2HBVA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 124
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbvA00
1A4LA 3E0FA 3LY0A 4CQCA 1QXLA 1O12A 1FKXA 3S4TA 2Q01A 1V4YA 1XRFA 3MDWA 4C6IA 3GTHA 4J5NA 3IV8A 2QS8A 3GUWA 2FFIA 2VM8A 4BJHA 1FWCC 4I6VA 2O4QA 3IACA 2VR2A 3F2CA 4WHBA 1M65A 2YB4A 1EJUC 3PANA 3F2DA 4C6DA 1EJSC 3K4WA 1GKPA 2GSEA 4XD3A 1NDWA 3DC8A 4IGMA 5HMDA 4LAMA 4DI8A 2I5GA 4LEFA 2R1KA 2FVMA 4LH8A 4R88A 2QPXA 4KIRA 2GOKA 4IQJA 1PO9A 3NEHA 3E0LA 4WVXA 3URNA 4KERA 1P6BA 3OVGA 4EPKA 3IJ6A 4C6MA 3OOQA 4H9ZA 4IFRA 4KF1A 1ONWA 3JZEA 1BF6A 2R1NA 4KQNA 1WXZA 4HA0A 2ICSA 3OJGA 1DPMA 1XGEA 1IE7C 1KRMA 3OQEA 4IFKB 2VUNA 4QS5A 1GKRA 3K2GA 1EJTC 4RDYA 3GU9A 4C6KA 4H9TA 2R1MA 4DO7A 2P53A 4IFKA 3CS2A 2Z29A 4LAKA 2ANUA 2IMRA 4XAZA 1YMYA 2R1PA 3UPMA 1RA0A 2E25A 3EWCA 3FDKA 3T81A 3TN3A 3SFWA 2OODA 2WJEA 1FWBC 4C5ZA 4EPEC 4PBEA 1J79A 3IPWA 4PCNA 3C86A 2WJDA 2O4MA 4CEUC 1POKA 3S2LA 4G2DA 2OOFA 1EJXC 3RYSA 1RK5A 2WM1A 3GRIA 4XAFA 2PGRA 3F2BA 4RDWA 4QTGA 2BB0A 4IF2A 2W9MA 4C6FA 2FTYA 1V77A 3O7UA 4HK5A 1ADDA 4INFA 3RCMA 4CNTA 4V1XA 3S2NA 3AU2A 1NDZA 1UIPA 1EJRC 1ITUA 3HTWA 2EG8A 4H01A 5FSEC 3V7PA 3MTWA 4QRNA 4RE0A 4G7EB 3A3XA 3QY7A 2Z24A 1PTAA 4GY1A 4C6OA 4B3ZA 2DVTA 1FKWA 2FTWA 4XD4A 3D6NA 1YNYA 4H9MA 4QROA 3A3WA 4G7EA 3OODA 4CQBA 1A4MA 5LXXA 3E2VA 1PB0A 3MPGA 5G4HC 3KM8A 3B0YA 2Z27A 3UR5A 4XD6A 3UF9A 3QY8A 3S2JA 1R9ZA 4RZBA 4L9XA 3NURA 1FWFC 4NP7A 5CH9A 4H9YA 4TQTA 4B90A 1E9YB 1XRTA 2Q09A 4UBPC 4C6EA 2Z2AA 1YIXA 2A3LA 3GIPA 2HBVA 1FWIC 3IARA 4F0RA 2G3FA 2Z28A 3AUOA 4LAOA 4KETA 4RDZA 4GY7A 3AU6A 2VHLA 2OGJA 1ITQA 1V7AA 2QVNA 4J2MA 1NDYA 5A6TC 4IH3A 3MKVA 1FWAC 2F6KA 2D2GA 4PCPA 4M51A 2BGNE 4DI9A 2UBPC 3GG7A 2D2JA 3GTIA 2GWGA 2FVKA 1EZ2A 1J6PA 4XAYA 1J6OA 3UR2A 4OFCA 2P50A 4KEUA 4R7WA 4J35A 3HPAA 4CNSA 2Z00A 3QGKC 4HK7A 5AKQA 1R9YA 4EPDC 3TN5A 2OQLA 4R85A 3TNBA 1KCXA 3B0XA 3LNPA 3PBMA 1FWJC 4D8LA 2Z25A 5FSDC 3MDUA 2PUZA 2I9UA 3URAA 2D2HA 1O5RA 3TN4A 2R1LA 1V51A 3CAKA 1P1MA 4C5YA 2AQOA 3RN6A 1XWYA 4BKNA 4CEXC 2Z2BA 1FWEC 1JGMA 3URQA 1KRBC 2CZVA 1YBQB 3ORWA 1POJA 1P6CA 3G77A 5HMFA 4XAGA 3QY6A 4C6QA 2DVXA 4GYFA 1KRAC 2HBXA 3B40A 3WYZA 4NG3A 1K1DA 4ZSTA 3O0FA 4BY3A 1ONXA 5HMEA 4F0SA 1YBQA 1E9ZB 3GTFA 2KAUC 1I0DA 2E1WA 4HK6A 2YB1A 3DUGA 4I6KA 3EGJA 2EG6A 1J5SA 4IG2B 4IGNA 4LANA 1NDVA 3URBA 1RAKA 1A5OC 2HQAA 4Z42C 3ID7A 5E5CA 1I0BA 4YIWA 3LGDA 1GKQA 4IG2A 4XD5A 2EG7A 3FEQA 4CQDA 4KEZA 4GK8A 1A5LC 3FDGA 4V1YA 1FWGC 4LALA 1K70A 2OB3A 4GX9A 4UB9A 3WZ0E 2PAJA 4LCRA 1VFLA 1UBPC 2XIOA 4LCQA 1UMLA 1A5MC 3NQBA 1QW7A 4LCSA 3MVTA 1EJVC 4C6NA 3DCPA 4MUPA 2UZ9A 3GIQA 2Z4GA 4ERIA 1EJWC 3ISIX 3E38A 2ADAA 4E3TA 4B91A 3IRSA 2YZ5A 3BE7A 3A4JA 3SO7A 3ITCA 1W1IE 1S3TC 4JOMA 3F4DA 1PSCA 2AMXA 4AC7C 4KESA 3LU2A 3N2CA 1RJRA 3S2MA 1FWDC 3RHGA 4GOAA 1RJPA 4H9VA 4C65A 2WJFA 4EPBC 2PGFA 2YXOA 3MVIA 4QS6A 2RAGA 4ZSUA 1R9XA 2ZC1A 3QGAC 3ICJA 3K5XA 4DNMA 4DZIA 2Y1HA 2Z26A 4GXWA 4QSFA 3WMLA 4L6DA 4KEVA 1K6WA 4NI8A 4CNUA 1YRRA 3EWDA 4H9XA 1EF2A 4C6PA 4LFYA 1RA5A 4DLMA 4IFOA 4DLFA 4F0LA 4H9UA 4ICMA 3LSCA 4C60A 4GY0A 3OU8A 4PBFA 1M68A 1EYWA 2Z7GA 2QT3A 3LA4A 3PAOA 3GU1A 2VC5A 3UBPC 3E74A 3LS9A 4RDVA 1WXYA 3CJPA 4AQLA 2HNHA 1NFGA 4DZHA 4GBDA 2GZXA 1A5KC 1FWHC 3PNZA 4ERAA 2HPMA 4PE8A 2DVUA 1HZYA 4C6CA 2PLMA 1M7JA 4HJWA 3GU2A 2HPIA 3TN6A 4WGXA 3F4CA 1ZZMA 4B92A 2VC7A 3E3HA 2AQVA 4ERGA 2GWNA 4P5UA 3R0DA 4GX8A 4C6BA 4DYKA 4H00A 3LGGA 3MSRA 1UIOA 3PNUA 4C6JA 3T1GA 1KRCC 3GTXA 1V79A 3MJMA 1RJQA 4C6LA 4EP8C 4GZ7A 3IGHX 4DIAA 3T8LA 1RK6A 3LSBA 1A5NC 3HM7A 4GC3A
chains in the Genus database with same CATH superfamily
1IGSA 2WQPA 4PFHA 4LGXA 1AJ2A 4F66A 1QNRA 2VJXA 2E6YA 3IJ7A 3NQMA 1TYGA 2BGSA 4HHMA 1EBHA 2CEQA 3CNYA 4DRSA 4YYCA 4FPSA 4I6VA 2W4XA 5CC5A 3F2CA 5I3FA 4F0HA 4QQUA 1R2TA 3U8GA 1EJUC 4OBTA 4DJFD 3LNMA 4HU0A 3QW3A 5EKYA 3S42A 3VPLA 3HFYA 4AWEA 5BROA 5K3VA 1Z32X 1OG0A 3ZR4A 3IIOA 3VD9A 4FF7A 4NVTA 4R9XA 3CT7A 4ZO6A 2JKPA 2W63A 1V6VA 4E5TA 4JQ3A 2WK2A 4Z2HA 4TO8A 1E70M 2GVEA 4D6IA 3BGJA 4AY8A 2WQDA 1Z69A 1LOSA 4BWLA 3A24A 4S3EA 2W61A 1GVOA 3Q37A 3I3DA 8A3HA 3HG3A 1IE7C 3WEZA 1RSCA 3CH0A 3CLMA 8RUCA 3H21A 4K37A 1X6NA 3ATZA 3ABQA 4IM4A 1WCGA 2P53A 2V5KA 1KA9F 3MUY1 1T7LA 2PS2A 2QDDA 4XAZA 2WSQA 4KCVA 3LN3A 3UPMA 3DFTA 3CV1A 4XO7A 3RDKA 3W4RA 3PP7A 3W37A 3SFWA 1WDPA 3N4EA 2YDSA 4HYWA 4IP7A 4I90A 3BTNA 3RR1A 3WNOA 4CEUC 2GQAA 1JUEA 2PTZA 4EX4A 4GYKA 1KQZA 4LXFA 5C7HA 2WM1A 5D09A 2P0IA 3MMDA 2PGRA 1KM1A 3GSMA 1SGJA 2C14A 4Q6XA 2VEKA 3OW1A 4IL0A 2FHBA 3AMGA 2VO5A 5IOBA 2I57A 3AXHA 4HBKA 4FLSA 3CTTA 4MWAD 4GVFA 3HTWA 2A7NA 1KBKA 1CGXA 4QLJA 1U5JA 4GY1A 5D05A 2CLPA 4XD4A 2ZUUA 5BWAA 4QROA 1A4MA 2PTXA 1F6KA 5LXXA 3KM8A 3LI0A 3UF9A 4O50A 5FJTA 3S2JA 4HJFA 3KOWA 4KCWA 2NUYA 4GCAA 4H9YA 4TQTA 4FHAA 4IOTA 1ISZA 3GZ3A 3IGXA 1UD6A 1L6WA 4KIEA 3QPEA 3GHRA 4XSLA 3VNJA 5L6UA 1OFRA 3L4VA 1E0TA 4MWAE 1GYNA 3W29A 3PTQA 2RH9A 1XLFA 2NQJA 1ME9A 1TELA 4I8YA 2F8QA 1UKOA 4R7WA 3HQ1A 3EX6A 1XV8A 2FJKA 4H41A 5HWJA 5LIKX 1L6SA 3CHDA 4JYEA 2BASA 2CHOA 5CC7A 1ML1A 3N2MA 2V2CA 3EDFA 4D8LA 3DH7A 3OTRA 1HO1A 4FB7A 3CWHA 3VOIA 2WWCA 5K9DA 5RUBA 1AVAA 4M19A 2AQOA 4NXSA 1Q6DA 3E0IA 4CEXC 1Q6CA 2VZSA 3CMJA 2WNNA 4U2ZA 5U4NA 3RM4A 3KTXA 3H2CA 4QG8A 4YVVA 1CDGA 1XJBA 2BX7A 4FA3A 3HGOA 2OMAA 2VOTA 1RPKA 2YL5A 3QC3A 1H09A 2J7BA 1H3GA 4NIRA 2NLIA 4D1IA 4FLQA 5AYYA 3ABOA 4K6AA 4HK6A 1S1PA 3OG2A 1JIBA 4BI7A 2OX4A 1A5OC 1WKEA 2XFFA 4S3AA 1J0KA 1CTNA 1I0BA 2PRHA 4OECA 3CO4A 2G96A 3QV7A 1QHZA 3IUDA 4OBSA 5BU9A 1A5UA 4WY0A 1G1YA 1PZ3A 2XTKA 4MGGA 5A8MA 2DSWA 3TCSA 4GUFA 1TX0A 3FKRA 4HNCA 4FEZA 2D69A 1KTBA 1TTQA 3PAJA 1PYMA 3DDMA 1EC7A 4LVDA 4Z1AA 1ZU8A 4S23A 2R24A 2PDMA 5FEXA 4XZWA 3S2CA 3J7HA 2VQUA 3RJYA 3LYEA 4GGHA 5CSSA 4MJMA 4WIWA 4UFIA 1XCXA 3S2MA 3NGFA 3I65A 4IJRA 1E9IA 2GL5A 2RAGA 3CO8A 5F4WA 3BZGA 3QF0A 3A13A 1VFTA 1ZPTA 1TMHA 2VFIA 2Y1HA 4GXWA 2I9EA 1VKFA 4O28A 3HGJA 3NYZA 1YRRA 3AHTA 1PIIA 1RA5A 4FXJA 4DLMA 4P8XA 4AX6A 3N25A 3R11A 5AYBA 3QC0A 5T26A 1MUMA 1C3FA 4DNHA 5JUVA 4GI6A 1CEOA 2QT3A 1RP8A 1SJCA 4W87A 5PTDA 3R0UA 1QK0A 2WZIA 2V69A 2FDMA 1DTUA 2DW7A 2D22A 3E6EA 1ZUAX 1E9LA 1WZKA 4O1BA 4V28A 2J6XA 3AMDA 2ABBA 3GO2A 1VRDA 3ZS4A 4RZ6A 1XDJA 2PTWA 1YPIA 3EB4A 1EHNA 1M7JA 3PB0A 3QHOA 1AFSA 4H04A 3AHXA 4QSHA 4LUYA 3HIJA 5AVNA 3R0DA 3II1A 2V9DA 2BBFA 3U4FA 3H70A 5CGMA 3PNUA 4TX6A 3T1GA 2L5HA 1RJQA 5HNRA 4XB3A 3IGHX 1A4LA 3W2JA 4JTIA 4EWJA 3QMSA 3SY5A 1WAUA 1W5MA 4ZMGA 2CZEA 2X1SA 2D0GA 2JKEA 3IV8A 1JR1A 4JS3A 2HJPA 3TJ4A 1Q4WA 2PGWA 1REQB 4IWWA 3T0CA 1DV7A 3NPWA 3C2YA 3PG8A 2GSEA 3LHWA 1NDWA 2JF6A 4AU0A 2QCEA 4E4PA 3YPIA 4N7QA 1EGVA 2VDHA 2Z1XA 3QOKA 3GDTA 4E3VA 3EKZA 4NX5A 4ECLA 3FA4A 4N42A 4F3HA 2ZUNA 4DJEA 5JH2A 2HZGA 1VGAA 3E0LA 2IW0A 4LYPA 5FOOA 3DI0A 1A50A 1KM2A 1EDGA 4B2DA 4AEEA 4BF5A 2QJGA 3UYIA 4H8VA 1GUVA 5BRPA 1JG9A 1ONWA 4HU3A 1WV2A 2ONEA 1BF6A 1V0NA 3DAQA 1M41A 2QCDB 3N6JA 2AAMA 3L4WA 5CPNA 4LBSA 2B81A 3CZLA 2WCAA 2BOFX 2O7QA 4KWWA 2ZTKA 4RDYA 3NWRA 4KT2A 3GXDA 1IR2A 4GG9A 4QLLA 1MEHA 4LY8A 4OZOA 1TUXA 3A4XA 4HPNA 1K02A 4XZNX 4N4QA 4K8GA 3I7RA 2OSWA 3T81A 5EL1A 3KX6A 3NJ3A 1TVPA 3ANUA 4PCNA 1V03A 1CZ1A 2OOFA 1M04A 1GZGA 5I03A 3S6DA 3LXCA 4OOUA 2QCHA 2JIWA 1XINA 1S38A 4CQ9A 1D9EA 1EWDA 4Q8UA 3UFYA 1B3WA 1HKJA 1NP0A 3VNYA 4O14A 4UTMA 3DERA 4OBRA 2PU0A 1PX4A 3QM3A 5I79A 3W81A 1XQLA 1QWKA 3PZUA 1DJIA 1F05A 2YL8A 3QY7A 4AHPA 1XYCA 4F0KA 6TAAA 5CJ5A 3VDAA 1KCZA 1NJJA 2Y7FA 2HROA 4Q32A 5REQB 5EU9A 5D2TA 2V30A 3P74A 4Y9NA 2NUWA 1Q2RA 3UJEA 1W8GA 4ZQCA 4D9PA 4CLMA 5AHNA 1OFBA 1XLJA 1J0ZA 1F6PA 5SWUA 2SFPA 1W5QA 3LLFA 3KP0A 4EK7A 3LHYA 1GVRA 3WLKX 4JTKA 3DU0A 1Y5VA 1IZCA 3NSMA 1GOMA 1P7TA 3KOFA 1FWRA 1V7AA 5M2FX 1NDYA 1VEMA 5HDRA 3GKAA 5CSYA 2VFEA 1BVWA 1HVQA 3LRLA 4D6EA 5TIMA 2OQLA 3WMBA 3ONCA 2CESA 4ZTXA 2Y7EA 3GR8A 1A5SA 3TSBA 1GOOA 2BOGX 1CI1A 4W86A 2VVSA 2V3FA 4UZUA 5BCAA 4JFSA 5FF0A 5CPLA 5D2VA 2I16A 3P0XA 1P1MA 3WY1A 3KWXA 5DLCA 1R3WA 4H7ZA 1A0CA 2Z2BA 3GH4A 2OPJA 2P88A 1IGWA 1ZBVA 1B2YA 3N19B 5E93A 4MFEA 3RX4A 2BVWA 5DRIA 3ZWTA 1J18A 5DBUA 1ONXA 3TA6A 4HB7A 3CEUA 3EGJA 3W1LA 3URBA 3RF9A 2NWSA 4JNMA 4P7NA 3T05A 1MFVA 1TQXA 1X7IA 1WKFA 3DN5A 1U5HA 4RKAA 1CGWA 4KEZA 3IV3A 2FZ8A 3TW7A 4HOWA 2J8FA 1HF6A 2MUCA 2IXVA 3IRDA 2XIOA 3WO8A 2QV4A 4LU0A 3CUZA 1QW7A 3SGUA 1WX0A 1DIDA 1V6UA 4ZO7A 3THDA 2NV1A 4PYSA 3AXXA 1YDYA 1X1ZA 1TWSA 4E3TA 1HJSA 4HHLA 2FIQA 3MU7A 1DHKA 4WQ6A 1VEOA 2BXZA 3FXGA 4AC7C 4XZ9A 1J12A 1XLEA 2E77A 1QI5A 1HUVA 4MWAB 2NT0A 3LOTA 4NASA 1QI2A 2ISWA 2CPUA 3MVIA 1BG9A 3AYRA 2XFYA 3MP5A 3PUOA 3VIJA 1GPWA 1DORA 2E9BA 4KRTA 2GGHA 3WBEA 2D3LA 3ICJA 4MB4A 3S1VA 3FJNA 3WLNA 4HNOA 2NQHA 3SM0A 4WD0A 3RG6A 3WQ4A 3K1GA 1XH1A 4HNVA 3ZR6A 1TMLA 1NP2A 1CT5A 3CUXA 3TW6A 4ML9A 3S0CA 4PA8A 3W1RA 2VC5A 1IIGA 2C7FA 3HPXA 4RDVA 1KR0A 1W91A 4UCGA 2VCCA 1F8IA 1UD4A 2OEMA 2C1GA 1E1FA 4H3DA 1A3XA 3SCWA 2GZXA 1BSIA 4PE8A 2EPNA 1MW3A 1J8VA 3DG6A 1P0NA 1EC8A 2CETA 5C8BB 5BXTA 2VVNA 1UWQA 1E51A 3VM7A 1DJYA 3C8FA 3MSRA 2G3NA 1EBGA 5GJPA 1HQTA 3BXWA 4AD3A 1RVKA 4WDTA 1A5BA 3O6CA 1Q5MA 3BOFA 3E0FA 3WEMA 1MXDA 4CQCA 4DZ5A 1PDZA 3WQCA 3P62A 4AISA 3MDWA 3W1PA 3REQB 4J5NA 2QS8A 1Y0EA 5F2IA 4AZCA 3INPA 5H91A 5CPSA 4HNTA 2ZUTA 4WHBA 1EDTA 2CZ5A 1M65A 4WJ8A 3W1QA 4Z2IA 4WDWA 3V1HA 3V5CA 3ARZA 3QTPA 5DMNA 2Z1WA 5F7UA 3W02A 4CU8A 1UP3A 2I5GA 3FK4A 4GIAA 3QN3A 5EGRA 4KWSA 3IUHA 5CPMA 1S5WA 1EFZA 3SECA 4GUIA 1KTCA 4S1FA 1OT1A 1UB3A 4R7JA 3FJLA 3AS0A 3BAJA 4Q8PA 3OVGA 3OBAA 5CQ1A 2OGYA 5HJYA 5HANA 4KF1A 3N2TA 3NDYA 4JIIX 6ALDA 1KWGA 3CMFA 4RJEA 4PUKA 4E2BA 3IAQA 1VFFA 3KL5A 4NL1A 1JNEA 3TSMA 3MCMA 4Q6JA 1R7OA 2J62A 4HVXA 4AHOA 4JICA 4CD6A 2YLAA 4CQAA 5DCDA 1P0KA 4ZOEA 1TPH1 3FXYA 1J10A 1YMYA 3NQ2A 2E25A 3EWCA 5K9XA 1UR2A 3AC0A 1QAPA 4C5ZA 3KBVA 2XVNA 3VOFA 3WQPA 1J9YA 1XUZA 4IIHA 1FCQA 1WAWA 2RJHA 3UR7A 3M43A 1XIFA 3RPDA 8CGTA 4HCDA 3PBYA 1M3UA 4TXEA 2QUTA 3I7QA 2YCLB 3TZFA 1PAMA 4TUFA 4Z2JA 2O92A 3LI1A 3RCMA 2VCBA 1HJQA 1YXDA 1J2WA 1QK2A 2OG9A 1QOQA 1C8QA 2J7GA 3QQ0A 1VFSA 1ZCOA 3SGZA 5KZMA 4UQBA 3KRZA 1GOIA 3MHFA 3CHEA 4RNFA 3EDJA 1P1XA 3LMYA 3W1UA 4G7EA 1JCLA 1P5BA 2PWVA 3MPGA 2Z27A 1K9EA 3A6OA 1DJZA 1E4IA 1LQ0A 1AD4A 1TV4A 3KVJA 4UBPC 1R3TA 3MI2A 3GR7A 2Z2AA 1NQKA 5G1TA 2DZSA 2C3ZA 1AW5A 3BW3A 2BS9A 2HBVA 3I3BA 3WLQA 2HCVA 4Y90A 3L4YA 3PBVA 3VDGA 3K8MA 1JL8A 1HN1A 4GY7A 2OGJA 5EMMA 5KZEA 2Y63A 4PCPA 3DZ1A 1UR9A 3CGTA 3GDKA 4FOJA 1J6PA 4ATWA 2E9MA 4OFCA 3STCA 5T91A 3N73A 4N9DA 3F7JA 4OU1A 3IJ9A 3PJTA 2GVGA 1MRQA 3A23A 3LNPA 3TOYA 4M6PA 1X98A 2NX9A 3BARA 2FZDA 3QKEA 1O5RA 1DHPA 4QAWA 3DECA 4C5YA 2V68A 2X1IA 4FLOA 1J2BA 1EDQA 2FGLA 5CEWA 1V3KA 5JBEA 1XYFA 2CZVA 4K39A 1YBQB 3BPWA 4GYFA 3GB6A 5CCZA 1E6ZA 4IUOA 4GJJA 5BRBA 2VRJA 4DO5A 3N14A 3AXIA 2NV9A 3C2FA 3WQVA 1ISWA 1GOXA 4ZQNA 1E6NA 3G3MA 4AZ5A 1NDVA 1MEIA 2VT0A 4LUSB 3BV7A 2FZNA 3N4FA 3FN9A 4QNWA 3ZIZA 3D47A 1A5LC 3UETA 1V6TA 3VC5A 3MI6A 3WZ0E 3SCNA 4DAFA 2E68A 3LLDA 3UG8A 2C6QA 1A5MC 2CZFA 1RQHA 3NQBA 1W1PA 3I6EA 4UTJA 3O6AA 2TAAA 4PMDA 2ZXQA 1WPCA 2PPGA 1VCVA 1SO3A 4MB3A 4X22A 4OJYA 3BAXA 4XO6A 1DVJA 1F07A 1VS1A 1US2A 5LIXX 1HX0A 1TE1A 4ICNA 2H6RA 3PS7A 2VGIA 3ZLFA 1XS2A 2P0OA 2WSRA 3RLVA 3RHGA 1KKOA 3SR7A 5HWMA 4QS6A 2VTFA 2FB3A 3LCXA 2PD9A 3VD5A 3HB9A 1EHAA 1LCOA 4DZIA 4TIMA 2E5DA 1XXXA 4GUGA 3CL8A 3TIMA 3WJWA 5C0QA 3MB9A 3G0SA 1EF2A 3OVRA 4ZCWA 5GPRA 1Q65A 3WF0A 2XH0A 2D73A 1G4TA 2WSPA 4S3GA 3VXGA 1EX1A 3FJ4A 5C2GA 1EYWA 5HJXA 5E70A 3K4AA 2X0HA 2XN1A 4LF1A 3P5ZA 4L1XA 3LS9A 4FI4A 3GC2A 4IUGA 4HNUA 1JPHA 4TX9A 3Q45A 1T40A 4DZHA 1PKLA 4H4IA 2QF7A 1XICA 4KFOA 1JCNA 3PSVA 5H2ZA 5DXYA 1JQXA 2H8XA 3DBNA 1OT2A 3VIGA 3WK1A 1OABA 4AVOA 5A6JA 4LUTB 1S3HA 2BNJA 1JZ6A 2Z2UA 2CWXA 3VDCA 2E6FA 1LZOA 2ZADA 1O1ZA 2PSNA 4ZZ9A 1VFUA 2X41A 1XYMA 1IXOA 1B3YA 4RV8A 4JYFA 3ERPA 4N6FA 4GC3A 5DRCA 1XYAA 2OEKA 1C93A 1Q13A 1U5VA 4HP5A 5FEWA 2C91A 3KUMA 4M82A 4ZFMA 4B4HA 1AG1O 4X63A 2FPVA 2RGMA 2WVUA 4WXZA 1EJSC 1F61A 2QMKA 3SRHA 4NAFA 1Y65A 1OD0A 2X42A 3MSDA 3HQOA 4U2YA 2VELA 4KBXA 2C0HA 1ZAJA 3WLLA 3M44A 3VU2A 4JQ1A 4A22A 3GQYA 2F9RA 4B3LA 5C5YA 4U3CA 4GIRA 4O16A 1CXFA 4C6MA 4C1LA 2YCEA 4CCZA 4HA4A 3RFAA 2R1NA 1DIKA 2PODA 2V2HA 1DPMA 3PZQA 4PUEA 3GNPA 3JW7A 2HVMA 2X2YA 2ZRZA 1XD0A 3GU9A 3HQPA 4ZOAA 4AAJA 4UTFA 4J2PA 1L2QA 5AB3A 2OLAA 4GVGA 1MDRA 2ZUSA 2Z29A 3DFHA 3SBFA 3RRAA 1QI4A 2ANUA 4MZYA 2IMRA 1F7BA 1SFTA 5BMXA 2OKTA 2AL2B 4GINA 4GD0A 1GJPA 1FVPA 4DX3A 3APTA 1BTMA 5D37A 1AH4A 4MSSA 2X40A 4F79A 5D03A 4JEJA 2GGIA 3QYQA 1T41A 3VO0A 2J8TA 1K7EA 4JTDA 4YWIA 5FA5A 2FGBA 4NZ5A 2OYLA 1A3WA 3LEPA 3O7UA 4CVUA 1AW1A 2DSZA 1IXPA 2PF8A 2PB1A 5F4SA 3SIZA 3AU2A 3ARVA 3M0IA 2ZIDA 4RE4A 1R2SA 4HNLA 3O2LA 3PPFA 2YCIX 2XZ9A 1OVDA 4DM2A 4HMCA 3L4ZA 5BW6A 2V81A 1S39A 1WB0A 2DZTA 1B31A 2BVYA 2QUNA 4Y8FA 4CQBA 3W24A 4AD0A 3HURA 4EWND 2Q71A 2Z1KA 1SO5A 3QR1A 4L80A 5CH9A 4LUJA 1GVFA 2Q09A 3U2EA 4TVCA 4N9EA 4NF7A 4DXVA 3EPMA 2VWTA 3VGGA 1FDYA 5HWNA 1OD8A 3FKKA 1H7NA 4L1GA 3AUOA 4IQLA 1FCVA 5C6MA 1D7KA 3AU6A 4LJ3A 1XSKA 2J79A 3RILA 2J7FA 1XLDA 1H5YA 4CU6A 3MZ2A 3THAA 3MSYA 1ZTVA 2VENA 3LTYA 3NQCA 4GACA 2J47A 1Y5XA 1OJXA 1TR1A 2Z00A 4ZGYA 4J3ZA 3NZ1A 1PCWA 2CCRA 1MW2A 2A3EA 4LF2A 1H5VA 2I7GA 3AALA 4XKMA 3T6CA 1TX2A 4MB1A 1S2UA 2PFHA 3BLKA 3VE7A 1Y7VA 3W7NA 4NKCA 1PWMA 1QASA 1GOQA 3GVVA 4JGDA 4JTCA 4IIGA 2XH4A 3N17A 3C2VA 4LX4A 1KRBC 3R89A 1PEZA 5D8ZA 1CXKA 4WKHA 4JY9A 4Q8MA 2C8NA 3GAKA 4RPPA 4BY3A 3DKLA 1H41A 3M0LA 3S1WA 4A2SA 3NL3A 3BAWA 2GOUA 4DVOA 3EWXA 3VI2A 3MYOA 3U4AA 4L4PA 3JUGA 3VGDA 1ZHAA 3Q94A 4V1YA 1TJPA 2FZ9A 5LZLA 2PAJA 1BQCA 1D8WA 3H24A 3WH7A 4XX6A 2ZC8A 3UY7A 3L9CA 3DYPA 1H50A 2FMOA 4Q8OA 4W5ZA 4A35A 5CJNA 3K1DA 4O1CA 3EKLA 4YL2A 1KXQA 1Q63A 1JZ8A 1DWAM 1S2CA 3H2EA 2ADAA 4KRUA 3TQVA 2WLYA 4S3CA 2QVHA 4WJEA 4O57A 4DXKA 4F48A 3O63A 4IIDA 5EB8A 3SURA 1FUYA 1QDSA 2PGEA 3WH6A 3VC6A 2ZICA 3BLIA 3B9OA 1LRNA 4NZCA 4ZSUA 1HG3A 4LV9A 1Q6EA 3ZM8A 4LNCA 5DMLA 3ZZ1A 4IJCA 4P8UA 1O6IA 4RR4A 4KEVA 2DH3A 4AEFA 3KLLA 3L5LA 1JD9A 2GYIA 2PF0A 3WUFA 4D2JA 1EC9A 1UMYA 3ABXA 5H8MA 4Z0SA 2Z7GA 1VAHA 3GXFA 1K8YA 4DWSC 1KFLA 3VABA 1TPB1 1JGIA 1BWKA 1SZGA 2WNQA 3W07A 1JZ2A 1JCMP 2CLHA 1PWLA 3N1AA 5HQMA 3OHIA 1AUSL 3CHVA 3GFZA 3GU2A 3L0NA 4EAMA 4HZ7A 4FK9A 1RR2A 1X8FA 5BXPA 2C0AA 5BOOA 5H8PA 2C15A 1ADSA 1MW0A 2QIIA 1JUKA 3RXZA 3KRUA 3PWGA 1V79A 3RM9A 4W89A 1UUMA 1QNVA 3EMCA 4JIHA 4Q4MA 1G4EA 5B80A 4Z1BA 3AZSA 1AQHA 2W79A 3KDOA 4KMQA 3UJFA 3N2XA 4WOZA 3BMWA 2ABAA 4JTSA 4PRTA 5AY7A 5EBUA 3NVTA 3KE0A 3BV4A 2WO5A 1FWCC 3CIXA 2VRQA 2O4QA 1M1BA 3CHCA 1HNYA 1PTDA 2XSBA 4YVPA 4I5RA 4KWOA 3PANA 1K9DA 2YDQA 5EPDA 3SCUA 3VD7A 1GKPA 3ITVA 4XD3A 4AD4A 4ZR8A 3HA1A 3U7VA 1PYFA 1F8MA 4XZMX 4BQ3A 3TV8A 4BI5A 4A3HA 3CAVA 1V02A 1XPYA 2ZKMX 1UG6A 5CC6A 1A0DA 4PUMA 4DPQA 3B0VC 3LBMA 3URNA 1R3YA 4RNHA 3MP3A 3VMOA 3WDQA 4ZQRA 3CV7A 1NOUA 3PZGA 4RZ5A 2G97A 3T8QA 5CPOA 3Q65A 3LM3A 4DYJA 3OEXA 4MPKA 3DHUA 2PP3A 1E1EA 1PE1A 1XUUA 5C9WA 3IIVA 3FGCA 1ME7A 4H7CA 1OCJA 1VPYA 1EJTC 2R82A 4LS0A 4NYYA 3LG3A 3KDNA 1XDMA 3GW3A 4GMEA 1PHQA 4I9AA 2R1MA 4XVDA 4IFKA 3GDMA 4NT0A 1XPGA 3P7YA 2MNRA 1ZJBA 2GFTA 1HJWA 3CLWA 4K7YA 3FJ6A 3UXDA 1I2QA 2JQXA 4FS9A 1JYNA 3ITGA 1OYCA 2DIEA 4D71A 3P81A 4WCJA 2O9RA 5FF4A 1EJXC 4WXYA 3H26A 2DUXA 1UPPA 2R6OA 3GRIA 3F2BA 2FMNA 1SW0A 4C6FA 5IHRA 3JU2A 4DJDC 1V77A 3VIPA 1QNQA 4DUVA 1TV5A 3GXIA 3MWCA 1DWHM 3O07A 2WPBA 3RGTA 2I1OA 2R14A 3E1F1 4JY8A 5A8QA 1Z41A 3G5EA 3CV2A 4QRNA 1EYEA 7REQB 3ABZA 4XBSA 1J0IA 5FEZA 1UC5A 4HSOA 4MKSA 1DYSA 3SUWA 3TYBA 3BLFA 1PVNA 3S1GA 3MUZ1 3V1PA 2DGAA 1ISXA 1QBAA 3ZSTA 4DWSA 1EWEA 2FVLA 1ZBWA 4NP7A 1E9YB 3W7HA 4K68A 2ZUVA 1UOZA 1JRBA 1LWJA 2V8ZA 4ILSA 1UZ1A 3DESA 4LY4A 2ZVRA 2YXGA 3KRSA 1JPIA 3OGVA 2PWDA 4H2HA 4HSNA 4EXQA 1LUCA 3BQ6A 5LNSA 1A53A 1N8FA 4KCTA 2XIJA 4AVNA 3HPAA 5FL0A 2YGYA 2WMFA 3BG9A 3L0GA 1LP6A 4R85A 4UQDA 5HULA 3IJ8A 5HUPA 4CCDA 1L9WA 4OOZA 5AOUA 3U3HA 2CWNA 5A8PA 2FLIA 1KM3A 1E4MM 4UOQA 1V6YA 1UUOA 4NILA 4QG9A 1TPUA 2FPTA 3SCQA 2J4GA 1M03A 4QFUA 4HA3A 3P84A 5M17A 3S83A 2GUYA 4K2SA 2NQ5A 4CD5A 2PBOA 3WEOA 1OG6A 2DORA 3UWVA 1Z44A 1XGZA 1P6CA 1ZALA 2D2OA 2YW3A 3V3WA 3AWOA 3B97A 4D6CA 4NAEB 1NOFA 3R79A 2Y8KA 4TTUA 3S47A 2DZVA 5D2WA 4I6KA 3DUGA 2W66A 4LANA 3HQNA 3UZYA 1RAKA 4Z42C 4BS0A 5E5CA 3PPGA 2HK1A 3K4DA 4M1BA 3WK3A 4GK8A 3UNDA 3M47A 2R94A 5LNWA 4FSAA 1SFSA 3LCIA 1BWLA 1Q7QA 4LCQA 3KLKA 1YNPA 5ABHA 3C61A 4K8EA 3L0KA 1W9DM 3GC4A 2BFGA 4B91A 1FXPA 1S2TA 3CB8A 2YZ5A 3BE7A 4O4VA 3TLLA 4W9TA 1H1YA 3L67A 5CBIA 3MUIA 2IKJA 1XKJA 2UV8G 3QW4B 4E8GA 4QLKA 2AKZA 3H4XA 1D7FA 3M0ZA 1KW1A 3T9PA 3AIVA 2ACQA 4DJDA 2WPGA 4N9BA 4NI8A 3I3EA 2W91A 3MW7A 4D6DA 4J7RA 4M29A 4J9JA 4NZ4A 3VX1A 2D24A 4HPGA 5LIWX 1UBSA 1VJSA 4XKYA 2CXEA 1NOWA 4M3PA 5F1UA 3LA4A 4JKMA 1GHSA 3VIFA 1O5KA 1RQEA 3O15A 4I5XA 1T99A 4MHBA 2UY3A 2VOMA 3CJPA 2E28A 5CZSA 1W1TA 1GW1A 4PTXA 1GTHA 3BSHA 3XINA 3BH4A 3N2OA 1UUQA 1O60A 3O1NA 3NSXA 3NCOA 1BLIA 3W25A 5I0DA 3RLUA 2Q6ZA 5E9AA 3VCNA 1BG4A 2VYOA 3DBPA 5M03A 3LD5A 3MMUA 1DL3A 1RUSA 5E0FA 1WKYA 1K9FA 4GX8A 3LGGA 2G3JA 1KRCC 5I23A 1XBVA 3WD2A 2DIJA 3W70A 2FTPA 3IS4A 2C71A 3PF3A 4RE3A 5LHFA 1JZ3A 1V5XA 3NUKA 4J3SA 4ROPA 4AC1X 2CLLA 1R0MA 4IX0A 1TKKA 5CSUA 1AL7A 4E2OA 4IQDA 1V3IA 3OLEA 4O0KA 3SRFA 2ZRXA 2QCNA 4JX5A 3R4IA 1ZS2A 2VR4A 1KM5A 4L65A 3LQGA 3GNDA 1W9XA 3FCPA 1VFMA 4DI8A 2ZA2A 2GJXA 2R1KA 2X7WA 4GVIA 3VA8A 1UQZA 5A6SA 2J27A 3KHDA 3ARYA 1U22A 4QITA 3GH5A 4H7VA 1SR9A 3ARRA 4KFPA 2G37A 3QSRA 1AMKA 3OOQA 2H90A 4YHEA 4FX6M 1U83A 1WXZA 4WSJA 4AF0A 3CEPA 1FFRA 5CBBA 3OLDA 2BY3A 2GJRA 4DUWA 4FXSA 2QW5A 1R86A 1B0IA 2V5BA 2VUNA 2J7DA 4FNQA 4AX7A 4A21A 4O13A 4IZGA 4IIEA 4H9TA 1TVNA 1UC4A 4I3GA 3OA5A 4OUEA 1RBLA 2HMCA 3WF4A 2Z1VA 2WHMA 2QPSA 1DJHA 2IS7A 4AYGA 3TXVA 3EKGA 4GYJA 1J11A 1KCKA 2WJDA 2VR5A 5D2YA 4WX2A 2VCAA 1V3LA 7CGTA 1W54A 4IF2A 2HVNA 2UY5A 2W9MA 4WKAA 4WDUA 4N02A 2D0HA 4JX4A 3M7WA 1S5TA 1TPC1 4AD1A 4AMCA 2WMGA 4QG6A 2QXWA 2EG8A 5IXEA 4DYEA 1CX9A 2EQDA 3W6YA 1M53A 3CPGA 4X2PA 3W7MA 1OFAA 3C4UA 2C79A 4WRHA 4NJIA 1W17A 4H9MA 3B8SA 3NO3A 3A12A 4P7OA 1UZDA 3TYZA 1CGUA 3N3MA 5FF2A 1OSEA 3NURA 1FWFC 3VNIA 4B90A 4OV9A 4C6EA 2OWCA 3H54A 2NXGA 3G1SA 4WOQA 1FH7A 4UR8A 1V3MA 2VC9A 1YDOA 1ZB5A 3POCA 4HN8A 1WOBA 5F1VA 1IEWA 3VX0A 1AJZA 5I3KA 3WQ5A 2D2GA 2TYSA 2INEA 1J6OA 1DWJM 3W1AA 3TYDA 1I2OA 4CNSA 3UJ2A 4HK7A 4Q4OA 4MLJA 1CGYA 1PTGA 1YNQA 1D8CA 2BY2A 4L4MA 4L9ZA 1OYBA 3TAKA 3PBMA 3NQ6A 4NRSA 4D8AA 2DUAA 3CPUA 1PX8A 3URAA 3W83A 2ZCGA 1AZ1A 3BL3A 2PDHA 5HQLA 2YDAA 4S39A 4HPHA 4ZB2A 3S6TA 1J0HA 4I7WA 1JGMA 3L4TA 4Y7EA 4S38A 3SAZA 3G77A 5HMFA 4CVWA 3HPSA 4GI9A 3FVMA 4YTRA 3AS3A 3WYZA 1X6UA 1HJUA 3MBDA 1GCYA 2EPMX 5CLTA 3CAWA 2WZEA 3O0FA 2D1ZA 4JIRA 2A3HA 1Z42A 1JFHA 4DXXA 5HBFA 2EG6A 1US0A 4IG2B 1GZ1A 4YYFA 2RFGA 3BJFA 4F40A 1J96A 2CBUA 4OGZA 1RLDA 1H51A 3PPHA 5FIPA 1XC6A 4J4KA 4HMDA 2EG7A 4U5IA 3OBEA 3L2MA 3FW6A 1QPRA 2IQTA 1UR1A 4LALA 2FH8A 1IHIA 3AYTA 4YWSA 2B7OA 1UBPC 2P8CA 5D02A 2IKGA 5HQEA 4AYSA 4AMAA 4IL2A 2C1HA 5DELA 1Z3NA 1C8VA 3W73A 2YLLA 4PGLA 2G4JA 2PP1A 4DBWA 2PDWA 4UR9A 2JE8A 4BFAA 2TODA 3DYMA 5HMSA 1IYXA 2HNEA 3MCOA 1SZNA 2HRWA 1HO4A 1EL3A 1YDNA 3NL5A 1VENA 3SO7A 4BK9A 4X2RA 4BI6A 1DTNA 4D6FA 1QI0A 2W27A 4KEMA 1Z6KA 4PODA 3R43A 1S46A 3M4HA 2YXOA 1ALDA 3DFSA 3VDBA 4Q7IA 5KINA 2YJQA 1BXCA 5LKYA 5HK4A 3S8HA 1KD0A 5DMYA 4CNUA 3AJ7A 3AWNA 3F4VA 4LFYA 1OGBA 3N4AA 1NU5A 3WNLA 1S5NA 1R3RA 3NVDA 1K7FA 3UA4A 3KBSA 3DG7A 4PMJA 1UKTA 2REQB 4AZBA 4MF4A 3I4KA 2W5FA 2WC4A 2BDQA 1TRIA 3SCSA 2YDRA 3B0UX 1YXYA 1FWHC 1G9HA 3M64A 4GH1A 2J66A 3FIGA 3AZRA 2PI6A 1BF2A 5LHEA 3PJWA 3UG5A 4PTWA 3PWAA 1UWTA 2P10A 3RPMA 3NGJA 3T08A 2Y62A 3OLIA 1UWAA 1K03A 4HTBA 1GEQA 4E38A 3HZ3A 1UWIA 5I77A 4QP0A 1J0YA 1KM4A 3VINA 5DT7A 4PL2A 1GHRA 1SQ7A 2OKOA 3P61A 3TTSA 4I9TA 3AXKA 5D2XA 1UR4A 5I02A 4FIQA 1EIBA 1FKXA 2Q01A 5D38A 4HU8A 1CGVA 1XRFA 4G7FA 4JL1A 4IGSA 5EMKA 5CXPA 3ZT6A 2FFIA 3ALFA 1K8XA 2ZZ5A 4Y96A 3TCEA 3MP4A 3IACA 1YPFA 5AHMA 2DT3A 4ZQMA 3FV9A 4DF2A 2P1FA 1YXCA 4ICCX 4XUGA 4US5D 2H8ZA 3IJIA 4JTLA 5LSMA 2FPYA 2OZ3A 2BY0A 1K7XA 3ITOA 4GO8A 1BAGA 2YFOA 3GKFA 4QISA 4GO9A 3G6LA 2VFDA 4R3UA 1W5OA 1WXJA 2Y88A 3E5PA 1GONA 2X30A 1OCNA 3A4AA 2GDQA 4EAYA 2V2DA 1UD8A 4K1GA 3QLLA 3NPUA 3STGA 7TIMA 1F6YA 4KQNA 4MY8A 4JIPA 2VGBA 2YZRA 1IT0A 4GGBA 3PFRA 3TEVA 3RU8X 2XN2A 3IIZA 3BLEA 4CD8A 1CW2A 3L5MA 5CLWA 4NXKA 3KBMA 1KFKA 1QWGA 2QCDA 2XHYA 2OZ0A 3OZPA 4LYKA 2ISFA 3LHUA 2GK1A 4JEQA 4DO7A 1RLCL 1EP2A 2H3DA 2PWHA 2GJLA 4O1AA 1AJ0A 4LAKA 2Q8LA 1CXHA 2FH6A 4XZIA 2RDTA 3UWEA 1TPWA 1V6WA 3CQHA 1TIWA 2J9ZA 4XTIA 5A2CA 3GNRA 3ZJ8A 4CKQA 3CM4A 4CU7A 1GVEA 1ZENA 4LEQA 3WSUA 3QJAA 2XU2A 1OYAA 3L23A 3B8VA 3RYSA 3R8GA 1G4PA 1V3HA 3NIYA 4RDWA 2Q3RA 3RO6A 3KRBA 3MMWA 3U7BA 4PUWA 4MWAC 1WDRA 3PZMA 3G1YA 4S3KA 1LBMA 1XH2A 3VOCA 3JR2A 1QO2A 1EJRC 1ITUA 3VAVA 1SMAA 8XIAA 2OEJA 2R9RA 1XIGA 3WF2A 3D6NA 3MC5A 2YBVA 3TC7A 4ACZB 1BKHA 1E0XA 3NOEA 3IJDA 3LHVA 4Q7BA 1TV3A 1XG4A 3RR4A 1LJYA 1UD5A 2PLKA 3PZ9A 3AIQA 4GKTA 1LT8A 1TV8A 3HO8A 3UZXA 3KBJA 1LF1A 4HA1A 1EIXA 1GVSA 2OO0A 3VMNA 1JDEA 4ZL1A 1FWWA 3CL7A 3PBWA 4CN4A 2BWGA 5MHBA 4MNMA 1ZJIA 4F2BA 3IK2A 2PDJA 4AIBA 3RIKA 2DZAA 3W38A 1NFBA 4IH3A 4NJHA 1FHVA 3T78A 3UWQA 2Q8ZA 4OV4A 4J40A 1VQTA 3SN0A 4J35A 4B3KA 2NUXA 4LNYA 4BQ4A 9XIMA 5AKQA 1MDLA 4QJ1A 2ZXBA 3F5LA 3USBA 3H7RA 4AZIA 4FX7A 1C8YA 3TC6A 4HD5A 1G01A 4XVEA 1JAKA 4MG4A 2RGLA 3KEHA 3TLQA 2CKSA 5GJNA 4EACA 4OHQA 4O1EA 3DHDA 3ZJKA 4ORMA 4BKNA 4DJFA 4IIFA 4PZVA 3MBFA 3ORWA 3QY6A 3GNOA 1NELA 3SN4A 2HBXA 2WKGA 2QDHA 5TD4A 3HGSA 3IJQA 3CZGA 1K8CA 4Q22A 1AZ2A 4F0SA 2QUMA 2KAUC 1I0DA 3M0XA 3AZTA 2A3AA 3A5VA 2WVVB 1SJBA 4R7OA 1XRVA 1LROA 2VEMA 1AMYA 5H6HA 4FR1A 4PULA 3MSGA 4MAVA 3TTQA 3W87A 3E0VA 3NQFA 1B90A 1VB9A 4MIMA 3FDGA 3WBXA 4D8ZA 5EA9A 2FB2A 3G1RA 1JZ4A 1EH9A 3G1FA 3NXLA 1MW1A 4QDPA 1BFNA 3TSDA 3I6TA 3IAPA 2UZ9A 1DWFM 2XPKA 3GR4A 3E38A 2PDFA 2GJXB 2J7HA 1XW8A 4LB3A 3MO7A 3GXTA 5C7VA 4PN2A 1ZRQA 3A4JA 3AUJA 3WDHA 1BRLB 2ZRUA 3F4DA 3B8DA 3VVGA 5D9PA 4JDBA 4ZE5A 1R47A 3QV6A 5AHEA 4FO4A 4L5ZA 5G1MA 4AF0B 4AHQA 1W32A 1SSGA 4IICA 1R9XA 4JNZA 3BSGA 4MWAA 3CL6A 3RX3A 5LA2A 3H53A 1TPFA 3W76A 1F74A 3VE9A 4C1KA 3C5QA 4DLFA 1H7OA 3QYSA 3PWIA 4IQEA 3G8EA 3WNNA 3STEA 4PBFA 4PMYA 3B8TA 4LRTA 3VD3A 1HGWA 1Q4NX 2WNZA 4BQ2A 1OWQA 2Y5JA 1W56A 4JDYA 3R8RA 1KXVA 4JHMA 2XGBA 1Z8AA 2HS8A 2CW6A 2QDGA 5LNUA 4GBDA 3LXBA 3R0KA 2A5HA 2PLMA 2J75A 1FXQA 1H63A 3IK4A 4ZQOA 4ZOCA 3TN6A 4R53A 3S46A 1F9CA 5KITA 4JFVA 2AQVA 4AY1A 3E9AA 1KLYA 2IKHA 5HNNA 4YU1A 4NJGA 3LK6A 4DPPA 4JCLA 3O0KA 3N04A 4JTJA 1AQFA 4AIUA 4GZ7A 5DT5A 5DF0A 2JK2A 2XVPA 3EMZA 1O12A 3B3DA 2Y7DA 4BCEA 1TVLA 2XISA 5HXMA 2XM1A 4FMVA 2INFA 2E8YA 2VR2A 2OR2A 1L6FA 4G9PA 3REQA 3VUSA 3Q67A 2DZUA 4EXBA 2P3ZA 1G69A 2QMJA 1YE4A 4M7SA 4GQRA 4MY1A 1JAEA 4LEFA 2WSYA 5G5IA 3FFSA 4LH8A 3AMKA 3LRKA 3BCFA 1G7UA 3SCTA 4KIRA 2ATMA 3SJ3A 2DW6A 5EMYA 4WVXA 4JTAA 3IJ6A 4PUNA 3I6RA 3O6YX 3WN6A 5K2ZA 3S5SA 4UNLA 2IPWA 3D3AA 3NO1A 3P8IA 1KGUA 5A5WA 1RHCA 2O55A 3OJGA 1P0BA 3NDOA 4DBSA 1KC7A 3L66A 3L21A 3WG6A 1XBYA 3M0KA 2CHNA 1CBGA 3N6HA 3PZVA 4DHGA 4ZBCA 4PRWA 1Y8BA 5XIMA 1QOPA 1Q6FA 1XHGA 4CN6A 1AODA 2GJNA 2VD8A 3W9ZA 4QEEA 1E15A 4M5PA 3WUBA 2EO7A 4ZB5A 1FWBC 2XGZA 3U2ZA 1TPVA 4ORIA 1EO7A 4GISA 3S9IA 3C86A 3R8HA 1OGSA 1WQ5A 1IF2A 1QPKA 3ZJ6A 1Z48A 5A8OA 4G2DA 3CT2A 1VC4A 3VKDA 2BZNA 4DJEC 2PDLA 2OZTA 3HN3A 2DU2A 3R5EA 1LORA 1QRQA 2PDQA 2ZWZA 3H2NA 1C7SA 6REQB 1VZWA 4DBEA 2XVLA 4N4PA 3DHPA 3B8IA 1LQ2A 2YCLA 3QFEA 5CJMA 3ZVHB 1YQ2A 5I06A 4Z1YA 5CZ0A 1TZZA 1PKYA 3OODA 1AQ0A 1DQUA 2QAPA 3VKCA 4XD6A 2V6AA 5BYWA 4S2CA 4M6UA 3ARPA 1VFOA 1XRTA 2V5DA 3TR2A 3EX4A 3G1VA 3JS3A 2YYTA 3PUEA 3NOYA 4K1WA 2ZTJA 1JXKA 3W1TA 3EOUA 1WOAA 3VZYA 3ZLGA 5JXQA 5T9BG 4LAOA 2IXUA 2J7CA 3EA3A 4KGJA 3WJSA 3WDJA 3RJXA 1LLOA 2VUYA 3WLRA 5AC7A 2VFGA 2BHYA 1UPMB 1ZCCA 2FVKA 4V33A 4XAYA 3K8LA 4UMAA 3KBNA 1SO4A 4DF1A 5J04A 3VOJA 1VEPA 4PEEA 2WHKA 3EOLA 5E0KA 4I9MA 3VNKA 4A3QA 5FSDC 1GYLA 1TV7A 3TZNA 3H2MA 4TR9A 3H2FA 2WANA 5G2IA 3W00A 3NZQA 4TVUA 3NA8A 3CXOA 4S3BA 3QRHA 4NQ1A 2YR1A 1XWYA 3E49A 3ITTA 4M81A 4Z1DA 1RQBA 1POJA 1OCBA 4XAGA 3WUGA 3W1NA 3B9NA 3GVGA 3TOPA 2ZDRA 4RW3A 4LC8A 1QATA 4ZSTA 3O6DA 3WF3A 4AZ7A 1J01A 1YBQA 5FESA 3W3OA 3NFUA 1SO6A 2V5LA 3ID7A 1FWTA 1S2AA 3BANA 2DP3A 1UWSA 4C1NB 4H6QA 4XD5A 2JIEA 3FEQA 3GG8A 1HJVA 1A3HA 2GUUA 1VF8A 4LUSA 5K4ZA 1KWKA 1K70A 5GVJA 1UASA 2O9OA 3DG3A 3CHFA 1FH8A 1V93A 4WK9A 2QCLA 3VMPA 4C6NA 1XIEA 4MUPA 1BHGA 1PZ2A 2QCCA 1FDJA 1JPKA 1X1OA 1W1ZA 1XCWA 3AS2A 4ACYA 3SFKA 4HNNA 1SYTA 3IRSA 3O9NA 3UZ5A 3HV8A 5TNVA 5C54A 4MDPA 1B3ZA 3BLOA 1TMQA 1XL9A 5FD0A 5E09A 4CD7A 3PC0A 3TE9A 4H9VA 4IPJA 5FI8A 1ICQA 1VHCA 4KGLA 1SZRA 2BMBA 1E4LA 5JIWA 1DJXA 3NYDA 3QGAC 2VP8A 3SUUA 5CPTA 3K5XA 4CCCA 3BZJA 2O56A 1RH9A 1ONRA 3A22A 1VHNA 1TCMA 3WQ6A 1UJPA 3AS1A 1IZJA 2XIIA 4IHCA 3VZZA 2ZX5A 1XIBA 3G8RA 3R94A 2OQHA 1VLWA 2J74A 2GK1B 3R25A 2GGGA 4IX2A 4IPLA 1YHTA 1KR1A 3W7CA 2XZ7A 3MV01 3QKZA 3OLGA 4W85A 1OX5A 5C9RA 3WDRA 3AICA 2G5WA 1EQPA 1QTWA 5J5DA 3OYXA 3G3DA 2DVUA 2VGGA 3PHAA 1NWRA 2W67A 3W2LA 2VFHA 2B7NA 4HJWA 1E6SM 3GDRA 1OX4A 3NQEA 1DXFA 3EXSA 1A80A 3FOKA 2WJZA 1MO0A 1NWUA 4ERGA 3NPXA 1QO5A 1VBJA 2X05A 5CAHA 3ZJ7A 1FCBA 3WMSA 2BV9A 3TP4A 3C3NA 1W3NA 2DY3A 3CZEA 2A2IA 4ZEPA 4LUTA 4RLIA 3TQPA 4PR4A 2VX6A 1R30A 1F3EA 2ZX8A 3KWSA 1T5AA 1IQ8A 1TCDA 4KRZA 3G1HA 5DQPA 2EPHA 3C56A 3MHGA 1V4YA 1RD5A 4IP5A 3ECQA 5DY2A 3W75A 1JDDA 1QW9A 4IMCA 4DEFA 1MZHA 3WK0A 4H2CA 2YL6A 3TTEA 4P8WA 2X09A 3NQ7A 1SVDA 3DFYA 3K4WA 4HHPA 1XLKA 1LL6A 1O4UA 1K4GA 2ZX7A 1LM1A 3BLPX 3QOMA 4CNPA 3NAVA 2ISDA 3WNMA 2GLKA 3VIIA 2H9AB 2WVTA 1MEWA 2Q02A 4F8XA 4IQJA 5LA0A 1PO9A 1GVYA 4XISA 4PTDA 1O66A 3APYA 1IWPA 3KCOA 2NQ9A 4JIEA 3A9IA 1DWIM 3HOJA 5I3IA 2QZRA 4JN8A 2YL9A 2YKKA 4GZJA 2C13A 1W1A1 4TU1A 2FFCA 3PM6A 4LAUA 1B54A 3EA2A 1C91A 3FEMA 3MV11 5E6ZA 4O15A 4QS5A 1QNOA 3K2GA 4PUJA 1LTDA 2CYGA 4GZEA 4EE9A 4P8VA 3RPTA 1TTJA 4YJ5A 4ZA0A 5HOSA 3K30A 3BURA 3IANA 2ESCA 1OFOA 1RA0A 4OWGA 3FDKA 4UFJA 2YOCA 1B57A 3G22A 2OODA 3A21A 2WMIB 4Y2WA 3OG3A 3H7VA 3QPYA 2J13A 4PCSA 4AY7A 2PDIA 3S2LA 3WENA 4GLEA 3UXKA 4DF0A 2NX1A 2V5CA 2NV2A 4Y9AA 2AL2A 1W3JA 2DSVA 2EPOA 4C7GA 2CKRA 4IMAA 4XAFA 4Y8EA 4XQ6A 2BB0A 1ECEA 4WGHA 5A94A 4EOUA 2RUSA 3W2KA 3MUXA 3MKCA 4HK5A 1Q8AA 2EEXA 4L64A 1R85A 3BAIA 1UIPA 2Q3OA 3U0HA 1SZFA 3W6MA 2VEFA 3WCZA 3EA1A 3KAOA 2Z6JA 2HEJA 4B3ZA 3B8WA 1DKWA 1FKWA 3NZRA 4IMGA 3Q2DA 3FAXA 3HV9A 2Y89A 2X2GA 3CIWA 2Y61A 4E6MA 2CLIA 1M7OA 1X97A 5TQLA 3MCNA 3CUIA 1XR2A 2RKXA 4LWWA 1XIJA 1KO0A 4GI8A 3UCCA 3C2RA 1H7RA 4JQ2A 1JYXA 4FLRA 2XFWA 1EZWA 4H6EA 2DJLA 2G3FA 2WOQA 4JD4A 2VZOA 1CXIA 2LLEA 4L61A 1WKDA 4NZJA 4R34A 1EEXA 1VH7A 2D2JA 1RV8A 4UWMA 1OIMA 5CGQA 3QGKC 4UFHA 4Q8QA 2XVKA 2J24A 3M07A 1KCXA 2E9LA 2QKFA 2DQXA 3IIXA 3THQA 3MA8A 2Y24A 3GIYA 1ESWA 5F2GA 3ARXA 5LNVA 3TN4A 1GG0A 3G18A 1E6RA 4Y9MA 3FLUA 1JYVA 2WKJA 3T40A 4GC4A 4HYVA 4L1WA 1Z7AA 3UJSA 3U5YA 5ABGA 1GPFA 1W5NA 4A6GA 2DVXA 1ZAHA 1OQFA 1QOXA 1Z89A 4J3TA 4TV6A 4IT1A 3ARWA 3LPPA 1E9ZB 2E1WA 4NNCA 1ZL1A 4FNRA 2CBJA 4DN1A 2Z1SA 3VD4A 3IWPA 1EXPA 3DFNA 3MS8A 1G6CA 3AAMA 5FJOA 5B7YA 1OIFA 1SW3A 2ISVA 2BSLA 4L4LA 3E12A 4HMNA 5AC6A 1WUEA 4ADUA 3JZUA 1CLVA 3H4WA 1OADA 2X1UA 1PDYA 4D1JA 3WD1A 3BWWA 5DCBA 1OC7A 4LCSA 2ZE0A 3PZTA 2AGTA 3L2IA 1G4SA 1VR6A 3H12A 3VZXA 4ERIA 3VNDA 3FY1A 1RCOB 5AZ1A 3RK8A 1IWBA 3EOEA 2CBIA 3ISIX 5KZDA 3TYCA 4UTUA 4K8HA 2GSJA 5C2CA 2OWWA 3BG3A 2D3NA 2NW0A 1F76A 4N0RA 1S3TC 1F5ZA 3LXAA 2BGQA 2PCQA 2PWEA 1R7AA 1PSCA 2E8ZA 3ALGA 5CG0A 4HZMA 3UXLA 1R38A 3EWZA 4HKPA 3KS5A 1P43A 3M7SA 4GWEA 4IMDA 7TAAA 2CNCA 1RVGA 3CUJA 4Q7NA 4M6VA 2YIHA 2ZQ0A 1L6YA 4J3UA 5EBAA 3ONBA 3UP8A 3WMLA 1H61A 3GVWA 3N6QA 3NEVA 2A85A 1LLWA 3EYPA 5IFPA 1KGWA 1EX5A 1YTDA 5A6MA 2UY4A 1CLXA 1M7PA 2IPFA 4UTWC 1GT8A 1HL9A 3OU8A 1GOWA 1VD6A 5E1QA 3U9IA 1M68A 8XIMA 1IEIA 4Q4PA 2AL1A 3PAOA 4BZYA 4NZ1A 3UBPC 4WEVX 2NVAA 4G8TA 4UFLA 3DENA 4W93A 5G1YA 1I1XA 4J28A 2FYMA 1NFGA 1EOKA 2PZ0A 3A9BA 1A5AA 4ZXLA 4AZHA 2CLKA 2CHRA 3H4GA 3S3GA 1KFBA 3DFQA 1OC5A 2IPGA 1Q7ZA 2IKIA 1OF6A 1TJ1A 1XI3A 3CAQA 5CZJA 4ZVJA 4XIMA 4PB3A 1JCTA 2VZUA 3LTSA 3TAOA 3KTSA 1J5TA 3WD3A 3ZWSA 1GQIA 4S2BA 4PL1A 1M6JA 1OFDA 3LY0A 4X0NA 2OELA 2OSYA 3WLJA 4W7WA 3S5OA 1CIUA 1TWWA 2YPIA 2ZE3A 5JH1A 4H1ZA 2W0UA 3FHAA 2WXDM 2J6VA 4K36A 1W9VA 2QYGA 3B9DA 4H83A 1TWZA 2HDJA 2P8BA 4F4RA 4V2XA 3MMTA 1OC6A 1TSIA 4GJIA 2YB4A 3F2DA 2X0YA 2PTYA 3O16A 1UKQA 2IUZA 3R10A 2ZWYA 5EY5A 4FNPA 5XINA 3DC8A 5EMLA 4WSKA 1KBBA 1H4PA 2Y0FA 1W3KA 4W8AA 4NYUA 1PKNA 4B5UA 3C2OA 3OA3A 3WBYA 2G0WA 2OX1A 3QR0A 3WKZA 1QPNA 3S6OA 2QV5A 1LG1A 3WQOA 1P6BA 1MWOA 4EPKA 3NR0A 1T8XA 4RZ4A 2I5IA 2JALA 1E6XM 3AXMA 4TX8A 4Z1CA 1F4AA 4HA0A 3H55A 4X60A 4QE4A 3CV6A 3BGAA 4MYXA 3V0UA 1LL7A 5JU6A 4MY9A 4E8CA 3PJUA 3WX7A 5D9MA 5BZAA 1VJIA 1SJAA 5K7JA 1YE6A 2PCEA 2TMDA 3ZSSA 1XX1A 1CNVA 1QCWA 3NQVA 1JDAA 1JUBA 4FOKA 1GNXA 1XM3A 3HG5A 3PUGA 2YFNA 3N29A 3UA3A 1F2JA 4Z2GA 2TPSA 4N2YA 1W3TA 2O9PA 1EP3A 3BO9A 5TBOA 7ENLA 4LV4A 2CBVA 4H6KA 1C9DA 4PH6A 1LT7A 2E67A 3KW3A 5MF5A 1OM0A 2F84A 1DJWA 3GAYA 4EXAA 1JULA 2O9TA 4H01A 4X61A 3V0TA 3MTWA 1DQXA 4OT7A 3NM1A 1PTAA 4C6OA 3BJSA 5T9CE 4UTWA 4C91A 4FXFA 3ZT7A 3DGRA 3CWOX 5FAGA 2Z7KA 1PB0A 3WFAA 7REQA 1KXTA 3OP2A 4YPJA 2GVLA 1SSDA 3GK0A 3H6OA 2XJ7A 1I2RA 2DDXA 3WQWA 1DBTA 4JHOA 5I78A 3BLLA 1HL8A 1A49A 5HATA 3KOXA 1FWIC 2FZMA 2Z28A 3SY1A 1E1CA 4KETA 4B5XA 5A6BD 1PHWA 5F4XA 1FWAC 2F6KA 1OY0A 1P6WA 1JF6A 2BLEA 3VCCA 1V08A 1BXBA 3P5YA 1EZ2A 1S1RA 2YCKX 4PMVA 3W28A 4KEUA 1PKMA 3SADA 1I4NA 1ZNNA 4U10A 3M5YA 4ZFCA 4MYAA 1HKMA 3UWZA 1FP8A 2BHUA 2QJJA 3NG3A 1RCQA 1WYIA 2DT0A 3LZ3A 2FGZA 4LOCA 5A6LA 4X3ZA 1RD6A 1V51A 1YKWA 3EZ4A 5HPCA 3ARUA 1L8NA 1UR8A 4PBGA 1TJ0A 3TTOA 3LPOA 1T6MA 1M5WA 2EKGA 3GS6A 1JI2A 3AIRA 4MADA 2C18A 1OX4B 4P7RA 2X16A 2A4AA 1KRAC 3KTCA 1PXGA 2XYLA 3VFLA 4MNLA 2DH2A 3GUGA 1IXNA 3MZNA 2EHHA 3SQMA 3AHZA 4X9YA 4NAEA 1IZKA 1X6LA 3TQ0A 1HIZA 3C0JA 3MANA 2YX0A 2ZZ1A 2VL4A 1H62A 4LBRA 1H60A 3UJRA 1TUFA 1Q2SA 2F7FA 3AHYA 1P48A 1FWGC 4KS0A 1YW1A 2ZZ6A 1KBJA 1VBGA 2D20A 3IEBA 1G67A 3HPZA 5ECUA 4O8AA 4LC6A 2E5CA 4HHHA 5HNUA 2PD5A 2VNCA 3AOFA 4N6EA 4YHGA 4AWUA 1BGAA 3A3HA 2VEIA 5C9XA 4I7VA 2QUUA 4GI4A 3T09A 2CZDA 1W9PA 2HVOA 3P14A 3VCRA 6XIMA 3H8AA 3CB3A 1DWGM 3TQKA 3MHUA 1W1VA 1W0MA 3IIPA 2ZXAA 5KEZA 4UTKA 3EX3A 3N3TA 1OHLA 2PDUA 5HUOA 5A6KA 2QIWA 3T7VA 4CNNA 1IIHA 2EJ1A 3QMTA 3CWNA 3XISA 5BOFA 3W7IA 1K6WA 1R87A 4K3ZA 4URIA 2BG5A 4XZHA 4IFOA 4WKFA 4DY1A 2QJHA 2J88A 1ZP4A 2Y5SA 3WK2A 2J9XA 2JEPA 5LGXA 1KM0A 2B0MA 5FJJA 1MQQA 3HJZA 1SFLA 4Q4KA 5AZ0A 5M3WA 2PE4A 1MQPA 4YXGA 1YPXA 3RAOA 7PTDA 4ERAA 4R33A 4GQGA 2WHJA 3UPWA 3LQLA 3IVSA 1RY8A 3F4CA 1ZZMA 2BXVA 2Y85A 5KSWA 1JNDA 4UFKA 2J78A 4S3FA 1LLZA 4DO6A 4W7VA 3S5YA 2HXTA 3QLDA 2P3EA 5EMUA 3GTXA 1B3XA 3NPVA 2FKPA 3Q58A 2RHGA 1O7AA 4DIAA 3LSBA 4O53A 3HM7A 2ZDSA 3TWBA 2ZZ3A 1ZQ5A 2F61A 1OGGA 1EUNA 3CK5A 4MLRA 4C6IA 2KX9A 1G94A 3G2GA 2HTMA 2OFJA 1VYRA 5MKGB 1QHPA 1OZMA 2QAFA 3P2VA 2OU4A 3NO5A 5KZ6A 5JBFA 1A5CA 3W26A 3H23A 4C90A 4IGMA 4EVZA 4OVXA 1TB3A 3EWUA 5DMMA 2FVMA 4OTKA 3TTYA 1L8PA 2QPXA 3AMLA 3NEHA 3B4UA 4O12A 2G3MA 1E5JA 4GE8A 4NRRA 4A4AA 3IUIA 4FZIA 4H6RA 1AQMA 1IEVA 3S1UA 3OQEA 1DE6A 3QR3A 4ONVA 1F3XA 1GKRA 4IPPA 3LM7A 1UHVA 4GYPC 1VBUA 3UU0A 1Q6GA 1B3VA 5DN1A 3LLXA 4D6JA 2WVSA 2QJMA 1W3LA 2BVDA 4JTFA 1D3HA 3STFA 2B7PA 3UEQA 3UPBA 2R1PA 2PDPA 3GE7A 4GXMA 1OEPA 2WJEA 2DIKA 1ONEA 3C3UA 3TROA 4AD2A 5IDZA 1PUDA 3LENA 2O4MA 4B5TA 3EEGA 3VIMA 1B9BA 4N9CA 4DQWA 3VGBA 3GZAA 3GG1A 4GIYA 3MI3A 2ZX6A 4MVAA 4OE7A 2R8WA 1I6NA 2DZPA 3G1AA 1EA0A 3MT1A 1MMFA 1NDZA 1BGGA 3VIHA 1M7XA 2XFRA 3AYVA 1X96A 4L7ZA 3AJXA 2DVTA 2FTWA 1FCUA 3TJLA 4DUXA 1C92A 1KFEA 4GFIA 4ADSA 5AHFA 1K6AA 4FF5A 2AGKA 4QJ3B 3CYVA 3RLHA 1W1YA 4K7VA 3M6DA 3PBUA 3WH9A 1YLVA 1YIXA 3W71A 4PMXA 1TPDA 3E0WA 9CGTA 4A2RA 2W6RA 1K3UA 3IARA 4PMUA 2GVYA 3VM5A 4L9YA 4B5VA 3FSUA 3BW2A 4MNJA 2VX4A 2ISSA 4ZE4A 2QEZA 1HP4A 2GQ8A 3M41A 2GWGA 2INZA 3E2SA 2ATSA 2V3DA 3GTNA 4PCFA 4JBRA 2RDXA 4ADTA 5D9OA 4JCMA 1KV8A 2AOSA 3TN5A 4EPDC 4RW5A 3TNBA 3U48A 3C2EA 4AW7A 4HGXA 3OVPA 4X0VA 3POHA 5BWFA 1OB0A 4PC8A 4U33A 2Z25A 1TE6A 1AL8A 4ENLA 1I8JA 1UQYA 3P67A 4M24A 3H7UA 4QCFA 3QMRA 4XK2A 2W92A 4GNKB 1PIFA 5H8UA 4AUBA 1W1B1 1Z9AA 3ANYA 3SW6A 1IWAA 1C90A 1HL2A 3SUTA 4B5WA 2VWSA 1E6PA 1QPQA 2QCMA 1XLHA 3BLDA 3ELFA 1FTXA 2WZHA 2AMGA 3EXTA 1ME8A 3EXRA 3B40A 4W4QA 3EX1A 1TO3A 2HXUA 1PCKA 1MXGA 5HNTA 4DJED 3UERA 1ISVA 2WCSA 5AC5A 4A3RA 3BW4A 5ABFA 3OVQA 5C9ZA 2HQAA 4WY0F 3FA3A 4B2DD 3ITXA 4LVGA 3W2UA 3W7EA 3VKBA 2DT1A 4ML4A 2BTMA 2CC0A 1VP5A 1GEHA 4HOXA 4IG2A 3VILA 3TR9A 1KLZA 4O18A 4JQ4A 1S2VA 3I7SA 3IVUA 1ZY9A 4LCRA 4PUDA 1VFLA 3AHVA 5IHSA 4GYPA 7XIMA 3BAKA 4UR7A 2F6XA 1EJVC 2WLZA 3OBKA 5G4WA 3W53A 3UXIA 3VTRA 1LDCA 4L56A 4LVBA 4FXRA 3LERA 1JF5A 1IEXA 4UCFA 2E40A 2OTDA 1DJGA 3E02A 5BU6A 3ZQ9A 1JCXA 2VZTA 1D3GA 3F4NA 2Y8VA 3VDHA 1XLAA 3OPSA 4BA0A 3RM8A 4P7LA 2PGFA 5M5DA 4Y9PA 1PX3A 3PN8A 4P61A 5KMYA 1V6XA 2ZC1A 4R27A 1E56A 4UQ9A 1CXEA 2A0NA 2R91A 1G0CA 4H9UA 3LSCA 3SCPA 5G2WA 3GXMA 3WH8A 2GQ9A 1PV8A 2EJAA 3TK7A 2TSYA 3ENLA 3E74A 3M6YA 4NI3A 1KM6A 3ZOAA 2JBMA 2FQIA 3ZMRA 1K77A 4GCXA 1XC4A 2YBUA 1SFJA 3SZ8A 1X1NA 2C19A 3PNZA 2HSAA 3R12A 1TTIA 2REQA 2NSXA 3HMCA 3M1ZA 2FHFA 5A95A 1N8IA 3ARSA 3FX4A 3PB2A 4LBUA 3T4CA 1O68A 3WLSA 1WP6A 2PWGA 3G6MA 3BVJA 5EYWA 3U6WA 3OZOA 1OCQA 1XLIA 4A8LA 1O94A 1PJ9A 1CGTA 4ASTA 3CUFA 4EF8A 4PSRA 4C6LA 1EO5A 3QBUA 5FJPA 1WNOA 3DFOA 1T96A 4PSPA 5JIPA 1IT7A 4PCTA 3N11A 3QQ1A 3S4TA 1ODUA 2JEQA 1V3JA 1YDVA 3GTHA 4GBUA 3B9AA 3AIEA 3GUWA 1GYMA 2A6NA 3RRXA 3CQKA 4ZQPA 5BXSA 3CTLA 4W7UA 4C6DA 3VYLA 1IT8A 4ATDA 3AIWA 4CGTA 3SSJA 3NNTA 3UZWA 1E1CB 4IGHA 2QCFA 3L12A 4JR5A 2X7VA 4ZENA 2JGQA 3TKFA 2GOKA 3QV8A 4NUWA 3UG4A 3WUEA 2ZFAA 2DFAA 3KOZA 5A8NA 3LCGA 3P0WA 4JKKA 3WFLA 1I45A 3UGRA 3WFZA 4BEQA 1R46A 1V0LA 2WSKA 2QJIA 3G1DA 3M46A 3O3RA 3SCOA 1MNSA 1U1HA 4QXIA 1B1YA 3HU7A 2DSKA 2WC7A 1TQJA 5C71A 1LG2A 1ZJHA 5I5RA 1U1JA 2DJXA 1P0EA 5AHIA 4C6KA 4HT3A 5KETA 3P80A 3UYCA 1F3TA 2W3ZA 3V18A 3WL0A 2PDCA 4Q8NA 4U28A 5EFDA 5DBTA 3HG2A 2B31A 4YVXA 1MXSA 4CCEA 4EPEC 1N55A 2JFEX 5U7SA 3WNPA 3GWQA 1K4HA 2EXOA 5BOEA 1GQJA 4PMOA 3UQNA 1R2RA 4R9OA 3E2QA 4QAIA 3N9KA 2FTYA 3GC5A 4GJ1A 4QHRA 3OHMB 4INFA 4CNTA 4V1XA 3L68A 4ZXOA 3S2NA 5LNRA 2XSXA 2J25A 3VOGA 5FF3A 3VKAA 3S5NA 3N2BA 3A47A 1XF0A 2Z24A 3QQWA 2QDEA 3IGUA 1BYBA 3IGSA 1M9HA 1E3ZA 4A8NA 4EIVA 4XG1A 4MAZA 1JXJA 2KZHA 2PU1A 3E2VA 3LPFA 1VCGA 5T8GA 2WMHA 5I3DA 4HOZA 2Y70A 1VYSX 4ACZA 1TZ9A 4LQ1A 3RCNA 2BY1A 4JAWA 1H1ZA 3BJTA 1XCFA 1N82A 4UTLA 1VRXA 2ALDA 3F1QA 4A3YA 3GIPA 3WLTA 4F0RA 5IBXC 1XRSA 4DBDA 4UMCA 3CC1A 3QXBA 3S9YA 3TYEA 3UZJA 2E5BA 1LRQA 1DIOA 4J2MA 4QE5A 4DI9A 3I68A 2OOGA 4GIEA 6CGTA 1TJ2A 4E8DA 1XG3A 4P2VA 2GDUA 3UZZA 1MZRA 1K8ZA 5EFFA 5I00A 8TIMA 1LOQA 4YCOA 5JBDA 2XWDA 2QPUA 2R1LA 3D5HA 2GGEA 2QCGA 3LPGA 2HS6A 2A79A 3SQLA 3UCDA 1MI3A 4JN6A 1GORA 1F3WA 4YMZA 3URQA 1WE5A 4Z17A 5I7GA 1BEUA 4V27A 3D3FA 3BMXA 3DEQA 1FQ0A 3RLGA 2WCGA 4E2VA 3KS6A 3ARQA 1K1DA 2BOEX 4DO4A 3AFBA 4UZSA 4CNOA 3V4BA 1OK6A 1KFWA 3V0SA 2PDYA 3ES7A 2XUCA 4IGNA 1XBXA 1CPUA 3CBWA 4KH2A 4C7DA 3CH9A 1BKSA 4WY0B 1Q6LA 4MMWA 5LIUX 3LCLA 4A29A 2WVVA 2PP0A 4FNTA 4TTGA 1ISYA 2Q8XA 1J0JA 4UB9A 2OVLA 2QUVA 4RXGA 5HA7A 1W2PA 1JCJA 4AVFA 1RP9A 2EKCA 1XP3A 4AIEA 4M56A 3BICA 4UIOA 5FAJA 3WMCA 4MNKA 3T2QA 4LT9A 3TMLA 2Y8UA 1MFUA 3WD4A 3B05A 4I5UA 4RL3A 4GABA 3BMVA 2G3IA 4J1OA 3PZOA 4GOAA 3OGSA 4PRRA 1UCWA 2XG9A 4C65A 2WJFA 1BYDA 3WLIA 3NZPA 4HZ8A 5DXXA 1BRLA 1GTEA 1W9BM 3OQ8A 3C0QA 3P93A 5C2XA 4XZBA 3G1XA 4IPNB 3MUAA 2B4GA 4FIRA 1I2PA 4ROQA 1L6GA 2P5NA 3UGVA 4JZ5A 2FDSA 5A3HA 2V0TA 1W8SA 3PTMA 1OFQA 4JYDA 5L9FA 4HSHA 3GW0A 1V8EA 1C29A 3QV9A 1NM9A 2DZXA 2WHLA 1PIGA 2A7PA 1WZLA 1GJUA 3AYSA 1ZAIA 1XSJA 2Y4SA 1WBJA 2ZUMA 3GM8A 3VKJA 4F9JA 4NNAA 1S5MA 3GBEA 2GGJA 4GNVA 3UNTA 1PBGA 2XH2A 2IQ0A 2A3CA 1NIUA 1OK4A 3RX2A 2HPMA 4DAIA 1FWSA 4RE2A 5I2UA 1QBBA 1GWJA 3I4EA 1PZ1A 1XLGA 4JL2A 1MVYA 5IBXA 3NSNA 2QGHA 4Y6GA 3ITYA 3E3HA 2GWNA 3RO8A 1OZQA 4C6BA 1SU5A 2DSUA 5GNYA 5F2MA 5J8LA 4AWSA 9RUBA 3TDFA 3CUGA 1R3SA 1Q3NA 2X0SA 3GBDA 1XYBA 4G1NA 5FACA 5CKSA 4WLCA 3GG0A 3CZ8A 1Q85A 2POZA 2Z1BA 2PC4A 3MY9A 3M0JA 4O4WA 2ODOA 4BF7A 4FALA 2E7FA 3TYAA 5CAKA 1DXEA 4MB5A 4IPIA 1E4NA 1KFCA 2ZRYA 2A1YA 4O1FA 5CC3A 2YBTA 4WR3A 4H8NA 3QSTA 1ENUA 4E0CA 3GHTA 2ZA3A 1TWDA 1B4EA 4G6CA 2OJPA 4JFWA 1XIHA 5AYXA 4M80A 2BODX 3GD6A 4NX0A 1SJDA 4QJ5B 1EGMA 1WDQA 1BQGA 1QMLA 3FA5A 1JZ5A 3KHJA 4PB4A 5XIAA 4MDOA 3W7GA 3JZEA 3OO2A 1XLMA 3STPA 2D0FA 4FR6A 2DPEA 2ICSA 4PMZA 1EPVA 4E4UA 3S1XA 3UVIA 2ZZ7A 2E1DA 1UWUA 2I14A 3W7QA 2WZMA 1CB2A 4O54A 3SDOA 1NY1A 3W85A 1XFCA 4XZLX 2QQ6A 2J7EA 4F2UA 3WLOA 1CYGA 4HCLA 4HIBA 4PTVA 6XIAA 1FHDA 3ATYA 5LIYX 3AIBA 1VPQA 4E2DA 2DZWA 1NVMA 3KXQA 2A21A 3LMZA 1SR0A 3W6LA 5ABFB 3E5BA 3T07A 1US3A 4Q4SA 1X38A 3F5KA 4QTGA 1MYRA 5LA1A 1QU4A 3EX2A 1UR0A 1E72M 3TONA 1BSLA 1H7PA 1ITCA 3B06A 2OLHA 4EF9A 1WUFA 1TA3A 1ADDA 1R3QA 4NZ3A 4O11A 4OUIA 4JFTA 2CLEA 4RE0A 4F0MA 5E0CA 1QI3A 4PB5A 1L0PA 3BOXA 4IXXA 2XN0A 3SJNA 1V0MA 2V67A 6REQA 2Z6IA 1YNYA 3W7LA 2B7QA 3DGBA 4DELA 4B15A 3BC9A 3UESA 3B0YA 3UR5A 3ZVHA 3MQTA 5A8GA 4MOZA 3QY8A 3C0LA 1PZ0A 1ZP3A 1TPEA 4QX4A 4YTUA 2WM0A 2Y7GA 1P7TB 4YTSA 3ANVA 4DWDA 2A3LA 5IDIA 4LYRA 1UROA 1XLCA 3KL0A 1THFD 4KWVA 4RDZA 4UTHA 2UY2A 1ITQA 1EF3A 3W7JA 4M51A 3KL3A 1UKPA 3PG9A 5FJIA 1HXJA 1KQYA 2VZVA 3SY8A 3WJZA 3WNKA 3QHNA 3WLMA 3VIOA 1XYZA 3WDIA 2C16A 4MPQA 4WUIA 3UWWA 2FHCA 4L6HA 1B3OA 4GRSA 4BF9A 4DM1A 4CUCA 5G2HA 4TOQA 2I9UA 4LUIA 4IXHA 3EWYA 4DZAA 4FNUA 2NX3A 4PMRA 1LWHA 3ZXWA 5FKYA 5A6AA 3T42A 4QGCA 5DEZA 4US5A 1NWSA 2YA0A 4BEUA 4A8IA 3KCJA 1E5NA 4WZHA 2F2HA 3HJEA 4RNJA 2CXGA 4D72A 1ZSXA 4U31A 4OKDA 5LGZA 5DCEA 4NG3A 2AKMA 2PRLA 4UTTC 3C0SA 4H19A 1DOSA 3WQGA 2PTDA 2QR6A 3B0PA 1NF0A 1YADA 3LCWA 5HMEA 4UQAA 3R2GA 1LYXA 1GQNA 2V82A 4HMEA 3CPRA 1EXBA 3NQDA 2VEPA 3TX9A 2NQZA 1GQLA 1AA1B 4HPJA 1KV5A 3E96A 1KB3A 4JFUA 4CQDA 3ABSA 1BPLB 3L65A 1BTCA 3VIKA 2OYKA 6TIMA 5FF7A 2J9YA 2J77A 4C1NA 4GQQA 3BCJA 4UQCA 3CZKA 5AN7A 4ZTYA 3MVTA 3ES8A 2RDWA 2OZ8A 1FX6A 1H7XA 2WBGA 1WZAA 1EJWC 4L6OA 2ZVIA 1TG7A 1KKRA 4DJFC 3NQ8A 4AFYA 3M0YA 4Q8WA 1K9TA 4DBUA 4I7UA 2PDGA 1SZEA 1HTIA 1UWRA 2DZBA 1CB7B 3LHTA 4QJ4B 2WKLA 2EAWA 3BGGA 1RJRA 1KNWA 1RJPA 4LW7A 4EPBC 3T2PA 3EWBX 3TMQA 1Q6OA 1TFVA 1UOKA 2V38A 2A6LA 1Q6RA 1WBHA 4F9DA 5HR7A 3LB0A 4L6DA 3EPOA 1H11A 4CQ8A 3EWDA 3K46A 3L5AA 3GDLA 2G4FA 1SM9A 4M7TA 4QDMA 2QULA 4ES4A 3KOYA 2Y5EA 3NTYA 1JZ7A 4GY0A 3C8NA 1ZBKA 5FJRA 3LV6A 3CUHA 4B9ZA 4RX0A 1E0VA 1HGYA 3DI1A 1NARA 1F4HA 1TJRA 3WQEA 4IP4A 1W31A 4HQVA 4O0ZA 3MJYA 2ZYFA 1NTHA 4UC5A 4AD5A 4RUBA 1UD2A 3V5FA 3UXAA 2WWDA 1NWTA 4NJJA 4NZFA 4XTDA 2DV0A 2E09A 2OWXA 2QGYA 1UP2A 3M5ZA 3AI0A 5M1TA 3AQUA 3G0UA 3PY2A 1U30A 4DYKA 3U5UA 4I9JA 5AHLA 1UIOA 2BVTA 3RMEA 1VBHA 1E0UA 1R5YA 3BG5A 2QHAA 3U2CA 4QBXA 1W6TA 4B5NA 4AZCB 4AIOA 3UD6A 1AK5A 4QEHA 5DO8A 1EB3A 2NSOA 3DXIA 2ZXDA 2WYSA 2XH7A 2FJUB 3FHQA 2YXXA 3SRKA 1Q8JA 2VM8A 2IQDA 4LTSA 1IR1A 2XVGA 2DUZA 1QNSA 4JTUA 3RCYA 2PZNA 2NXHA 3THUA 3ITLA 3N15A 1XYLA 4HU4A 2EBNA 2A7RA 3GYCA 2VURA 1JQVA 3ME3A 4WF7A 3UG3A 1NSJA 4UTTA 5FJUA 3T0TA 3MO4A 3EMQA 4KERA 4M8UA 5K9CA 4IFRA 5AC8A 2E4TA 1KCLA 2H9AA 3N18A 4UQEA 5I6SA 3W74A 3F03K 5BMWA 2VMFA 3XIMA 4WDXA 4QM1A 1DQWA 2BHZA 3P3BA 4LVFA 3TJIA 3D46A 5B7ZA 3HMJG 4KFNA 3O06A 3JVAA 2HV5A 4M6QA 3OB8A 3IJLA 3QZ6A 4CN1A 1YTKA 1DJNA 3W2NA 1X8CA 2NQLA 5CZTA 4TV5A 3VK5A 2GDVA 3G0XA 3PK7A 1H1NA 2XM2A 5IRPA 3UR8A 3OZMA 4W88A 1RZMA 1DE5A 4MKVA 4MKNA 3SN1A 1GZJA 2WMIA 3M0MA 4PFMA 7A3HA 1DP0A 1N2VA 1HFBA 5IFTA 1WDDA 1XDLA 3R1ZA 4CD4A 3WIJA 2OCZA 6ENLA 4UXDA 1JCYA 3LHZA 5AVHA 1QT1A 2VX5A 3GNXA 1D3CA 4JTQA 3V75A 3V7PA 4G7EB 3AIUA 4Z2LA 4UTIA 3CQIA 1VJZA 2BP1A 3PSWA 2O7SA 1JD7A 4O0QA 2OYMA 2VQTA 2HE5A 4AEOA 3A3WA 4YTQA 2WZTA 1KXHA 1IV8A 4NHVA 3SQSA 5HR6A 3W01A 4EKJA 1DJQA 5DANA 3BSMA 2XIQA 4GPNA 4W84A 4IIBA 3WLPA 4Z2KA 5FCZA 1UR3M 3APGA 4L4OA 4G5DA 4LVAA 1ADOA 2YW4A 3H2AA 4FOUA 1R3VA 3W1XA 1E71M 1YTEA 5I24A 2X1RA 1WDSA 5E6YA 1TIMA 3FAWA 2VHLA 3W7RA 1U2YA 2QJNA 2RDUA 3S9ZA 3GTIA 1JPMA 4O10A 1V0KA 4RK8A 1RALA 3M5XA 1H49A 2CIPA 3N9RA 1A0EA 4P7QA 1R9YA 2RJGA 3RU6A 1NFPA 3BOLA 3FVDA 3O05A 4US6A 2D2HA 4MJZA 3R7MA 5AC4A 3M5VA 4YLWA 3PBGA 3BDKA 3MKKA 1S5VA 5D4YA 5CBJA 1VCFA 4X9SA 3FYPA 5A2BA 5IM51 5E9XA