2HBVA

Crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
331
structure length
331
Chain Sequence
KPRIDMHSHFFPRISEQEAAKFDANHAPWLQVSAKGDTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDVQVTCATPVMFGYTWEANKAAQWAERMNDFALEFAAHNPQRIKVLAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAFLTHCANEDIPILVHPWDMMGGQRMKKWMLPWLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFLLGRVDNAWRHRDIVREDCPRPPSEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGGLVLSSNLGESAKDKIISGNASKFFNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of alpha-Amino-beta-carboxymuconate-epsilon-semialdehyde Decarboxylase: Insight into the Active Site and Catalytic Mechanism of a Novel Decarboxylation Reaction.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase
total genus 124
structure length 331
sequence length 331
chains with identical sequence B
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2hbvA00
2ZC1A 2EG6A 1P1MA 2O4MA 2WJEA 5G4HC 1K70A 4V1XA 4B91A 2AQOA 4UBPC 2OB3A 1NFGA 4C6MA 4IGNA 2ANUA 2R1MA 4RDWA 3OQEA 1M68A 2YB4A 3N2CA 3WMLA 2BB0A 4QTGA 4XD6A 2VR2A 1DPMA 4G7EA 1NDZA 2Z25A 4HK7A 2BGNE 4QROA 1R9YA 4C6QA 4EPDC 2FVMA 4XD5A 3FDGA 1FWFC 4QRNA 4C6NA 4M51A 1EJSC 3CS2A 2R1LA 4V1YA 1PTAA 1FKWA 4HA0A 3GTXA 2QT3A 1KCXA 4GY1A 3V7PA 2Z29A 3SFWA 2FFIA 1FKXA 4AQLA 3MSRA 4GOAA 3QY8A 4RDVA 4UB9A 2VHLA 1RAKA 1I0BA 4H9XA 4LANA 1EJWC 4DNMA 3SO7A 4CQCA 1WXZA 1YRRA 3LNPA 1GKQA 3A4JA 1P6BA 2OQLA 3HTWA 3QY7A 2DVXA 2CZVA 5LXXA 1RK5A 4PE8A 1E9ZB 2KAUC 4GX9A 3K4WA 2YB1A 3UR5A 3OODA 3GU1A 4IF2A 4WGXA 4KESA 3LSCA 4DLMA 3DUGA 4DI9A 1EJVC 2I9UA 3QY6A 3OU8A 1QW7A 1YIXA 2PLMA 2VM8A 4OFCA 1M65A 4ERAA 2WM1A 1PO9A 4G7EB 1K1DA 2VC7A 2R1NA 3PNZA 3G77A 1FWHC 3OJGA 4F0SA 3RYSA 1A4LA 1FWBC 3AU2A 3PAOA 2Z27A 3PBMA 2VUNA 5A6TC 3IGHX 4B3ZA 1ZZMA 4C6IA 3OVGA 3S2NA 4GY7A 4C6CA 4KIRA 4PCPA 3R0DA 3LU2A 1A5LC 3NQBA 3IJ6A 3QGAC 3CJPA 4RDYA 4B92A 2O4QA 4LCQA 4IH3A 1FWAC 3LA4A 3RCMA 1A5KC 4LCRA 2FTWA 4C6KA 3S2JA 1J79A 3S2MA 1O5RA 1XWYA 5HMEA 4INFA 2Z4GA 4BY3A 4LAOA 4HJWA 4C6EA 4IFKA 1VFLA 1KRMA 4R85A 4KEZA 3GTFA 4KETA 4GK8A 1A4MA 1POJA 2DVUA 3A3XA 1A5MC 4QS6A 1ITUA 2Q01A 2W9MA 4GX8A 1EJUC 3LGDA 4IFOA 1P6CA 2IMRA 4H01A 3WYZA 4LFYA 4I6VA 2D2GA 4C6LA 4R88A 3TN6A 4H9ZA 3CAKA 3GG7A 3GUWA 3MVTA 2I5GA 3DCPA 1YMYA 3S4TA 1FWDC 2HQAA 1V79A 4RDZA 1JGMA 2QPXA 1R9ZA 2GOKA 1EF2A 4ERGA 3E74A 1BF6A 4KEVA 3E2VA 3EWCA 4HK5A 4PBEA 1XRFA 4I6KA 4H00A 1A5OC 2GZXA 4GZ7A 4LCSA 3URQA 3B0YA 3F2CA 4G2DA 1ADDA 1NDWA 2PUZA 4H9YA 4P5UA 3FDKA 3NURA 3ITCA 4PBFA 1PB0A 1UIOA 1J5SA 4RE0A 1RA5A 4J5NA 1FWGC 2P50A 3B0XA 4MUPA 5E5CA 3F4DA 1RJPA 3PNUA 2R1KA 2YXOA 4C6FA 2DVTA 1ONWA 4GYFA 4PCNA 3EGJA 1KRCC 4GC3A 3TN3A 4IFKB 3IRSA 5FSEC 1J6PA 4JOMA 2PAJA 4C6JA 2D2HA 2Z28A 3O7UA 4XAGA 4NG3A 4IQJA 4NP7A 2Z7GA 4LAKA 1O12A 1KRAC 3BE7A 3RHGA 4KQNA 3E3HA 3GTHA 4NI8A 3RN6A 2HPMA 4IG2A 3GU9A 3IPWA 4C60A 1UMLA 4Z42C 2EG8A 4LAMA 3T81A 3GIQA 4IFRA 1J6OA 4H9TA 2OOFA 3TNBA 3IV8A 4C6DA 2Z00A 3MKVA 1EJXC 2ADAA 3E0LA 1FWEC 4CNUA 3MJMA 3LY0A 4WVXA 3UR2A 1K6WA 1QXLA 3JZEA 2GWGA 3GIPA 4DZIA 2D2JA 2Z26A 4QS5A 3NEHA 3D6NA 1POKA 4BJHA 4RZBA 4XAFA 1NDYA 2UZ9A 3LSBA 2WJDA 2FTYA 3A3WA 3MPGA 3F2BA 4LH8A 2Q09A 4GBDA 2HBVA 1E9YB 4C6BA 3MDWA 4DI8A 2E25A 2AMXA 4C6PA 4TQTA 1HZYA 1A5NC 2AQVA 1V4YA 1FWJC 4XD3A 2QS8A 1EJRC 5HMFA 3LGGA 3UF9A 3TN4A 1EJTC 3O0FA 4H9VA 5FSDC 3F4CA 1IE7C 1UBPC 3B40A 4KEUA 3GRIA 4CEXC 2EG7A 3T1GA 3E38A 2RAGA 3MDUA 1RJQA 1YNYA 4KERA 4KF1A 3URAA 1RJRA 2Z24A 3E0FA 1GKPA 4YIWA 4C5ZA 1V77A 3S2LA 1EYWA 1EZ2A 4CQDA 4GY0A 4F0RA 2XIOA 2GSEA 4QSFA 3KM8A 4R7WA 2Y1HA 4EPBC 3IARA 3URNA 3ID7A 4IG2B 4BKNA 2HBXA 2P53A 4L9XA 2ICSA 3GU2A 2E1WA 2Z2BA 4XAZA 3C86A 4J35A 3URBA 4F0LA 2A3LA 1ITQA 4C5YA 3AU6A 1RA0A 4CEUC 5AKQA 3ISIX 2FVKA 2OGJA 2HPIA 2PGFA 4EPKA 3DC8A 4DO7A 4H9MA 1FWCC 1NDVA 1I0DA 3QGKC 4ZSUA 3ICJA 4WHBA 1V51A 5CH9A 2HNHA 2QVNA 2YZ5A 4AC7C 3UPMA 4DYKA 4J2MA 2G3FA 1RK6A 3MVIA 1UIPA 3IACA 1M7JA 4XAYA 1GKRA 3FEQA 4HK6A 4CNTA 3LS9A 3ORWA 4DLFA 4XD4A 4EP8C 2WJFA 3HM7A 4IGMA 1YBQA 1W1IE 4LEFA 3T8LA 3F2DA 5HMDA 2F6KA 2OODA 2PGRA 3K5XA 4D8LA 1R9XA 4B90A 1XGEA 3AUOA 4E3TA 1V7AA 4ZSTA 1S3TC 4CQBA 3K2GA 4GXWA 4ERIA 4DZHA 3UBPC 1XRTA 4LALA 4DIAA 1FWIC 4L6DA 2UBPC 3GTIA 1YBQB 4CNSA 4C65A 4ICMA 2VC5A 1WXYA 3EWDA 3MTWA 3OOQA 1PSCA 1KRBC 4H9UA 3PANA 3HPAA 2R1PA 3WZ0E 1ONXA 3TN5A 4EPEC 2GWNA 2Z2AA 4C6OA
chains in the Genus database with same CATH superfamily
4LW7A 2EG6A 1BSIA 4QXIA 3PG9A 2QJGA 2ZX9A 3V16A 2FMOA 1XGZA 2WMHA 5BU9A 2YA0A 4A8LA 3QRHA 1R5YA 4RZ4A 2CEQA 1JCXA 2R1MA 2VEFA 3GG0A 4JIQA 4XB3A 3WD1A 2DEPA 3GAYA 3AXHA 4ALDA 3TWBA 3O6YX 4NZJA 1E1FA 2IPJA 5H8UA 4CLMA 1K3UA 3NQFA 3TEVA 1EL3A 1OIMA 3QC0A 1M1BA 3Q58A 1VHNA 1Q7QA 1KFCA 2J9YA 3N04A 1GQIA 4ZO8A 4H9XA 1W9UA 2NQ9A 3MCOA 1KGUA 1KM5A 3R94A 3KOZA 2ZZ2A 3L21A 3ABSA 4LUYA 1M5WA 1KXTA 3FGCA 3EEGA 3UVAA 3N14A 1W2PA 1ZENA 5I03A 2PZNA 3SGZA 1DWHM 1W54A 1YPIA 3B9AA 4M7SA 5LNSA 4WDXA 1MUCA 4QE5A 1TPDA 3ZIZA 2I9UA 3KLKA 1GGOA 1AH0A 4W7VA 1H7RA 3WLMA 2BVDA 3NZ1A 3QFEA 2V30A 1Q6GA 4XK2A 1KFWA 1RZMA 1C8XA 3GDRA 3SR7A 5BRBA 2R14A 1R3RA 3C2EA 3N6JA 2PP1A 4NRRA 4C6IA 3MP5A 4KIRA 3IJIA 1A5SA 2A7NA 5K9XA 3HFYA 1AQHA 1MYRA 3Q94A 2XH7A 2JALA 4K7VA 4GO9A 4UTTA 2VR4A 2C8NA 2WSPA 4H3DA 4IMEA 3CZGA 4BF5A 1QK0A 3ITYA 1AG1O 4PL2A 4TVCA 3RJXA 1VFLA 4NZFA 1JRBA 2G3MA 2OSWA 1DORA 3OIXA 4UNKA 3PBUA 5FL0A 3H7VA 1ISXA 2W9MA 4QGCA 1KBLA 2QMJA 3NQMA 3VDHA 2V82A 1X96A 3F7JA 1AL7A 1JPHA 1R2TA 1UR0A 4HMCA 1REQA 3IJDA 4HMDA 1Q7MA 3PUOA 4PMVA 1A5OC 4LCSA 1ZAHA 1D2KA 1Q7ZA 3PPGA 4IQDA 3CQKA 4HNOA 1ZPTA 1ADDA 1KO0A 4S1FA 4O50A 1QBBA 2VCBA 4RE0A 2QJHA 3NDZA 1UD2A 1FX6A 2G3JA 1DWIM 3W81A 4HB7A 5K7JA 1DJIA 1KRCC 3L4XA 1V02E 4W86A 3UCDA 3BC9A 3W1AA 3I6TA 3W7JA 1Y8BA 3VNIA 1AH3A 3KS6A 1HKJA 2WSKA 4UQAA 3NOEA 2HSAA 3LUTA 4AD2A 4F0HA 5C8BB 4O8RA 4U3CA 4QEHA 3T05A 3GU9A 3AYRA 3TYAA 2E1DA 1E5JA 3CHFA 3N15A 5HAOA 3EPNA 2Y5JA 3CMJA 1QTWA 2ADAA 5BRPA 4GUIA 2WC7A 5M3WA 4J27A 4DBEA 4JEJA 3Q65A 2NVDA 3MP4A 2PEVA 2ZUTA 3ZJ8A 1JAKA 1EDQA 3UZXA 5DY3A 2WMGA 3SUTA 5LIKX 1W2VA 2ABBA 1N2VA 1LWJA 2TYSA 1ZJBA 5FEXA 2VT0A 2I5IA 2JBMA 4UQDA 2A7RA 4H9VA 2HXUA 1Q6LA 3MYOA 4JTEA 4Q6XA 1JRCA 3LXBA 4QJ3B 3GYEA 5CSYA 1O1HA 1V0MA 1MVYA 1MW0A 1V77A 1EZ2A 4ATLA 2ATSA 4HD5A 2WZHA 3GDBA 5DANA 2YCLA 3UESA 2Z2UA 4GIRA 4GABA 2O9RA 3R58A 2V2CA 2DZUA 3VD9A 4US5A 3CZEA 4XZHA 4P7QA 1TV3A 4AFYA 3DI0A 3C3NA 3VO0A 2H90A 2OX1A 3UY7A 3PVFA 4GZEA 2V2DA 2Y2WA 3GFYA 3ITOA 4JYFA 2BGQA 3AWOA 2Y7GA 3TR2A 4N9CA 1Q4NX 2WXDM 4J40A 1M7JA 2O9PA 1G4PA 2Y70A 4UFMA 1RCOB 4NZ3A 3KRUA 5HPCA 4TX8A 3B8UA 1HKWA 3HG4A 2PSNA 3LLXA 3VILA 2G3NA 4B5UA 1OT1A 1GQKA 2G4JA 4D8LA 2BY0A 4P7NA 3VKAA 1MUMA 4FF7A 4U33A 5JH1A 2WSRA 4R27A 1G4TA 3TKFA 1L8PA 4CQBA 4K6AA 4F2BA 3MUCA 4GXWA 3CM4A 3SSJA 4P7OA 5I02A 3V5CA 2Y8UA 3ITXA 1M53A 3BVJA 3N12A 3HV9A 3DFNA 1C7TA 1GONA 2XWEA 5CPNA 3JUGA 4JTAA 4P7RA 4RJEA 4TVDA 4DO6A 4PBGA 1PZ0A 4HTBA 1XYBA 1GVRA 5D09A 4UOQA 5BXSA 4QIUA 3WBWA 4V1XA 5KZMA 3SJ3A 1I4NA 3EX2A 3GZ3A 1GVYA 3O06A 1OFDA 3M44A 3P67A 4MZYA 4EANA 4CCDA 3BLFA 5A69A 1R3QA 4ZGYA 3NO5A 2X09A 4HYVA 3A4XA 4X9SA 5HMSA 1D3HA 1W3KA 4IIHA 4LWWA 2ACRA 5CGMA 2D73A 4ACZA 1CGTA 1TG7A 2J78A 3NQAA 3OB8A 1ISZA 4PEEA 1H7WA 4E6MA 1WQ5A 3S6OA 3VGEA 3M4HA 3H12A 3FV9A 4MY1A 4JKKA 4D6GA 4B9ZA 3CZKA 4RE3A 2FZBA 4K2SA 2KAUC 2DY3A 3IEBA 2PMQA 2G41A 1RALA 4A22A 3IJ7A 3NA8A 5AZ0A 1DWJM 3DG7A 1MFVA 3PZNA 3EKZA 3DUGA 2VO5A 3BOXA 3HG5A 1BYDA 4YTQA 4GQBA 1W9BM 3T0DA 1EJ7L 1G4EA 4HHLA 4W87A 2POZA 5G1YA 3NQCA 3IAPA 1KKRA 5ABFA 1KD0A 2OEKA 4EX4A 2CIPA 6REQB 1NFPA 4EF9A 1SJAA 3O3RA 4CKQA 1JFHA 2Z27A 2INEA 1JD9A 3GH7A 1O5QA 5A6TC 4YTSA 3G6LA 3W75A 2G37A 1F4AA 1B1YA 4RNIA 2GJLA 3R0DA 2F6UA 4JFVA 5FESA 1TRIA 1GTHA 4CVWA 2Z1BA 1E6ZA 5U7SA 1I2NA 4YHGA 2ZKMX 4INFA 4S3GA 1W0MA 5FACA 1EX1A 1JF6A 2D3LA 2NT0A 3OHIA 3SCTA 3S1WA 5AZ1A 4GK8A 3TTSA 4IHCA 1QR7A 3VM5A 4DJFC 5EL1A 3B9NA 4M24A 1W3JA 1Y65A 4GISA 3SN0A 1ZRQA 3RLUA 3QH2A 5JBFA 3C3UA 3EA2A 5LSMA 3RPDA 3AHTA 4BS0A 5LHEA 1G9HA 3TYZA 1BRLB 2NVAA 2DORA 4BI6A 3N17A 4AZ5A 3E2VA 3W23A 5FEZA 2NUYA 5CG0A 1OFQA 1KFKA 1B2YA 3EPOA 3NPUA 2QW5A 3LN3A 2A85A 1UIOA 1HUVA 1AUSL 1BRLA 1F2JA 4LYQA 2RH9A 1TPB1 3GC5A 3QBUA 4YPJA 3EGJA 3P5YA 4RPQA 3HPFA 1KCKA 1YPFA 2Z7GA 1KBKA 4LAKA 3SRDA 3DI1A 1DIKA 3UZYA 1DL3A 3STEA 5JBEA 2WZMA 4XV0A 2H6RA 2XJ7A 4XIAA 3A64A 3T07A 1UP2A 1VJZA 1KTNA 5FF4A 2OEJA 4P8WA 3UWUA 3MANA 1XLDA 5TD4A 1NSJA 4JHOA 2ZRUA 2DZTA 2ESCA 3SQSA 3VX1A 3JZEA 3VIIA 4DZIA 2D2JA 3ZS4A 1S2TA 3NQ6A 1V6XA 2AAAA 4WK9A 4MF4A 3SJNA 1RBAA 2GJXB 2E25A 3GR7A 4ORMA 4QAIA 4Y9PA 2PTWA 4D72A 5CAKA 5IFPA 3MWAA 1E9IA 2C3ZA 3W84A 3COTA 4UOZA 4NHVA 3R0KA 3GHUA 3NO1A 2J9ZA 1GKPA 2EF9A 3PK7A 2ZIDA 3GVGA 4O12A 5M17A 3UZ5A 2VFEA 4O8AA 3NQVA 4PFHA 4EPBC 5IBXA 3EDJA 1OFPA 1I1XA 2E6DA 3TSDA 4B3LA 1QHPA 3H4WA 4XTIA 2AKZA 1Z89A 5D33A 2QV5A 3W7DA 1D7KA 3KRBA 3AU6A 3HV8A 3K1GA 4I9TA 2PODA 1ZJHA 1HL9A 1K7EA 3WJSA 4W84A 1HL8A 2NSXA 3N9SA 4DZ5A 5AYYA 4GLEA 5HXMA 3SUWA 1GZJA 2C91A 5CZ0A 3LTPA 4IICA 1FY6A 2VX4A 2G3FA 4F40A 3QHNA 3JRKA 5F4SA 1YDOA 1KBBA 1FH8A 1VC4A 4GCAA 4JHZA 1FWRA 3PTMA 2Y8VA 4LAUA 1YBQA 2H8ZA 3FJLA 4Z1AA 5JH2A 4NX0A 2GK1A 3XINA 2PGRA 1TQXA 1TWIA 2ZZ7A 4DWSA 2CLMA 5AB3A 3S1XA 3CQHA 2QNEA 3H2EA 1LROA 2BNJA 1PTDA 1UR4A 1NU5A 4UR7A 1ME7A 3PZOA 3LCFA 1P7TA 3FAXA 4O0ZA 5I3FA 1KRBC 1TSIA 4UQCA 4KRUA 3BOLA 3K13A 2J25A 3CT2A 4EPEC 2PI6A 1GVIA 4AZBA 1XXXA 3WEZA 5I3KA 4IQEA 5ABEA 2AQOA 1KA9F 1IXPA 1H11A 5LNWA 1UR3M 4FX8A 5BXTA 2OLSA 4LRTA 3L67A 1OFAA 1JVNA 4E4FA 3DYMA 3N2CA 2BB0A 5C71A 1VBRA 4XD6A 1ME8A 3D3AA 4GI6A 1FWNA 3NZRA 2CHRA 1RY0A 1CWYA 4EPDC 2FVMA 3NQ8A 4R53A 1WAWA 1LL7A 3WQ5A 4AIEA 4GMEA 1YTEA 3VZYA 4V1YA 1PTAA 1IGSA 3QR3A 3CEPA 3L2LA 4WEVX 4AQLA 3QY8A 5JIWA 2PWUA 5FJPA 5I07A 4LANA 3QPYA 1QWGA 5H8MA 1XDJA 5AHFA 1UR8A 1WO2A 4KGLA 4E3VA 4DPQA 3E0IA 3RMJA 4XKYB 1K4GA 5A1AA 1SO4A 3JVAA 2EBNA 4DF0A 4M8UA 1ECEA 3LX9A 3WNNA 3EEZA 1YDYA 1SPQA 3SY5A 2X16A 4GKTA 2FTPA 1V3IA 4L7ZA 3W1XA 1FWTA 1A0DA 1SW0A 3HQPA 2E5DA 4TTGA 4ZB0A 2F9RA 3P0XA 2WVSA 1IZCA 1JYWA 4IUOA 5M1TA 4PUDA 2OLAA 1LWHA 2J4GA 4UIOA 3CU2A 3B03A 3PAOA 1XCXA 4QLJA 2OELA 1AQ0A 4RNJA 5FL1A 1PL9A 1UOZA 2NSOA 2NLIA 2G0WA 2XIJA 3VZXA 4AAJA 3QR0A 4CU6A 4WQ6A 5LHFA 4O28A 4U3AA 1S1PA 4IH3A 4Q7IA 2QCCA 2RDWA 4M5PA 3NL3A 3LXCA 5HBFA 1KM1A 4Y7EA 2NZLA 4W8LA 1KRMA 1ALDA 2QKFA 4WKFA 1VJSA 4Y9MA 3ERPA 2SFPA 3WF2A 1YPXA 3E5PA 4DHGA 5F2GA 3L9CA 1SW3A 1K02A 4ZBCA 4B5VA 4HZMA 3CAVA 4RDZA 3P7YA 4UQBA 3LPPA 2EKGA 5JU6A 1W1B1 4Y8FA 3SN1A 2EJ1A 4GJ1A 4D9PA 3CZJA 1BF2A 3CXOA 5AHNA 1JPMA 3Q37A 3HA1A 4NJGA 3REQB 1JYVA 4KMQA 5CC7A 1JCNA 4HPJA 1JPKA 4UTTC 1XYFA 1NF0A 2CLPA 3VKKA 3WLTA 2DJLA 4IX0A 1BD0A 3L7RA 4AD4A 4WOZA 4GQ0A 4MDPA 1UWSA 3A23A 1RQHA 5LNVA 2VVNA 2XN0A 5MF5A 4MLRA 2DZAA 5JIPA 5AVNA 4F48A 2I9EA 2PTYA 1HW6A 2OLHA 2E28A 3T08A 3AQUA 3FIGA 4H7ZA 3QSTA 3H2FA 1HL2A 4U10A 5H2ZA 2Y85A 4PA8A 1SGJA 2PWDA 1B9ZA 2EXOA 2F61A 1DWAM 4RKAA 3GIQA 1OX6A 1XLIA 2FHCA 1W8SA 1BSLA 5LXEA 3MJMA 2RDUA 2VTFA 1US2A 3GIPA 1YDVA 1I8JA 1MW3A 4BJHA 2OYLA 2FJKA 1VLIA 4M80A 4ML9A 2DSWA 3B05A 4GBDA 1J2BA 4GUGA 5M2FX 1OB0A 3SCVA 3AJ7A 2PDCA 3KHDA 3V1PA 4HTYA 5A6JA 5AFDA 4ENLA 3W7OA 2J7EA 2HCVA 3PZUA 1F6KA 3TV8A 4OQVA 2C18A 3F5LA 1Y5VA 1K8ZA 3BWWA 3N25A 1T99A 3NVDA 2NQJA 3RGTA 2BFGA 1LOLA 2NXGA 3TYBA 3P3BA 4HGXA 1YYAA 3NNTA 2DZSA 1XIBA 1WPCA 3PZVA 3OLDA 3UA4A 4HSHA 5KEZA 4J2PA 1DWFM 5I3JA 3WJWA 1QI2A 4GD0A 3AIRA 1LM1A 2ISVA 2QIIA 3UR8A 2Y5EA 3QW4B 4ZQRA 3R12A 2GVJA 3BAIA 3IIVA 3DC8A 2HISA 1GNXA 2VX5A 3VX0A 3N4AA 4RW5A 2XWDA 3UPMA 3MT1A 4LJ3A 2DV0A 3WY1A 3WQPA 5AHIA 1FFRA 4M1RA 1QOPA 3WBAA 3GC4A 2DT3A 4CNTA 1JZ6A 3LERA 1LQ2A 1W1IE 1ICQA 2DZXA 1ADOA 3P80A 1R6WA 3MI2A 1GOQA 2PWEA 2VGFA 1XGEA 3KOXA 1T40A 1EO7A 3E6EA 1EOKA 4BHYA 3W76A 2RKXA 5D38A 1G0CA 3ABQA 4FSAA 4FLOA 2XIQA 3CLWA 3UBPC 3T78A 5CCZA 1WXYA 4IMGA 2R82A 1B5TA 4Z1YA 1NWUA 1QPKA 2PWHA 4WD0A 3W2KA 4RL3A 1XYZA 1HNYA 4QE1A 2RHGA 3CV6A 5G4HC 8RUCA 4MWAB 5DO8A 3AHYA 3W07A 3EDDA 4N9DA 5GPRA 1OK6A 4LY4A 4IGNA 1JDFA 2J66A 2PDMA 3IWPA 4RDWA 3SUUA 1SFSA 2YB4A 1DJHA 1A0EA 3A9BA 2B81A 3V0TA 3OYXA 3U4AA 3A21A 3FDGA 3B8SA 3F03K 3I7SA 1EJSC 3QV8A 4PRTA 4X9YA 1D9EA 2CW6A 4GI9A 3SGGA 5A8NA 4ICCX 2OWWA 3IRDA 4PUMA 2BTMA 1JF5A 1LYXA 3A13A 2HWGA 2D23A 5J8LA 1UG6A 2J7DA 1RAKA 5EYWA 2PDPA 3BGJA 2BVYA 3LCGA 1J0KA 1E6QM 2QAFA 1CGUA 4H4IA 3LHUA 2CLLA 1Z42A 4PTMA 3WUBA 3W86A 2W6RA 3PWIA 8CGTA 1RP8A 1ZGDA 1RSCA 2BY2A 4YS1A 3VOHA 1F8MA 5CC3A 1IT7A 2WHKA 3VKCA 3LCXA 4EK7A 2E5BA 1QI4A 4RK8A 1NF7A 3TE9A 2GJPA 2F6XA 2PFHA 4A2RA 1UBSA 4AIOA 3WX7A 6ENLA 3NPVA 3S9ZA 3RITA 3W74A 1M7XA 3WENA 2WVVA 1W8GA 4G7EB 4J3SA 1K1DA 1QJWA 2WHMA 3EOEA 3ITGA 3B8DA 4JQAA 5EBUA 1ZCOA 1XLFA 1FWBC 3WLJA 2HEJA 4ONVA 1UA7A 3I68A 3OZYA 1UA3A 1XLCA 2UY4A 3S2NA 3T4WA 3GVRA 2OT1A 3P61A 4TXEA 5EMUA 1CLKA 2AGTA 4GUJA 1HJVA 3HFTA 2WHJA 3O15A 4XVEA 3A4WA 5MHBA 3WF0A 4RNHA 2E9LA 4H8UA 1W3TA 3N19B 3VDGA 3ARXA 4K8EA 3KBJA 2YCLB 4LS2A 4GYJA 3LG3A 1B4KA 1E1CB 3MHGA 4L6OA 3V4BA 3BQ5A 3KBVA 2CC0A 4LB4A 3P74A 1XLHA 5JUVA 3MSDA 4LUJA 2P3ZA 1FHDA 3NZGA 2CXEA 5HANA 2D69A 3T40A 4YL2A 3L2IA 4YCOA 2I5GA 3KVKA 3KBNA 4I3GA 1JGMA 3CL6A 3H53A 3UR7A 2QPXA 2ZRXA 2GOKA 3PBVA 4R34A 1HG3A 3EDFA 4ERGA 1RLDA 1V3LA 1CYGA 2YDQA 4HOXA 1AK5A 2BMBA 3EB4A 5AVHA 2GGJA 4MWAC 1ZHAA 3IGSA 1ISYA 3C8FA 2FJUB 2CLHA 3DHUA 3EWUA 5IHRA 4I5UA 4WXZA 3DN5A 4D6JA 4WUIA 3FDKA 5DX7A 2OFJA 4D6FA 5HQEA 4AXKA 3F4DA 1RJPA 5HA7A 1XW8A 3O9NA 4N02A 2VD8A 4TO8A 1X97A 4PCFA 1GPWA 5D9MA 3BZJA 1G4SA 4G8TA 4HHPA 2WSYA 1L6WA 4PMRA 5CPQA 3U7BA 3MY9A 1LRTA 1S5NA 4YU1A 1BAGA 3UNDA 1O12A 2ZICA 1SSGA 3VIHA 3KZPA 1KR0A 1H41A 1IT0A 2PWFA 4ZFCA 3T81A 1TZZA 3M0VA 5CLTA 2CLKA 4W4QA 2WW5A 3KTCA 2C1HA 2MUCA 1IXQA 2R6OA 2XFYA 3QN3A 4AVOA 3WFLA 5DBTA 3RRXA 1FWWA 2D0GA 1JZ8A 2Z26A 3W87A 1UKQA 3THAA 4D2JA 1KB3A 1J8VA 1W5OA 5KSWA 2VVSA 5D2TA 1ONRA 3W6MA 3VE9A 3LSBA 1CECA 4G7FA 2WCGA 5CJ5A 4FI4A 3S83A 3MA8A 4XD3A 3ZJ6A 2ZRYA 2OQHA 3B40A 2CHOA 3BURA 4QLKA 1SYTA 2Q8ZA 5FF3A 5IBXC 3PZ9A 4LF2A 2Z24A 2OSYA 3NSNA 2QJMA 4NJHA 2W63A 2NT1A 6ALDA 4DWSD 2WBKA 1PIGA 2Y1HA 5AOUA 5LYRA 2ZUVA 1E4MM 1S1RA 1WA3A 4LUTB 5CBBA 1GOIA 3W2MA 2XSAA 3KLLA 1XBZA 1QI0A 1KQZA 3N4FA 2PLCA 2YW3A 5LZLA 1H09A 4J35A 3URBA 1PE1A 3K1DA 4O1AA 4JTDA 2X0SA 4CEUC 2QZRA 2HS8A 2P88A 1ZFJA 1F3EA 3WD3A 1I0DA 1UASA 4MWAE 3A22A 4AC7C 5E0CA 3FYYA 1LBLA 3C4UA 4XISA 2CESA 3FEQA 4HBKA 3BPWA 1O1ZA 3UCCA 1ENUA 4AYSA 3GKFA 4AIBA 2E09A 3WNPA 3PR2A 2WVVB 3PJXA 3P0WA 4IUGA 1O5XA 2XGZA 4ZSTA 1IXNA 3QTGA 1PWLA 4DIAA 2ZX7A 4PMQA 3GTIA 2B31A 4TX9A 4S3DA 4DAIA 1T41A 4V2XA 3NTYA 2XUCA 3FXGA 1JPIA 5HULA 1W5PA 4V28A 4JDYA 3NQ2A 4L80A 1GPFA 3KBMA 4MNLA 3TZFA 1OFRA 2O4MA 1FP9A 1WKFA 3SCNA 3ZYZA 3JS3A 3UJEA 3N1AA 3WDJA 3TA9A 3QVQA 2VC9A 1DTUA 5KZEA 4BI5A 2D0HA 4GZJA 1DPMA 2DH2A 2Z25A 3JU2A 2ZUWA 4TIMA 2WPBA 4F4RA 4XD5A 1YLVA 2HV5A 1VENA 2V5JA 1FP8A 2PGWA 3QSRA 1FCUA 1WB0A 4GY1A 5EKYA 3L68A 5CPSA 3TZNA 5H1WA 5SWUA 3EB3A 2G97A 4UCGA 4DNMA 2YA2A 3L5LA 3P6LA 2PU1A 5A6LA 4D6HA 3UWZA 3HTWA 5L6UA 1XSKA 5LIYX 1RBOB 3HZ3A 4UMCA 4JY8A 1S2WA 3U9IA 6XIAA 3IUIA 3S6DA 5EU9A 3WN6A 5XIAA 4A3YA 3HQ1A 1GK8A 1EWEA 3RR1A 4GACA 4WGXA 4HHMA 1XFBA 2TRSA 5K3VA 3VE7A 3SRHA 1V0LA 3BXWA 4ERAA 2WANA 4IP7A 2J7CA 4FEZA 4KWWA 4LYRA 3BCDA 1PCWA 1E3ZA 3VCCA 2LLEA 2WB5A 1ZP4A 2IW0A 3ONBA 2PRMA 5AHEA 2EO7A 1A4LA 1XINA 2E0PA 4L1GA 4ZEPA 1RXOB 2XM2A 2NWSA 1Z6KA 3BOFA 3DGRA 4DB7A 3VIKA 3C5QA 4X3ZA 2E8ZA 3BL3A 1UYQA 1P43A 1WZKA 1SQ7A 2FQIA 1S2AA 3F4NA 3POCA 3L0NA 1JFXA 3DBNA 3LA4A 3M46A 1AFSA 1Q45A 2GGEA 3QZAA 1HQTA 5CGTA 1P0BA 5ECUA 1LUCA 4M82A 4PMXA 1EUNA 3PJWA 3C0JA 4K8HA 3DKLA 4IFKA 3FYOA 1H1ZA 4AD3A 3H2MA 1EFZA 3IV3A 7PTDA 4R85A 3R79A 3W1QA 4BCEA 3NAVA 3S42A 7ENLA 4MB4A 4DYJA 4QS6A 3LGDA 3VDBA 1LT8A 3KEHA 4H6QA 1THFD 1DIDA 3KX6A 1P5BA 3SCWA 1CENA 3FHAA 2Y89A 1R7OA 2JIEA 7TAAA 4JQ2A 3V5OA 4FA3A 1Y7VA 2I7GA 4L4OA 2G4FA 1OCJA 3LPGA 2WWCA 3KTSA 1EGMA 1MNZA 5K4ZA 2VXNA 1JNDA 1QO5A 1P0DA 2GVLA 4LVBA 1HVQA 1HO1A 3CMFA 3UZJA 1VBGA 3C2OA 4HA1A 1Q6OA 2PWGA 3QOMA 4F0KA 4F2UA 4D6EA 3CWHA 2E7FA 1FWGC 1IGWA 2DW6A 3POHA 3ZWSA 5BYWA 2PAJA 1RV8A 3N6HA 2ZC8A 1AD1A 3OZMA 1TJ1A 3BE7A 3O16A 3CUJA 2FGZA 1JXKA 1K9DA 4Q6JA 3W70A 1W56A 3IANA 3W37A 4C60A 4Z42C 1Z32X 4AZ7A 4UR9A 2XFWA 3LHWA 3NSMA 1W9VA 4K38A 1Q2SA 4CNUA 3MSYA 1PZ1A 4E2DA 5C0QA 1EXPA 2EAWA 2J13A 2NVCA 5KETA 3MCMA 1IEWA 4RZBA 4XAFA 3W1MA 4MGGA 2VFGA 2ZA3A 3PAJA 3K4AA 1H61A 2DSZA 2GOUA 2CBVA 4O16A 4IMDA 4CD6A 1W32A 3R11A 1V6UA 1W37A 3APGA 3O6AA 2WQDA 1PIIA 2EG7A 3LRLA 2EHHA 3V75A 4ZL1A 3AHZA 3ELFA 4LVGA 1OABA 1F8IA 4DQWA 2GGGA 3WH9A 5KMYA 3P2VA 4QSFA 3R25A 3WUFA 4UTIA 4DEFA 2QCGA 2WZIA 4KRZA 1HKKA 1VFTA 1OYBA 4FXJA 2EQDA 4XO6A 4FOKA 4ECLA 4XSMA 2D20A 2ZDRA 4MKSA 5B7YA 3I4KA 3U5YA 1C8YA 1R3YA 2FVKA 2B7OA 3LGEA 2EPKX 2QJIA 2CPUA 4IGHA 2P0IA 1FTXA 3VNKA 2QPUA 3BJSA 5CH9A 3VOIA 4ADTA 4OWGA 1NM9A 3O2LA 2Q3OA 2Z1KA 3VKBA 2J8GA 1DJNA 1VHCA 2QCDA 1UIPA 2OT0A 3EX3A 3VINA 1QWKA 1SZEA 1DE5A 3IACA 4XAYA 1N82A 5CQ1A 5DMYA 1TX2A 4MADA 3ZR4A 2QHAA 2ZBTA 3CUHA 3VIOA 2GGHA 4JTJA 1GJWA 2Z6JA 1K77A 2OJPA 1EB3A 3TJIA 5C9RA 4FLRA 2XH4A 4LT9A 3T0AA 1V7AA 3AIBA 4MAVA 3E96A 3KOWA 3OP2A 5I06A 1QATA 1SZNA 1KFJA 4JN8A 3ALGA 1LLWA 2UBPC 4J3WA 4S39A 3WQFA 1K6AA 4E8CA 2ONEA 5I3GA 3ENLA 4C6OA 5BZAA 3RX3A 1K8CA 1XKYA 1LG1A 4E8GA 1TWSA 3H2OA 4FIQA 3SQLA 5TIMA 1XF0A 3V0SA 1PTGA 1PYFA 2G5WA 3ABXA 3CWNA 2PD9A 1Q6QA 4QM1A 4EVZA 4QHRA 3TC7A 1BGGA 1QPRA 2QVHA 2TMDA 4E4UA 2AKMA 3GSMA 1HJQA 4Q4SA 1V3JA 4G56A 3CS2A 3O8AA 3II1A 2WHLA 1VBHA 2NV1A 1W9DM 1F4HA 1KCXA 4GIEA 4QCEA 1VJIA 3W26A 1UWTA 1LG2A 1CT5A 4OV4A 1KWKA 3V3WA 5CC6A 4KWVA 1LLOA 1E5NA 2CLEA 4GFIA 1FXPA 2FYMA 4OJYA 2V5CA 3WQVA 1OYAA 2YKKA 5TF0A 4PE8A 5HNNA 5EPDA 2QYGA 3WEOA 1I2RA 5G4EA 2YB1A 1BWLA 3MUZ1 2XPKA 4GI8A 3MBFA 1XH2A 2Y7FA 4O4VA 2JF7A 2XVGA 1E6XM 1XLLA 2WM0A 3UWQA 3VNLA 3VOJA 2Z7KA 5CGQA 3NSXA 4DBWA 1Q5MA 1EP1A 2QJJA 1J0YA 5M5DA 1BYAA 1XG4A 3PNZA 1TV5A 2BXVA 2PLKA 1GJPA 3G1FA 2H9AB 2IPGA 2IKIA 2CZDA 1TV8A 2E3ZA 3M5ZA 4GYPA 2V9DA 4RUBA 1F07A 1XH1A 3W7QA 4HVXA 3W29A 1B3VA 1XIFA 2C1IA 4B92A 4ORIA 5ABFB 4DX3A 1EQCA 3QLDA 1DIEA 3W88A 4E0CA 3DZ1A 2CBUA 3MZNA 3OVQA 3S2MA 1J0HA 4Z1CA 3WQWA 2JQXA 3OZPA 3G6MA 4HJWA 3UJSA 1MW1A 4E2BA 3W7NA 2V81A 2GUUA 3KDNA 5I3IA 1R3WA 5JXQA 1UD4A 4MZ8A 1XLEA 1TA3A 5FJUA 3N34A 3OQ8A 1YW1A 2QCNA 3MMWA 5AHLA 4XZ9A 4OT7A 3M5XA 5HNRA 5BXRA 4H2HA 3TN6A 3CC1A 4LUSB 1LP6A 1UR1A 1R9ZA 4DRSA 2GJRA 4AWTA 4A8NA 1LBFA 1JCJA 1OIFA 4PBEA 3NYZA 4N9BA 3AYVA 2PDWA 1VD6A 2GZXA 4ZENA 4NVTA 2YDAA 4EAYA 3NPWA 4GJJA 2J47A 1H7PA 5E0KA 1ITXA 3F2CA 2VRJA 1PIFA 1GHSA 2VP8A 3LM7A 2CLFA 3ITCA 3UYIA 3PZGA 1NQKA 1S2VA 4FAMA 1LOSA 3B8VA 5IDIA 2R1KA 3D46A 2C13A 4MM1A 4ES4A 1TR9A 1RVKA 4JZ5A 3K30A 5I0DA 3PUDA 4P7LA 1QNSA 4XAGA 3FA4A 4NP7A 4NT0A 3HGRA 4B5TA 1ICPA 3RX2A 4Z2LA 3QPEA 1M7PA 4HZ6A 4WCJA 3GG1A 1CGYA 3TLQA 2PTDA 2OMAA 4LSBA 4Z0JA 1UMYA 5DMMA 1V08A 1ZBCA 2ISFA 4DBSA 4NZ1A 4AISA 3FKRA 4M6VA 1D8CA 2Z00A 3S5OA 3W7KA 2A3AA 3VDCA 2WNWA 3H2NA 3MO7A 4QS5A 3SUSA 1NWRA 1J96A 3TQPA 4IPLA 3A3WA 3OHMB 3W1TA 5A5WA 4C6BA 3MDWA 4NSBA 1JQXA 1AMYA 1X98A 3AS1A 4UWMA 1W5QA 3QMSA 5K9DA 2WVTA 1GYNA 1Q3NA 3E49A 4JTSA 1IE7C 3MUXA 4HCLA 1J12A 3TVAA 1BVWA 2Y63A 4CEXC 1L8NA 2RAGA 4KF1A 2UV8G 2RJHA 3EAUA 3DFPA 5A8MA 2YFNA 4CQDA 3IK2A 2VR5A 4BEUA 4MNJA 4PMNA 4O14A 2WJZA 2ZE0A 4BKNA 4Y6GA 1XIIA 3M0IA 2XFRA 3B8WA 3LI0A 5JQ9A 3RRAA 4F0LA 4GFSA 4NNBA 3NXLA 2A3LA 4ZE4A 1BYCA 3EZ4A 1O66A 1RA0A 2CHNA 1CDGA 3KS5A 1R38A 5HQMA 4PUKA 3S9YA 4WLCA 3EMQA 4J2MA 3FS2A 5CC5A 2AL1A 2HXTA 4YMZA 3GHRA 4JNZA 1U33A 1XIGA 3EYPA 4R33A 3GXNA 3C56A 5I09A 1PX3A 3NM3A 1JJKA 2WPGA 1E70M 2VKZG 2PDQA 3UXAA 4W9TA 4QNWA 4UNIA 4XSLA 4XZLX 5CLWA 5BOFA 2WAGA 1JCLA 4IIEA 4LRSA 4S3JA 4C7GA 2PB1A 1G6CA 1CEOA 4OV9A 3I3EA 5G1MA 3RPTA 2ZADA 4QR6A 1YBQB 3SADA 4C65A 1CXHA 5C54A 5GJMA 4CCEA 2PTXA 2A3CA 3EWDA 2GK1B 1OEPA 5EFDA 4ZTXA 3C8NA 4S3EA 3TN5A 4XZIA 5BCAA 3PG8A 4DWSB 1B0IA 2YLAA 4XTDA 2KX9A 1IQ8A 1LDCA 7REQA 4LNYA 3TSMA 1TV4A 1N8IA 1F73A 1KGXA 5AC4A 1X1ZA 1GT8A 4FNSA 2YZRA 1YKWA 4MTVA 5CJNA 3M43A 3TX9A 1L6YA 5H91A 5CZKA 4L9YA 4ML4A 4QRNA 4Q8OA 3L66A 3AS0A 3GFXA 2VZOA 1QW9A 2IUZA 2YR1A 1I2QA 3BLKA 3LZ5A 4IXHA 1UQZA 1I45A 2FZ9A 2Q02A 3TR9A 2BSLA 4CD8A 4LQ1A 1GTEA 4DJDD 1JYXA 2C7FA 3W1LA 3VU2A 3OYZA 4CQCA 1WXZA 1YXYA 5T8GA 2W5FA 3ZQ9A 2JKAA 2HVNA 2YCJA 1EOMA 2RUSA 1OF6A 3AFBA 4I5XA 1V02A 3OODA 3W85A 4IF2A 1KM6A 2PF0A 3TYUA 4MWAA 1H2JA 2DZPA 4R7OA 3DEQA 3M0LA 1VR6A 1YADA 9CGTA 2VYOA 3GXTA 5ECVA 2E77A 3G3DA 2A3BA 3WK0A 2ZRZA 3W7IA 2Q6ZA 5HNUA 4N6EA 3FLUA 1UP3A 2QR6A 3CPUA 4F0SA 3RYSA 2VELA 3I4EA 3TJ4A 2YLLA 4HNCA 4KCVA 2ZQ0A 2QAPA 2WV8A 4ZOAA 2VUNA 5CZTA 2C6QA 3F4VA 1EUAA 1VLWA 5DXYA 3ITVA 4O19A 3BMVA 3M0YA 3G3MA 2XM1A 3D0CA 3N13A 1A5KC 3ARRA 2E9BA 1B3WA 4QCFA 4Z2JA 5A6KA 3FX4A 4S3FA 5D37A 1XWYA 4BWLC 3QZEA 2QV4A 4Q7NA 4OTKA 2ZUMA 4O1BA 3B9OA 1UZHA 3EBVA 4PB5A 2ACUA 4GXPA 2NQ5A 4S38A 1NH6A 2NQLA 2PCQA 4O1DA 1G69A 1A5MC 5CXPA 1EO5A 1VAHA 3PHAA 3CO8A 4GUHA 1K03A 2VZSA 2NX3A 2IMRA 3WLKX 1MXGA 4WRHA 4Y9OA 3MWCA 3ARVA 3RO6A 3PBGA 2PDKA 1X6LA 3A3HA 1JL8A 4FX7A 3CIVA 2AAMA 4RX0A 3AALA 2PU0A 3NXFA 1VEMA 1TJ0A 1BWKA 4NL1A 4UFHA 1W5NA 1OX4B 4KEVA 1G7UA 2WWDA 4ZTYA 3W25A 4QX4A 3Q45A 1P0NA 4QJ1A 5D2XA 1MRQA 3KZSA 4GYKA 3V18A 1CXKA 4UTHA 2TODA 4H9YA 3WDQA 2XVLA 4PTXA 1W1TA 2P8BA 5E5CA 2HROA 2ZOXA 4AC1X 3VABA 4RNFA 2X05A 1ONWA 3TN3A 5XIMA 3TAKA 3MB9A 3SCPA 4E4PA 3CIXA 2ZZ1A 3J7HA 1X7FA 1OY0A 4PTVA 1G7VA 1OM0A 5AYIA 3WUGA 1W31A 2XHYA 2HPMA 3M0XA 5DELA 3TTYA 3GXMA 1O95A 4EAMA 3CT7A 3Q2DA 1PHWA 4I8YA 4ZOBA 4C6DA 3U2OA 4NAFB 3E0LA 1XCWA 3UGRA 3LY0A 4KCTA 5CZJA 5T9CE 1GOKA 1EYEA 1VCVA 3B9EA 1XCFA 3VIJA 3H7RA 4RCXA 3WNMA 4B5XA 4L1XA 2Y4SA 2WJDA 3MPGA 2G96A 1E3XA 3OBKA 1W17A 1A5NC 3UWWA 2PDNA 1E9LA 3EX4A 1IEIA 2VX7A 1U22A 5A2CA 1BEUA 4JDBA 3STPA 1NP0A 2FHFA 3RILA 1S5TA 2I17A 1XLKA 3GRIA 3VIGA 3IK4A 2EGZA 5BOOA 2J27A 4J3ZA 4DY1A 1ZAIA 3FVDA 3ONCA 3IVUA 4HZ7A 3EMCA 4Q8VA 3DFQA 1KTBA 3BCFA 4MYAA 4ZODA 5I79A 2DZWA 1MI3A 2IQ0A 2JGQA 3S1UA 3MUIA 1UHVA 1C9WA 2OX4A 5J5RA 1UUOA 4IG2B 4OE7A 5DT7A 3APYA 4JHMA 5D32A 1KM2A 3GXIA 4GNKB 4Q4QA 4GG9A 3I6RA 2GQ8A 3TONA 3EB2A 5FF7A 3WF4A 1WKEA 3GNNA 1VRXA 1PYMA 4KWSA 3T09A 1Q6FA 5DCDA 3QGKC 1V6VA 4K8GA 1WZAA 2PPGA 4A2SA 3HPSA 1XBVA 2PGEA 1VIZA 1FDYA 3IJLA 1JD7A 3LS9A 3LHTA 4B4HA 4G6CA 4IGMA 4F9JA 4LEFA 3PUEA 3W1PA 1ZBVA 5L9FA 4B90A 3AUOA 1R2SA 4E3TA 1CCWB 3UXLA 4AZCA 4HN4A 3HIJA 1UJPA 3ZT5A 4BZYA 4JKLA 1VFSA 5C6MA 1K8XA 3MU7A 4OUEA 3OVPA 5GNXA 1AODA 5CSUA 2ODOA 3DX5A 3VC5A 4DM1A 4LOCA 3T8QA 2VC5A 1F9CA 1TZ7A 3H70A 5DXXA 3AAMA 1GOOA 1W6TA 2ZA2A 4NZCA 4FHAA 4H83A 3DERA 3TTEA 1VFHA 1UC5A 5AY7A 2WBGA 4ZB2A 2IPFA 1M9HA 3DBPA 1B57A 4DN1A 4GE8A 4H6KA 2CBIA 4DVOA 2VFFA 4C1KA 2PDJA 2QGYA 4QTGA 4NKCA 4O4WA 5MKGA 3SN4A 3LYEA 3CLMA 4C6QA 4PTNA 1GWJA 4ZA0A 2JF6A 2WYSA 3DYPA 3UWYA 3SY1A 2NXIA 1WP6A 1NAL1 3WLIA 2E9MA 3FNDA 4AVFA 6XIMA 2YSWA 2HTMA 3OA3A 4CD7A 1UZDA 3AISA 1YHTA 4EWJA 3TCSA 3RCYA 3UVIA 1ME9A 4LUIA 1H49A 2A4AA 3TYCA 4FK9A 1TB3A 4QE4A 1BHGA 1HP5A 4GKLA 4ZO9A 4HPNA 2QCHA 1MXSA 1BVZA 3T2QA 3VDAA 2FPTA 1DJZA 2C1GA 5I2UA 3DENA 3BK0A 1JUEA 4O1FA 1XG3A 2UY5A 2D0FA 2WNNA 3M1ZA 3TMQA 5I00A 3R7MA 4IPIA 2R24A 3CHDA 1U30A 1M3UA 1CXLA 2VEKA 1RY8A 1PHQA 5HNTA 2IPWA 1S46A 1FWHC 2QMKA 3BAJA 3SEPA 1HKMA 3RLGA 3TFXA 5EMKA 1VCGA 3N4EA 3KVMA 1QI3A 4TX6A 1PDZA 4I9JA 3T6CA 1AA1B 4IPPA 2BOEX 2D1ZA 3LU2A 3IJ6A 3NPXA 5HJXA 2W92A 3QGAC 5IHSA 4JBRA 3PJUA 3OPSA 4GNJA 4QJ4B 3LHVA 1J18A 5EGRA 5KITA 1PUDA 1EIBA 2J7BA 5CEWA 4GVHA 4FXRA 9XIMA 5DCEA 3BICA 3WQDA 1W91A 3S5SA 1W5MA 2QGHA 3LZ3A 3GTFA 1BFNA 5D2YA 4KETA 4XQ6A 1A4MA 3G1AA 2CERA 1AQFA 5H8PA 4NUWA 3PN8A 1R86A 1A3HA 3MP3A 1IT8A 4GC4A 3DG6A 2D2GA 3GHSA 4C6LA 1WDSA 4QSHA 1BTCA 3H26A 3LRKA 3S4TA 3VMOA 3QFWA 1ELSA 4KGJA 4NAFA 4MVAA 3LDVA 3ATZA 3U5UA 1UWUA 4U4MA 3L4ZA 5HPOA 1OCQA 2FZDA 3W6LA 3URQA 3G18A 1JZ2A 2BVTA 3EWYA 5FAGA 1NDWA 1JZ3A 4B5SA 1WKDA 3U7VA 2CWNA 5EMLA 2P50A 2QEZA 3B0XA 3ES7A 4WKHA 4MUPA 3RM8A 3A12A 4WOQA 3UXDA 4V27A 3BV7A 2V63A 2XISA 4IFKB 3IRSA 4JOMA 1T7LA 4MAZA 1TCDA 1E56A 2I5QA 3RJYA 2QF7A 2XVKA 1EDTA 4FNRA 1E43A 4KQNA 3EOUA 4X0VA 1W3IA 1I6NA 2FVLA 1PDYA 2W27A 4IIGA 1A80A 4GXMA 4F8XA 3WFZA 1SFLA 4AD0A 1JNEA 2ISWA 2A6LA 3B4YA 4XWUA 4JTTA 2BY3A 1HKVA 4H8VA 1GQLA 2ZRWA 3W6YA 2ZTKA 3WH5A 1E73M 1E4LA 5H6HA 1GYMA 4AEOA 1E40A 1EEXA 6TIMA 5F1UA 3NEHA 1G01A 4L1WA 4I7WA 1Q13A 3PPCA 4KCUA 4JL1A 3KBWA 1OYCA 4YTUA 3K8KA 5E1QA 3QMTA 5FCZA 3OGSA 1MZRA 3CUIA 3GW0A 2X8RA 3RAOA 2TAAA 3M16A 3AMLA 4JX5A 1A0CA 3EWZA 3R43A 5CBIA 3F4CA 4D6DA 2AOSA 2Y62A 2WMFA 4BQ5A 4O52A 3BGAA 4W7WA 2VWTA 1PZ3A 3VKDA 4REQB 4C5ZA 1ADSA 3ARTA 3PSWA 1VPYA 1JCTA 4V15A 4MB3A 3CPGA 3AS2A 3AMGA 5HJYA 2XSBA 1Q85A 4HU4A 3UPWA 3TNOA 2Z2BA 4C1NA 3NL2A 4Q8QA 4UTFA 1QUMA 1YXCA 4C5YA 3SGUA 3BTNA 3WQ4A 4REQA 3ZJKA 5AKQA 3UA3A 1W9XA 4ZO7A 3THDA 3CV2A 3BG9A 5DMLA 4EPKA 2BBFA 1G67A 2VWSA 2H9AA 1K9EA 4F0MA 3ICJA 3WK2A 1HKIA 4NNCA 4PL1A 3KRSA 4NIRA 3QYSA 4BQ4A 3N2XA 1WOBA 1GKRA 3CAWA 2DSVA 3CB3A 2XYLA 1UWIA 3G1RA 1EBGA 3UFYA 2WJFA 2VD9A 1UZ4A 4FS9A 3T8LA 3F2DA 3E02A 3CWOX 1J0IA 3GWQA 4JD4A 2DUZA 4HNUA 4WY0F 3AS3A 3I7RA 1U1HA 4KWUA 3GW3A 5HK4A 4Z2GA 2GDVA 3MBDA 2ZVIA 1OFBA 1FWIC 4KRTA 3AXMA 5CKSA 4ZR8A 1OJXA 3I10A 1XJBA 1GUVA 4AW7A 2ZWZA 3ZWTA 3W9ZA 1ZSXA 4I8DA 1BWVA 1J4EA 2E6YA 1A5AA 3H8AA 4ROPA 5C55A 2GJNA 5I24A 1WDPA 4PGLA 1E72M 3FJ4A 4PUUA 4HPGA 4XUYA 4AYGA 4PR4A 4JN6A 5T26A 2CCRA 3UNTA 3PM6A 5HINA 3CYJA 4FOUA 1D3CA 5CJMA 3WDRA 3OLGA 3T0CA 3NZPA 4C6NA 3RG6A 1CLVA 4L5ZA 1C7SA 1XYCA 4GZIA 4OOZA 3FW6A 4JIHA 4NJKA 5A94A 1FKXA 2VENA 4TR9A 1VGAA 1I0BA 2VGBA 3E0WA 3K8LA 1L9WA 2W0UA 2X2YA 3SO7A 4DZAA 5A8OA 3FN9A 1NWSA 8XIMA 4GHRA 3BAYA 3R8GA 1R8LA 4S3AA 1NQ6A 1C90A 1CW2A 3CV1A 1VPQA 1ZCCA 1DJYA 1XYAA 3FY1A 3M0ZA 1BG4A 2XGBA 2ZZ3A 1TZ9A 4IZGA 1F3WA 3QXBA 3S5YA 3LCHA 3BJTA 3QY6A 4Q8MA 4GWEA 4GYPC 1R30A 1YIXA 3HN3A 1GVSA 1VKFA 2BOFX 1VYRA 2QUMA 3G2GA 2X1TA 3CZ8A 3AIVA 3GD6A 5KZDA 4H8HA 1KKOA 4N4QA 4GJIA 4A3QA 1U5HA 5IFTA 4AHOA 4K39A 4WKAA 3BAXA 2HNEA 4PTWA 4YVPA 4PB3A 3PBMA 4FR6A 2NQZA 3FYPA 1KLZA 1OZMA 2YBVA 5A6MA 1XLAA 3AXKA 1UC4A 2IXUA 5GJPA 2H8XA 1OD0A 5G2IA 3WQ6A 2HVOA 3CJPA 3IGXA 1WDRA 4PTDA 4UOJA 5C7HA 1V93A 1UWRA 1RHCA 3O6CA 3OG2A 4JL2A 4MYXA 4HYWA 1H51A 1SW7A 5F4XA 1R47A 1YTDA 3WLRA 3S2JA 1J79A 3AXIA 4FF5A 3QYQA 4FNTA 2O55A 3VC6A 5HMEA 3HG2A 1H1YA 5DEZA 1UOKA 2WKLA 1DE6A 2B7QA 4JIEA 2CZ5A 3WG6A 1QK2A 3MKKA 4DNHA 1UWAA 3A6OA 3CH0A 1POJA 3UGVA 1ITUA 2YOCA 2RDXA 2D24A 2XU2A 4IFOA 4JIIX 5HOSA 1DQXA 3WYZA 4CD5A 3R13A 1V6TA 3E0VA 4BK9A 1XP3A 3NO3A 2BLEA 3F5KA 2DDXA 3ANUA 1ITCA 1HF6A 3FVMA 4AWSA 2FZNA 3QQ0A 5K9CA 1SUXA 3NVTA 3AO0A 1TVLA 2OVLA 1VQTA 1Q2RA 3TCEA 2VRQA 1LBMA 4YYCA 3BMXA 1TX0A 4G2DA 3UG8A 1ZBKA 3FCPA 5M03A 4O0KA 1RA5A 4M56A 3BLIA 4CQ9A 4M19A 3BO9A 2XDFA 4JFUA 2V67A 1DWGM 3VYLA 3P62A 3ALFA 1Q6CA 1Z44A 3GDKA 1IV8A 1P7TB 4IISA 3L65A 4NAEB 4C6JA 2Z28A 1V6YA 3LCIA 3MMUA 1LF1A 3VOFA 4B4FA 4GQRA 4TTUA 5D8WA 5D9OA 3NUKA 4EE9A 2WVUA 3RN6A 1ML1A 2ZZ5A 3SCOA 3W72A 3W7GA 4QFUA 4LAMA 3MUY1 5A6SA 1MO0A 3ZLFA 4LUSA 4YVVA 5CSSA 3IV8A 2J74A 1AJ0A 1Q6EA 1EJXC 5D30A 3QZ6A 3UR2A 1QXLA 4IM4A 4C1LA 4L4PA 1JZ5A 1JQVA 8TIMA 3RF9A 4C90A 4NYUA 2X42A 4LH8A 2DFAA 4Q32A 1E9YB 1RLCL 3PZTA 4AG0A 2GYIA 1JI2A 4TQTA 3UZWA 3DFOA 2XTKA 1FWJC 1XD1A 2Z1WA 3SCSA 3TK7A 3TTOA 3MI6A 2CWXA 2V5KA 3UPBA 1M01A 3KWXA 1W1PA 5D8ZA 1TA3B 1LORA 3LTYA 3R89A 5D2WA 4Y9NA 3LENA 4O57A 1DXEA 3THUA 3M0JA 4R9OA 3RMEA 4O1CA 4A3RA 5CPTA 1RJRA 3T7VA 4US6A 4YIWA 3GYCA 3LLDA 3RLHA 2OG9A 3WF3A 4GY0A 3SIMA 3BLDA 4DBUA 5LKYA 3CAQA 1KW1A 1GCYA 1YDNA 2E1WA 3W83A 4CUCA 1QNVA 4CN1A 4AHQA 3AYTA 2C71A 2A3EA 4EF8A 2VEIA 4IQLA 1C3FA 4G1NA 2W67A 3GXDA 2BV9A 3WJZA 3ISIX 3E2QA 4DJFD 1PPIA 1OFEA 1T6MA 3H6OA 4F2TA 3WUEA 2WCAA 1UKSA 1V51A 4DELA 2HNHA 2R8WA 3T4CA 1FDJA 3ANVA 4UC5A 1KFBA 1F6PA 5REQB 4PZVA 5LA1A 3BANA 4Z17A 2JIWA 1M04A 1V3MA 3HQOA 3WQGA 5G1TA 4EKJA 3OEXA 3I3BA 3SDOA 4JTGA 4DWSC 2OODA 2XIBA 1DXFA 1CPUA 3SZ8A 3QOKA 4X0NA 1DEDA 2ACSA 2OTDA 4PCSA 3WH7A 2E4TA 1BVNP 3M64A 5G5IA 4J1OA 2C19A 3U3HA 1VH7A 1VBJA 1VP5A 2W3ZA 5BNKA 5LNRA 3PWAA 3AIWA 5U4NA 3SBFA 2GVYA 1GQJA 1JI1A 1LLZA 1ONXA 4BF9A 5I77A 2GWNA 3L23A 3DGBA 1SJDA 2WNQA 1EDGA 3GNOA 2O7QA 2X2GA 1F61A 1IZJA 3HBLA 1Q6RA 5DT5A 1NFBA 1WDQA 4AIUA 1MQQA 3WQEA 4XKMA 3USZA 3REQA 3LTSA 5HJLA 2EPMX 1XRVA 3AJXA 1H4PA 1TMHA 3MC5A 4PSPA 1C92A 1R9YA 3KP1A 3HQNA 4UTWA 2YXGA 1S5WA 3C0LA 2HE5A 2QPSA 1OQFA 2HK0A 4HA0A 4CN6A 3BDKA 4WF7A 3LI1A 3AHXA 3MSRA 3B0UX 3ABRA 1VFUA 2PE4A 1TELA 1ECQA 4LVDA 1DQWA 1I60A 1H60A 3W7CA 1JYNA 1VCFA 1A5UA 4LC6A 2FZ8A 3U57A 3VGGA 2W62A 4ZQPA 1J2WA 1KGWA 2OQLA 3EA1A 3QV7A 1UW9A 3NR0A 1ICSA 5GVJA 3VAVA 5DMNA 2PP0A 4JFTA 1L6FA 4KH2A 5E0FA 3KCOA 2J62A 4L4LA 1P6WA 3WJXA 2DT0A 3G1HA 3QLLA 3QEZA 4DI9A 3V36A 4YTRA 4ZXLA 1X38A 4X63A 1Z3NA 2PLMA 5D9NA 4UMAA 3NDOA 3TU9A 1HT6A 2BDQA 4CU8A 3UXIA 1XC4A 3C52A 1S39A 4RW3A 2HJPA 2V5BA 1K4HA 1XPYA 3UETA 1QNOA 3QM3A 4AU0A 2W79A 3FJNA 3KTXA 4QDMA 1REQB 3LBCA 1ZZMA 4H04A 1CTNA 4M6UA 4WIWA 2Y8KA 1OWQA 1AVAA 3W4RA 4EIVA 3QHOA 3O1NA 2R9RA 3JZUA 3PTDA 1CBGA 2VZVA 4YWIA 2Y7EA 2O4QA 2WMJA 3P84A 4HNVA 4D6IA 1U83A 1BQGA 3E2RA 3WBYA 4JTQA 5TQLA 4JX4A 3H7UA 1O5RA 1ZAJA 5GNYA 1GOWA 3K46A 3QMRA 5EY5A 2G3IA 5HWJA 3QC3A 5T9BG 1HJWA 2WK2A 1UCWA 4H6RA 3WLNA 4DUWA 4G9PA 5D02A 4DXKA 2ALRA 3N2OA 2C79A 3A3XA 2Q01A 3U2ZA 4QNEA 3D47A 1FHUA 1Q8JA 3G1SA 4U31A 2EPHA 1A47A 2EEXA 4I6VA 2PDFA 1LQ0A 5D2VA 1FBAA 3DCPA 1AMKA 1FWDC 2HQAA 1E6SM 3T44A 4HOWA 4GIAA 4MIMA 4JTKA 2A3HA 3E74A 2XVNA 4JTFA 1HO4A 4HYRA 3NIYA 4TOQA 3WQ8A 3HOJA 1GZ1A 4GZ7A 3GDTA 1LQAA 4CNNA 4XKYA 4PSRA 1WCGA 2CLIA 1FCBA 1EPVA 3HMCA 4BWLA 3KVLA 1GG1A 1P48A 3M7SA 2WLZA 2Y6ZA 2Y5SA 4PBFA 3TMLA 1XQLA 1E0VA 1IEQA 3KW3A 1AW2A 1IXOA 3PNUA 1A3XA 3VVGA 4X2PA 3F5JA 5FSEC 3DC0A 3MS8A 4U2ZA 3OBEA 3NL5A 3W24A 4Q8UA 4UNLA 1Z41A 3TXZA 1C9DA 3RHGA 4H7VA 5ABHA 3BAKA 1ISVA 3ARPA 1VF8A 3FK4A 1A3WA 1SO5A 1KM3A 3S5ZA 5E09A 4AD5A 3PWGA 4A29A 3O63A 3BW3A 1J6OA 3HMJG 3UG3A 2JK2A 1UD5A 3ZLHA 3AZTA 2BG5A 4G5DA 3WDIA 1QNRA 5AN7A 4H41A 3VA8A 5F7UA 2O7SA 4HT3A 3GE7A 4NU7A 2RDTA 1J5TA 3KFTA 2CZEA 4GQGA 3U2EA 1E51A 1JDAA 3F2BA 4DI8A 1DYSA 1GEHA 3JR2A 4LGXA 2AQVA 3GXFA 5REQA 2CFFA 2C0HA 2A79A 1PXGA 5TBOA 5HMFA 2X30A 5HR7A 2JKPA 3RLVA 2PZ0A 4KFOA 3VMNA 1JXJA 3OA5A 5GNZA 3O0FA 4KEUA 1KQYA 1TV7A 3VIFA 4GGBA 1CGVA 3L2MA 3RFAA 3CB8A 4DXXA 6A3HA 2OGYA 3HU7A 3E0FA 3EWBX 2WNZA 3S2LA 1EYWA 3GDLA 3W53A 3MKCA 3UY8A 3KM8A 3URNA 3ID7A 1NP2A 3SUVA 3SQMA 4AMAA 1J0JA 1XC6A 2X0YA 4P61A 3NL6A 1SU5A 3C86A 4D71A 1XIDA 4WX2A 3C0QA 3I3DA 3QKZA 1VRDA 1E55A 2OGJA 3DFHA 1XIJA 2WZTA 2CU0A 5FEPA 1FVPA 3U48A 3CHCA 1CNVA 2ALDA 3FEMA 1XUZA 2W66A 3LLFA 1VFFA 1A53A 3LK6A 4QLLA 1V8EA 3N3TA 3HO8A 4A21A 2BODX 3UJ2A 4JNYA 1CX9A 1XSJA 4CCCA 1E4IA 1R3SA 4PCTA 3GKAA 2J79A 4FNUA 4Q4RA 3O07A 4KCWA 2NV9A 1RD6A 3KVJA 1QO2A 1XLMA 1YX1A 3CHVA 1EZWA 4XO7A 2DGAA 1WKYA 1K9TA 3SM0A 3L4YA 3ZLGA 2JFEX 3TW6A 4NY2A 3ECQA 1PSCA 3WZ0E 3MJYA 5A8PA 2J77A 1YNQA 3LQLA 1B4EA 1E71M 3WLLA 2J24A 1TVNA 3QF0A 2PRHA 4DUXA 2REQB 2ZC1A 1XYLA 3IIPA 4IMAA 4ATWA 2GSHA 2P8CA 3C2RA 4FLSA 1VYSX 4NZ4A 1H63A 5E9XA 2DT1A 2PTZA 1BG9A 2DW7A 3M6YA 5E70A 5A6BA 1XPGA 2OB3A 1XSIA 2QCLA 5DFAA 4ZZ9A 4HCDA 5HUPA 1W1VA 1M7OA 2NLYA 4RLIA 1SSDA 3MCNA 1QAPA 5I78A 4YTTA 3R10A 2W61A 3NQ7A 1KXHA 4QROA 4OBRA 4ASTA 1J0ZA 2YCEA 3IAQA 1PX4A 4JR5A 4MPKA 4JCLA 3DFYA 1AW5A 1M03A 2PCEA 4S3BA 3MZ2A 3V7PA 5C2CA 5E93A 2O9TA 4S3KA 4Q33A 1EPXA 3ZR6A 1OF8A 3Q67A 4ZOEA 1H5YA 4ACYA 1F7BA 5HR6A 1Z8AA 3DU0A 2QDDA 2OZTA 3L12A 4W5ZA 4GBUA 1ODUA 5A6BD 1XBXA 1KFLA 3H2CA 3NCOA 4M3PA 4DJDC 4DJDA 4ICNA 5GJNA 1WE5A 4LV4A 1X6NA 4F3HA 3R5EA 3PTQA 2F2KA 4KESA 4MPQA 4DLMA 1RUSA 2YL6A 3HPZA 3H22A 3GAKA 1CB2A 1VIWA 1DV7A 3PFRA 1MSSA 4QDWA 4OFCA 2DQWA 4MB1A 2FHBA 2V5DA 2ON3A 4K68A 4ZMGA 1AZ2A 4CGTA 3AMDA 3GS6A 2VC7A 1E0WA 3RU6A 1BPLB 1EKOA 5BXPA 1KC7A 2PURA 4DBDA 5A2BA 2P3EA 4YHEA 4RZ6A 1S38A 2WMIA 1Z7AA 4RV3A 5BMWA 4JIPA 3GR8A 2AQWA 1HX0A 1OZQA 1PKMA 3OVGA 4UUIA 4GY7A 4B5NA 3VD4A 4OHQA 2YL8A 3EWXA 4CU7A 1S5VA 3EWWA 3CK5A 3ABZA 1FWAC 3VIPA 4BI7A 4M0XA 1E4NA 1TKKA 2HDJA 1GHRA 2FH8A 5JBDA 4LUTA 1EHNA 3WH8A 4LAOA 3UJFA 3RK8A 2TPSA 5AYBA 2VL4A 1B31A 2YL9A 4KEZA 2ZTJA 2YBUA 4AY7A 4FPSA 3LQGA 1ZALA 5DLCA 4X60A 4GX8A 1NTHA 5LNUA 1H0IA 1B3YA 1DHKA 3GR4A 4GI4A 2GGIA 4R88A 3GG7A 1MWOA 5CG7A 2GPTA 3P8IA 3SRKA 4OVXA 3BMWA 5LGZA 1JG9A 1SZGA 2FGBA 3IIZA 1XIMA 3PZIA 2J7GA 4Q8TA 2ZCGA 3THQA 3FSTA 4HOZA 2IQDA 3CO4A 3WEMA 3TOYA 4MMWA 1H3GA 5CBJA 4PMJA 4PMUA 1BTMA 3RNDA 3TA6A 4Z0SA 2Z1VA 2CLOA 3SECA 4GQQA 3LOTA 3L4VA 1UUQA 2WLYA 4TV5A 5GQBA 2VDHA 2PLJA 2ZUUA 4B3KA 4YNGA 1OCNA 3DOPA 3PPHA 4HMNA 4L64A 3LBMA 4C6FA 3VGFA 4GC3A 1JIBA 1IZKA 4PFMA 2ZXBA 1JUKA 2V3GA 5BU6A 2NUXA 4Y90A 1XLBA 1TIWA 4J4KA 2QDHA 2F7FA 1FQ0A 2OYMA 3CZLA 4HNNA 2NQHA 2W91A 3NEVA 4DPPA 3IPWA 5EMMA 3ZOAA 3UEQA 4UCFA 1O6IA 1IIGA 3M5VA 1OADA 1TV2A 3W7PA 4IFRA 1IF2A 1TVPA 1YQ2A 3S0CA 4AY1A 2DT2A 4W5UA 4JKMA 4LYPA 1OC6A 4LAZA 1KNWA 3MQTA 2VGGA 4WGHA 4FNQA 1UR9A 1KCZA 2FTYA 3STFA 3A5VA 3GVQA 4WJ8A 2AMXA 2ATMA 2E6FA 1HZYA 2DSKA 4JTRA 1AL8A 1V4YA 4IMCA 4MJ4A 3Q4DA 3UF9A 1EBHA 2ZXQA 1GVOA 1KV8A 1XDLA 3H54A 4QQUA 4O1EA 3FGCB 1TUFA 3LM3A 2NXHA 2QDEA 4IPNB 3W7EA 1DJWA 3WO8A 5DF0A 1FCQA 4LV9A 2QLYA 3TQ0A 3B97A 2WMKA 3A9IA 3IARA 1SO6A 3GBEA 1TREA 1WOAA 4HSNA 1DJXA 4Y96A 4QITA 3DHPA 2GVEA 2VEMA 3WLHA 1XUUA 1B3ZA 1EA0A 1XR2A 2VOMA 3QV9A 1UKTA 4M7TA 4BQ2A 2GDUA 3MO4A 3WH6A 1MEWA 2PGFA 3M0MA 4PMYA 3A4AA 1TJ2A 5I3HA 1O60A 3P81A 1OVDA 2ZYFA 5LA2A 1F6YA 3GNRA 4J28A 3ZJ7A 5A95A 2J6VA 2OR2A 3WCZA 3BG5A 3HPXA 1MUWA 4ZFMA 3HGSA 3DFTA 3IIOA 1XIHA 2E40A 1GW9A 1TWWA 3DECA 4WSKA 2W4XA 3BLLA 4GVGA 3R0UA 1V6WA 4TMBA 3QW3A 1PV8A 2XVPA 5TNVA 4S3CA 4TU1A 4KT2A 3PB2A 4JN7A 4ICMA 1XDMA 2NWRA 1SZFA 3HPAA 4UTJA 4ZQOA 1VFOA 2V5LA 4Q4OA 3BARA 1CXIA 1SO3A 1K70A 1F3XA 4CQAA 4BFAA 2YXXA 5A2AA 2XSXA 1E1EA 1VB9A 1WV2A 1AQMA 4DJEA 3PBYA 3CBWA 2XH0A 5KINA 1FH9A 3O6DA 3OQEA 3PPFA 1H7NA 1EX5A 3M07A 3R8RA 5FAJA 3M41A 4HK7A 3DAQA 4N6FA 1FWFC 3F1QA 5B80A 3XIMA 5CPMA 4A05A 1QNPA 1OFOA 1VS1A 4U5IA 2V3DA 1XI3A 4GOAA 3VZZA 4BQ3A 4PODA 3YPIA 1GJUA 3ZO9A 1EJWC 4AMCA 3LNPA 1N8FA 1R85A 2INFA 1ZLPA 3GHTA 1X6UA 1PKNA 3W2JA 2I57A 3TTQA 3OGRA 2UY2A 4MFDA 4YLWA 5HATA 1RK5A 1WZMA 4MLJA 7XIMA 1IYXA 4J7RA 4F79A 2Y0FA 2V6AA 4PMZA 4DM2A 1E15A 2C0AA 3LSCA 2XIIA 3QPZA 4KEMA 4NXKA 3H24A 6CGTA 2VC6A 3FXYA 3RPMA 1VBUA 3GQYA 3RIKA 1PVNA 3UWEA 4JPGA 4JGDA 4PULA 4FR1A 4NXSA 2BXZA 3S46A 5T91A 3GB6A 4MFEA 1TPC1 1YE6A 3HGOA 3ATYA 5FF0A 2PC8A 1CI1A 1W3LA 2A7PA 3AU2A 4WJEA 4AZ6A 5E6ZA 1MQRA 1OX4A 1C29A 1TR1A 4GVIA 1TMLA 3L4UA 4DWDA 4OBTA 1UB3A 4W7UA 1BYBA 1FDZA 3FAWA 2PDXA 3MV01 1OX5A 3VM7A 4H7CA 2JEQA 4US5D 4PCPA 4PMOA 2FFCA 4AF0A 1R3VA 2FTWA 3UJRA 1YTKA 4GGHA 3S8HA 1YNPA 2VFIA 4WY0B 3QTPA 3SRFA 2Z4GA 5EFFA 2FDMA 5HWMA 5B7ZA 2P0OA 3LRMA 1H62A 1V3HA 5TAOA 1U1JA 3S5NA 4M6PA 4MG4A 6PTDA 2B4GA 3SCRA 3VTRA 3KL3A 3G0SA 4HU8A 5FJIA 2YDSA 7TIMA 3W7LA 3G8EA 1P4CA 2VRKA 3GBDA 5F2MA 2PA6A 3B0PA 2HK1A 3RDKA 2VQUA 1T5AA 1RR2A 3TOPA 3LCWA 4R9XA 4KPLA 2BY1A 1VEPA 2YCIX 1RQEA 1RVGA 4NNAA 2JE8A 1N55A 3PY2A 4H00A 2OCZA 3GVVA 3ARSA 4NYYA 3DXIA 4CNOA 3BLEA 2UWFA 1UD8A 2WC3A 4QG6A 1LJYA 4P5UA 3W1RA 3DHFA 5E6YA 5EMYA 8A3HA 1FHLA 1TPVA 1XICA 1XFCA 2E6AA 1WDWA 3KUMA 4OOUA 1LUCB 1KBIA 3CPRA 1N7KA 2XN1A 5A6AA 3KOFA 3STCA 4LPCA 5K2ZA 4JTUA 3BZGA 3S1VA 3KL5A 3PULA 3E3HA 1NJJA 2Y7DA 1PJ9A 1KWGA 4RPPA 1GQNA 2P76A 2V3FA 4IG2A 3L0KA 3UERA 2CXGA 1UMLA 2X1SA 3WBXA 1FFQA 5ABTA 1UH4A 4H9TA 4PUNA 3E2SA 4LS1A 4C91A 1L2QA 4NJJA 3ABOA 3ZZ1A 4XG1A 3GH5A 2CKSA 3IVSA 4P8VA 3TQVA 3VUSA 3NG3A 2VQTA 3D6NA 3WIJA 1QASA 4FB7A 3N6QA 3INPA 1NOFA 1NDYA 1O7AA 4KWOA 2Q09A 2HBVA 3FHQA 4IJCA 2CYGA 4J3UA 2GLKA 4C6PA 1E6PA 2VJXA 3VKJA 1V0NA 2PC4A 1G5AA 1C8VA 1GEQA 4Q8PA 2DZBA 5FSDC 1XLGA 1QHOA 4Y9AA 1H7OA 1HFBA 3W0KA 4NJIA 4PB4A 3AICA 9RUBA 3MDUA 1IWBA 1KXQA 2FB2A 4XAPA 3MSGA 3OGVA 1ZS2A 3LHYA 1TPEA 1XQKA 5A8GA 3LMZA 3NQDA 5DQPA 3ZT6A 1G94A 1VZWA 1TWZA 1EEPA 3C6CA 4L9XA 2ICSA 3BW4A 4XAZA 3ZXWA 2ZZ6A 1EH9A 1P0KA 3M0HA 3UD6A 1EC9A 3RU8X 5FD0A 3H2AA 1EC7A 4RXGA 1RBLA 3N2TA 4E2VA 2P10A 1EF3A 3LV6A 3WK1A 4ZSUA 4ZE5A 4KIEA 1PX8A 3GTNA 1LTDA 3KDOA 1RK6A 3MVIA 4AEFA 5BMXA 5C9UA 2A1YA 3VGBA 4HK6A 3IJ8A 4DLFA 4JCMA 3AMKA 5FJOA 4PC8A 4Y2WA 2VEGA 3IUHA 3QQWA 2XFFA 3K5XA 2AGKA 4AH7A 3AIQA 2GUBA 2OWXA 1OHLA 1V5XA 1R3TA 4NZ5A 3CUGA 1UPMB 3GG8A 5HUOA 2OPJA 3TW9A 5J5DA 3ZVHA 1K7XA 1PEZA 4AX6A 4ERIA 3W2NA 4C7FA 3XISA 4LALA 1CLXA 3MYPA 3BW2A 3N9RA 4CNSA 1VFMA 4GUFA 5LIXX 3MMDA 3PP7A 3MTWA 4RV8A 4GIYA 4BEQA 2PD5A 3IGUA 4AF0B 2Z2AA 4O17A 2VNCA 2ZUNA 4WR3A 3TW7A 1P1MA 4HA4A 3VIMA 1S5MA 4A3UA 1Q66A 4Z2KA 3EKLA 4B91A 3LPOA 1MDRA 4I90A 3WLOA 2P5NA 3PZQA 4DJED 2ANUA 1UJQA 2OZ3A 3FFSA 1E1CA 2ABAA 1TPUA 1HXJA 3WMLA 1M68A 3WMCA 4R7JA 4JICA 4PN2A 3P82A 3W01A 4XZBA 4K36A 4G7EA 4CCZA 2BASA 1BKSA 2BHZA 3TJLA 2WSQA 5AHMA 3STGA 2Q8XA 5FJRA 4MJ2A 2VGIA 1MXDA 1RPXA 1FKWA 1FWSA 2PS2A 3C61A 3GTXA 2QT3A 4M81A 3D5HA 3C2FA 2X1RA 3OLEA 3R2GA 5D05A 3CGTA 1EA9C 3GUGA 6TAAA 1TQJA 2RJGA 1TMQA 3EDEA 3VD3A 3BJFA 1OT2A 3UYCA 4XZNX 3A4JA 4HHHA 4DO4A 1P6BA 3SW6A 3TP4A 4MNKA 4XZMX 4WY0A 4AHPA 3KBSA 1E0XA 1J9YA 3NQGA 3G5EA 3VFLA 1KCLA 4MY9A 1CGWA 1QHZA 3BCJA 3GU1A 1FUYA 3QHMA 3U6WA 4ZVJA 1EJVC 2V69A 3QGVA 4XVDA 2VM8A 3B3DA 4UTKA 2Y24A 3GVWA 1RD5A 2PRLA 3M9YA 4L61A 3RCNA 3V35A 4FNPA 1KM0A 3O05A 2GJXA 4URIA 2FH6A 2R1NA 2BP1A 4S2BA 2VUYA 3G77A 2VI0A 1A50A 1OSEA 3NWRA 3SURA 3B0VC 2HVMA 2HS6A 1ONEA 4XBJA 2QUTA 3VK5A 3EPMA 4H8NA 4ACZB 5AC5A 2PDYA 3GY1A 5D9PA 4RDYA 4UFIA 1VPXA 3U2CA 4LCQA 3TSBA 3KP0A 2YX0A 1QCWA 1SMDA 4MNMA 1W3NA 5AECA 3WDPP 1W3HA 2ZXAA 2MNRA 1V03A 4Z2IA 1JDDA 4FMVA 3G1YA 2WOQA 2DIKA 3BAWA 3WL1A 1SJBA 3ARYA 4UTLA 2D22A 1HTIA 1A5CA 2DIJA 2QIWA 2X1UA 3WSUA 1NWTA 1ZP3A 3GXPA 4JQ4A 4DUVA 1XM3A 2J7FA 3WL0A 4JQ3A 3ZSTA 7CGTA 1Q63A 4MB5A 1P6CA 4JXCA 4PEKA 1RPKA 4I7UA 4LFYA 4NI3A 3KWSA 4EOUA 5A3HA 1MFUA 4A6GA 1TO3A 4H9ZA 4E38A 3MVTA 4QBXA 4CQ8A 2JGYA 3EOLA 4HKPA 4IOTA 1SJCA 2GVGA 5BWAA 1EQPA 4HPHA 2INZA 2VX6A 5CPOA 4NASA 1B9BA 3CEUA 1EGZA 3EWCA 4HK5A 3PZMA 4I6KA 4JY9A 2HZGA 4AZIA 3SCQA 4LY8A 3RUBL 1AH4A 2I1OA 3KCJA 4MSSA 5DBUA 1P1XA 1W9PA 1SM9A 2ZX8A 1FXQA 2X7VA 1AJ2A 2HE8A 2DVTA 3RX4A 1HVXA 4PCNA 1TPH1 4FO4A 1PCKA 3AOFA 3A5FA 1L6GA 3O7UA 4TV6A 3I7QA 1GYLA 1TRDA 1Y5XA 3W28A 2J6XA 5FA5A 1F76A 4L65A 2REQA 4POCA 2CBJA 3B8IA 1Q8AA 3USBA 4MJZA 5CPLA 5IDZA 1NARA 2J9XA 2GQ9A 3TWAA 3OVRA 1MMFA 7ODCA 3I65A 2VZUA 1D3GA 2G95A 3RXZA 4IX2A 4D6CA 3G1XA 4N2YA 1DJQA 2C14A 5IXEA 4LVFA 3TNBA 3DKJA 3W02A 3EOOA 2RFGA 4D8ZA 1J01A 2D2OA 4JX6A 1E6NA 1JCYA 4JTIA 4WVXA 3S47A 1B30A 4UFJA 3NOYA 4Z08A 4D1JA 3FA5A 4LX4A 1POKA 1KTCA 4N9EA 1YE4A 1YXDA 3KL0A 3DH7A 4YVXA 1WNOA 3WBEA 3P60A 5RUBA 1SR0A 1ZL1A 4QG8A 5DRCA 2IKHA 1Q6DA 3DYOA 2VEPA 2VCAA 5E9AA 2CETA 2G8ZA 4Q4PA 4K37A 4K7YA 3O0KA 4OUIA 4O13A 4E8DA 3N9KA 1EJTC 2Z6IA 3NGFA 1TPWA 2PP3A 2BWGA 3CMGA 5FF2A 4ILSA 1IEXA 3E38A 1B90A 3URAA 4A8RA 2GQ3A 1LZOA 2OEMA 3BGGA 1EC8A 2XIOA 3V5FA 4UFKA 1ZUAX 3VPLA 1I2OA 2ASHA 3UW6A 4C7DA 2AL2A 3CNYA 1LWIA 1KBJA 2Y88A 2PBGA 3GU2A 3BLPX 3SFKA 3EDKA 1YEYA 3TDFA 9XIAA 1H7XA 3ZSSA 1ESWA 3NYDA 4HMEA 1AZ1A 1T8QA 2YBTA 2ZX6A 3RO8A 3AUJA 1ZB5A 5C5YA 1U2YA 3ZM8A 4HU3A 4PRRA 5HQLA 4QISA 1Y5WA 3NJ3A 2JEPA 2AL2B 3BSGA 2QVNA 2YZ5A 5FJJA 4I5RA 4AWUA 1LT7A 2H3BA 2YYUA 2V8ZA 3IUDA 1TCMA 1GZGA 2V2HA 2Z0IA 3N3MA 1UROA 4UXDA 2QUVA 4IXXA 2VFDA 1DTNA 4WZHA 2DIEA 2WKJA 1DIOA 4IIBA 5C2GA 1S3TC 4E2OA 2WCSA 4ATDA 1IWPA 3R1ZA 3WNKA 1W1YA 4UQ9A 4AEEA 4L6DA 3G24A 4HA3A 4AZHA 2IQTA 3FA3A 1RCXB 4G1KA 4H9UA 2ZX5A 1KXVA 3PANA 2R1PA 3W2LA 3OO2A 2ZRVA 4O15A 3KRZA 4I9MA 4IP4A 2WJEA 3N2MA 2WC4A 1C91A 4LC8A 3E5BA 3WD2A 3WMSA 1QPOA 4UBPC 2FGLA 2G50A 4YN5A 4NRSA 5KTLA 1MZHA 1DXIA 4QQ3A 1XL9A 3P14A 2VR2A 1Z69A 4O11A 1BKHA 3E9AA 4J3XA 2PBOA 3UG5A 4XBKA 2V38A 1TE1A 3M47A 2R94A 4QJ5B 4HSOA 3G1VA 2YFOA 3SFWA 2FFIA 2WZEA 4W8AA 3R8HA 3GX9A 2E67A 4JFWA 2VHLA 4GO8A 3WF1A 4HNTA 3AZSA 3SY8A 2O92A 1WUEA 3ITLA 4LU0A 3EKGA 3VNYA 2XN2A 3QY7A 4OU1A 4Q3MA 3VGDA 5LXXA 5I23A 2OZ8A 2ZE3A 1ZNNA 4XUGA 4Q4MA 3WELA 2XH2A 3BUVA 4W8BA 4X22A 1CIUA 3A24A 1XLJA 5D4YA 2A2IA 4JEQA 2EKCA 2X7WA 2I56A 3OU8A 4Q7BA 1QT1A 4UZSA 1BXBA 1ISWA 2PDLA 4M1BA 1M65A 2PWVA 5A8QA 3W73A 2OOGA 1TUXA 2GUYA 4AVNA 2ISSA 4IGSA 3OJGA 4N42A 3MHUA 3L5MA 5FIPA 1HJUA 1I75A 3LPFA 2IXVA 4N4PA 2OSXA 4IT1A 1RP9A 1XS2A 1GORA 1PWMA 4DXVA 1R87A 2OYKA 4C6CA 2DPEA 4CNPA 2DJXA 1A5LC 3UQNA 5DY2A 1ZQ5A 4RE4A 3W3OA 2F2HA 4Q4KA 1KM4A 4W89A 2J7HA 3RCMA 4OBSA 5C2XA 1IIHA 3G8RA 1B54A 3C0SA 3LD5A 3NZQA 2XIMA 3PUGA 1U5JA 4NAEA 2BS9A 4D8AA 3H55A 3EXTA 5CSRA 2BVWA 4XZWA 5D03A 1AJZA 4GCXA 4GNVA 1X7IA 3GC2A 4UZUA 4UFLA 2VFHA 3NQEA 2OO0A 2L5HA 3H4GA 5LGXA 5EBAA 3N11A 2DZVA 1DHPA 1JDEA 3ZR5A 1OGGA 2ZA1A 2YPIA 3WQOA 4LTSA 3PTKA 3BQ6A 4FLQA 5BWFA 4HCHA 3M6DA 1S2UA 3DG3A 4LBUA 2OWCA 1EF2A 1C93A 3B9DA 4OKDA 4WSHA 1WBJA 1OC7A 1O5KA 3EXSA 3G22A 2OKOA 1XRFA 2OZ0A 3IJQA 3THCA 2WQPA 2YW4A 4UQEA 1BQCA 4NQ1A 3SCUA 3UU0A 2DH3A 2PUZA 1H1NA 3P93A 1PB0A 3PS7A 2F84A 1WX0A 1UPPA 4J5NA 3S6TA 4H1ZA 4HQVA 1T8XA 4GINA 3KAOA 4WDTA 3ZFHA