S;  2UP1 A;  2N4D A;  4HHU A;  1Y5L B;  3W7B A;  2J6T A;  2ZBQ A;  2ZC4 A;  2DR5 A;  4G6V B;  1C4C A;  1IQT A;  3SYZ A;  5AXM A;  4B9T A;  4EUV A;  1SPB P;  4CLY A;  4J9O A;  2IMW P;  2FLP A;  1R8H A;  3UCZ P;  4CM2 A;  2DIS A;  1RT6 A;  3TEH B;  3D66 A;  4F7V A;  3M1V A;  1WC1 A;  3U02 A;  4K4W A;  4MIB A;  1D8Y A;  5M2R A;  4NLD A;  1TQL A;  3M2R B;  3HX9 A;  4NPO A;  5GAD U;  2QLX A;  5JUM A;  1WG4 A;  2QMX A;  3G87 A;  1G7C B;  4LJM A;  2GC8 A;  4XK8 C;  4UY8 T;  3FCW A;  4LFC J;  3JYT B;  2UU9 J;  4OL8 A;  1PO6 A;  3NWG A;  4LFC F;  3W5Y A;  4NLR A;  3SI8 A;  2UU9 F;  2H3E B;  3I0S A;  4NLU A;  4ZPB A;  2W7O A;  3DDI A;  3MUT P;  2QMU B;  2XSJ B;  5L46 A;  4OZ2 A;  5HMY A;  4CLT A;  3DXB A;  4OLO A;  1ZPW X;  1VQS A;  2GAH C;  2R4F A;  3VVT A;  2WBR A;  4BWM A;  4C6A A;  4ZVS B;  2F63 A;  4OYW A;  4M5N A;  3GYX B;  2UV8 G;  3PXG a;  2ASY A;  4ENO A;  3G6V A;  3BPS P;  3P45 B;  4F3M A;  4PQA A;  5JMN A;  4OJG A;  1H2T Z;  1R6Y A;  2HZC A;  2GAG C;  1F6T A;  4F67 A;  2XTJ P;  1CQN A;  2QSF A;  2MHE A;  3MM5 A;  2C2E A;  3IMQ J;  1XNQ J;  1KOO A;  4AL6 A;  4TY8 A;  1FK9 A;  2A2C A;  3MCS A;  1YGY A;  1Y10 A;  4MKA A;  3TA0 A;  1OYD A;  3MAA A;  4TKT A;  2JVR A;  3R5D A;  4HHJ A;  1LWF B;  3FK4 A;  3TAR A;  2GQC A;  2EEY A;  3OD2 A;  3T19 A;  1SKU B;  1R31 A;  4QZV B;  3NGD A;  2HNY A;  3TNV A;  2JHE A;  1EAY C;  4QBU A;  4DV0 J;  5J2Q B;  2UUB F;  3VCD A;  4DR7 F;  3I9V 9;  4DV0 F;  2HHV A;  3IA0 A;  4PPZ A;  2RHS B;  2YPZ A;  3LW5 C;  1XC9 A;  3IS9 A;  2HZV A;  4ELT A;  5EN1 A;  4LFA J;  2Z2L A;  5BYQ A;  3TQE A;  1CJT B;  3MEC B;  4WK1 A;  1TMM A;  4LFA F;  1VS3 A;  2E1R A;  4OYX A;  2XUL A;  2BRK A;  3FGV A;  2H5E A;  4WWS A;  2HWI A;  2W8K A;  4KFB A;  2QL5 B;  2BDP A;  1WC5 A;  3DOK B;  4CYU A;  4A8K A;  1H7X A;  3GTY X;  4KGV B;  4JI0 J;  2ADB A;  5A8R B;  4FF2 A;  2RRB A;  4JI0 F;  1MRO A;  2JEI A;  1JKH B;  1FEH A;  2ZH5 A;  1RAG B;  4KKO A;  1BQM B;  4MK8 A;  2IAJ A;  2OPS B;  1NKB A;  4PXC A;  3IM9 A;  4DV6 J;  4YDD B;  2JRS A;  3IGV A;  3OXL A;  1NZA A;  3KLG A;  1V3R A;  4NLQ A;  4ZVF A;  2Q6C A;  5FLX Y;  4DV6 F;  2IJN A;  3M7V A;  4QIV A;  4ES3 A;  4J9R A;  1RT1 A;  1XMO J;  2GGP B;  2DVI A;  4ZIT A;  1T3O A;  3N28 A;  1HPZ A;  2VH7 A;  4CLS A;  5GAH I;  1XMO F;  4C0O C;  2NSC A;  2H4W B;  3F56 A;  4P9S A;  2V2Q A;  3OVS A;  1YTY A;  2HHX A;  1ZM2 A;  2NZ4 A;  2HRY A;  3QLH B;  3G4S S;  1K1S A;  3TVZ A;  3GIJ A;  1U1R A;  4NXM F;  2ZZN A;  1L3S A;  2J0X A;  3QGI A;  3J7A 1;  3C6U A;  3AD7 C;  2R2T A;  4X4R A;  4Q8F A;  2HWT A;  4LVO P;  3ITH B;  1X9S A;  2JLF A;  4ANE A;  2CQ4 A;  2PII A;  1SJ4 P;  3QJP A;  2VDH A;  1YSJ A;  5DG8 A;  3PO4 A;  2BV3 A;  1N5Q A;  2ZH1 A;  1WJ9 A;  2EC0 A;  1LW0 B;  2RAQ A;  4YEA A;  5DM7 Q;  2OUG A;  5D3G B;  3AJD A;  3GJQ B;  2PGC A;  4C0B A;  2KFZ A;  2ZNZ A;  4OI0 A;  4C2M A;  2JWN A;  3FUY A;  4ZVP B;  5HP1 B;  3S8S A;  2J8S A;  4LRF A;  1UKU A;  2W2P P;  1KDN A;  2UUT A;  5K8M A;  1U48 A;  1SV5 A;  3MMB B;  4F26 A;  1UJ6 A;  3T6B A;  4N77 A;  1QY7 A;  3F41 A;  1JLG B;  5KG5 A;  4PG6 A;  4X4T A;  3SFG A;  3BBB A;  3OL7 A;  2E1P A;  1U45 A;  1H6K X;  1AUD A;  1RT5 A;  1XTZ A;  1RAA B;  3WZ0 A;  2DR6 A;  2GVD A;  3QRR A;  3I0R B;  3QNW B;  4N5S A;  2R7W A;  4XAK A;  1FNX H;  1E6Y A;  2J6U A;  1IR0 A;  4AFF A;  1FKO B;  1FVS A;  3HT3 A;  3R7B B;  2QYG A;  4GKK J;  3G8S A;  5KT5 A;  3NBP A;  3DRP B;  2HHW A;  2MYF A;  2IVF B;  1H74 A;  4GKK F;  4OYA A;  1ZM4 A;  1YZ7 A;  5D77 A;  1VIS A;  3G6Y A;  4B3O B;  1S97 A;  1N5Y B;  1XJW B;  2EFP A;  3CJQ A;  4PWU A;  4QWC A;  1C1C A;  4K2X A;  5D4L A;  1IWG A;  1L3V A;  1UFW A;  4PEO A;  4JI5 J;  1HBO A;  1HA1 A;  1TKD A;  1RWX B;  1TAQ A;  3TVY A;  1WHW A;  3M6U A;  4YN3 B;  2O01 C;  5D78 A;  2Y0S D;  3Q23 A;  4JI5 F;  2I0X A;  3ZTP A;  2YVS A;  2AEF A;  3DRY A;  4OJH A;  1UP1 A;  1KS2 A;  3CJ5 A;  3AOD A;  1UEV A;  3OSP A;  3EX7 B;  3RUB L;  2J9D E;  2B51 A;  5ETK A;  1IKV B;  5GME A; 
#chains in the Genus database with same CATH homology
 2CJX B;  3GJR B;  1RHK B;  2QLJ B;  1RHM B;  3QNW B;  1IBC B;  3EDQ B;  2H65 B;  1ICE B;  3R6L B;  2Y0B B;  1PAU B;  3RJM B;  2Y1L B;  2QL7 B;  5K20 B;  3D6F B;  2XZD B;  1QDU B;  2QLB B;  2H5J B;  2C2M B;  3KJN B;  2CDR B;  2CJY B;  1RWP B;  3R7B B;  4ZVU B;  2C2O B;  2H51 B;  3KJQ B;  2QLF B;  3EDR B;  3SIP B;  1RHU B;  2HBR B;  1I3O B;  1RWK B;  2QL9 B;  2CNL B;  1SC1 B;  2H5I B;  2HBZ B;  2P2C B;  3R7N B;  3GJQ B;  2C2Z B;  3D6M B;  3GJT B;  1BMQ B;  3D6H B;  1RHR B;  5IC6 B;  4ZVO B;  3R7S B;  1SC4 B;  1F9E B;  2H54 B;  1RWO B;  2CNO B;  1QTN B;  2XZT B;  4ZVP B;  1NME B;  2C2K B;  2HBQ B;  3P4U B;  1RWN B;  1RWV B;  4ZVS B;  1GFW B;  5IC4 B;  3IBC B;  1PYO B;  2FQQ B;  4ZVR B;  1RWX B;  2H4W B;  3GJS B;  1SC3 B;  2CNN B;  2XYH B;  2XYG B;  4JB8 B;  2XYP B;  4ZVT B;  3R6G B;  1RHJ B;  3P45 B;  2C1E B;  4DCJ B;  1I51 B;  2CNK B;  4ZVQ B;  2DKO B;  4LSZ B;  2HBY B;  3NS7 B;  2H4Y B;  1RHQ B;  3KJF B;  2H48 B;  4DCO B;  3R5J B;  1RE1 B;  2QL5 B;  4DCP B;  1RWM B;  3IBF B;  1RWW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...