2HBVA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 124
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbvA00
4GX9A 3MDWA 4C6MA 1S3TC 1W1IE 3NURA 4HA0A 2DVUA 4DLFA 4JOMA 3T81A 4H9MA 1I0BA 4DYKA 1PO9A 1PSCA 1HZYA 3GG7A 1K1DA 1KRMA 2GWNA 4HK5A 4DIAA 1NDWA 2OGJA 3DUGA 4H9XA 4ERAA 2Z24A 4G7EB 2WJEA 4PBFA 4IFKA 4XAYA 2WM1A 1POJA 4LH8A 2ICSA 4QS6A 4RE0A 4CNUA 4GBDA 4C6JA 3K5XA 2ANUA 4QSFA 2Z2BA 4RZBA 4V1YA 1O12A 2GWGA 3G77A 3CAKA 3S2JA 4QTGA 1A5LC 2VM8A 4J5NA 3AU6A 1FWHC 4LAKA 4GYFA 3RN6A 3E74A 4C6IA 1E9ZB 5LXXA 4KERA 4XD4A 1E9YB 5A6TC 4KEVA 2A3LA 1EJTC 4BKNA 2EG8A 2P53A 4GY1A 1YBQB 4BY3A 4IGMA 2FTYA 3MSRA 4C6BA 2E25A 4KETA 2R1PA 1NFGA 2DVXA 2CZVA 3TNBA 4ZSUA 3NEHA 3LNPA 2HBVA 2YB1A 4YIWA 3E38A 3S2LA 1FKWA 2F6KA 4M51A 3GU9A 4LALA 4RDZA 1ITQA 4C6PA 3GTFA 4BJHA 1I0DA 1NDYA 2O4MA 3IJ6A 1PB0A 3AUOA 1FWDC 1ONXA 4IG2B 2Z27A 2R1NA 1FWEC 4PBEA 2BGNE 3E0LA 1YRRA 1RA5A 3URAA 2Y1HA 1YBQA 3ITCA 3OVGA 3V7PA 1FWIC 4KEUA 1YMYA 3UPMA 2D2HA 2D2GA 1QXLA 4R7WA 4RDYA 1NDVA 4KESA 4C6LA 4XD5A 2OOFA 2AQVA 2ADAA 5FSDC 2Z2AA 1KRBC 4WHBA 3B0YA 1VFLA 2FVMA 4LCRA 2YXOA 4CEXC 3F4DA 4LCQA 4HK7A 1FWBC 2BB0A 3EWCA 1V77A 3KM8A 2Z28A 1EJWC 1R9XA 1EJXC 1XRTA 4IGNA 3LU2A 4C5ZA 4LCSA 5HMEA 1FWFC 3HM7A 2VC7A 4OFCA 1R9ZA 4AQLA 2YB4A 1YIXA 1UIPA 4C6DA 4EPEC 3IGHX 4G2DA 3WYZA 3C86A 3QGAC 1A5MC 4QROA 4B92A 1O5RA 2PUZA 3MKVA 4C6EA 4C6OA 1XRFA 4ERIA 3CS2A 3NQBA 4LANA 3DCPA 4H01A 3GTIA 4DO7A 4E3TA 1V79A 3IARA 4H9YA 4XD3A 1P6CA 3PNUA 2GOKA 1POKA 3MJMA 3URQA 4DNMA 4DLMA 4I6KA 4IG2A 3GU2A 3O7UA 3FDGA 4EPBC 1RJQA 4CQBA 1EJVC 4NG3A 4XAZA 3S2MA 2HQAA 3LA4A 2QS8A 4C6QA 4GX8A 3URNA 3PAOA 3TN4A 1QW7A 3GIQA 2Z25A 4IH3A 3A3XA 3EGJA 2R1KA 2R1LA 1A4MA 4L9XA 1RK6A 1ADDA 2D2JA 4IF2A 4GY7A 4XAGA 3IV8A 4XD6A 1KRAC 1WXZA 1ZZMA 4PCPA 3B0XA 2I5GA 4F0LA 3IRSA 3B40A 2EG7A 2OB3A 3FEQA 2HPMA 1GKRA 1YNYA 1RJRA 3O0FA 1EF2A 3QY7A 3MDUA 3GIPA 1UIOA 3ID7A 3T1GA 2GSEA 2KAUC 3WMLA 3LGGA 3LGDA 3ORWA 4RDWA 3S2NA 1A5KC 4I6VA 2VUNA 2W9MA 2Q01A 4AC7C 4WGXA 4WVXA 3HTWA 3D6NA 3F4CA 4ICMA 1A5NC 1J6OA 4Z42C 4GK8A 4CQCA 3F2BA 3RHGA 4H9TA 3T8LA 2IMRA 2E1WA 1XGEA 3UF9A 3MVIA 3UR2A 4EPDC 4C6NA 3OJGA 3GTHA 4DZIA 4KF1A 3QY6A 3K2GA 2Z26A 1DPMA 1M65A 1A5OC 4IFKB 4H9UA 4V1XA 4CNTA 2Z00A 3E2VA 4G7EA 1FWGC 5CH9A 4H9ZA 2YZ5A 3MVTA 2Z4GA 1ITUA 1J5SA 1V51A 1IE7C 3MPGA 4IFRA 5AKQA 4J35A 3SO7A 2WJDA 3E3HA 1P1MA 4LEFA 4MUPA 1R9YA 4LAOA 4J2MA 1KCXA 2RAGA 3S4TA 3UBPC 2Q09A 3N2CA 1A4LA 4R88A 4CEUC 3PANA 1K70A 4R85A 1M7JA 3JZEA 2VHLA 3DC8A 4KIRA 3GRIA 3GUWA 3F2CA 2PAJA 4ERGA 1P6BA 5FSEC 4DZHA 1RJPA 3QGKC 4TQTA 2WJFA 3OQEA 3OOQA 2O4QA 3R0DA 1RAKA 4QRNA 2QPXA 2R1MA 1PTAA 3URBA 4C6CA 3HPAA 4B91A 4NP7A 2VR2A 4GZ7A 4HK6A 2EG6A 3RCMA 4P5UA 2VC5A 4GXWA 2HPIA 2FTWA 3GU1A 4LAMA 4UB9A 4IQJA 1BF6A 2OODA 3SFWA 1EYWA 1FWCC 3GTXA 2GZXA 3RYSA 1EJUC 2P50A 2QVNA 2HBXA 3A4JA 4L6DA 4GY0A 3LSBA 3K4WA 3MTWA 3IACA 4KEZA 3AU2A 4C60A 4F0RA 3LS9A 1K6WA 1GKPA 2FFIA 1GKQA 4LFYA 2Z7GA 2XIOA 3A3WA 2UBPC 2PGFA 4IFOA 1XWYA 2AMXA 5E5CA 3LSCA 2AQOA 1FWJC 4QS5A 3WZ0E 1J6PA 3OU8A 4C6KA 5HMFA 1WXYA 3TN5A 1V4YA 2UZ9A 4ZSTA 3OODA 4GC3A 1KRCC 2Z29A 1UMLA 4C65A 3TN6A 4EP8C 2G3FA 2FVKA 4C6FA 3BE7A 3ISIX 4KQNA 4PCNA 1EJSC 2PLMA 3PNZA 1FKXA 1J79A 3CJPA 4B90A 4INFA 3LY0A 4UBPC 4C5YA 4F0SA 4CNSA 4RDVA 3E0FA 1RA0A 1EZ2A 4NI8A 3TN3A 2DVTA 4H9VA 2PGRA 3EWDA 4H00A 3QY8A 1UBPC 1JGMA 2ZC1A 1RK5A 4HJWA 2HNHA 4XAFA 4GOAA 1V7AA 1ONWA 2I9UA 2OQLA 5G4HC 3UR5A 1NDZA 3PBMA 4D8LA 3ICJA 2QT3A 5HMDA 1FWAC 1EJRC 4EPKA 3F2DA 3FDKA 1M68A 4CQDA 3IPWA 4DI9A 4B3ZA 4DI8A 4PE8A
chains in the Genus database with same CATH superfamily
3RM9A 3MDWA 2GQAA 1OX5A 2FZ8A 2X16A 1B3ZA 3WNNA 2C0AA 3FGCA 5JUVA 2PP1A 1E73M 1W54A 1ZFJA 5GJMA 4WY0A 1B3VA 3C2EA 3QMSA 5CGQA 1X7FA 4LAZA 1H62A 4C6JA 4Y6GA 3K5XA 4D6JA 3NTYA 4OE7A 3NSMA 1OC6A 2X2GA 1XKJA 3DC0A 1VC4A 3G77A 4BA0A 4JR5A 2QUMA 4Y2WA 1IZCA 3LD5A 3WEMA 4LU0A 2IUZA 3RILA 3AU6A 1WKEA 5KZDA 2CETA 1TA3A 1G01A 2QUVA 3EDEA 3NQ2A 1LDCA 3B8DA 3A13A 5D30A 4MB1A 4QGCA 3N4AA 5MKGB 1I2NA 1JYVA 3SUTA 1B2YA 2QCHA 2IKJA 1I2OA 3D3AA 3IAPA 2X0HA 3R12A 4TV5A 1NU5A 4ZSUA 2Q8LA 3FK4A 1PHWA 4RL3A 1PX3A 3O0KA 2NT1A 1ZB5A 1REQA 2QZRA 3C2RA 1ITQA 4OECA 1YNQA 3WLHA 1UZHA 2A7RA 1TX2A 4UWMA 4O11A 2ISFA 2OMAA 1RA5A 5D9NA 3THQA 3UFYA 3CQIA 3V7PA 1WYIA 3PZGA 4PB5A 3WDQA 3M6YA 4XV0A 1ZJIA 4G7FA 1NDVA 3TH6A 3KBSA 1V6UA 3NQ8A 2XIMA 2GL5A 1F5ZA 3VCCA 4NI3A 4GYJA 1EHNA 1W6TA 1QWKA 1FWBC 1H0GA 5C0QA 3R94A 6TAAA 4HSHA 1V03A 2EJAA 4ATLA 3PN8A 3LU2A 1XIBA 4C5ZA 3M5XA 3OA5A 1KNWA 4Y9MA 2VDIA 2ZKMX 3H2FA 2BVDA 2GQ8A 3NA8A 1S2UA 5I6SA 1IEIA 3CHDA 3TYUA 1W9VA 3BURA 2WMIB 3WUGA 2PTWA 3BICA 5B80A 4MYXA 1MW0A 1LBFA 3STPA 2X05A 2VDGA 1JRCA 1VYRA 1UWAA 1BQCA 5E9AA 1GZJA 2GJLA 5CPLA 3W1NA 2O9RA 1PWMA 2PDMA 3H7RA 1VCGA 4Y96A 3QFEA 5BOEA 1QOQA 5D9MA 1YDOA 1TWSA 1X7IA 1LBLA 2A0NA 1GG1A 2QCNA 3L21A 4AF0B 5JH1A 3UNDA 2Z0IA 3WDJA 3IJIA 4ROQA 2R9RA 4DUWA 3G6LA 4L4MA 1NY1A 1YNPA 2C8NA 3SJNA 2D24A 3TR2A 1OFEA 3QYQA 4F2UA 3II1A 1YTEA 3EDDA 2ZX7A 4FS9A 5EA9A 1G4PA 3WQFA 3TQKA 3QOKA 2OEJA 3ARXA 3D0CA 8XIMA 1GKRA 4JYEA 3R58A 2OYKA 3KZSA 2QUUA 4GUIA 3W23A 3WLSA 3S3GA 3MHUA 3ZWTA 2YBUA 3VD9A 3ZLFA 4AZBA 4MJ2A 2J9YA 2C18A 4QITA 3QZAA 1OF6A 4FALA 4BK9A 1YPXA 1W9UA 3I68A 3H24A 2E7FA 3KE0A 3MQTA 4W7UA 1LUCB 3ERPA 4M56A 2IMRA 3WMSA 3AHYA 3ZWSA 4EX4A 3MUXA 2Z26A 1DPMA 5DY2A 3W7PA 1W9BM 3TXVA 2GSHA 3IUHA 1FFQA 5CLTA 3FFSA 1V51A 1NSJA 3TQPA 3OVPA 3SCOA 1JCXA 3Q2DA 1HTIA 2R91A 3CWNA 1KM3A 3WQ8A 4HIBA 4LUSB 2BGQA 1A4LA 4IWWA 4CEUC 1KTNA 2WVSA 5D38A 3V3WA 1M7JA 3JZEA 4KIRA 2H3DA 1TWWA 3G0UA 3I4EA 4ML9A 3UP8A 1BFNA 1UD2A 4WEVX 1HT6A 3OOQA 2VCBA 3N2TA 4RNHA 1HP4A 2X7VA 3FJ4A 2Y63A 2WAGA 3B4YA 3EWXA 3BPWA 2BXYA 1ODZA 1E71M 5E0FA 1B3OA 2QW5A 4NU7A 1CLXA 3AMGA 3J7HA 4AIBA 2WK2A 1OK6A 1K6WA 1G7VA 1XISA 1VFFA 3L0KA 1MI3A 2CLFA 1EPXA 1FXQA 3SADA 2BOFX 5KETA 4QS5A 1R5YA 2HEJA 3GR8A 2VEIA 2PMQA 4H2HA 4M24A 4C6KA 1XSIA 1WXYA 1NIUA 1TVLA 1XDLA 3WF4A 4IPLA 3QV6A 4AU0A 2PB1A 4ENLA 3P8IA 2A6NA 4LC8A 2ASHA 3WBEA 3UZZA 4E2BA 4DXKA 4Z1DA 3PAJA 3QTPA 3CMGA 3E0FA 3AXKA 4H7CA 2DZBA 3EWDA 4H6KA 2Y2WA 3HU7A 5DRIA 1GQKA 4GZEA 1SFSA 1XH2A 1ISXA 5I06A 2ZZ1A 2RHGA 1X1OA 1MW3A 4RV8A 3OIXA 5F7UA 5HMDA 5AFDA 1FWAC 1Z3NA 3LZ3A 1A49A 2A4AA 3PUDA 2ZX9A 4Z0SA 4NAFB 1J0IA 2GVJA 2XVPA 4QM1A 5H8MA 4GH1A 2QLYA 4QJ4B 1XYMA 5FAGA 3W00A 1XGDA 5LHFA 3WMCA 5CG0A 3GG7A 3EA3A 1KRMA 1XQLA 4HK5A 2ZVRA 2OCZA 1KTBA 3NDOA 5C9RA 4KWSA 4MWAA 2BODX 4CNUA 1KM6A 3V5OA 1BAGA 3VDHA 2PGEA 3EXSA 3S47A 5DQPA 5EBUA 2HNEA 3HIJA 3LOTA 2PEVA 1IHIA 4KIEA 1E9YB 1RPKA 1KFBA 2VFEA 1VP5A 3TA6A 2Y61A 4NXSA 4WXYA 1NF7A 4S3KA 3W87A 4HQVA 4DXXA 5I0DA 1X6NA 3BJSA 1HIZA 1LWJA 2CZFA 2ZUNA 4AY7A 5CKSA 1UR4A 5AYYA 3BG9A 4O1CA 1UOKA 1LLZA 5C5YA 3N34A 3G2GA 3SY5A 2O0TA 3NXLA 3G1DA 2OZ8A 4G1KA 1TWDA 2X42A 4AIOA 1X38A 4AIEA 1Q8JA 5FJPA 3GE7A 3HO8A 1V7YA 3PBUA 1FWIC 4FZIA 3AXHA 1GWJA 1DWFM 4O0QA 4O28A 5FEZA 4H83A 1S1PA 1SZEA 2NLIA 3ALGA 3WJWA 4CCZA 4DX3A 1E15A 1GQIA 1DQWA 4NKCA 1VCFA 3ZR5A 1Y5WA 4UMBA 1Z48A 3BAJA 3VIJA 2DZAA 1VH7A 2BHYA 1TPVA 3W24A 4X0VA 2NUXA 2YOCA 4TX9A 1H61A 3NEVA 1FCVA 3UD6A 1L8PA 4YL2A 3WJSA 2J8TA 4EPEC 5I77A 2D73A 2DFAA 1W91A 4IMFA 3MBDA 1ZENA 1X8CA 1Q4WA 2YA1A 4ECLA 1V79A 2IS7A 1G0CA 4WJEA 1XIEA 4UCGA 2GK1B 3W0KA 4DNMA 3ZJKA 5AYIA 3FAWA 4Z2KA 4E0CA 2FYMA 1OFQA 4M6QA 1E4MM 1EX1A 4W9TA 4RZ6A 4WJXA 4C6QA 2BG5A 3FYPA 3UG5A 2BXZA 5TF0A 3FNDA 1SVDA 3LMYA 3U5UA 4JIHA 2XDFA 1RK6A 5HNNA 4I3GA 4O8RA 2POZA 3TSDA 1XFBA 2ZVIA 2XUCA 3GXTA 2WPBA 3L9CA 3QZEA 3SB0A 5FF3A 1GVFA 2D3LA 2PDQA 1PTGA 3CUJA 4MMWA 3CTLA 4GXPA 4HCDA 3O0FA 3QSRA 4RE2A 2XIJA 3T1GA 4MZYA 3LQGA 4FOUA 3LGDA 2FVLA 4BI5A 2CLPA 1LLOA 1MW2A 4L4LA 5AZ0A 3KVKA 3RMJA 4B9ZA 3KS6A 3QSTA 2WQDA 4Z42C 3VDCA 3O1NA 4H9TA 3WJXA 1IT8A 1BYAA 2FDMA 3UF9A 3MVIA 5XIMA 5PTDA 5E1QA 1E0XA 3OJGA 1H1YA 3O06A 1EUNA 3LI1A 3M64A 5BW6A 3UCCA 3CGTA 2IKHA 4GYPC 3PBVA 4NZJA 2J6VA 3PFRA 3AZTA 2YBTA 3MVTA 4KW2A 3CH9A 4DEFA 5ECUA 4IFRA 5AKQA 1WA3A 5BOFA 3QM3A 2EJ1A 3RMEA 1RVGA 4F2BA 3K30A 4JTSA 1EA9C 1V5XA 2ZUSA 4ZL1A 2QIWA 2FH8A 3QC0A 4W93A 3T08A 2V81A 4OOZA 1BTCA 2PU1A 3M16A 1Y8BA 3URBA 2PBOA 3OQ8A 5EB8A 5LGZA 3B3DA 5U7SA 3KZPA 2A5HA 2Z1WA 3DFPA 3WL1A 3NG3A 3PY2A 3UGRA 2G4FA 3W76A 2OXNA 3VM5A 4A8IA 1T5AA 4IPNB 4JFVA 1EWDA 3VOJA 5IXEA 1W1A1 3IACA 3AU2A 4H8VA 4C60A 4O4VA 2Y89A 3MV01 3LCHA 4CQ8A 4FHAA 3B8VA 2FFIA 1OT1A 1V8EA 4K36A 2FJKA 4DBWA 1ZBCA 2YCJA 1KGXA 3TC3A 3W1TA 1K4HA 3GH4A 4W88A 2CLLA 3ZT6A 1EGZA 4IJBA 1SU5A 4RJEA 4CU7A 3LK6A 1ZALA 2V38A 1CB7B 1R6WA 3EBVA 2UY3A 1J5TA 4UTFA 2EAWA 1KM0A 1A5UA 1AJ2A 4K38A 5TQLA 1W3NA 5LKYA 2G0WA 2E6DA 1R47A 1Z6KA 4NZ4A 1RA0A 4ADUA 5A6JA 3VI2A 1Z32X 4GQGA 4I5UA 5AVHA 1UBPC 3AHZA 2HXUA 1HL2A 1QO5A 1YADA 4WR3A 1DQXA 1OX4B 3T42A 3D47A 2WNWA 2A3EA 1WAWA 2POTA 3AZSA 1WUFA 4V15A 5T26A 1XLFA 4A6GA 1W31A 1Z41A 1BXCA 3B8SA 5HQEA 5KEZA 3WK0A 3QV7A 5A69A 3XISA 2NXHA 3EB4A 2FMOA 5H2ZA 3AWOA 4UQEA 4XG1A 3NO5A 2GWNA 2IPJA 3HJZA 2OGJA 1WKFA 1H5VA 4XAYA 5EY5A 3W7NA 3W7OA 1RPXA 1SFLA 4MTVA 3VE7A 4IXXA 2GWGA 5DELA 5E0KA 3S2JA 2YDQA 5M03A 2JEQA 3WK2A 1VFUA 3CO8A 1VQTA 3BZGA 4O1FA 4G56A 3GH7A 3RDKA 5CSSA 1WUEA 4A8NA 3W70A 2TODA 1JYWA 3N19B 1ICSA 1W3IA 5GQBA 1TSIA 2LLEA 4HB7A 2VOTA 4YMZA 1FHUA 4JX5A 1S3HA 3S1WA 3INPA 5K2ZA 3UVAA 1LRTA 2ZX6A 3PTMA 2HDJA 2WZHA 3B8TA 2CWNA 1JEZA 1JG9A 1M9HA 3S1GA 4JQ2A 3V5CA 5BOOA 1X96A 3OB8A 3RJYA 2VEFA 3UVIA 3QZ6A 1XC4A 3MMDA 2IKIA 3C2FA 4CVWA 5D03A 5CGMA 3ITCA 2J25A 4OT7A 2YJQA 4BS0A 5LGXA 1WBHA 4HA1A 2CHNA 2QPUA 5EFFA 2O9TA 2ACRA 4LCQA 5D4YA 4HMDA 2XSAA 1NAL1 4TO8A 1RQEA 3HGJA 5IBXC 4JTTA 2X0SA 4AQLA 3NZGA 2PGWA 1Z9AA 1TV3A 3HG5A 3HQ1A 2IXVA 2D2OA 3HBLA 4L4OA 1UIPA 1SO6A 3IK2A 1HGYA 4ES4A 4GI8A 3VOFA 1PL9A 1AQMA 5J8LA 3NQBA 3PM6A 1RXOB 3W7QA 2XYLA 1UH2A 2NXGA 1RLDA 2WWCA 5CAKA 1UC4A 1ONRA 4IM4A 4GPNA 2Y5SA 3PNUA 1I8JA 3R13A 2GOKA 3P61A 4OHQA 4GACA 3LEPA 3AC0A 1YDVA 5DANA 3CB8A 3IRDA 3GK0A 4GLEA 4NG3A 3AIWA 3C2YA 5JXQA 2W61A 2OQHA 4PGLA 4OGZA 2QULA 4J27A 2YX0A 3B9EA 1OVDA 3QW3A 4X0NA 3BMXA 3KOFA 3DG3A 1DJXA 1ME8A 1KRAC 1F7BA 3H4XA 1UW9A 3ITYA 3PPCA 4JKLA 5C7VA 4P2VA 4Y90A 3VU2A 4CQAA 1ZTVA 2HPMA 3TW9A 2A3BA 1ZAHA 1W32A 4DO6A 1LWIA 1S1RA 1OGSA 4OU1A 3Q67A 3GO2A 5HATA 1JVNA 5KZMA 2YZRA 1F07A 4KWWA 4H8NA 3W2LA 5FKYA 3T40A 5CLWA 2INZA 1W17A 4C7GA 1TIMA 2CXGA 1EO7A 3TWAA 3PTDA 2OWCA 4WY0F 2QCCA 3FVMA 4RNIA 2HJPA 3N2OA 2E8YA 4PMDA 5CZJA 2CBIA 2XU2A 1FWWA 1XLJA 2XN1A 1LWHA 2F8QA 5CPTA 5EMMA 4R85A 3PBYA 2O56A 4KH2A 4FLSA 1H7OA 2G3IA 4GD0A 3VGEA 3QV9A 2Y5JA 5CZKA 3IUIA 3JS3A 1PKLA 2DT2A 2NSOA 4AZGA 1KKRA 3OHIA 1LL7A 1N8IA 4UB9A 1CXIA 3E6EA 4KKXA 4LBSA 4MYAA 4XISA 1US3A 4PUUA 3ONCA 4L6DA 2ZE3A 2YFNA 2ISDA 3REQB 2CBUA 1NF0A 2ZUTA 2WO5A 2C16A 4IIDA 1Q3NA 3ZR4A 3VUPA 5FJRA 1UUQA 3DFTA 2J7HA 1AODA 5I78A 1MWOA 4IFOA 5EYWA 1V3JA 3WZ0E 2CFFA 3GR4A 4M19A 1Q6DA 1BVWA 1LQAA 4ZO9A 2GJNA 1CIUA 1GW9A 4QFUA 2CC0A 3UG4A 4CGTA 3ZJ8A 1QOPA 4FNRA 4B5SA 5HMSA 4HYRA 1DORA 2WM0A 1KLZA 4B90A 3PUGA 2OZ0A 4IIEA 3MP5A 3E0IA 4ALDA 4M6UA 3DHDA 1LOQA 4GNVA 3PS7A 1JPKA 3GBDA 4GVFA 1LRQA 4QNEA 1JGMA 1NELA 4XO6A 1GJWA 2WSPA 4HPXA 2WHJA 2BVWA 4KRTA 2ZTJA 2EPMX 3N1AA 3PBMA 3T0DA 1TKKA 1BLIA 3QMRA 4V28A 4EPKA 3F4NA 1OFDA 2CIPA 3GDLA 4J3UA 4N02A 2OSWA 4PTWA 4ATWA 1F61A 3H2EA 2QV4A 3CIVA 5CXPA 4FI4A 2OKOA 3W1RA 1YW1A 2O9OA 7REQB 4Y9OA 2WWDA 3LHYA 3KRBA 1TVNA 1TPDA 2YIHA 4KWVA 3S9YA 5I3GA 2W91A 4PC8A 1RBLA 3NIYA 4ZEPA 2Y6ZA 3TONA 2H6RA 4QJ3B 4QS6A 2QF8A 2PDHA 4A3QA 3DHFA 4PH6A 1BEUA 1J0JA 3MV11 4S3AA 4PUJA 4ILSA 4M5PA 3DI1A 1E6PA 1DTNA 1EPVA 3NVDA 5DXXA 4M7SA 5CJNA 4PFHA 2INFA 2YA2A 3RAOA 5DMLA 2DZVA 3C61A 3ZMRA 1PBGA 4HTBA 4F0KA 1C90A 1IIHA 2GYIA 3KTSA 1IEVA 5D2VA 1TE6A 2XH4A 4MFEA 4B5WA 2JIEA 2WHKA 4GUGA 4LVGA 1SFJA 5G2WA 4F9DA 5CZSA 4AEEA 3W71A 4ZTYA 1R3VA 4QHRA 1UJPA 3VIFA 1L6GA 3PHAA 4JQ1A 3WD2A 4WGHA 4LALA 3W2MA 3T44A 1RD5A 1R3TA 3DX5A 3OZMA 5I07A 1V6XA 3QV8A 3BANA 4DO4A 4J3XA 2VURA 2Y1HA 4GFIA 4G6CA 4GRSA 3W1PA 1G9HA 5IBXA 4DHGA 1KLYA 4JN7A 2D2HA 1JQVA 4R7WA 2AL1A 3H8AA 2HVOA 2ZYFA 4CU8A 4N7QA 2AQVA 1QI2A 1LG1A 1LLWA 3QXBA 3FIGA 3OO2A 1AMYA 4LNCA 4US5A 1UP0A 1H51A 1J12A 3CL8A 1RALA 2XG9A 1M03A 4DAIA 2YA0A 5G5IA 1ALDA 1RQHA 3MYPA 2RDWA 5HMEA 4JTGA 1HJSA 3SCSA 5F2LA 1WDQA 3A12A 3N14A 4JTAA 2ZRWA 1TTJA 4IQLA 1U5VA 4GWEA 4IX2A 1B54A 3RLUA 2PDIA 2BASA 3NCOA 2J7EA 4QROA 1LOSA 4LX4A 3ARTA 3MUAA 4FNQA 4AY8A 1EH9A 1UASA 3W29A 3P93A 5DCEA 3F5JA 2NXIA 1PYFA 2Y8UA 3NZRA 2REQA 3RLGA 1V3LA 3PJXA 1AZ2A 5C2CA 1POKA 3PWAA 4GO8A 3W7MA 1J96A 1QVBA 5C54A 5J5DA 4HNCA 2J88A 1YDYA 4AZ5A 4AZCA 1YTDA 1LT8A 3PAOA 4XWUA 2PURA 4UR8A 1G5AA 3NQVA 1BYCA 1KFLA 2WMIA 4DPQA 4JX4A 3STEA 4W7WA 4IF2A 1D8CA 3IIVA 3TQVA 4AX6A 1PAMA 2BGSA 3K4AA 5C9WA 4NJGA 8TIMA 2VZTA 1V0MA 1K7FA 5GPRA 3G22A 4X9SA 5HQMA 3N12A 1BG9A 1J93A 5DX7A 1SSGA 2J66A 2WSYA 2C14A 4P7NA 4PULA 1PE1A 1JXKA 1CGVA 5ECVA 1EEXA 3FAXA 2R24A 1IXOA 3GQYA 4J3SA 2QXWA 2WCAA 5CZ0A 1FP9A 2Q01A 4FX7A 5AN7A 1B4KA 3HTWA 3L65A 2DPEA 3N25A 3JU2A 4HZ6A 3PZUA 4E4FA 4NVTA 1R8LA 3F2BA 1S5VA 1VKFA 5I7GA 1V3KA 4QAIA 1ZCOA 3CV2A 1JCYA 4ML4A 3GKFA 1IF2A 4IMCA 1EO5A 3TJLA 2GQ3A 3TIMA 2ZRXA 1RD6A 2Z1KA 2WC3A 1K02A 4XQ6A 1JDCA 4K2SA 2BVYA 1ITUA 1IE7C 3CAQA 1S5TA 3ZQ9A 4MUPA 5A8GA 1J2WA 2Y5EA 2V5BA 4IPIA 4MB3A 4D1JA 5C8BB 5E93A 1O94A 3S4TA 3SSJA 4R88A 3MB9A 2QAFA 2TMDA 3N73A 4FLOA 3VFLA 1XV8A 4ICNA 3VGFA 4G8TA 3KVMA 2IQTA 1WKYA 1FWNA 1KCKA 1OFPA 1QDSA 1T8QA 3DG7A 4XUGA 3TZNA 2YCKX 1XLIA 2FPYA 3WLNA 4US5D 5FD0A 2BDQA 2OODA 3SFWA 1FWCC 4GJ1A 3GTXA 5K9DA 2Q71A 3A4JA 2E40A 1VHNA 1VLIA 2AKZA 3LV6A 3M5ZA 5HPOA 4L80A 3AXMA 4HOZA 1M5WA 3QPYA 4ZR8A 3LSCA 2AQOA 1DEDA 1UD8A 3BLLA 4GXMA 4ZB5A 2ALRA 2AL2B 2UWFA 4PMYA 1V4YA 1KRCC 2Z29A 3O3RA 3MHGA 2I16A 1WO2A 5I24A 1ZLPA 3WJYA 4MAVA 2OT0A 3P2VA 1J10A 4FX8A 2H9AA 1ZJHA 4UCFA 1JCLA 3H26A 5KITA 2G3MA 4CNOA 3BG3A 4XTIA 4JIPA 3AHXA 3UU0A 4U2YA 2J9ZA 4UXDA 3AUJA 4NI8A 2QJNA 3AIVA 3AWNA 4FX6M 3UT0A 3R10A 7CGTA 1FQ0A 1F9CA 1ZS2A 1MEIA 5G4HC 1ONWA 3KW3A 4AHPA 3PPHA 2BY0A 4AB4A 3MP3A 1CW2A 3WLPA 2XN0A 1IT0A 2PDWA 3ITVA 1GEQA 1C8QA 4JPGA 4LRSA 4AIUA 1S38A 1EDQA 1EHAA 3R25A 1CXKA 3NURA 3TTSA 4US6A 5D9PA 2ACQA 4IHCA 2OO0A 3HB9A 2VC6A 5JBEA 1QATA 2GVGA 3L4WA 5LA1A 3SN1A 3Q4DA 2EPLX 4G7EB 1LCOA 4NZFA 2IPWA 4LUTA 2ICSA 1K7XA 4A3YA 3BW3A 4AWSA 3TU9A 3I3DA 5LNWA 4GJIA 1O12A 1QPOA 4S3JA 3EEZA 2XFFA 3STFA 3LRLA 4RXFA 3POCA 2GJXB 4KRUA 3O8AA 1OD0A 4PN2A 4L9ZA 1FCBA 1GCYA 4WKAA 2YXGA 1ZL1A 3ONBA 2V5CA 2RGLA 1XLGA 5CAHA 4EXQA 1U1JA 2HCVA 1PZ0A 3H7VA 4X60A 2ZCGA 2MANA 1FCUA 4JXCA 5ABTA 3A9BA 1J0HA 1C92A 3MSRA 2CZ5A 4HHMA 3VD4A 3A24A 4JQAA 2R1PA 5AC6A 5LYRA 2DSKA 2O9PA 4KGJA 3AROA 3S2LA 4L1GA 4W8AA 4ZMGA 1TTPA 4RDZA 4ZO6A 4Z1AA 1KD0A 1JUKA 1XYLA 3DH7A 3AUOA 4WLCA 3G1HA 4LRTA 1TV5A 3A9IA 1FWEC 2P0OA 5E6YA 2E67A 2OFJA 3E0LA 4QLJA 5GNZA 1NWSA 1BGGA 5A1AA 1X39A 4LT9A 2TPSA 1KXQA 2ZQ0A 2BXVA 1VS1A 3MKCA 4Z17A 4PEKA 3FSTA 3K4DA 1FWTA 2BX7A 3TK7A 2WNZA 3JVAA 2X1TA 1IR2A 2VZUA 4FR1A 3N9RA 4IMDA 3GH5A 4XZMX 3N04A 4HMEA 3UWUA 1Q7QA 6A3HA 1MRQA 1FWRA 1WP6A 1EJXC 4GIYA 3LTYA 3SUUA 3QFWA 4PCSA 4NJIA 1XJBA 2VC7A 4TMCA 2OZ3A 4NAFA 3USBA 1QPRA 1YEYA 1PX8A 3HPXA 1Q6RA 4DQWA 2C0HA 3AIRA 1XH0A 3V36A 3VNLA 1E1EA 2GJRA 5M2FX 1W2VA 3GX9A 3MSGA 4DF0A 4UMAA 1E1CB 4PYSA 2E5BA 4LY4A 3AZRA 2Q02A 4DJEA 4JEJA 2IKGA 1P6CA 4JFUA 3Q58A 2ZRZA 4AEFA 4ZOBA 1QHPA 1GOMA 4CQBA 3TAKA 4C1NB 1LORA 2Y8VA 1XLEA 3QC3A 2ZXQA 3S6TA 3LLDA 5AZ1A 3TN4A 4PB3A 3NQMA 2XH2A 3AI0A 3R7MA 2HTMA 1UMYA 4XD6A 3W7DA 3G6MA 3K8LA 2PCEA 3ARQA 3B0XA 1B0IA 3CQJA 2VOMA 4BR1A 3M0XA 4PSRA 4R5EA 3HURA 1MEHA 2VMFA 3BAXA 2OB3A 4RNFA 2P3ZA 3DXIA 1PEZA 3UERA 1PVNA 3BOFA 4NJJA 5CZTA 3IJDA 1RCXB 2V82A 4RDWA 4BI6A 4S39A 1F8IA 4LF1A 4DYEA 4WVXA 4Z08A 3WUFA 3NL3A 1J6OA 1PKYA 3CBWA 2QDHA 3LBCA 1S2TA 2P76A 3ES8A 1C29A 1EDTA 1JF6A 3BQ5A 1GZ1A 4O10A 2YXXA 2XZ7A 1DE6A 4H9UA 3E2VA 3ARVA 5FA5A 4GVGA 1Q45A 4GI4A 1SJAA 3C56A 3WUBA 1DOSA 4NF7A 4GQQA 3LCWA 4LEFA 3DYPA 5A6AA 4Q8MA 1R9YA 4ZA0A 1KCXA 1SO4A 3QGVA 4JD4A 1IQ8A 4W5UA 5HWJA 1M7OA 5I2UA 2OTDA 3DC8A 1XG4A 3F2CA 1EIBA 4ERGA 1P6BA 1FWSA 3CZKA 3OPSA 1YXDA 4TQTA 2XSBA 1AUSL 4HN8A 4X22A 1RAKA 1R3SA 2VR5A 3L12A 3EOLA 5A95A 1XR2A 3GXFA 4B91A 1PZ2A 1GTEA 2VRJA 3EYPA 4NP7A 4XTDA 3TFCA 2HMCA 3C0SA 1XGZA 2VI0A 4DWSD 1QBAA 3VC6A 1HXJA 4WSKA 4LF2A 1VPQA 1IXQA 4S38A 4C1KA 1F3EA 1HN1A 3K4WA 3LI0A 3MTWA 4ZO8A 5C7HA 5HINA 3GNDA 1KCZA 1VYSX 4KEZA 1UH4A 4AD0A 5AC7A 4A29A 1T99A 3CHCA 2JKPA 4FP1A 1W5MA 3W02A 3UQNA 3I7SA 1KXTA 1KGWA 1XWYA 4YVPA 2BBFA 3AXIA 4OVXA 3LCGA 4MJMA 5TNVA 5HMFA 2OOGA 2J7DA 3VIOA 2C91A 3S5SA 3GDBA 3M0ZA 3GHSA 4ZOEA 3HOJA 4KFPA 3F03K 3TX9A 4UQBA 4JCMA 4NHVA 5G1TA 1O60A 2VT0A 4N6EA 1K9DA 5EMYA 1DWJM 7A3HA 4KQNA 2RUSA 2PTZA 3LGEA 2JK2A 4UQAA 5K7JA 2W4XA 1HO1A 3SQMA 1SJCA 4N6FA 2BZNA 3WK1A 3ZYZA 4O0ZA 2CKRA 3CB3A 1Q4NX 1B57A 2NQJA 3PB0A 5I23A 2XVGA 4KMQA 3O2LA 2VNCA 3EX6A 1VLWA 2PDXA 3W7JA 3HQOA 3N6JA 5CPMA 3WF2A 1NDZA 2QT3A 4U10A 2B7OA 3FHAA 2ABAA 1EJRC 2HSAA 1UHVA 4IISA 4DI9A 3FJLA 4X3ZA 4CLMA 4Z1BA 1OINA 1Z7AA 4A22A 2PLJA 4HA0A 4AY1A 4QCEA 3NL5A 2YSWA 5A8QA 3TQ0A 3HPZA 2VGBA 3TXZA 4JYFA 2Z24A 1UCWA 2WJEA 3IUDA 4R27A 1NOFA 4RE0A 4DPPA 3PG9A 4IIFA 2NX1A 3JZUA 4K8GA 4JYDA 4H8HA 1H7PA 2WANA 2C6QA 3FXYA 3DECA 2PWHA 1QW9A 3BCFA 5LIWX 3K1GA 3OZPA 2CKSA 3RN6A 2QV5A 1PJ9A 1A3WA 3QN3A 1BXNA 5I3DA 1DJWA 2QJMA 1UQYA 1TTQA 1J11A 4TV6A 4WCJA 2OZTA 1OCBA 3ABOA 2XSXA 3O63A 2F2HA 1OWQA 4BY3A 2VRQA 3R8RA 2V3DA 3AJ7A 3UZXA 3TYBA 5DMNA 1W1YA 5CC7A 3SR7A 5JIWA 4NX0A 4KETA 1GPFA 4JQ4A 4AZ7A 3ZR6A 2J7GA 3B0VC 4HP5A 4MJZA 4E2DA 3LERA 1NP0A 1WZKA 3AO0A 2ZWZA 2P10A 4L6OA 1L0PA 5F1VA 4ATDA 3CASA 4KCUA 4UQ9A 1TJ0A 1CZ1A 3QF0A 1HVQA 4LC6A 1VFHA 1O1HA 1OYBA 2BGNE 3KTCA 1PUDA 5A6KA 7PTDA 2A85A 4CCDA 1UD3A 2PDKA 1QPNA 1TR9A 2CXEA 2A6LA 5KTLA 2V63A 2Y7GA 1WDSA 3AYRA 3UWYA 2ADAA 5EMUA 4MB5A 3WNKA 4HK7A 4FNTA 4F66A 3NPXA 4B2DD 3AISA 2W79A 3WDHA 4M1BA 3S1VA 1SO3A 1H41A 1QK2A 1XIJA 1DJYA 5A3HA 3ITLA 2DUXA 3VABA 4HMCA 2BMBA 1YIXA 1AW5A 3NNTA 1U83A 3QGAC 1TZ7A 3W7KA 4FOJA 1G1YA 4XBSA 3SUSA 5G1YA 2G3JA 3GTIA 3SM0A 3KDNA 2FGZA 3EAUA 4HU4A 5C55A 4JTUA 2NUYA 4L64A 1LYXA 2ESCA 2VFGA 1NM9A 2F6XA 3MMTA 3NOEA 3CV6A 1B5TA 2G95A 2CESA 1I45A 3P5YA 3URNA 1XYBA 1JGIA 2PSNA 4IH3A 4UFJA 1SFTA 3A3XA 4W4QA 2DEPA 1KM1A 1TO3A 2QPSA 4NNCA 4XAGA 2CITA 3P5ZA 2WQPA 1XIIA 1O5QA 1S2VA 2ZZ2A 4TR9A 2XGZA 4UFIA 1R7AA 7TIMA 3KCJA 2BP1A 2Y85A 1ONEA 1DHPA 2RDTA 1DKWA 5I3KA 5C2XA 1PDZA 5FJOA 1IIGA 2OO6A 1F2JA 1A5NC 4OWGA 3EMCA 1R30A 1XRSA 2VGGA 4LB3A 3WENA 4R7OA 3P14A 4DYJA 1NTHA 4DZIA 4L1XA 3OBAA 3GIYA 4KF1A 5LIUX 4JNZA 4IFKB 4CNTA 5LZLA 3RGTA 1TUXA 3RRAA 1QRQA 4UTMA 1I2PA 2Z4GA 1XDMA 4JHMA 1S2AA 4HPJA 4C7DA 2AL2A 3W1QA 4TVUA 4WKHA 3TOYA 4AMCA 1RH9A 1Q6EA 3G1SA 3VIKA 5HNTA 2CYGA 2VHLA 3GRIA 3P84A 3SBFA 4Q8OA 1VEOA 1TPFA 3DI0A 3T05A 3R0DA 1E55A 3WBAA 1IXNA 1XS2A 2F84A 2NQ5A 4Q33A 4L1WA 4M0XA 1OIMA 4J3WA 3ANYA 1W8SA 4IQJA 1P1XA 1W9XA 2MUCA 1YTKA 1RVKA 2NVAA 4D8ZA 1MXGA 3WLOA 1DYSA 1OT2A 5BXPA 3BZJA 2J75A 1OK4A 4O1AA 3LRMA 3GUGA 5HJLA 3MHFA 2JBMA 3W25A 4OBTA 4LBRA 1MVYA 1A0CA 5I79A 1FWJC 4D9PA 3HFTA 2VCCA 3CC1A 4C91A 4W86A 4WDXA 1XSKA 4ZSTA 3OODA 4GC3A 2OX4A 3AAMA 2GVYA 3M4HA 3VD3A 5IDIA 3MCMA 4ADSA 1SR9A 1LM1A 2FPTA 4QDPA 2XFWA 3NQAA 5EFDA 4C6FA 1AD1A 5IRPA 1N2VA 4AWTA 4AVOA 1GVEA 4TVDA 1XLBA 4UTWC 4MY1A 3I10A 1TPEA 1ITCA 3LY0A 2C1GA 1K7EA 4Q8VA 1DIEA 4CNSA 3WQ5A 2CLIA 2ALDA 1KGUA 3IAQA 3B05A 1UQZA 1JZ8A 2PGRA 3UZJA 1O95A 4LVFA 4S3GA 3TWBA 3QY8A 1Q7ZA 1OABA 1DQUA 4YU1A 2HRWA 3W1LA 2HVNA 3OIHA 5JH2A 4N4PA 2VFFA 1YDNA 3N29A 2GFTA 1WXJA 2OWXA 1ZAJA 1EXBA 3PUOA 1D8WA 3ZJ6A 2EQDA 2WHMA 2A79A 2JEPA 3O16A 4JOMA 4HU8A 5A2BA 3NPWA 3RK8A 1H5YA 4HT3A 1U30A 1K1DA 5CPOA 3E5PA 1W3HA 3OP2A 4GIRA 3BK0A 2EPNA 2QDDA 1NOWA 1ISVA 1ODUA 2YW4A 4K7YA 1TA3B 5TIMA 3S1UA 5D2XA 1WE5A 4BZYA 4GUFA 4QTGA 3TTOA 4IUGA 1X8FA 3D5HA 4NT0A 2XWEA 4LAKA 4LB4A 1LBMA 4J7RA 4AD2A 1UYQA 4MNLA 3VOHA 3G3DA 4EAMA 4QSHA 1BKSA 1P0BA 4Q4PA 4MKNA 1CEOA 1YBQB 2PTDA 4D8AA 2VCAA 5DMMA 1ZBKA 3H12A 4NAEA 2FKPA 2DZPA 3NO3A 4WSJA 3KHDA 6XIMA 2CZVA 3KXQA 3TNBA 2HBVA 3B9OA 1IZKA 1J18A 5CG7A 4EK7A 3HV8A 1K9EA 1VRXA 3W75A 1FKWA 2XH7A 4PMJA 1LOLA 3ABXA 3WLIA 2XIIA 2R1NA 3W26A 1XYAA 3VC5A 4D2JA 1KA9F 1LG2A 4LUJA 3OVGA 2VKZG 4PCFA 2DJLA 1C8XA 4KESA 2W3ZA 4YYCA 2OOFA 2RKXA 1MQRA 4S1FA 3GVQA 4CD8A 4PZVA 5LNVA 2GDUA 1VFLA 5F4SA 2FJUB 2V5LA 2V9DA 1ISWA 1XBXA 3U2ZA 2HZGA 1JPMA 4E4UA 3DYOA 3W82A 2AMGA 2Z28A 1XD1A 4O1EA 5FL0A 1GHRA 3GDRA 3DERA 3MCOA 3V0UA 1QHZA 1O4UA 2HWGA 3CH0A 4RR4A 4BWLA 2X1RA 4IX0A 3PK7A 3VXGA 4N42A 5HDRA 3OLEA 4WQ6A 4GQRA 3BV7A 3ZIZA 1GT8A 1XPGA 4XVDA 1BRLA 4DF1A 5M17A 1CXFA 3W85A 5BZAA 3IARA 3IGUA 3R1ZA 2FGBA 3W2NA 1GW1A 1DJZA 4N9BA 1I60A 1WBJA 3G18A 1B90A 3GU2A 3U48A 4UTIA 3IK4A 1GOQA 2WMJA 2FMNA 4WD0A 3C5QA 2E5DA 3HJEA 4AYGA 2A3CA 3RITA 3S9ZA 3VKKA 4AWUA 3BJTA 2OELA 3BSHA 1LL6A 2AAMA 3KL3A 5K4XA 4D1IA 3IV3A 4NYYA 3W3OA 3IS4A 2WYSA 4JZ5A 2EG7A 4FO4A 2PP3A 3EWZA 1XIHA 5H6HA 4UR7A 3NQ7A 1GK8A 2JF7A 2X41A 3V0SA 4IIBA 4PUMA 3UJRA 1UIOA 1B30A 4MZ1A 1B1YA 2PDPA 5FESA 3SI9A 1EJ7L 2XJ7A 3AYTA 4MAZA 4WGXA 3B9NA 3UR8A 3DFOA 3AOFA 3ZVIA 1ITXA 4GK8A 1FH8A 4S3EA 3T8LA 2QCDB 3RO8A 3ARUA 4GO9A 5ENLA 1X97A 1A5OC 5FIPA 2YZ5A 3HN3A 3SRFA 3SUWA 4UR9A 1PTDA 1QASA 3ELFA 3SO7A 3ANVA 1R3QA 2CU0A 5H8PA 1WKDA 3PWIA 4QDWA 1HKIA 3VZYA 4H6QA 3T2QA 3BVJA 5K3VA 5D05A 3SY8A 4N2YA 3VZZA 1GORA 4PA8A 3L4TA 3WLRA 4FNPA 1Y65A 1Q6CA 3GR7A 3WNPA 5HNUA 5XIAA 3BAWA 3OEXA 4E8GA 1UKTA 3I3EA 5I03A 3W81A 4PEEA 3VYLA 4DJFC 1UB3A 2YL5A 1VFOA 2O7QA 4OUIA 5AYBA 1L2QA 3DBNA 4PMUA 1WCGA 3I4KA 3F4WA 3M47A 3APYA 3LCIA 3LN3A 4U3AA 1W2PA 2NV9A 5HWMA 3ABZA 1E5NA 5AOUA 3PSVA 2XIOA 3G5EA 4Y8FA 3U2OA 3O6AA 1TMQA 1NEYA 4PB4A 3E9AA 1AH3A 2BHUA 2XIBA 2OR2A 2WNNA 1H1ZA 4F9JA 2VGIA 4H3DA 3N13A 3BH4A 3UWWA 4DJED 2ZICA 3GTNA 3UXAA 3KFTA 3BLDA 4UIOA 1QMLA 1V6YA 5H1WA 2WNQA 4YTSA 4ZTXA 5G4EA 2ZDRA 1GOWA 1VIWA 1I1WA 2EF9A 1M04A 3N2BA 1EC7A 4ZQOA 1HNYA 2R6OA 2UV8G 1DV7A 4LUIA 3LQLA 1JZ3A 3MMUA 3TN3A 2PWDA 4B4FA 1H50A 3AFBA 4JTEA 5E70A 2YDSA 2W92A 1AA1B 4J1OA 2I1OA 2E0PA 2X1UA 2WCGA 5A5WA 4YTQA 3ZO9A 4C7FA 1OG6A 4Q4SA 3CPUA 4PODA 3UZ5A 3CUGA 1S3TC 1W1IE 1KB3A 3BLIA 3MANA 1KFJA 3A6OA 4UQCA 2J74A 4H9MA 3IIZA 4RPQA 3H2NA 4GFSA 4PUWA 4EXAA 4ORIA 3TYEA 2G96A 1FFRA 3NXFA 4GZIA 1W5QA 1BG4A 1D9EA 1JAEA 1CECA 1W1ZA 4MOZA 3RNDA 1V0NA 4DY1A 3LTSA 3VIHA 2A2IA 3UWQA 2QMJA 3GC5A 3ARYA 3L4YA 1E9ZB 4KERA 3DENA 5HQLA 3PTQA 3KTXA 4TU1A 3U6WA 4BKNA 4LYRA 1CLVA 4W84A 1SW0A 1TJRA 1EQPA 2ISVA 3F5KA 1Y0EA 5CJMA 4UFKA 4H6RA 2QDEA 1US0A 2PDFA 1G6CA 5I3JA 4KFOA 1VBGA 1L6SA 3ITOA 1OQFA 4MIMA 2ZC8A 1A5AA 3EPNA 4YCPA 4XSLA 3WFAA 2C1HA 3MS8A 3LLXA 3RX3A 2X0YA 1XQKA 4Q32A 4P61A 4JFSA 2O4MA 2H9AB 5CC6A 3SCUA 2QGHA 3JUGA 7REQA 2F2KA 2PWGA 2QF7A 1DP0A 4ZOCA 3P74A 3H2CA 3URAA 1HG3A 4YS1A 3PSWA 3BLOA 2DGAA 4B3LA 1YMYA 2ABBA 3UG8A 4BWLC 4NX5A 2V8ZA 3WN6A 5I02A 3UPMA 2V67A 4D6FA 2XH0A 1PV8A 2EHHA 2ZXAA 3BCJA 5FSDC 4TX6A 4WHBA 3EX3A 2YXOA 3KOYA 4L4PA 3N4EA 2ATSA 2B81A 2XISA 3B06A 1UD6A 3KAOA 5BMWA 3KDOA 2OSXA 4ORMA 3RUBL 1SO5A 1TR1A 2NW0A 3KUMA 1R9XA 1XRTA 2ZIDA 4PUEA 5EL1A 1XLLA 2E09A 5D37A 3T09A 3T9PA 1HO4A 3H54A 2E5CA 2PTYA 4PR4A 1F76A 5CC5A 3DGRA 3MYOA 3VCNA 3F4VA 3T4CA 1R2TA 4C6DA 4U5KA 5XINA 3EOSA 1Z8AA 1A5MC 1NWRA 1BHGA 3BAKA 3UXLA 2Y62A 4E3TA 3VDBA 3B0PA 1XL9A 1KR1A 4XD3A 3GZ3A 2PDCA 1SW7A 3OVQA 5I09A 5E9XA 2FZDA 3GB6A 4N9CA 4OJYA 2XINA 4DUVA 1C8YA 3SN0A 4LS0A 4MLJA 3SGUA 1REQB 1ISYA 4L9XA 3KBNA 3QOMA 1D3GA 4DBDA 3CWOX 4S2CA 3NM1A 1EKOA 3PFMA 4B4HA 4JTRA 1YHTA 2Q8XA 3QR0A 3NZQA 3B40A 3ZZ1A 1LZOA 3NSNA 3BLEA 3OTRA 3OA3A 4XSMA 1NARA 4W89A 1EF2A 1OX4A 3QY7A 3TKFA 1FHVA 3GIPA 3MWCA 2KAUC 3LGGA 1QI5A 3S2NA 1A5KC 4I6VA 4JTFA 4QDMA 1AJ0A 1FTXA 1DJIA 4I8YA 4A05A 3SQSA 3GFYA 4I5RA 4RW5A 1UJQA 1EF3A 2VX7A 4CQCA 2VENA 4Z1CA 4OBSA 5F2IA 1O5XA 2NX3A 5IHSA 1EP2A 3EXTA 4M7TA 4P8VA 1ADSA 3G1XA 3UY7A 3WLLA 1FWGC 4AZCB 2JF6A 1KO0A 3H55A 4QE4A 2PDNA 4DJFA 3W84A 3B04A 4BQ4A 1H11A 1JL8A 1CGTA 5FEWA 1QI4A 4JBRA 2REQB 3G8RA 1JQXA 2QIIA 2GDVA 4YXGA 1KBIA 1EOKA 1P0EA 2PAJA 3VX1A 1JI1A 4FNUA 2FGLA 4I8DA 2J24A 4LGXA 1E4NA 2WJFA 2PA6A 2O4QA 1W9PA 2QPXA 3MI2A 4BF7A 4DF2A 4ZFCA 3SURA 1A0EA 1QAPA 1K8XA 3CHEA 3RCMA 3WBWA 4GXWA 4QG6A 4OIFA 4K8HA 1ZP3A 2V5JA 4DWSA 1T40A 1E6NA 2JQXA 3NQ6A 2VD9A 3ARRA 4CCEA 4MDOA 1EBHA 1W5NA 2O7SA 4FF5A 3LBOA 3LS9A 4BQ3A 4F4RA 1T0OA 4AZ6A 3PZQA 1BRLB 3R11A 4YYFA 4ACYA 1ZBWA 4PUKA 2P5NA 1H63A 1QNPA 3UY8A 1XCFA 4HNLA 3QLDA 2VO5A 1EL3A 2OU4A 4FF7A 3M43A 4JHOA 3UEQA 3T2PA 2ODOA 1F6KA 3TJXA 1CXHA 2YBVA 2E4TA 1ADOA 3KVLA 1M6JA 5AVNA 4CD5A 3TN6A 2DZTA 4G5DA 3T0CA 3T6CA 1YX1A 3CZ8A 3RR1A 3PZTA 1PYMA 4QR6A 4O50A 6XIAA 2KX9A 1HUVA 4PCTA 3N18A 4DBEA 1EJSC 3AS1A 3UPWA 3OYXA 1F6PA 2VR4A 3KBVA 3WQCA 3A4AA 5CGTA 1DIKA 5A8MA 1OEPA 2I9EA 4M8UA 3LXBA 3IGXA 1GYNA 3B8UA 2QJGA 1S2CA 3GFZA 1OGBA 3ARSA 4MLRA 4WY0B 4GVIA 4HJWA 1XHGA 3VK5A 3RO6A 3CV7A 2SFPA 3LCLA 3TC6A 2C3ZA 4A3UA 3EB3A 4O13A 3ENLA 4JTIA 3FDKA 4RE4A 4M6PA 3DFQA 4BEUA 4CQDA 3EWBX 4IL0A 3LXCA 4GZJA 3H2AA 5MF5A 1R86A 3EKGA 1XI3A 2TRSA 4MWAE 1RHCA 3A47A 1QOXA 5CBBA 3OLGA 4Z2LA 4RX0A 3T81A 1GG0A 3RPTA 1I0BA 1PO9A 4B15A 4O1BA 1E4IA 1JPHA 3T78A 4Q8TA 2PPGA 2D22A 4AD4A 1C91A 3M0KA 3MZNA 1UA3A 3STCA 3SCVA 3I7QA 3M5YA 1F73A 1K6AA 3THAA 4UTJA 3SCRA 4LUYA 3OGSA 1DXFA 1LROA 2DORA 2J8FA 3IJLA 1UZDA 1S39A 5F2GA 1AQHA 5BROA 4L61A 3VNDA 4NZ3A 1HGWA 3W72A 2DZSA 3AHTA 4PL1A 1FH9A 4RKAA 4H4IA 3ITTA 4XBJA 1JULA 4CN6A 5DEZA 5HAOA 4ZBCA 4Q7IA 2FB3A 4XD4A 2WVUA 2A3LA 4WDUA 1FX6A 1E6SM 1H0IA 1GVRA 2A3HA 1JZ7A 1HJXA 1OY0A 4IGMA 2QUTA 2XPKA 4GCXA 1UKQA 4PL2A 5LIXX 5C9UA 2E6AA 1NFGA 4UC5A 3CYVA 2D20A 2HK0A 2EEXA 1H7RA 4M51A 4Q7BA 2WMGA 4C6PA 4QE1A 3GTFA 4WF7A 1I0DA 1PB0A 1OGGA 1QPQA 2GOUA 2W67A 3UCQA 2EPOA 2GGHA 2OLSA 1Z89A 4PBEA 1GOOA 1YBQA 4AXNA 4KEUA 1DJHA 1EGMA 3WFZA 4PTVA 1TTIA 2FFCA 1CI1A 1SW3A 1TIWA 3GNOA 1XLKA 4TVCA 3SCWA 3TVAA 1SGJA 3TLQA 4E6MA 4H2CA 3B0YA 3BWWA 3TW7A 3EKLA 1YPIA 4CEXC 5JVLA 1GHSA 2GGGA 1MFVA 1EJWC 1VBRA 4IGNA 4DXVA 1ZAIA 4LW7A 1MXDA 2JE8A 2FTPA 4OTKA 5GJNA 2YB4A 1UP3A 5E0CA 4LVBA 2NVDA 1OHLA 3WBYA 1X1ZA 2CLMA 1IGWA 1TREA 3GC4A 3KOWA 1CXEA 5DT7A 4AHOA 1UUMA 2ISSA 3GC2A 1V02E 3D46A 2F61A 1JIBA 3RJXA 3VD5A 4U31A 4LANA 3KOXA 4PMRA 1DE5A 4M82A 4AAJA 1J2BA 3M0MA 3EKZA 5F4WA 3W1UA 4JTHA 4Z2IA 1JCMP 2X09A 1EJVC 4DB7A 2HQAA 2GUBA 2QS8A 2WMFA 3DZ1A 3WCZA 2GVEA 3GXDA 2W6RA 4GKTA 5DT5A 4WZHA 2D2JA 4GC4A 3QPEA 3DOPA 5EMLA 1I2RA 3M9YA 1WXZA 4REQA 5LHEA 2I5GA 2XVLA 4I9TA 3SIZA 3AICA 2OG9A 1K9FA 1RJRA 4LOCA 1D7KA 3S6DA 1ENUA 3VKDA 1XIFA 2WVTA 2E9BA 1WPCA 3WMLA 1PIGA 4P7LA 5T9CE 5AHIA 4RLIA 4WX2A 5ABGA 1BKHA 4D6HA 1B31A 1HL8A 4K68A 4UQDA 3OVRA 4FLQA 1EOMA 3WH5A 2J8GA 4MY8A 3U8GA 3GS6A 3N9SA 4XZWA 1US2A 3NYZA 5CCZA 3QY6A 3PZOA 1M65A 4KCVA 1UBSA 3P3BA 3WLQA 3VIPA 4RXGA 3TW6A 4BHYA 3T8QA 3VINA 5KMYA 1P1MA 4S2BA 1Q6GA 4JS3A 5M5DA 3EX2A 4WK9A 3GZAA 2Q09A 1UR3M 3L4VA 2PTXA 2FQIA 3RPMA 4IMEA 4IOTA 3M6DA 1GUVA 1UR0A 3W1XA 4DZ5A 1ZQ5A 4UZSA 3OQEA 3T4WA 1U1UA 2CWXA 4Q6JA 3P81A 1EA0A 3IEBA 1DWIM 4DWDA 2EG6A 7TAAA 3DFSA 3W53A 3NPUA 3WD0A 2YW3A 3GU1A 4LAMA 4Z1YA 3MU7A 1EYWA 3U7VA 2P50A 5CSRA 3QYSA 3RG6A 3QPZA 1HP5A 4A2SA 3H53A 4ZXOA 5AYZA 5HXMA 5H91A 3M0VA 1S5MA 4EIVA 4JGDA 2YCIX 4LV4A 1XUZA 4PTMA 2GVLA 1TJ2A 2JKAA 4MUZA 4I7UA 4E2VA 1ICPA 2E77A 1YE4A 4FIQA 3TN5A 1UWRA 4JY8A 2QCMA 5KSWA 3HQNA 1UMLA 1XDJA 4EP8C 3ZFHA 3CM4A 9CGTA 3STGA 1BGAA 2QCEA 4G1NA 4XZLX 3GNNA 3M7SA 2QHAA 3N9KA 3PNZA 2OKTA 1FKXA 3TYCA 4INFA 3LUTA 3PTKA 2DZWA 4EWND 1PIFA 4DJFD 3W01A 2R8WA 4UTKA 2OX1A 5ABFB 6TIMA 2HK1A 4HNTA 2V3EA 3MSDA 4XAFA 3UR5A 1KFEA 1IWBA 2ZUWA 3NUKA 3BDKA 2V0TA 1PKMA 4JL1A 2IXUA 3SRKA 4NQ1A 4ZE4A 4KFNA 2DSUA 1R85A 7ENLA 3BMWA 2P8CA 1TUFA 3FW6A 4PTNA 1GYMA 2VFDA 1IT7A 1SZGA 4OZOA 5F2MA 3UYIA 1H60A 1XYFA 3KWXA 2NV2A 1T7LA 3TYZA 3M5VA 3Q45A 4GBDA 3CZJA 1RBOB 4ZFMA 4RZBA 1UPPA 3G1FA 3WH8A 4QG8A 3NYDA 4GQBA 1YXCA 2CBJA 3VM7A 3R8HA 3WX7A 1MNZA 3WLJA 3BAYA 4GYFA 3E74A 4HVXA 4FMVA 4R7JA 4UMCA 2OQYA 4NL1A 1TV8A 4LY8A 5IOBA 5FACA 3HFYA 5DO8A 2X1SA 2EG8A 1W3LA 3EX4A 1UR9A 4A4AA 4HYVA 1VB9A 2HE8A 1TZZA 4GY1A 3ITXA 3LG3A 4DWSC 5GVJA 4MY9A 2BY2A 4XKYB 2VD8A 1E4LA 3I6TA 4PRRA 3DKJA 1Q85A 4C6BA 4DUOA 4QEEA 5FL1A 3A3HA 1E56A 2B7NA 1ME7A 1VF8A 4JTCA 4HZ8A 4UUIA 1SM9A 5FJUA 3ZT7A 2YDAA 1CGUA 1U2YA 4JCLA 3GBEA 2FZBA 1A80A 3VOIA 3O6DA 3WQPA 4XB3A 1EC9A 4AG0A 1FRBA 4RDYA 1A5CA 4ZODA 4XD5A 3WQWA 1ZRQA 2PLCA 1IWPA 3W86A 2F7FA 4QG9A 2FVMA 3IJQA 5GNYA 4FIRA 4NASA 1MRAA 1V0LA 3O15A 3NSXA 4MDPA 3VGGA 1Q5MA 2ZZ5A 3BG5A 2QGYA 2R82A 4QXIA 1J01A 2G4JA 1VRDA 1IYXA 4DRSA 1FXPA 3C6CA 3LMZA 5U4NA 4V33A 4UOQA 2QR6A 3V5FA 3WYZA 3PVFA 4B92A 2WMHA 2VXNA 4EACA 3MKVA 3FYYA 3OZOA 2WLZA 4QEHA 3OLIA 1KKOA 3CHVA 4J4KA 1ISZA 4A8RA 3LXAA 1SYTA 3U2EA 3GAKA 4O1DA 1YYAA 1FH7A 1GOKA 1DIOA 3EEGA 3O05A 4LEQA 2H8XA 3LHZA 3EMZA 4DLMA 4IG2A 2ZZ4A 2BOGX 1V6VA 1S46A 3UZWA 3S2MA 1F05A 4Q4OA 1E51A 4D6GA 3W73A 4GYPA 2WPGA 1G4SA 1VBHA 2I5QA 4NNBA 4XAPA 1Q7MA 1M7XA 3U4FA 4O15A 2R1LA 4AEOA 3DN5A 5DCBA 2FHFA 3DFYA 4O19A 1KFKA 3COTA 3H70A 4F0LA 3KP0A 2Q3OA 4W8BA 2WLYA 3AS2A 3IIPA 3NL6A 3TMLA 1QUMA 1R3WA 1EBGA 3HGSA 4YLWA 1UKPA 3GYEA 1ME9A 1Q63A 3AMCA 4L5ZA 4K8EA 4Y7EA 4TOQA 2ACUA 2QYGA 4TTGA 1I2QA 1OG0A 3WEOA 4JIIX 3KEHA 4Q8NA 4GI6A 3R4IA 1DXEA 4Q6XA 3VGHA 3FKKA 1MUWA 2A21A 2A7NA 3H22A 1ICQA 2PODA 5HPCA 1OCQA 4GUJA 1RBAA 3SFKA 2FDSA 1M7PA 3WDPP 2H8ZA 3NQFA 2ZUVA 5DF0A 3ABRA 4HJFA 2VZVA 1KW1A 1J5SA 1WQ5A 2D3NA 3PC0A 3HPSA 5CBIA 2ATMA 2WKJA 2VL4A 4LAOA 4HPGA 4D6DA 1CGWA 4K39A 2PCQA 4RZ4A 5LSMA 3QTGA 4CN1A 3GXPA 3V4BA 1ESWA 4CNNA 2FZMA 5IHRA 4GQ0A 2NQ9A 5E6ZA 1VGAA 3OW1A 4MG4A 3HPAA 2VR2A 3RX2A 2V6AA 3RFAA 4ZQMA 2X1IA 1Z69A 3WF0A 4CQ9A 2ZXDA 2UY4A 4MF4A 1L6YA 3KWSA 4NILA 1GYLA 3RYSA 5A6BA 2WVVA 1UC5A 2VX6A 3UJEA 3K46A 3LSBA 3PB2A 4JTDA 3WLMA 3GDKA 3R0UA 3L7RA 2WKGA 1CLKA 3UG3A 3MP4A 3C52A 1GKQA 3SCQA 1LP6A 1B9BA 4GNJA 1GOIA 3LENA 4P8WA 4DM2A 3WF1A 4DAFA 4DNHA 1Q66A 5LIYX 3THCA 4FOKA 4WOZA 3QRHA 3U0HA 2ZZ6A 3ME3A 2I56A 2R14A 2IW0A 2PLMA 2GJPA 4P8XA 4PTDA 1B9ZA 2DUAA 3VDAA 4Z0JA 2ZA2A 4C5YA 5A8NA 2W27A 4F0SA 3E2SA 3ITGA 3N11A 1EB3A 2I17A 1E6QM 4TXEA 5FJIA 3SGGA 1CNVA 1EIXA 4I7VA 4J3VA 4QQUA 1L6FA 5CPSA 4NZ1A 5BRPA 3CQ0A 2V69A 5HWNA 4CVUA 3GAYA 4I5XA 1BWKA 4NZ5A 4YTRA 4IGHA 5G2IA 4A35A 3NQEA 1FVPA 1JDFA 2WJZA 5JIPA 5L6UA 2NLYA 1YQ2A 2RFGA 3ZLGA 3WELA 4GYKA 3FA4A 5DMYA 2DVUA 2RDUA 3W2KA 4QCFA 4P7QA 4MWAB 3EPOA 3NR0A 3N17A 3QR3A 3AHVA 1E1FA 2Y7EA 3DEQA 5D09A 3G0XA 5EMJA 1MDRA 3W28A 2I14A 3D3FA 4JQ3A 4PBFA 1HL9A 4IFKA 1VFMA 4LH8A 1M1BA 2Y24A 4HNUA 1W37A 4QX4A 3WH7A 3T2OA 2Z2BA 4YWSA 1DIDA 5C2GA 3QKZA 1HFBA 1H1NA 2NVCA 4POCA 3W1AA 1A5SA 3PZVA 2VM8A 4FR6A 5AC4A 2GGIA 1CBGA 2VP8A 4X2PA 4PSPA 1Z44A 1P43A 1V08A 4AWEA 3TEVA 4IT1A 1AVAA 2DUZA 3IVTA 1XLCA 3VZXA 1JUEA 3G1YA 2XTKA 1XPYA 4R34A 5AHFA 3VIIA 4CU6A 3LYEA 4R9XA 2J79A 5A2AA 3LM7A 2Q3RA 3LNPA 2YB1A 4YIWA 3UA4A 1F8MA 3FV9A 1UWTA 5IDZA 4G9PA 3ARWA 1F3XA 4NJKA 3ECQA 2DZXA 1NDYA 2E28A 4Q4RA 1ONXA 4AFYA 1E0TA 1TPB1 2PF8A 1VENA 2VEPA 4RNJA 2PD5A 3VMPA 2D0GA 4F8XA 3LRKA 4XUYA 4TX8A 3R6IA 3S9IA 2O92A 1GZGA 2AQWA 4YVXA 1JCNA 1JFXA 5BYWA 4F0HA 1OF8A 3KX6A 2GGEA 3MUZ1 2J7BA 4GE8A 3KHJA 3CK5A 1V6WA 3V75A 3E2QA 1E3XA 3F4DA 3F1QA 2QAPA 3HMCA 1PHQA 5M3WA 2EKGA 4LBUA 4HA4A 3W7EA 4LQ1A 3HM7A 4RE3A 2ACSA 3ZLHA 5HOSA 2NUWA 1BVNP 3U7BA 3IJ9A 3CV1A 4QBXA 5BCAA 2UY2A 3V16A 3LLFA 2CZEA 3BL3A 4M29A 1O5RA 1U33A 3H6OA 2CLKA 4C6OA 1DL3A 4I9JA 1UH3A 1JXJA 3OBKA 3UJSA 4LNYA 9RUBA 1M53A 3TSMA 4IICA 3WF3A 1QFEA 1NFBA 4UTTA 1A0DA 2WZTA 1KCLA 3N4FA 1W3JA 3FDGA 1RJQA 1GONA 2OJPA 3H4GA 3SJ3A 3CMJA 3SRDA 1JCJA 5I5RA 4RZ5A 2CCRA 1OFRA 3S83A 1NOUA 3FKRA 1P5BA 4B16A 1VR6A 4OV9A 2V5KA 4GY7A 1LUCA 4LXFA 4DWSB 2P3EA 4YJ5A 4PCPA 1TRDA 3W07A 5FCZA 4CD4A 3GXNA 2HS6A 4GISA 4IIGA 1H7XA 3FEQA 5AHNA 1BPLB 2X2YA 1V3MA 3HG4A 1XD0A 1AW2A 3MDUA 5HANA 1BF2A 5HA7A 2GSEA 4KCTA 1XCWA 3QH2A 4XZ9A 4ZE5A 3VTRA 5FAJA 4NAEB 2J78A 1X1NA 3PZIA 4IL2A 3WUEA 5K4ZA 3T0TA 2ON3A 3WG6A 5L9FA 3JW7A 1PKNA 2W63A 1HF6A 1XGEA 1JYNA 2J77A 5HUPA 5D2WA 1N8FA 3LZ5A 1KWGA 4GABA 3GNPA 3CT7A 3ABQA 1C3FA 3NJ3A 1UR2A 4PMZA 4CD7A 1DJQA 1QR7A 9XIMA 5C71A 3IJ7A 3WMBA 1H09A 3IVSA 3FJ6A 3GXMA 4J2MA 3N3TA 4Y9AA 1QW8A 1XH1A 3ARZA 5DCDA 3UBPC 2QEZA 1IZJA 5D8WA 3CWHA 3NO1A 3U2CA 3R5EA 6REQB 2DJXA 4ZQRA 5KZEA 4AUBA 3A22A 4GJJA 5HJXA 1AL8A 2A3AA 2WC7A 3CUHA 1SZFA 4XKMA 2H3BA 2RGMA 4P5UA 1O68A 3AS0A 3QVQA 1ZJBA 2XFRA 2EKCA 1O1ZA 3PJTA 4JIQA 2C7FA 1Y7VA 4LAUA 2ZRVA 1VPYA 2GUUA 3CPGA 4JTQA 4F0RA 1PWLA 1QI3A 4JL2A 1JZ5A 1WZMA 1MO0A 1E5JA 3MUY1 4KCWA 2VWSA 4NRRA 4PMNA 5E5CA 2OLAA 1JZ6A 2RJGA 2VC9A 3E0WA 5F4XA 4YCOA 5CPNA 3XINA 2I5IA 4LPCA 4PRTA 3W2UA 1L2UA 1TV7A 2NWSA 4C65A 3BGAA 2G3FA 1UKOA 2WBGA 3EOEA 2FVKA 1A53A 2AKMA 4A3RA 5TAOA 3GXIA 3USZA 1G4TA 1K77A 1H7NA 4Q22A 4H7VA 2DU2A 4UBPC 3WQEA 3RX4A 1ZBVA 2PRMA 1H3GA 4GI9A 4Q4MA 1TE1A 1W0MA 5CQ1A 4H00A 4IP4A 6PTDA 4NJHA 5LNSA 3IGSA 4GOAA 2CNCA 1UR8A 6CGTA 3MMWA 3M0IA 3TE9A 4AHQA 4CN4A 1EWEA 4XX6A 2VVNA 1QWGA 1F4AA 3ZT5A 3DHUA 3WQDA 4MJ4A 3I6RA 4DN1A 1ZHAA 4ZZ9A 4HSNA 4ASTA 4P7RA 3UXDA 3OLDA 1HZYA 3UWEA 1PDYA 4DIAA 1F6YA 1NDWA 3O6YX 1WDRA 1GVOA 2E3ZA 1LF1A 3AYVA 1KFWA 1TRIA 1O5KA 4JIRA 1K8ZA 1BD0A 3FGCB 3UZYA 5JBDA 4Z2HA 2PP0A 2NT0A 4ACZB 1XSJA 3G1AA 1CX9A 5HULA 4N0RA 2A7PA 4LUTB 1XF0A 1W3TA 4K37A 4O53A 2PDLA 2DDXA 2OYMA 4X9YA 2VVSA 1TJ1A 2D23A 1CDGA 3TTYA 4L65A 1XYZA 2RDXA 3AIUA 1XLDA 4AX7A 3BGGA 1NH6A 4M81A 2OGYA 1R2SA 3VOGA 2GK1A 2PF0A 1P0NA 3CEUA 2PC4A 2G8ZA 4BFAA 1AJZA 1QTWA 1BWVA 2Q8ZA 5DLCA 4KS0A 1KQYA 3E38A 3VKCA 2ONEA 3UJFA 4MKSA 3BCDA 3E02A 3SW6A 1RP9A 3R2GA 2HV5A 3VE9A 2Z27A 1W5PA 1UA7A 1WDWA 3W22A 4LVDA 4OOUA 3P60A 3W9ZA 3E96A 1QXLA 3KBWA 3AYSA 1E0WA 4UFMA 3M1ZA 2FPVA 4QJ1A 2BSLA 3RF9A 1XCXA 1YXYA 4FLRA 4S3CA 3P80A 3KM8A 1N55A 3VNIA 2BY1A 2VJXA 5IFPA 1M41A 4LCSA 3TNOA 2Y7FA 1MNSA 3E0VA 3K8KA 3W7GA 3P0XA 1FBAA 3L5LA 3L0NA 3L5AA 4DJDC 2GQ9A 1TZ9A 3TCEA 1BQGA 4W85A 3M0LA 1JAKA 3UGVA 2XGBA 5CJ5A 4AD1A 4IP5A 2YLLA 3TP4A 4AW7A 3AMLA 3BUVA 4DO7A 5J5RA 4H9YA 3EDFA 2BS9A 2JFEX 3MJMA 5G4WA 3BLKA 3GSMA 2ZX5A 2F38A 4P7OA 4W7VA 3H4WA 2ZZ3A 2PLKA 4PBGA 4GX8A 2IQDA 5TD4A 2QCGA 3KRSA 1QW7A 2E68A 1R38A 1E6RA 1QNQA 1TPC1 3GIQA 2WSRA 3UW6A 4XO7A 2R1KA 2BNJA 4WDTA 1XBZA 3GG1A 1XLHA 2P88A 5I3IA 4B5TA 3C4UA 4LYQA 3ZOAA 3K1DA 5I3HA 1VEPA 2O55A 4NRSA 3HQPA 3WQGA 3ZM8A 5J04A 3BLPX 3BXWA 1MYRA 4H04A 1KQZA 4BQ2A 5LNRA 3FCPA 2FZ9A 4HA3A 3H2OA 5CC3A 3FSUA 5REQA 2DQXA 4PMXA 3PBWA 2CW6A 2WVVB 3E12A 3D6NA 3W37A 1JR1A 4OUEA 4UFLA 4UTLA 1VZWA 5HNRA 1QNVA 1NWUA 3CIXA 3RHGA 2V2DA 3NM3A 3APGA 4O8AA 5MHBA 2NQHA 2ZOXA 2CZDA 4G7EA 4YN5A 1O6IA 3RR4A 1M3UA 4NXKA 1F4HA 4IJRA 2PD9A 4ZVJA 4J35A 5JBFA 2WJDA 3ZVHA 3CL6A 3O07A 3WH6A 3POHA 1JPDX 4GINA 5BRQA 1RV8A 1E70M 3L4ZA 3DESA 4M6VA 5FF0A 4DZHA 3QGKC 4D6EA 4WDWA 3GVVA 1XIGA 4ROPA 1THFD 4HHHA 3IVUA 4C6CA 1T8XA 3M41A 4GZ7A 2HISA 4X63A 4XKYA 1K9TA 1ZU8A 1HVXA 2WCSA 1BF6A 1I6NA 4URIA 3VX0A 3CXOA 2GZXA 1B3XA 2YR1A 1EJUC 2DZUA 3KVJA 3W7LA 1CB2A 2ZWYA 3CLMA 1GJPA 4LS2A 5H8UA 1HJQA 4WSHA 3SECA 4Q3MA 1Q2RA 3LPPA 1XRVA 3L66A 3RLVA 4F79A 3THDA 3WLTA 4UTTC 2PGFA 5SWUA 1JZ4A 2WBKA 4JY9A 3S46A 4HPNA 3QHMA 3MY9A 4PUDA 3M07A 5LIKX 3TJIA 5C6MA 4HCHA 3BQ6A 2YYUA 2OYLA 4U5IA 4NNAA 1W8GA 2X30A 5B7YA 2UZ9A 4GKLA 1ML1A 2NWRA 1E9IA 1Q8AA 1C93A 4R9OA 1OX6A 1QCWA 1GTHA 2BV9A 3L2IA 1F3TA 3L68A 1GVSA 3GNRA 3AXXA 1AZ1A 2FIQA 3CJPA 2GPTA 3NWRA 3CPRA 3VCRA 2I57A 5DY3A 3ZJ7A 4JFWA 1DJGA 1OBAA 3W6YA 4F0MA 1HKWA 2L5HA 4O12A 3C3UA 4Q4QA 5EPDA 3CUFA 1ZJAA 4MHBA 3SRHA 1N82A 5KZ6A 2D69A 1V7AA 2QCLA 4FAMA 1K03A 4IPPA 2ZBTA 3F2DA 3N2MA 1XLAA 3N6HA 1D7FA 2C15A 1GGOA 1HJWA 1CGXA 1MFUA 2VELA 3MZ2A 4HYWA 3MUCA 3MSYA 3IIXA 5RUBA 3MUIA 3TSBA 1QBBA 4LV9A 5ABHA 2DY3A 4QP0A 1E1CA 3F5LA 2G5WA 3WNOA 1W1B1 2J7CA 2WM1A 3T0AA 3E2RA 1RY8A 1HKJA 1VFTA 2BY3A 2QKFA 3NOYA 1AD4A 3ZS4A 4FA3A 1TV4A 4HU3A 4GA8A 4E8DA 5BU6A 1UG6A 1VIZA 4Q4KA 2W66A 3FA3A 4D6IA 2PBGA 4C6IA 3W38A 1OYCA 3BLFA 4KEVA 1VEMA 1JD7A 2ISWA 4H1ZA 4O17A 1HX0A 3ARPA 3M0JA 2WB5A 4BF9A 3ES7A 3KCOA 3WQOA 2EPKX 2XVKA 3QBUA 4FXRA 3OYZA 3GD6A 2GGJA 1C9DA 1H49A 4H41A 4A3HA 3EXRA 1WDPA 4R33A 4A8LA 3CUIA 2E6YA 4FXFA 1QT1A 2XM1A 2WKLA 3GU9A 1RLCL 5HBFA 3MO4A 3VGBA 2ZX8A 5HK4A 3SIMA 4IG2B 1DTUA 1JPIA 3QEZA 3G3MA 3WO8A 2P1FA 3GWQA 2VWTA 4GGBA 3R43A 1O66A 2OWWA 3SY1A 1TJPA 2VEMA 3I7RA 4GGHA 1AL7A 5AC5A 1LQ2A 3CT2A 1SZNA 5FEXA 1JYXA 3SCNA 3W88A 2PU0A 1UOZA 2AGKA 4MGGA 4MPQA 1AK5A 1UZ1A 3PBGA 1NP2A 4LCRA 1K8YA 1KXHA 1VYPX 3HZ3A 2Z6JA 1WZLA 4YPJA 4O52A 1AW1A 2XWDA 1BSIA 2WZMA 3PPGA 1SJDA 2YKKA 3ZVHB 1FWFC 1LL4A 3LBMA 4OFCA 1N7KA 4KT2A 3GNXA 3WH9A 3GHUA 3QHNA 1G94A 1T96A 1U22A 4V2XA 4MKVA 4A21A 3MBFA 4G2DA 3C86A 3QHOA 3C3NA 4OKDA 2PUZA 3MC5A 1R87A 4E2OA 2PWUA 5A6SA 3R89A 5HR7A 3LB0A 3ALFA 1H7WA 3UXIA 2XZ9A 4UOZA 4AD3A 1I1XA 2WW5A 1VJSA 3AS3A 2EBNA 1J0ZA 1JJKA 3WQ6A 3WNMA 1GQNA 3C0QA 3O7UA 4DBSA 3B9AA 2OVLA 1UZ4A 2EXOA 3EX1A 3NQCA 4NY2A 3RIKA 1K8CA 2Y70A 4O14A 1R0MA 4ZQNA 3HG2A 2PDYA 4TIMA 3VD7A 1NQKA 3NGFA 3L2LA 3NFUA 2WSQA 3EDJA 1PIIA 4QAWA 2FH6A 4J9JA 4MPKA 4PFMA 4WRHA 3P0WA 1Q6OA 4F48A 3EOOA 4AVNA 4R53A 2Y0FA 3SEPA 5BWFA 3MO7A 4MFDA 1KBJA 5C70A 1OJXA 5BRBA 2TYSA 3Q65A 1CT5A 3B4UA 5BU9A 4TMBA 3ID7A 3PP7A 1XUUA 1TYGA 4K1GA 4KGLA 3EA1A 4DJEC 3EB2A 4B2DA 4HOXA 4ICMA 3S5YA 5T8GA 4H19A 4EAYA 4MADA 5DN1A 4J28A 1C7SA 2PE4A 3HMJG 4C6NA 2YL8A 4XZHA 2YGYA 1TPH1 1L8NA 4P8UA 3P62A 3VO0A 5AHMA 4V1XA 1LJYA 3EWYA 4IUOA 3P8JA 1ZY9A 2CBVA 2NSXA 1MQQA 3R0KA 1BVZA 4GNKB 1V6TA 5C9ZA 2C13A 3BOLA 2RAGA 1KTCA 1PPIA 3N2CA 3TLLA 4Y9PA 3DG6A 3B0UX 2A1YA 2PI6A 5LA2A 1QJWA 1H4PA 2WMKA 3RM8A 2J62A 3FVDA 2G97A 3QJAA 4N9DA 4AZIA 2Z2UA 3OGVA 4E4PA 1GVIA 3LPOA 1SSDA 3CEPA 2R1MA 1IR1A 3Q94A 5LNUA 3CZEA 1SMAA 3I3BA 3W6LA 1KFCA 2DSWA 1OFAA 4O54A 4DJDA 5DXYA 2W62A 5LXEA 2GLKA 8XIAA 1NFPA 1I75A 2IPGA 5G2HA 3A4WA 4GUHA 4B5UA 4GVHA 4JN8A 5A6BD 1EXPA 3KRUA 3DAQA 3TTEA 3VOCA 4DBUA 2ZUUA 1TCDA 3WD3A 3I65A 2WOQA 1WDDA 2Z7GA 3L5MA 3A3WA 2FLIA 3G0SA 3S5OA 1V02A 4MB4A 1EZWA 3L67A 3A64A 3FS2A 1Q65A 2QCFA 5FI8A 2VEKA 1Q6FA 1GEHA 2OEMA 3PULA 1KBBA 1Q6LA 3GDMA 2J47A 2ZRYA 4B5VA 3BE7A 5AHLA 2V3FA 2DP3A 4ZXLA 3IJ8A 3EWUA 3FLUA 3BO9A 4W87A 1WX0A 2GDQA 4FXJA 2VZSA 1ZP4A 3WIJA 1OFBA 3L2MA 3H2MA 3A21A 2J9XA 4S3BA 2ZA3A 1EZ2A 3CZLA 1FDYA 4MM1A 4H9VA 4ZENA 3G8EA 1XM3A 4EE9A 2ZC1A 2QNEA 1ZUAX 2HNHA 3FHQA 2BFGA 2QJJA 4D8LA 3ICJA 5AB3A 4UTHA 1JDDA 4HD5A 1IV8A 1OB0A 2ZTKA 3KLKA 4JX6A 4RPPA 2B7QA 1GQLA 4UZUA 5BNKA 2JALA 4GX9A 3RM4A 1W9DM 4HSOA 3U3HA 2E9MA 1BTMA 4BI7A 4DLFA 1FA2A 3CL7A 1OFOA 3CIWA 3LTPA 1EFZA 2HXTA 2UY5A 3A4XA 3MI3A 2C79A 2B31A 1J0YA 1POJA 2DSZA 1OZQA 1EGVA 2YL6A 2Y4SA 3CQKA 4L6HA 1J0KA 1IEWA 2DT1A 2ANUA 3O6CA 4UNKA 3GG8A 4D6CA 3CAKA 4HMNA 4KEMA 4Y9NA 3UPBA 1VD6A 4K6AA 4HPHA 4O4WA 4J5NA 1TB3A 1FWHC 1MDLA 1BYDA 3LCFA 1TX0A 2PDGA 3M7WA 1T41A 3S5ZA 5A6TC 1HW6A 3T07A 4XZNX 3G24A 1Z42A 2OPJA 3VKJA 2P53A 1ELSA 4D71A 3C8NA 2J6XA 1DJNA 4JTJA 1IGSA 3QR1A 4FSAA 1HJVA 1S2WA 5TBOA 1V3IA 4QISA 2QJHA 2BHZA 1W5OA 1XYCA 2C19A 4ZB0A 3NEHA 3ZXWA 2EO7A 2XN2A 4JICA 1U1HA 4FPSA 3GG0A 3HGRA 1UD4A 2VEGA 1QHOA 5D04C 3NZPA 1GNXA 1EQCA 5T9BG 1P6WA 3E5BA 1FWDC 2P0IA 3W74A 4IGSA 1OADA 5HUOA 4NSBA 3PG8A 2PS2A 2YLAA 1NWTA 1P0DA 1YRRA 2D0HA 3B97A 1WB0A 3H21A 3AIEA 2D2GA 4E8CA 3GKAA 2JKEA 1PZ3A 1M01A 4PTXA 5A8OA 2VGFA 3N15A 4YNGA 4AD5A 3WSUA 4YTTA 3QKEA 2VZOA 3TZFA 4F3HA 4J3ZA 1SPQA 1KWKA 3N3MA 4LVAA 3G1RA 3LCXA 1EP3A 1EC8A 3LHVA 3A5FA 3UXKA 1BXBA 1DWHM 4S3FA 3RLHA 3T7VA 1OC7A 1W1VA 1QU4A 2HROA 1P0KA 1J8VA 1UR1A 3OG3A 4C6EA 1AMKA 1XRFA 3DCPA 4H01A 2PRLA 4X2RA 3VGDA 1VBJA 2VUYA 4HHPA 1S5NA 3PF3A 2Z1BA 4TTUA 1YLVA 4MNKA 1W1TA 3L0GA 3VNZA 4I6KA 1VHCA 3M0YA 3VNMA 3DFHA 1D3HA 4K1WA 3PPFA 5EBAA 1QNSA 5IM51 1AH4A 4XK2A 1KBKA 3LA4A 1KM2A 3TJ4A 1GJUA 3NVTA 2B7PA 3TYDA 5FOOA 5EGRA 5D2YA 1KXVA 1A4MA 1ADDA 4HHLA 2HVMA 1F74A 1ZZMA 4CUCA 1RCOB 3IRSA 1Q13A 3T55A 3RRXA 4HU0A 2JIWA 4MVAA 2Z6IA 6ALDA 4HCLA 3V35A 2CLEA 4EWJA 2ZA1A 5E09A 1QK0A 1OD8A 4ZO7A 3KBJA 3RCNA 2DW7A 5BXTA 2CHOA 1YKWA 3TFXA 3BJFA 3W83A 3IANA 2GUYA 2XHYA 1XC6A 3UR2A 4ZB2A 3LPFA 4PMOA 5T91A 4E3VA 4L56A 1CWYA 3PUEA 5ABEA 1E43A 3FEMA 3MJYA 3KBMA 1VJIA 2CPUA 1UROA 2AGTA 2VDHA 4I9AA 4OV4A 1Y5VA 1FHDA 4AMAA 3LM3A 3MW7A 2RH9A 1QPKA 3W6MA 4UOJA 1UP2A 3WQ4A 1OCJA 4D72A 4MZ8A 4I9MA 3PANA 4XIAA 4LSBA 3ANUA 4REQB 2JGYA 1XG3A