2HC9A

Structure of caenorhabditis elegans leucine aminopeptidase-zinc complex (lap1)
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
489
structure length
489
Chain Sequence
b'TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine aminopeptidase 1
publication title Crystal Structure and Function of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 168
structure length 489
sequence length 489
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hc9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hc9A02
3WC5A 4OC4A 1Y0YA 4YU9A 3FMCA 2ZEHA 4R8FA 4ZX8A 4PQAA 2ZENA 2IQ6A 4AXVA 3I1UA 3IO1A 3L2NA 2PJ2A 2PVVA 2PJ7A 3B3VA 2PVWA 3KQXA 3FVLA 4OC5A 2JEWA 3VATA 3H8EA 4MXUA 2QVPA 1ZG7A 5LRKA 2HB6A 4BD9A 3SI0A 3H8FA 3CT9A 3CDXA 1VIXA 5HVGA 3NH4A 4NGNA 1BPMA 1CX8A 3FH4A 6CPAA 3WC6A 1XJOA 4DYOA 1CG2A 3KGQA 1CBXA 3IFEA 2C6PA 3IWWA 2ANPA 1XFOA 4NGSA 3D68A 2V77A 3WABA 2AFUA 3BI1A 4H2KA 4TNUA 2IJZA 3T8WA 3D7GA 1F2OA 4R6TA 4NGPA 1TKJA 4O23A 1HEEA 1YLOA 4Q7AA 3PFOA 1ZG8A 1M4LA 4P10A 4PXDA 3KQZA 4MCPA 1LANA 1TKFA 4K3NA 2PJ4A 1QMUA 3D4UA 3HUVA 2HC9A 3PRTA 3KASA 4P4EA 3IEHA 4X2TA 1PCAA 1ZG9A 1TF9A 1EE3P 4F8ZA 4EWTA 1TF8A 2JBKA 2I3CA 4X3RA 2POKA 1GYTA 2Q4ZA 1Z5RA 5LRGA 2ZEDA 2BOAA 3D66A 1LFWA 2WYRA 2JBJA 3GLJA 1R43A 3PFEA 3WT4A 4P4BA 2IMOA 2PJ3A 5LRJA 3PB7X 3IC1A 3B3TA 2ZOFA 5IB9A 4NGMA 4MRIA 1VHEA 1AMPA 3MRUA 1VHOA 4JZ0A 2EWBA 4LQGA 4W9YA 2AFSA 2PE3A 2PJ5A 3SI2A 4OKOA 1ZLIA 4OC0A 4ZY1A 3CPXA 4KSIA 4ZY2A 5LYFA 1PYTB 3HLPA 3GB0A 5HVFA 3KR5A 1OBRA 5LYIA 5D8NA 1QQ9A 1LCPA 5CPAA 3TC8A 3VARA 4P4DA 3FEEA 1IGBA 2Q43A 4MHPA 4P6YA 1CP6A 5K8OA 4X8IA 3PB8X 4MCQA 4F9UA 2EK9A 4R76A 4MCRA 2OR4A 1TKHA 4FBEA 4G1PA 1Z2LA 1YW6A 3PBEA 3NFZA 4NGRA 8CPAA 2ABZA 3B35A 1BAVA 3MN8A 4UIBA 1LOKA 4OC3A 2NSMA 2ZEEA 5K8NA 1Y0RA 2XEFA 1BPNA 1ELMP 2BO9A 4WJBA 5K8MA 2C6GA 4UEEA 4NJRA 4Z65A 5ELYA 2Q51A 1NSAA 2AFWA 4A38A 1LAMA 3BHXA 1KWMA 1ARMA 1F2PA 1FNOA 2O53A 2QYVA 2PIZA 1XRYA 3KL9A 4PPZA 2RB7A 4MHYA 4OP4A 4A37A 2AFXA 3FF3A 2CTBA 3NA6A 4RUHA 4OMEA 3RAMA 4FWUA 3NH8A 4MCSA 2EK8A 2O4HA 1HDUA 3D7HA 3N5FA 2F8HA 2ZOGA 3S9MA 3H8GA 3SJGA 3KHXA 1YW4A 4YWYA 4P4IA 3DGVA 2CF4A 2PJBA 4NJQA 1XBUA 5JGFA 5HVHA 1XMBA 1Z8LA 3TX8A 2FVGA 3B3SA 5I4MA 4PXBA 4IAVA 3VH9A 1DTDA 2CTCA 3WC7A 3K2KA 1VGYA 2PJ0A 1Y7EA 2QJ8A 2AFZA 4A39A 3RBUA 1RTQA 1ELLP 2XEIA 2PJ8A 4NGQA 4ONWA 2V8VA 3BXMA 3PB4X 4UF4A 4IK2A 2CIJA 3SJEA 1H8LA 3QNVA 5K8PA 4OC2A 2ZEGA 3NH5A 3PB6X 2PJ9A 2PJAA 1ARLA 2XEJA 2RFHA 4EFDA 3DLJA 1JQGA 4ZY0A 5JH9A 2V8DA 1BLLE 3ISZA 2OOTA 4WWVA 4FAIA 3PBBA 1F57A 2PJ1A 3KZWA 3SJXA 3FECA 2GREA 5DS0A 3GUXA 2AFOA 2V8HA 2J9AA 2VL1A 3B2YA 3IJ3A 3K9TA 4CPAA 2AFMA 2WZNA 2V8GA 2PRQA 1CP7A 5THWA 3FJUA 1ZLHA 2PJCA 1YMEA 4UEFA 1AYEA 1FT7A 2F7VA 3D7FA 4P4FA 4MHZA 3FEDA 3IIBA 3LMSA 4B6ZA 4P44A 1R3NA 4P4JA 4DUKA 5LYLA 1IY7A 2GLJA 2DEAA 4A94A 4OC1A 3B7IA 4FUUA 1CPSA 3ISXA 2XEGA 4F9VA 3RZAA 4DJLA 4IHMA 3CPAA 2BCOA 4MMOA 5HXDA 4PXEA 1CPXA 3D67A 2ZEFA 2PIYA 4NFRA 2NYQA 3PB9X 7CPAA 5LYDA 5J1QA 2ZELA 3LWUA 4UIAA 5JM6A 3KHZA 1HDQA 3B3WA 3FX6A 4ZI6A 3V38A 3SI1A 2C6CA 5F09A 3SJFA 4PXCA 4NGTA 1DE4C 3S9NA 4TWEA 3KR4A 3BI0A 4ZYQA 4OIDA 4GM5A 4R7MA 4MHNA 1TXRA 4JYWA 2PCUA 3B3CA 4ZX9A 2ZEPA 2PJ6A 4OIWA 3PEIA 3JRUA 4EMEA 4P45A 1LAPA 2G9DA 3D7DA 3V7ZA 2GLFA 2GU2A 5D29A 2ZEMA 3S9LA 4UEZA 3KI9A 1Q7LA 1UWYA 2C1CA 5CBMA 1YSJA 2ZEOA
chains in the Genus database with same CATH superfamily
1YK0A 1R6TA 3MNFA 1UP4A 2C5LA 1GA6A 4UFWA 5FCDA 3NHZA 1LFAA 1OA0A 1GQYA 1F0KA 1NXWA 1LSUA 1J99A 1EVQA 4K6HA 4KQ2A 3D8RA 1NA5A 3TMYA 2H2GA 3NUGA 1LU9A 2A1TR 2ZTUA 4UBIA 2FIAA 4WLUA 4CIXA 3W8EA 4B32A 5KNDD 4CHTA 3PXUA 3B7GA 2DE0X 1VL0A 5EKXA 2QXTA 2G63A 5DHUA 1W49A 2E1PA 1VC2A 1P3Y1 2RGNA 4N4AA 1WHTA 4I6JA 1SIOA 4BO6A 4W99A 3UN1A 3EGXB 2EGGA 1J2RA 4U9YA 1T4CB 3HHEA 1E2KA 3C14C 1GQQA 3HWSA 3K0KA 4AUNA 2JIOA 3PXDA 3OESA 2NP7A 4Z9YA 3OQBA 2RSLA 4CTOA 1CFJA 4NE7A 2EFEB 3EIEA 2QTNA 1OW3B 2QI9C 1TUGA 3GHYA 5LMNB 2BGJA 1LPMA 2IUTA 2J0VA 3A2KA 4MRIA 2NO4A 5K1ZA 2IKSA 1ZICA 2FX2A 1AMUA 3U4QB 2F1IA 3NFYA 3ZHVA 4BNZA 5ILQA 4OJKA 1SD5A 1K4MA 2B0JA 3IVCA 4IF4A 5IVDA 4FINA 4YT8A 3GBPA 4YO8A 4XXHA 1YONA 1LC3A 2D0PB 1B2LA 2FK7A 4YP1A 3CZCA 3H9JA 3NFZA 3W6ZA 3HJGA 4KQ9A 3D4IA 3JQAD 2BV3A 1Y7PA 4PSKA 1T6NA 3F3YA 2P91A 4O4LF 4IRMA 5G0TA 5EIBD 1E2NA 4F0JA 2VJBA 1PR1A 4HAIA 4A2ZA 1KDPA 1KYVA 2ORIA 4JELA 1UP7A 4QQNA 4TXJA 4V0QA 1LLDA 4MS1A 4UQOA 3WMXA 1TO1E 4YALA 4BDTA 2DFVA 5C7IO 2BGWA 2ZBQA 3GG2A 5JBIA 2HRZA 4B2YA 5EUCA 1QP0A 1G6HA 1K5DA 1EFLA 1JFTA 3A28A 5IJWA 4ZDKA 4JJAA 1HLGA 2JLRA 1X7XA 1VSTA 4FYJA 2I4RA 3DW3X 3NP9A 4PPNA 5HFJA 5CCBA 5KMGA 4CDRA 3G82C 3KAQA 1M83A 4LYGA 1FFGA 3HR4A 1QH0A 4M7WA 1VL8A 3FECA 5KTYA 4NIMA 2ZK7A 1QIHA 2VPTA 4FDLA 1EFVA 4PSXA 1YI1A 3ANTA 4JI5B 3B2YA 2RGAA 4RKRA 2O0HA 1KI1A 2WIGA 3GDGA 3TTVA 2PBZA 2P2LA 1K8ZB 1JSZA 1TAUA 4R84A 2FUG6 1F1BA 3G6WA 1XT6A 2WVHA 2PUEA 3ZXIA 3H8WA 1R66A 1ZK0A 2BFEB 5CA0F 3PVSA 2CLCX 3BN3A 3BE6A 1N75A 4F9VA 2V7UA 2E6KA 2P9JA 4MQFB 4FZ5A 3DZCA 1MFZA 1U4SA 3TI9A 2VA9A 3A0UA 1WDLA 3IP6A 1JFFB 3QELA 4PYLA 2AC7A 1CW2B 2IYNA 1ZA1A 2WFAA 1IVSA 1A4UA 1GGMA 1ONSA 4II9A 1HYBA 1QU3A 1EKXA 2I1LA 1JH8A 2YUTA 3N76A 4CV3A 2FP4A 1MVLA 4GX5A 3KR0A 2WWRA 3P9XA 3SQXA 3EXG2 3LP5A 1UK9A 2P11A 3EXNA 5CDYA 1XRLA 3KJZA 1QIIA 3VMMA 1DL5A 4C22A 3UXHA 4MROA 1GSOA 2J3KA 1WPXA 1PR4A 4A10A 4MUIA 3EUWA 2R65A 3HRIA 4GM4A 2HQYA 4IIYA 3AMVA 3D8UA 3GH1A 1I10A 5TQ2A 2A0UA 4PU0A 1RRFA 1YNOA 1OH6A 1HF3A 1FLAA 4NNOA 2NT3A 1QFXA 1BA3A 1IN8A 3I6MA 1H0HA 3G5LA 1IPHA 2WD9A 3E5NA 2FFBA 4P93A 4OQZA 1EP3B 1ZOOA 4O4IA 3M6IA 4RS2A 3K1ZA 5IVKA 2Z10A 1I0IA 4AJLA 1FSZA 5KHLB 3NH9A 4U7DA 4X64B 3EXIA 4E2WA 1U8ZA 2P7IA 3H05A 4FGZA 3AZPA 2HHHB 3HU2A 3ZD7A 4PINA 1GSAA 5KDDA 5E9QA 4F4FA 2A2ZA 4D9IA 3P9RA 4WLVA 1OBCA 3AVTA 3B6JA 2Z8YA 2H5IA 1KDTA 3K1YA 1EDEA 5IB9A 1FMLA 4RPLA 1EFRA 3MRUA 2GM4A 4A6EA 1WXXA 1R5JA 4GMFA 2PGAA 3NEJA 4XPZA 5A5FA 4XEHA 1BG6A 1JJIA 1RBZA 1E6CA 1G38A 2C03A 1G7SA 1SNYA 3NTRA 1ZITA 3EC7A 1W4AA 4MI3A 7MDHA 4XWKA 4ITUA 1U2DC 2XE8A 3OZVA 4F2PA 4OP2A 5T3UA 3FTCA 5ALVA 1FTGA 3FMIA 2DBQA 3OOHA 4LDPA 2VOEA 3MJDA 2WUEA 3C3YA 1NE2A 5AW9A 2EW2A 4W5RA 3TD9A 4PSCA 1PT8A 5E6UB 4M76B 5GV8A 1SAYA 1Q21A 2JIDA 1ZHFA 3C6XA 4B75A 2QEQA 4G4SO 2X14A 4Q00A 3W4IA 3KYCA 4LDZA 4MVYA 4KQIA 3EVFA 3K96A 3G5TA 4OP4A 4HRAA 4XWWA 1J97A 1R0ZA 1HQYE 1CLUA 4RDHA 3TRIA 1XXLA 2DPXA 2A3NA 1JJ7A 5JCPA 4ZDWA 3OT4A 5EHIA 2YWGA 3RCBA 4YMLA 3LLMA 2FMKA 3D6AA 3D0KA 5HQTA 1C0IA 3PQCA 4U00A 3K0CC 3PUYA 2FQWA 4ZT2A 3UO8B 2IH5A 3HVHA 3ZDFA 1WE2A 5I7RA 3H65A 4S1TA 1BDBA 5C3MA 3K0EA 1EUCB 3UAGA 3LGSA 5A9RA 3VKVA 3ENVA 2ID7A 5G2OA 3GP5A 1NUSA 2FUG1 3VNRA 4CUJA 3E5HA 3DULA 1XEWX 3EQ8A 4BX8A 4JL5A 3DLIA 1WU8A 4GBED 4HNVA 4N6GA 4MJXA 3H5IA 1XX6A 3F5DA 1A0OA 2IDKA 3AKEA 2D0OB 5B58T 5LOVB 2HQRA 3I5YA 1EP1B 3DC2A 4TLAA 3OQ6A 5DCUA 1Z0KA 5EYPA 3ENZA 3C7DB 1DBVO 1VKHA 4P1ZA 2J46A 2PLAA 3UPTA 2AXQA 1YC5A 3K0SA 2GCGA 4MTCA 4QULA 3IUBA 2PFSA 4G0PA 3SICE 2EKQA 3LQ1A 3EQ7A 3DEFA 1Z13A 4ZHQA 4F85A 3MRVA 2C42A 2H9AA 3BIFA 5ALNA 3GIDA 2RHCA 1UXIA 3LDUA 4ZIRB 3L43A 4KXFB 3JZMA 2OFOA 4JXKA 1RCTE 4OC4A 5J9FA 3R95A 2IZ6A 3QKSB 3IH5A 1Y9JA 5DLYA 3T3EA 4AI6A 1R9MA 2JEWA 3ZOZA 4QLOA 3TBFA 1PL8A 1QU2A 1I3LA 3RC8A 3KZMA 3UY4A 2X3YA 3NH4A 2OZLB 2G04A 2LCQA 5LVAA 3P8ZA 4H6WA 4INPA 3KB2A 4LQ4A 1N8SA 1GPWB 2IHVA 3Q2IA 4ND3A 4BEJA 4Y98A 4Y2YA 3OP4A 4GZ3A 3EDMA 1P0CA 3TNLA 3CM0A 3SXNA 3ND5A 5L4SA 5JVDA 4PCVA 2OV3A 4R69A 3PRJA 4YLEA 3QPCA 4I50B 1QYDA 3KO8A 2DC1A 2PKWA 5JWHA 1EXVA 4H60A 3KFVA 1KS2A 3ZTWA 4DFDA 3AF6A 1VSVA 3WWEA 2XTAA 1DJLA 1PZFA 3JV7A 2J6IA 1EK6A 1KEUA 3CZPA 4DXDA 2P3QA 3MRTA 5CDGA 1UMCB 5JAPA 1WG8A 4H3VA 1JYSA 1XQXA 2FPRA 2PR7A 2XAUA 3LZCA 1V37A 2I5PO 3DUFA 1XQWA 4JXQA 3ZHSA 1OGJA 2WWVD 2WE8A 1DAHA 4ZOLF 4FLMA 1TZBA 4RH1A 1ZEJA 3L46A 1QVRA 4F4HA 5FJIA 1JVSA 3B1VA 3RSCA 1GDTA 4WK4B 4MHTA 1Q15A 4DJAA 3WGGA 4ZV4A 2PL9A 5KSYA 1Z0UA 4B8ZA 2OCGA 1LTQA 3MBOA 3O4RA 4BBJA 3VR6H 3B35A 1XRQA 3UYLA 1MORA 3NHKA 1QK5A 4UU0A 2NU6A 3QU5A 3LGXA 5KQPA 5A4IS 4HPJB 1DWPA 2EEZA 4ED9A 3VC3A 5DYYA 4TYYA 4RZHA 4P7JA 1SCUB 2CTBA 3BAZA 3IOCA 5FTLA 3I9OA 4WBXC 5AVYA 3D7LA 1SUAA 1XZJA 3L0OA 1FQOA 1PEDA 4FEAA 2EC5A 4NS4A 1UAYA 5T57A 3LUHA 2XPCA 4JIGA 1K7EB 4PXBA 2VQSA 1WDKA 5I6DA 2I03A 3ZPXA 4W8GA 2NQ2C 3DOEA 2OORA 1NVFA 3CRVA 4MW5A 4JQSA 2GERA 4L5IA 2PJZA 2WNIA 4MRAA 3HP1A 4NV0A 1JQLB 2I4LA 2I6XA 1Z8HA 5C8DA 5BWMA 1KYTA 1KO5A 4LOAA 3QWFA 3EA0A 3NBAA 5B12A 5C8XA 2FPMA 4GWKA 2XRMA 4D7AA 3P45A 4IAOA 4PC2A 5KSOA 4XNHC 1EXMA 1N7JA 2H4HA 1XFDA 2Q4DA 5FH9A 4R41A 1SXGA 3RO0A 4LF4B 5TQ0B 3BB4A 3RC3A 3S2IA 3DMPA 3AVUA 2VJPA 5JG7A 2FRDA 5B57C 3PXGA 2YYSA 1QG4A 3N2LA 4E46A 3RANA 3IAM1 1FT7A 3RSZA 4ZHSA 2DFTA 1N0UA 2HI0A 4YQEA 2W6PA 3S8EA 5T4FA 4YONB 5IXJA 3NVMB 4QKQA 4AYTA 3FPCA 1R6XA 1LNSA 1ZM7A 1FS5A 3B9BA 1T0HB 1ND5A 2A0WA 1SVSA 4BV9A 1FTSA 1BVUA 2R85A 4ZEVA 3WGTA 5EKDA 4ROSA 1OFVA 2V5UA 4WSOA 3VUEA 5KTSA 4CHGA 1T26A 3PWSA 1T8PA 2WF8A 4FUTA 4E2YA 5HW0A 3VO8A 1KI6A 1ZW1A 3R5TA 5CT6A 1KEPA 5IUNC 1HOXA 1VKZA 3F8KA 1Z9UA 1K6XA 2R25B 4N3BA 4C0AC 1M7HA 1NMSA 4DAEA 3WIVA 2GF2A 3IT3A 2BFAA 1GPDG 4BAUA 4W9RA 4EOGA 3RS3A 3ZEAA 3GUCA 4DLVA 4HI0E 2UZ4A 1KI7A 1NBMA 1CCWA 3QE3A 3RUPA 5K0LA 1J8FA 4MAAA 4UAJA 5BQFA 4WVFA 5DW0A 4G0ZA 5IH3A 3L7LA 1P19A 1QC5A 4MYCA 3CZMA 4BC1A 1RAIA 5ES4B 1RMQA 3O1LA 3I76A 2ZE6A 3GH3A 4FMDB 2B25A 4WKNA 4P0TA 3NPMA 2PA0A 2J48A 1UR5A 3C2QA 4RK7A 3OC0A 4XUGB 1MX1A 1FDTA 3E3LA 1R50A 4B71A 4QRHA 4X3OA 2Z3MA 4EJSB 4MQUA 4MFLA 2CMHA 2XCIA 3OM9A 4KLNA 4EHLA 1ZOPA 4IM7A 2H9IA 3CN7A 2KW5A 1LBHA 4NATA 5DXJA 2I3CA 4J7CA 2VZ9A 3UT5A 4JX9A 4LHXA 5KOIA 1NDHA 4REMA 3X0DA 3TW4A 1QGYA 3I01M 3CEHA 2FJ0A 2Q3LA 2QN2A 2N47A 2X9NA 5DM4A 4Y6LA 3W1VA 2J5RA 4X5KA 3DV0B 4IHJF 4CKEB 5K6RA 5C1DA 3D6FA 2AFSA 1C4XA 3T38A 1HE1C 3M3DA 3TNJA 4HX2A 2R8YA 2ZUCA 3MT0A 5IBRA 4OC0A 2WA2A 1NUTA 1NUHA 2O2ZA 2Q2WA 3KLMX 4CW7A 2I33A 4ALMA 4P7BA 3VKHA 3NONA 3A1TA 3RH0A 1LQUA 4EGJA 3BGIA 3K9BA 4KN9S 1HC7A 5KS2A 4HP8A 4KB5A 4UPDA 3EFHA 4KFRA 3P20A 3M6VA 3Q5GA 3LC2O 2X5NA 3KVRA 3VKFA 3CC8A 3ESDA 1Z28A 4GGPA 4MYTA 4DPKA 4BYMA 4CMEC 1F20A 1IZZA 1UH5A 2HCFA 3NDPA 2NTNA 5C37A 2FOLA 3HKBB 2GJKA 1O3YA 3QBVA 3RV4A 3WISA 5FL7D 1V5EA 2LGJA 3KJXA 3FR8A 3A9WA 3MJRA 2C7OA 2CL5A 4OSEA 2HYDA 1KHHA 2PX3A 5KKAA 1E99A 4YRQA 2WY2D 3ZE7A 3NIWA 3MWGA 1E59A 2QRGA 4CG1A 4MKZA 4BBPA 1MD9A 1VSQA 2CN1A 1RACA 4D02A 4CLOB 4BQIA 1C80A 4KIJA 4BN0A 5LUBA 3U1VA 1F8YA 5TEVA 1PT7A 4KNWA 5K9ZA 2EX0A 1FJGB 4A73A 3S7ZA 3NG1A 2J8MA 3EA4A 3RVMA 2Q3DA 1FDWA 1OLOA 3M0EA 2Y6UA 3CJRA 1NJFA 4HPXB 1KJ9A 5LDHA 2ZRDA 5ALSA 3AUXA 3BULA 3BSSA 5FHQA 4W8HA 4B7CA 4L78A 1KJJA 2HMAA 1EFHA 3GZNB 5AK3A 1RM4A 4QO7A 2JEZA 1OC4A 3V8RA 3K1AA 4R1TA 4C0WA 2I9KA 1UZAA 3NGXA 1QGAA 4KTTE 1UADA 3NOOA 4OY3A 1HMPA 2ZS7A 4DJFC 5KYWB 2R1ZA 1WUKS 5J1QA 1S2IA 3JQ7A 3RT1A 4Q3CA 4LWQA 4PZAA 1R9NA 1F9AA 2IUUA 2GRAA 3INRA 4C2XA 2QP3A 4JH0A 2BGRA 4X6UA 4HLCA 4KXNA 4D6YA 1AA9A 2XT9A 4M7PA 3H11B 1NT4A 3GEMA 1L1RA 1N8TA 2AWNA 1B8OA 3GIUA 4J0CA 5FR1A 5G1OA 3QVSA 3B5IA 3I23A 3KUCA 3D2AA 2NU7A 4NL4H 5CYFA 1MVNA 2X1MA 4URUR 2EU8A 3WHPA 1U8CB 1PYOA 4GM1A 2VP5A 4OB8A 2M6SA 3WAGA 4IMPA 2IOYA 2VDVE 2B4RO 3R24A 4BVFA 2QR5A 3CT9A 3ZHBA 2H00A 2VH5R 4DBVO 2PANA 3NETA 5ESDA 3FH4A 1L5RA 1KOFA 4C7MA 3B8HA 3QVTA 4C6TB 1BO6A 2NNLD 4OV6B 4CEJA 2BUEA 3VZBA 2ENWA 3U48A 3T1OA 3MLAA 1LCIA 2PKEA 4JWKA 3BXZA 1NQOA 2Q5OA 1N2JA 3U49A 4KVOE 3UBTA 4LCEA 1WS6A 1ND6A 2FPOA 3DB1A 3IPCA 4NOLA 1Z4KA 2ZEJA 1ZK2A 3LLCA 1XR3A 4LJSA 3J81A 2QXYA 3DL0A 1JGTA 3OQJA 1Y34E 4LJ7A 3JS5A 5A28A 1YRBA 2QVYX 1IHXA 3BPSA 1OBOA 1JKXA 3GCXA 2Q1UA 4H1VA 1H4QA 3TTTA 3UMMA 1VGVA 4D42A 2R1UA 4K6GA 4RPHA 3ZXXA 1VHTA 5C5CA 3B89A 1SCJA 2QAIA 3D43A 5TPZD 4JV5B 1FDSA 1JQJC 1U02A 3NTLA 3HA5A 4JP8A 3GB0A 1CQZA 5KWVA 3Q8MA 1S7CA 1CJVC 3PP9A 3SMVA 1HSZA 3AESB 4PAQA 2QECA 3G2KA 4D44A 4D8WA 3F1KA 2OGWA 2V97A 1QSMA 2Q29A 2IRWA 3I61A 1MQ9A 2G9NA 5F1OA 3PL1A 4ZALA 5JQGA 1HT3A 1NPYA 4M88A 2B8TA 4QAJA 5A71A 2ODPA 3L7KA 3SHOA 4FC7A 4LW8A 3N6RA 4F2HA 2J59A 2XCSB 4YQFA 5JBNA 5JZOA 2C9DA 4JI7B 2HXGA 1K2WA 2QTRA 1DIBA 4LRSB 2MYTA 1L5WA 2XYHA 3RSQA 1W44A 1W46A 1XZIA 2H07A 2AA3A 3NH8A 2KPOA 1Z06A 5B1DA 2MWMA 3GYBA 3H9CA 3VA7A 5IAEA 4R2IA 1Q0RA 1Q3TA 3DMNA 3KKWA 1CDEA 4HB0A 2P9GA 2IVFA 3CZXA 1BMFA 5C46F 4WXYB 3HGTA 2A0KA 4GXQA 4DILA 4MWEA 1SCIA 1LPPA 3AVVA 1JBQA 4BECA 1TQHA 3ESXA 2P6RA 2EDCA 3IQHX 4EABA 3TSAA 4GWGA 4TMFA 4FONA 4F3CA 3DZJA 1TQDA 3SPXA 4RF3A 4FIDA 2WD7B 1EJ6A 1NI5A 3RT9A 4FFOA 4DIBA 3E0XA 1AHNA 1GU1A 1QK4A 4S1OA 2R48A 5LJLA 7ABPA 4BVKA 4AYWA 2EZ9A 1GCAA 4IVPA 2CL6X 3ABIA 3O90A 4A26A 3GK3A 5AJYA 1VCIA 1ODJA 3TXXA 1QNFA 5IASA 4D3DA 3ZV7A 4UVHA 4UWJA 4N0QA 3V7UA 4QOJA 3ZI0A 1V8BA 1A4RA 2HU8A 3EY5A 4NWIA 1GLNA 4AJHA 4EO9A 3C8MA 2J7PA 3W5AA 1CPSA 1OXXK 2YJ4A 4ZMRA 1TU3A 1RR6A 5JPHA 1U11A 4TQ9A 4KWEA 3ZZMA 5J2TF 5HX7A 1FFDA 3OMWA 5KO2A 2Q0QA 1XCBA 3I4FA 3LF1A 2AZDA 4NGTA 2J5KA 5C81A 1U8AA 3KL4A 4Q3DA 3TFOA 1J2TA 1QJCA 3OLZA 5AW0A 2GN0A 1GKLA 1B6GA 1L2TA 1X1QA 2Q5LA 1LPAB 2PKRA 1T8TA 1S5PA 3V7ZA 2BD0A 3H83A 3VPDA 2YZ2A 4WXMA 1RXCA 3HLYA 1RHQA 1E1QA 2BHRA 3AM5A 4LY0A 2X9QA 1VHJA 4GPEA 2CLIB 2GLUA 3WDSA 4B5OA 5B6IA 2QVZX 3GLIB 2ZSJA 3I83A 2PFKA 4ENQA 5EUQB 1DIRA 3HP4A 2PV0A 5B5SA 2DTXA 2C2YA 1M33A 4HV4A 4R8VA 1TYAE 4EITA 4N40A 5E6RA 4G07A 4PXSA 2A0XA 1CG2A 1B2RA 4EY7A 1GZ5A 3TE4A 4YB8A 3BILA 2DCMA 3PE3A 4HDAA 3IP5A 3WOHA 3F71A 3EEFA 1SQ6A 4BNDB 3AVXA 4LQLA 5G53C 5EMIA 2XITA 3L07A 5E0KB 1JR3D 2QD3A 1KBQA 1KC1A 2RDMA 4F3TA 2RHOA 5TV2A 3NHMA 1CRLA 1OPRA 4LX9A 3BREA 4YI3A 2I91A 4DA7A 1X2BA 2POKA 1YB5A 1GLGA 2Z2IA 2G67A 1U3FA 4LQDA 1R00A 4NENA 4R4JA 1UM9A 4JP1A 4DRXA 2I78A 1U0RA 3ZW8A 2CD9A 2J3IA 2R6DA 4PR0A 4D4IA 2AYXA 1QIGA 5K0GA 2QQ5A 4J76A 4ZY1A 5HVFA 1TLLA 2R1TB 4GBMA 4DV4B 4DLUA 3RHZA 1CUZA 1A88A 3MJFA 2QYTA 4DCUA 5C7OO 3ZIDA 2H2AA 4K2HA 1G17A 3O2NA 1CF4A 2ZRFA 3KWLA 2QLLA 2ZJ5A 3S6JA 1YHZA 3FB3A 4KITB 4UA3A 3K7EA 3KVVA 4GI1A 3Q2KA 3UENA 2P3OA 3RU7A 2YHIB 3OEYA 5C4IA 3FZYA 1Z34A 1L4FA 2VBIA 1N1GA 4CKXA 3JYLA 3P26A 3PK0A 4ZYUA 3CNBA 2ATXA 1W6RA 4U2GA 4REQB 3DLHA 4CR8A 1NW8A 3Q8WA 1NXOA 2IWHA 3FD8A 3RAGA 5CG2A 3P2IA 4LPSA 2QMLA 2W2OA 1O57A 5AM5A 1N78A 4PHHA 2ZI4A 1LJ8A 1V1RB 1BWRA 1QBKC 1XAJA 3AYXB 2EP5A 2FLVA 5SZHB 3UICA 3L0DA 1AXGA 1M34A 4CV0A 4BFYA 1F48A 3KS9A 3N7UA 1AE1A 4R7ZA 5LN1A 2O5CA 1M2OB 2EBFX 3DLAA 4NOMA 4KK3A 2DH6A 2W70A 2NUPB 3U4GA 3I6QA 2FEWB 2H59A 3VR4D 2B1GA 1O87A 1QFJA 1FNCA 4PLPA 3ICVA 3V8NA 3WLIA 3ND8A 3RS2A 1IBMB 2Z09A 4QA9A 4W9NA 3NV7A 2CJXA 2GLJA 4OLLA 1V1JA 3K8ZA 2QSUA 1I5OA 5KSWB 3ONFA 2F2TA 4AJJA 3EC4A 1M2VB 5DDIP 1LWOA 3NM4A 5HVNA 3T3NA 1J90A 5LU8A 1VCHA 5CP8A 5CXUA 3HV0A 5I4KA 2EYQA 2WMYA 2HK8A 3G7UA 2OCLA 2C2MA 1C50A 4QYSA 1BFUA 2XEXA 2JDIA 4FS8A 1MOZA 4MHNA 5T5QA 2HWYA 1XZLA 2IV2X 3E0QA 5GONB 4DCVA 5AI6A 4N41A 4W1RA 1SKYB 2QD4A 2IXTA 4TROA 1UBMS 1AMNA 1J9ZA 4Q7QA 3JUWA 3DVAA 2V7GA 1C41A 2Q21A 4AJPA 5CA1B 3WKAA 4CYNA 1TOAA 1OXKB 5FORA 3UB3A 4EAQA 3PJFA 5DJ5A 3KQXA 5AG4A 1NVUQ 4AZTA 3ICCA 1USGA 5G22A 2HJVA 3THYA 1I4OA 4YRIA 3PHLA 5JSFA 2C9ZA 2H1VA 3TOBA 2XYRA 1J5XA 2X2EA 4DKJA 2CV2A 3ZTTA 5JUWA 1MW9X 3ZD6A 5GOZA 4B3FX 1TZMA 1POWA 4XWGA 3W8DA 5BT9A 4NBTA 4BINA 5EXSA 3JQRA 1VIYA 2Q8PA 2E5LB 1OFUX 1SUSA 1ZP6A 3O8LA 4F92B 1NKSA 2HLDD 1TF8A 5L3QA 2GZSA 3TW0A 3SXUA 4QDZA 4PTYA 1AKTA 1CY6A 4OBWA 4QRDA 1SCDA 1AUGA 1IQPA 1NUQA 3NHJA 1H3EA 4O4JB 2JLVA 5A03A 1OYWA 3GGCA 4KK4A 3CUSA 1Q7RA 4FYVA 5CYOA 4BTLA 2Y1XA 1FLNA 3C3EA 4ZKEA 4W9YA 3Q4GA 2QTFA 3QF7A 3RNOA 1J22A 2G1JA 4MWDA 4HWKA 1TE2A 2FA9A 1X8KA 1ECJA 1YK3A 3L4BC 2FYTA 4JJIA 4C87A 5SY6A 3W2TA 2OHGA 3I9SA 4EK9A 3I0NA 4OP1A 4V1CI 4KPFC 3WMRA 4FGLA 4B3SB 2P65A 4Q5IA 5BOVA 3HFGA 4GOXA 2B82A 1U6IA 5DPMA 3RD5A 3ODGA 1UK6A 1ODFA 1C14A 2VKQA 2JAQA 2XJ9A 2YWJA 4BE7B 2R8RA 4Y2GA 1RAGA 4AJOA 2VKTA 2PIZA 2C8KA 3WDKA 2Z5LA 2XD9A 4RO0A 4FWUA 4RF2A 4DN6A 2RHMA 2QE6A 4RULA 4D1YA 4QUKA 1JEAA 2J4FA 3Q8KA 1HNXB 1THMA 4IUDS 4TVBA 3FMFA 2C7GA 5EP1A 2VK8A 3DL4A 2H85A 4Q01A 3ORSA 3E05A 1KO7A 3QX3A 4QOEA 5EJ7A 1Z6PA 3TIXB 4I2NA 4B33A 1Y8AA 1HNZB 2VQFB 1W85A 4OQXA 3QWBA 4BKMA 3LBAA 4EMUA 5EVJA 4TKUA 1VE7A 1RRVA 2XEJA 4A8JB 1ZM3A 1IZ8A 2QZ4A 5ICSA 1YOVB 1GZ6A 3UF0A 3T7EA 1GZSA 4BMVA 3QOWA 1ML4A 3D5EA 5EIFA 1MMFB 4Q37A 2AI2A 4LZWA 3DP7A 5EE3A 5REQB 3PEWA 3GJ3A 4BNTA 2NO7A 1KGSA 2V7QA 1QUEA 2H08A 1M7GA 3NUQA 2AOWA 2R6R1 2ZYWX 4C88A 2Z2KA 3T0GA 1UXKA 5EXEA 5K3FA 2FPLA 3LCUA 4EI9A 3D67A 2BTQB 4MHSA 2QP4A 5F52A 5JASA 3GLHA 3OO1A 3JVDA 5E3IA 3RGGA 3T0FA 4F46A 5DWQA 4U9UA 4FFPA 3I34X 3RRBA 1FQKA 3RRFA 2ZB7A 3SI1A 2C7QA 4X24A 1L3BA 5FF9A 3I37X 4Q7EA 4E5VA 2Y4NA 3W8RA 2HQ1A 1U9YA 2ZIGA 2ZVQX 2O7SA 3JRUA 3A6GA 2H4WA 1Z2EA 4U6QA 2O6HA 1N6NA 1M2EA 3I9LA 4DLNA 1R8JA 1GHTA 4AG3A 5J2UA 4KZPA 4Z1OA 1W52X 2OM2A 4EFLA 2V1UA 1PJQA 3U7FB 4FI3F 5EIBC 3ZY4A 3G49A 2ECOA 2XGOA 4RADA 3VJMA 3H8EA 4BO0A 3RKSA 1BEZA 3M82A 5EIEA 3KCNA 1BPMA 4CEIA 5GM2A 2NV0A 5U4QA 4DNQA 1VPWA 3O82A 4R2JA 4UBLA 4K8RB 4Q1EA 3SLGA 2JK0A 4B3MB 2OESA 3FXTA 2CNWD 3MCTA 3M1LA 3D2PA 1KYQA 2QXUA 2IYAA 1YVKA 1PQUA 2JFZA 2NAFA 2VQ3A 2ISCA 4TMVA 4MQBA 4OUDB 3DEKA 5IAGA 3GT4A 2EXXA 3CX4A 1TKFA 3D3NA 4FFDA 2F8TA 4IVNA 4IV5A 3TRHA 4O29A 2IYTA 1XTJA 1K7XB 1JALA 5GINE 1KU0A 2GCPA 3FPAA 2HA2A 1IC6A 3GCZA 2G0NA 3KHKA 2EHDA 3SJZA 3G8YA 1B7GO 2YWDA 3H0CA 4M1MA 1AK9A 1ZQ9A 4BLUA 1VHDA 4POAA 2VQEB 2ON6A 2PX5A 3CNEA 1JIKA 1K7FB 1V26A 5C35A 2ZYRA 2Z8XA 1ZPDA 4MUBA 3PQEA 4JMPA 2V98A 3IUQA 3A1SA 4WESA 2JIBA 1X3LA 1MPXA 3QVVA 3CW2A 2NU9A 4NS1A 5IUJC 1RBMA 2ZROA 2GYWA 3R7WB 3E9RA 4TSFD 3LG2A 3DAGA 1U31A 2XYPA 4LS3A 3W6UA 2WSYB 5DASA 3QAYA 2CYCA 2KX7A 4JAVC 4QQKA 1R15A 2QLBA 3SC2A 1D2RA 2G0AA 5J4LA 2JJYA 4GU5A 3MYRA 2E21A 1JIQA 4D9BA 1QX4A 4JFAA 3ZXYA 2VHUA 5CB4B 1VDZA 4RJJA 3WLPA 2JFHA 3NKFA 4EB6B 3SEAA 3AP2A 1FNDA 4Q7LA 3CNHA 3O31A 4B6RA 2HJHA 1L5ZA 4H89A 4TMZA 3M70A 5B7PA 5LPNA 3HEAA 4BFWA 4NBLA 3MJTA 3FSJX 4A38A 1FNOA 4QC6A 3ANXA 4V2UA 4ZHQF 1YREA 3IEXA 3G23A 3I1YA 2IYPA 1JDUA 5DNEA 3T15A 4LSMA 5BNIA 1TJYA 3DEJA 3X1JA 1NIPA 3WMGA 1S3FA 4RKYA 3OJ0A 4G4GA 4XARA 4D0NA 1Z6QA 3SDSA 3GXOA 2PX4A 2GLTA 3FUCA 4FFMA 1URPA 1CJUC 2O8FB 4XRGA 1JKIA 4HKTA 2PAFA 3EVZA 4ZZ0A 3FNGA 3WK5A 1NVGA 2DUUA 2AFZA 1U5CA 4Q0MA 1WSBA 5TT0A 2IEAA 2H8KA 3E2PA 4ONWA 5F1YA 4G0WA 5LA6A 4XQEA 2BMWA 4OI0A 4H0CA 1TRHA 5AKKA 4ZI2A 1CPYA 2WWIA 1QV7A 1CZUA 3U9LA 1KFJB 4C0QC 1P7CA 1H4VB 1FP1D 1QPGA 2VUTA 3RQIA 3R5XA 2VHCA 2FN4A 2ZUTA 2X23A 3KT3A 1NP6A 1EAYA 1BS2A 5F49A 5F7XA 4GGOA 5MHTA 3WNZA 3GU3A 5JVDF 2VEDA 5LDGA 3H2IA 4HH4A 3W78A 4RTJA 4UTOA 2W00A 4GPD1 2FUNB 5HTOA 5LYLA 5LQSA 1HG1A 2IU3A 1JXQA 4PGFA 4ADSG 5FBLB 2BFFB 3KQMA 2ZIXA 3PA6A 3G17A 5J23A 5HEKA 4JLSA 4NBNA 3VNUA 4PONA 3NOQA 2X2PA 4XIJA 1Z0JA 4OP3A 4QREA 4DGSA 4K9SA 1AG9A 2VQDA 4OL9A 2ADOA 2VRCD 3I2JA 4YFVA 3C6BA 4F0YA 1QVVA 5E1MA 1YDFA 1AQJA 4DC1A 4BRZA 3HCCA 3IT0A 3K0AB 4CKCA 2Q6IA 1E2PA 5JHGB 2VHXA 5CLQA 3OTHA 3O8OA 1GQ2A 2QTGA 3PHGA 1RFLA 3O92A 4YK7A 3CZ9A 1Y8QB 4IILA 3A7DA 4W63A 1TM7E 3W3AH 4MFZA 1GGNA 3CWZA 1D2EA 3B48A 1A9QA 5FQOA 1K8QA 2PV7A 5LYJB 5EPEA 1G9XA 4F21A 2QVPA 2SKCA 1EG2A 4PCAA 2M6KA 4PF1A 2IKQA 4M0KA 3G1WA 2IK8A 2LWIA 1R8XA 2Q50A 3C5EA 1CIVA 4ZCLA 4PYOA 4PPQA 2CE2X 3UJ9A 1PJ2A 4I8DA 2V77A 1WZCA 1TKJA 3Q40A 4LMPA 4RABA 4JBGA 1X1CA 2E4UA 3NHUA 4YCJA 1WF3A 3KRTA 3MFYA 2LR0A 2QJFA 3OECA 4KRXA 3GZ4A 4JNCA 1BKDR 2RAFA 2GAFA 4I5GA 1A04A 1C7IA 1E2EA 4JC0A 3SC3A 1XTZA 2WVGA 3DZIA 3COZA 4M21A 2HCJB 4RPIA 2WWFA 5L6MB 1QSGA 3H42B 3CRRA 3N75A 2ZM6B 1UQTA 1DRJA 2OH1A 1OR8A 2Z83A 1X8JA 2HZ7A 1HR0B 2RAVA 5H7XA 5LB2A 4JDPA 4MV4A 3FFXA 2ILVA 3RODA 2B1IA 4P3YA 1GZ7A 1BH6A 2RAUA 3AC0A 3NTUA 5CM9C 3I2HA 3D6UA 4Q6BA 2WWXA 1AKNA 2V74B 5AM1A 2Q0XA 2XUFA 1QQ9A 3O21A 3RIEA 5B53A 4RSRA 3QXXA 2HXSA 4P3XA 2BLNA 3FMGA 4BU0A 4DIUA 1JXAA 1GUYA 2NXNA 4X62B 3ICQB 1UDCA 5HE9A 5CHEA 4H7DA 3R0VA 3ANLA 1G64A 1RBQA 4LKOA 5LXTA 3ZDAA 1GTG1 2GCOB 2XX3A 5F7JA 2R1IA 2X8JA 2J3JA 1UOQA 3REQB 2HL6A 1E0JA 3U60B 1TTHA 3MTQA 2FN8A 1UJCA 3VBCA 4RPCA 3RFFA 1ZBQA 4DTIA 2XDQA 1XK6A 3IAM6 4JA0A 8OHMA 3DKVA 2NTYC 4E31A 2JLYA 2FN3A 4ILEA 3R6WA 5F3WB 1HT1E 1ICEA 3HC7A 3FPFA 2I80A 3LYUA 4PX2A 1ZS9A 3FOBA 2H6EA 1E92A 1JG1A 4JSRA 4GAEA 2XUAA 4IHKA 1QX3A 3P0RA 2R751 2WZCA 1XXHB 3VPFA 1MKYA 2C3MA 4ND8B 3URMA 2BGNA 1KUVA 5KYXA 3OUUA 4F5YA 3ASZA 2AJTA 3IV7A 3IUPA 5JU6A 4X1YB 4B4OA 3PF9A 1CB0A 3ER8A 1G20A 1U0SY 3OLCX 3NM6B 2C8JA 1VPVA 2CNKA 3GLSA 1IZ0A 1X70A 4UNRA 1I21A 2KB0A 3G9TA 1I4DD 5IMBA 3C7CB 4XJTA 3LFUA 1E1CB 1ZZGA 4A9AA 1UBRS 2XWBF 4DIMA 4DSTA 3C5WP 2PEYA 2D5BA 1EIWA 3EH2A 1D2GA 3AUTA 3C5VA 3AU9A 2D4HA 1I7NA 4V3BA 4U4AA 2BFMA 1QSOA 3Q7IA 2LKDA 4CMHA 4IIJB 4WKBA 4ND7A 1WQ1R 5AG5A 4OIMA 4U7PB 3SS8A 1ZN9A 4JYMA 3M6LA 3L18A 5IABA 4HWOA 4OHXA 2Q5HA 4QUHA 1WV0A 3IX7A 2BP7B 2AK2A 4MARA 2RHLA 2NW6A 3URKA 3SHPA 4B0OA 4KLAA 5DTIA 4DCJA 4EMEA 5ITSA 2X0RA 1R1DA 2IV7A 4ESVA 1P6QA 1KY2A 2W37A 2PUVA 2ZSDA 1I7DA 1GNPA 1N2XA 4WJKB 3DDOA 4J6EA 3MA0A 1N2BA 1LEHA 1KAHA 2EF0A 4WEOA 2FR8C 4YNBA 1FE8A 2DT8A 2ZFUA 1OLXA 3FHOA 2PZAA 2CXHA 4L5YA 1RQPA 4IEIA 4P9NA 2ZIZA 2FU5C 3PKJA 4LMBA 1T1JA 3DTVD 3U1TA 1XJOA 4MHOA 4B7AA 1QR2A 3GJ4A 3FLMA 3OZUA 4YRSA 3F3KA 4TRRA 4FFLA 3WXMA 4TNUA 4AD8A 3HJBA 1CUFA 4HWPA 2PAAA 4PNEA 1DX4A 3BJEA 2FW6A 4RYLA 3R9EA 2GPAA 4QB9A 1YLOA 1ARZA 4ARCA 3DTNA 5JJBA 1D2MA 3PNVA 4ZEWA 2X0IA 4BNGA 1OFIA 3BQNB 3P0EA 3S6HA 3ZN2A 4PCLA 1OQAA 4DV2B 1IUKA 1LRJA 2A9JA 4TTJA 3HGMA 3ZBTA 2ZAYA 1VBFA 1A7UA 4U5YA 3ER6A 3PYLA 1NN0A 3EJWA 5F5XA 7AT1A 1SIWA 2OHVA 1YS2X 5LQDA 4MI9A 4LF7B 4WIAA 4WKOA 3WL7A 1BDIA 5DHPA 5I8PA 3DZHA 3GLIE 4JLUA 4JJ4A 1U6MA 2ZVDA 4LJKA 3FAZA 2H7XA 3H1FA 2YXNA 3L8DA 1YJ5A 3RF6A 2H0AA 4C78A 3RHFA 2JK1A 2PT7A 4DT1B 1U7HA 2OCXA 4GR4A 1EX1A 3T4UA 4MICA 4IIXA 1SEPA 1Z2AA 1ORVA 2FWBA 4FX5A 1I1NA 1GL6A 1J5PA 3K1TA 2IELA 2D62A 4G1CA 1PT6A 4HB3A 5E9WA 3PUZA 4JS0A 4M7OA 3JQCA 3VNQA 1XVVA 4C68A 2IX9A 1WF6A 5CLLA 1E6MA 2AOTA 4WD3A 1II9A 4TV8B 2I4NA 1ELMP 2YN2A 4MLZA 1J21A 2R7HA 4NPAA 2QZSA 2XYVA 1G2IA 4W5WA 3Q8XB 1U8FO 3RS0A 3VPBA 3PQ4A 3BEDA 4XGKA 4X3PA 2YXEA 3HS3A 1W0KA 2CHFA 5I48A 3PFGA 3UH0A 2AWOA 1Y9AA 5LMZA 4AJ4A 5HTKA 2WHRA 3R9KA 2BRUA 2BFNA 1G2QA 3PP8A 4GP9A 3LHFA 4H7IA 3ONVA 2XV1A 4MFQA 3SJGA 2ZUFA 2QOEA 1G8KA 1W19A 4FWIB 1L7OA 1XBUA 4F9GA 4OX9Y 4PLCA 1PKXA 2J6BA 4D97A 3WWDA 2PCLA 2CVZA 3HKCB 4MQEA 4HNGA 2SICE 1FUIA 2VZ0A 5DX8A 5C1IA 3PTZA 4DQLA 4EG8A 5AW1A 4NSNA 2QVLA 3JQPA 4DQDA 2CIJA 3HRHA 4MW4A 1N2SA 4JJ6A 4LGVA 1GKIA 5G02A 5SV2A 4K2AA 2B5GB 2J5QA 2Z30A 3VRHA 4R0NA 1EM8B 4CG3A 4Q1VA 4LRYA 1J1UA 2JI7A 3Q85A 1HFJA 2PK3A 3I9KA 2DQZA 2J9AA 4BB5A 4GOJA 1XYVA 3CB4A 3E9YA 3EBLA 1JHZA 1JPNA 2V8GA 3KQWA 3JWHA 2CNDA 1J23A 1QCYA 3GLRA 4C06A 1IRXA 3O1IC 2J3HA 2O5VA 1H05A 3UGTA 5IYZA 3JQ8B 2OBMA 5ADUS 3CGGA 1R5NA 2C98A 3GPDG 4P4JA 4CN9A 2YOFA 5EHGA 2Z5FA 4EG3A 2GNPA 1Z37A 4QQFA 4DPMA 2BCOA 1H0SA 4DUGA 3QLVC 2HHJA 2D8MA 3KHZA 2XQVA 2YBDA 1TF7A 1EIZA 4Y67A 2IE0A 4B2IA 2RH8A 4I1OA 1FRVA 2GMWA 2BGUA 4QXPA 1FRFS 4WOCA 3T61A 4NHEA 1UL1X 3ZJUA 2P1ZA 4HAWA 4B46A 3AU8A 3VOSA 5D29A 4PHGA 1PJRA 3KEFA 3UUEA 2AFHB 2UV8A 2JEVA 2Y66A 3NBFA 4ENSA 4NCZA 4JB3A 2ZPTX 4IH9A 4AXVA 3AUFA 5JQGF 1K3FA 4CTNA 1OXTA 1FUKA 1U6JA 1I9CA 3QFHA 3GT7A 1QH9A 4J94A 4FZVA 3P9IA 2D54A 3ONDA 2XRFA 1W8IA 5AOBA 1M8PA 1O4WA 1IBRA 4QARA 5IMSA 1EZ4A 5B1SA 5DX0A 1CBXA 3OIUA 3IWWA 2L18A 1QZ3A 3PHIA 4KX3A 2DU8A 2XGGA 5IZCA 2CT8A 1QYXA 1TUBB 4FDAA 1EFKA 4YAUA 5KB3A 2FX5A 2OQ2A 3AL2A 3HB5X 1P45A 2RKWA 2ARHA 4F3RA 3MQ2A 3TCXB 3WQSB 1E60A 2W2NA 3ELBA 1W9HA 1EE3P 5HQ3B 5LP6B 1SKYE 1C0EA 3Q88A 3SXOA 1NN1A 5T6MA 4DDHA 1ATZA 2A1UB 5CAEB 3D2CA 1LLUA 3WGJA 3EX7C 3I4CA 3B5JA 1B42A 1OY1A 1BU5A 1U1FA 2GCNA 3MVEA 1JQDA 1PUIA 2P30A 9GPBA 5AW4A 4CGPA 1DCMA 4XVQA 2CXSA 2NYUA 2Q5QA 1VYVA 3OX2A 3DXYA 3DLPX 2GANA 3CISA 3JASA 4CF3A 1KP9A 4C14A 5AUPB 5KX5A 5FOXA 2Q3MA 2W2XA 3MSCA 1E2HA 1G98A 4BRWA 1ZD1A 3RARA 4N82A 5D8NA 1N2OA 3IEUA 5ULLA 2O0KA 3OOJA 1E0DA 4BXOA 3PBKA 5I7UA 4LZZA 4DS3A 1JQBA 2WF7A 5U9CA 3QU2A 1UZMA 3ZEIA 1TYZA 1XFAA 1S4QA 4LVCA 3S6KA 2GD6A 1ZGJA 3RJZA 1WR8A 4MW7A 3PWZA 3Q9UA 1XTVA 3IVMA 2TMKA 2LUOA 5IULC 4YAJA 1BGXT 4GW3A 4K6OA 3IDQA 4I1PA 3GFFA 3V1MA 3A2MA 4KDCA 1ZMXA 1QOQB 4MH0R 3G5MA 5CK4A 3DFZA 4CMGA 2QYVA 1E7SA 4J2OA 5HP4A 1I4EB 3U4HA 3LAWA 3N05A 2WJHA 4LK2A 1JQAA 3UHPA 1XZDA 3MTIA 4FKZA 1YQXA 1CS4C 2YW2A 3GNTA 4R3NA 3AEQA 3L7JA 2OECA 2GPBA 4AG6A 5CX1A 4PIVA 1H4SA 4YWJA 3KBBA 1V43A 2D5CA 3E3NA 1L5OA 1V9LA 2IOFA 2IHYA 3KQLA 3E22A 1U2GA 2IPXA 4N5HX 5IDQA 5CB8A 1CR0A 4BVHA 1RMYA 2GVNA 3NBZC 3I73A 3K72B 5JYCA 4QASA 4KFUA 1D9ZA 2BL1A 5DGIA 4Q03A 1RRGA 4HVAA 3CLSD 1WM1A 2GK6A 2J87A 2I6SA 1J2YA 3PDHA 1DIGA 1AF7A 4DMGA 1KE1A 1CRQA 1YJBA 3IJ3A 2QF7A 2IEYA 4WBSA 2QE7D 1C7FA 1Z73A 3OX4A 2EKDA 3AFOA 4RL4A 1S1CA 3K92A 2R8XA 3QVLA 4J6FA 1WD5A 4QYIA 4B3HA 4F5DA 5ISVA 4LJLA 1XD9A 1FEZA 4CI0B 4IMIB 4F6AA 4B5PA 1YOBA 3M3HA 4Y2UA 5TPWB 1WB9A 3DO8A 2ZOSA 4KZKA 4DEXA 1XAHA 2FIWA 3DE1X 2HV2A 5FP0A 4BNVA 3GN1A 1ZCFA 3F2VA 4W1PA 1AC5A 1T8RA 4IICA 4Z6KA 2IXAA 3PSAA 3RK4A 4EEKA 4NMMA 2QVBA 4RACA 3RC1A 2FUKA 3ZZNA 4G5QA 3WI7A 5AK5A 1DE4C 1YI8A 3S9NA 2UUCB 2PXAA 4NU0A 4XX1A 5AK0A 4XGIA 2BPOA 1N9GB 3BWMA 3KYDA 4E14A 4RZ3A 1LTHR 4ZQCB 3ED5A 2FX3A 1PYDA 3AEXA 4JJFA 1NFRA 4JWTA 1MEOA 4G4SP 1OWNA 3TQOA 4OKOA 2AN1A 2COKA 3UXYA 4GE3A 4LPKA 1OFUA 1VBMA 5ICMA 3R9WA 5KTOA 3IEMA 2NO6A 2OWDA 4DSUA 2OV1A 1CF9A 5AJUA 1TIBA 4YH1A 1PG2A 1UMDB 1X9HA 5CITA 3IUMA 4GXNA 4L9SA 3N2EA 4YAGA 4CEHA 3JYOA 2OC9A 2YNMC 3PI6A 5EZYB 2QL9A 4MR7B 3DO5A 2FQQA 5FI5A 3QTBA 4FEGA 2GM5A 2ZCJA 4HF7A 2W2VA 1Z8NA 2C5EA 4PFQA 1VPDA 3S70A 3K1JA 4G6ZA 3EUAA 3ND7A 1E5XA 3F6CA 1RHKA 2FPWA 4O23A 4G0NA 5KTTA 5HKKD 4Q9DA 2FOIA 1JPVA 2VNAA 3JAKA 3UMVA 4AAYA 1E69A 1RXIA 1F1JA 2WAXA 2QKYA 1QFMA 1FYEA 3WLNA 4YT4A 1W25A 4I4TB 2DBYA 4NYMQ 5AUOB 3K3PA 1E2DA 3VHXB 3PQDA 4NBRA 2YNMD 2B61A 4TTVA 4S05A 3WGLA 1NJ2A 2IBTA 4OLJA 3VPXA 2ZSKA 4J75A 3OLWA 3EG9A 3VO9A 1ORWA 3JAWA 1HDIA 1JBKA 1DPFA 3L8YA 5H02A 3RFVA 1X8LA 2ZDQA 4RPKA 4BEBA 3CURA 4JU9A 3O8QB 1SU8A 2GR9A 1Q11A 3I5AA 2A88A 1T5SA 3OJLA 3W2FA 1KOGA 3BGVA 4GPIB 4G8CA 4CIYA 3G9XA 2GTIA 3PC7A 3UT6A 1OCEA 2EWBA 1W76A 3GNSA 2QZ9A 2NVUB 5CNKA 3A25A 3VSAA 3UJCA 5SYMA 4PHCA 4XIFA 3R4CA 4KYTA 3DH0A 4ALKA 5KQLA 5B2EA 2CHVA 4JVMA 2IFTA 4BMNA 2BMEA 1RM0A 2BH2A 1Z16A 3C8HA 2CLDX 4MVJM 4WOKA 2VXCA 3VPAA 4MEAA 4OK5A 1D1PA 1CY8A 1ECCA 4YAEA 3AB3A 5GZ1A 4EKIA 2BT4A 1RM5A 3QHQA 3IJPA 4GPBA 3KWMA 4EYGA 4GKVA 5K8MA 1SOWA 3JYNA 3IGRA 2B2CA 1WDTA 4ARIA 3SE7A 3FJYA 4P5PA 3A14A 1BAPA 1CJSA 4ZYWA 5LC1A 4JYBA 2BMAA 4KRYA 2CUNA 5K8IA 3BOSA 2BMJA 3KSZO 3G13A 3QA3E 3RAPR 1EQ2A 5H59A 1LFDB 4F6LA 4CETA 3AR4A 2PH5A 2BTEA 3I5XA 4HNSA 4F1KA 1BCRB 4TTPA 4IZHA 1XC7A 4K6FA 3FKSA 4RS3A 4IG4A 2QRVB 1T91A 2GSDA 1PO7A 4GDMA 4AVYA 3JZDA 4FD5A 3JRNA 3PR1A 3UUGA 1P75A 1W6UA 3KJQA 3FTDA 3EVBA 4TPKA 4EFDA 4L8YA 4O2AF 4MV9A 4NPHA 3E48A 1FP2A 4N76A 3KZWA 5K20A 1JMVA 2OFWA 4OFBA 3DBIA 3M4ZA 4BKUA 4C4YA 4HH1A 2VT7A 3E6AA 4C7JA 2VNIA 2VL1A 4M9QA 5JH7B 1ZW6A 3H9BA 4DREA 5FNZA 3SOZA 1GR1A 1Y1RA 2VDMB 1SK9A 3M1IA 3OD5A 4MVJH 1UBGA 4MGYR 3ZU4A 4P4FA 2WHPA 3GMSA 2QUBA 1TJ5A 4C20A 3E4DA 1GGKA 3RYCA 4I19A 3LV8A 4EI2A 4G4JA 4TLCA 4GRDA 4H3HB 1TYCA 2BEKA 4RUKA 2H52A 4YXFA 1G21A 4O4HB 1HYGA 4B11A 3TJZA 1U63A 1VM6A 1R9GA 3ZK9A 2E7ZA 2O8CB 1JE0A 3CH7A 1GN8A 4NR0A 5JM6A 3CW8X 5FO0A 1JHDA 2PWBA 2IPLA 3I9NA 3HWWA 2DEUA 3AV3A 1IBCA 1PRYA 3THWA 1NF9A 3S40A 4QYWA 1Y7HA 2RH9B 1GRCA 3QPDA 4OBXA 2FZKA 4DPLA 3DCYA 4UXHA 1XAGA 4NMLA 4GMGA 3SZLA 1KQGA 3LXXA 2A9OA 4WA8A 1KP3A 3PFKA 4CXMA 5T4HA 4MP8A 3FB4A 4I9UA 3TW6A 3ASYA 1KUXA 4UHFA 2W5UA 1ZI8A 3TG2A 3DDZX 1D0SA 1NVKA 4DJJA 2HU5A 3H5LA 4AZ3A 1IOZA 1U6KA 5KDLA 1KZYC 3U37A 1FUYB 4ARZB 4UTNA 3O4JA 1PYGA 1D2CA 1AHHA 5DTJA 1Z8FA 1XWIA 4A6XA 3PEEA 4DCSA 5ECWA 4XQ0A 1Q0TA 1F0YA 4Y9TA 5JSYA 2IS6A 1MENA 3AILA 5AIAA 1E61A 2QX7A 4LJ8A 4XPIA 4UTPA 1SK8A 3ZE9A 1TC2A 2ZBEA 3HSSA 3NCHA 2QN3A 1V3UA 1GCOA 2VJOA 2F55A 1JG3A 2Q4ZA 4R1PA 2YJNA 1W1IA 3ZXUB 4MUJA 5E4YA 3KDPA 2PJ3A 1GZ3A 4KUGA 3QPBA 1G41A 2XB9A 3M6FA 2JFNA 1VHEA 1TVKA 3IDSA 3NXSA 1VHOA 1KTVA 1VPTA 3H19A 4LKRA 4CLDA 1V96A 2P75A 4BVBA 2M98A 1QJ4A 1WQ4A 1WCV1 5DT2A 2X6TA 3RWBA 4QOFA 4DMFA 1HRKA 4BLOA 3TTUA 1E7MA 1TPYA 1P74A 4RA6B 3UK0A 3L6DA 4AF7A 5B4UA 5D8DA 2P3LA 4UNSA 3KELA 5CT9A 1VL2A 3OQMA 2FVXA 1OD6A 2QD1A 4R76A 2PUFA 5TVKA 2FZVA 1O95A 2QM0A 5I9TA 3L0YA 1KYXA 1M1NA 4JD6A 5AW7A 4EA6A 1VJTA 1DC8A 2IYSA 1IB1E 2Y1EA 4AQ7A 2OHIA 4FFBA 3KL9A 4ZCTA 4G8JA 2WC1A 3G0IA 1DO8A 1YQQA 2G8NA 1IOWA 1O8BA 1P3DA 2NSHA 3OUZA 4BC0A 2G83A 5I51A 2ZJ6A 5SZJA 2YV1A 3KR2A 5LL6P 4DHEA 3RBVA 3U40A 2QJ8A 4QG7A 4UEOA 1FFEA 1AS2A 5JW6A 4MR8A 3KQVA 3DOJA 1GV0A 2ET6A 1QZTA 5AYVA 5LLSA 2XCRB 4MDYA 3CG0A 2YOGA 5BW4A 5MFZA 4QNMA 3BF7A 5ARCA 2QORA 4LBYA 5AXAA 1AO3A 2JIMA 4MAMA 4UBMA 3WBJA 1G16A 3SJXA 2P4UA 1MHTA 1NSLA 4EKEA 5DHTA 1SXJD 3UXMA 1QFYA 1LS1A 3GLFA 4WFKA 3W5VA 2QGNA 2X8BA 2QV7A 3HDTA 4U6NA 3ZD9A 4DUZB 4CCYB 4F12A 4QQ8A 3ELUA 3NHSA 3IAHA 2WTXA 3ZH2A 1SUCA 4ZPJA 3ZV4A 1MQ8B 3VU3A 2L17A 4OL0A 3PPVA 4L5JA 3WYEA 2APJA 3U3XA 1GO2A 5E1OA 3WDLA 2EZ4A 3OPVA 1PLKA 2HIAA 5GV7A 4CM4B 2ANBA 3MC1A 1XXHE 1NI4A 1YCFA 3KSBC 4CF6A 2NZUG 1D1QA 1EGQA 4RK0A 1OASA 2EZTA 1MT0A 1NOIA 1O94A 1P7YA 3QFCA 4GG1A 1Z2CA 4YIKA 1ULUA 1UMBA 4II2A 3MGKA 4TT3D 2Y76A 2HYIC 3N7AA 3WRXA 1ZD2P 3ZGXA 4U2DA 3MF4A 2ZZNA 3W6PA 4WV3A 1PS9A 3OFVA 1O4VA 2QMYA 4IGIA 2XNKA 3OPYI 1TM3E 3UXEA 4QBFA 3A1WA 4RESA 3CO0S 4FIZA 1H9BA 4JROA 3DWGA 5BVHB 4AKTA 2WJPA 3RABA 3P5SA 3LL4A 3TDMA 1RLIA 4JA2A 1ZX1A 1YE8A 1WCXA 3GFBA 3KQSA 4MIKA 3JSAA 2EJVA 5HM8A 3GGOA 4DRZA 5J8CA 4K3UA 1XL0A 4NBUA 3E1GA 5ITZA 3HEMA 1M76A 1BXGA 2RB5A 5TQJA 1F51E 4MVCA 5DULA 1H6BA 1HEEA 2D1YA 3GMIA 1MO5A 3C8DA 4RZSA 2WU8A 2QW0X 5FWAA 2QUKA 3W4JA 2OD7A 4UU8A 1UBLS 3VH2A 4EQ6B 3PGPA 2PGIA 1AURA 3KSUA 1W47A 5F21A 3FUUA 4UUPA 2AG8A 4FQ8A 2BCJQ 1T15A 3K31A 4LJAA 3TVTA 4QPCA 1MOPA 1RWVA 3ELWA 2GVDC 4LV5B 1X7ZA 3K0FA 3UMCA 1WK4A 4YY3B 1IHDA 5KKCA 2WRZA 3ZWOA 1NQUA 3AB7A 3LQ2A 1BC5A 2FFRA 2OFXA 5CVEA 2F67A 1ANKA 5LD2C 3TZQA 4KFTA 3S1LA 1Q74A 5K2OA 2XADA 5JXHA 3S2ZA 2YYZA 3SI2A 2BEVB 1J8MF 1T2AA 2Q0SA 1W73A 2ZIEA 4MJLA 2AVDA 3AXTA 2JGRA 4KE8A 1GDDA 2N0SA 3GYGA 3HPRA 2BKAA 2Q4OA 3WNQA 3EIXA 1ZN7A 3MLBA 3EZLA 3INTA 4MCQA 3KFLA 4BUCA 1VI5A 3RG2A 4O4IF 4HDKB 5EA2A 2G06A 1J0CA 3DCJA 5B4VA 3FUTA 2WQ6A 4WJBA 3FROA 3ZOKA 1T9GR 1IUNA 1UF9A 2YR0A 4D4LA 1NLUA 2HT1A 2ZUSA 5DTMA 5HGJA 3A26A 1OROA 1XD2B 4JB8A 3MB5A 1YVDA 5ICEA 2HA6A 5JCXA 4XD7D 3BWEA 1ZMOA 2VF5X 2MINA 5BN1A 3CR8A 1A9XB 5CFLA 1CR4A 4F91B 3P96A 3BFVA 4CLRB 2V8OA 3OIVA 4MB6A 3CRMA 4MVXA 3D3JA 1G7CA 3DM5A 3T1YB 1US8B 4YJFB 1CE8B 3W90A 1TM5E 2WW8A 1QVAA 2PL3A 2HDWA 3DAFA 3DTYA 4ZO8A 4JBXA 5JI3E 1LPSA 5M29A 3SNKA 1HWYA 4U8GA 2AKAB 2UU9B 4YECA 1ECLA 4RJ2A 3PQ6A 3QWIA 4G0YA 1A8PA 2XLBA 1SQ5A 4AXBA 3EY9A 4UEJA 4A92A 1EK0A 2QHXA 4BO4A 1RTKA 3L40A 2A5DA 3BJ7A 4E33A 1PUJA 3KR9A 4CQLB 2WAAA 2PH3A 4LISA 4HAYA 4MKXA 4UASA 1WW3A 3AKYA 2DEAA 2JLBA 4GNKA 4KSCA 2WILA 5NLLA 2JZNA 4C0HA 3V97A 3DPUA 1HDXA 5DN9A 4YN3A 1KMCA 5AT1A 2VXOA 2ZYIA 1A1SA 3L05A 3N5CA 3IMFA 3O9VA 4NYMR 1F3OA 1W93A 6LDHA 1YRYE 4B3GA 1XEFA 3H5NA 4QJ4A 3BZBA 3L41A 2H5LA 1ECPA 4WADA 4D9HA 5A9SB 4YXWA 3SBOA 3ASVA 3ME5A 7GPBA 2HJSA 5F51A 1PJCA 5DWMA 1H8HD 2Z3ZA 3GQBB 3VDXA 4UU7A 3BRSA 1T4CA 3PRKE 1K9SA 4PNPA 1YS6A 2HUNA 2ZBDA 5FWDA 2QUZA 5JS6A 3OT1B 4DIEA 2POCA 4B84A 4K26A 1PV1A 4XDZA 4QUDA 4P83A 4XIIA 2D00A 3NBMA 3K2EA 1AZLA 4V3CA 4IGEA 5LXTF 3IDFA 5EJMA 1RHUA 5ALPA 2A92A 3DNFA 3ZWDA 2Q4EA 1ZH4A 3U9TA 2X4IA 3BBPA 2ZBRA 1S5KA 4I49A 1OIXA 2YY5A 5D5PA 5ECYA 4BIIA 1RFGE 1J42A 4QXQA 2V4ZA 5HBGA 4OU5A 1L7NA 1YASA 2KE5A 4OI4A 3EVTA 1MGOA 4Q82A 3JU3A 4RORA 3L0SA 4MI6A 1QS0B 4YRJA 1AV6A 1U04A 2RHDA 3MELA 4IDCA 1E3WB 2J3EA 1UXOA 3QU7A 1CUYA 4P33A 3KT0A 4IG9A 4IINA 5IF3A 4IQGA 1V5IA 4ZOBA 2AE2A 3WWYA 1CY4A 3ZLJA 2VNKA 3NE8A 2VOJA 4D57A 3W34A 3GEHA 1XJCA 4H4DA 5AW2A 2AFHE 2KYRA 4M6WB 5C5EA 2ZW7A 1SC6A 2ZW9A 2JBJA 1H1DA 2OM6A 5I7VA 2JLQA 2QPTA 5JXIA 1LB1B 5LLDA 1IY0A 2V9PA 2N1MA 3TR6A 4MMXB 1QGED 4G67A 2WAYA 1JT2A 4F4IA 1Q1AA 3TS1A 1CQIA 3KQTA 1U9ZA 1T3TA 4MPTA 1W36D 3U4CA 3ZGZA 2E4AA 1IY2A 5AVKA 3FB1A 4YRFA 1REQA 1RCUA 3A9SA 3BTSA 3Q15C 1GRQA 4FBGA 2JAPA 4TXNA 2X4LA 1AUVA 2CSUA 5ALYA 2HMTA 3PB8X 1UDAA 3ETEA 421PA 4QGFA 4OQQA 2EK9A 2QB5A 1M0SA 3G2OA 4PZ0A 4RH0A 2VJMB 2BKLA 3GUZA 3UKJA 3FPHA 1X9IA 1G8FA 2EKZA 1JSCA 2WWHA 1T5HX 1XN1A 5ELYA 1BSVA 2F7SA 4RY8A 2A9QA 4J43A 3TD2A 5E6SB 3T9BA 2EKLA 1CQJA 1QAMA 3WWPA 4B82A 1NXXA 5JE8A 2L2QA 3FXAA 3A4VA 4Q39A 4TWJA 3WBKA 3KEMA 1Y5MA 2AFVA 2BFEA 3C16C 2HA0A 2PJBA 2Q2QA 4NOKA 4IMRA 1V4BA 4C0LA 5BYAA 4MV0A 2GNOA 1BE1A 3DKPA 1CIJA 2DF8A 3EASA 4IS3A 1ZCAA 3CIFA 5IM4A 1Z88A 2JBAB 5DLPA 1JR6A 4BKOA 3LMKA 2DQYA 3H0KA 1GL3A 2IPNA 3QYFA 2XZOA 5TXGA 2PNFA 2AJ8A 4BVLA 4OATA 5EMMA 2OZEA 3BRWA 1JJAA 4MRMB 1ZH0A 4YCCA 2W6JD 4DDUA 2QTVB 2FF5A 3PQ2A 3WK4A 2RGCA 2XCQA 3V80A 4HKFA 1DFHA 3P0IA 2XMSA 1QYVA 3HXKA 5BW8A 3FDZB 4WERA 4II7A 4BJHB 3FLEA 1N2CB 3F3MA 2I65A 5ESWA 4RJKA 3JXEA 1EEHA 3RTBA 1XG5A 4ZBGA 3L9XA 4HWGA 2V0CA 1RKBA 4ZV9A 3C74A 2HF9A 1Z9BA 3B7IA 2PVPA 4OTZA 3PRYA 3WJAA 2UUPA 5FPSA 4IHMA 4D80A 2F9MA 1R6UA 2PIYA 1TIPA 3BHIA 2PY6A 1I01A 1VRVA 1YMUA 1A50B 3CKMA 1NQVA 1TL7C 1F8UA 3LW8A 3EQZA 4PYNA 4P2GA 1E1RA 4HX9A 1FDUA 3GARA 1CEXA 4UAVA 4MKGA 3CNLA 1KQNA 2RGWA 3GZJA 2QRZA 3OFNA 4UFPA 4UWIA 4IPTA 2L82A 5JEEA 1DUVG 2PZKA 2A1TS 4W7HA 1LVGA 2PC1A 4JOBA 5EEHA 1Q6ZA 1T9DA 5EIWA 3DWFA 3SJCA 3VGJA 4MW9A 2A30A 5TRTA 2XXJA 1P4SA 5I7FA 1U5BA 4AO7A 2FJUA 1D6JA 1FSFA 5BN3B 3B3JA 3AF5A 1MX5A 4BD9A 5HJ2A 3E81A 3ROQA 3NIBA 1TKAA 3CLVA 4UM8B 2HU2A 2HXYA 4XB2A 4HY3A 5ALFA 1Y5IA 2O2YA 2H0QA 3MS2A 2ATIA 2DPMA 4DYOA 1IATA 5FV4A 1LLQA 3ZGVA 2ZU0C 3N1UA 4UEQA 4Z8YA 2IU6A 2XBUA 2WEKA 2EP7A 2QAGC 1XMOB 1NOJA 3MWJA 4WNCA 2H9YA 2R9VA 3AFNA 4Z2AA 3EULA 2PRSA 2PR8A 2FZGA 5E6UA 3BMNB 4IHAA 1FXSA 3HXOA 1TNDA 1L5KA 4S04A 4Y9RA 1X1TA 3A9LA 2G70A 3ZZ1A 1EFRD 1LK0A 3LKDA 1QO0A 3H1BA 2J7KA 3FGZA 4R3LA 1UANA 2W8BB 1H2XA 3HBFA 2VF2A 3RGWS 2OK8A 3NATA 1ZD8A 4MWZA 4KORA 4WZAE 2MOKA 1N4AA 3A6JA 2QGZA 1CUEA 4QTXA 2D1SA 1YGPA 4S1PA 3Q3CA 1DTEA 4ENVA 1DX6A 5B30A 4G1BA 1AZSC 1E6LA 4KI0A 5F2KA 3AL3A 2VWPA 1C3LA 1QE0A 1KUYA 3DYVA 2PD4A 4IWYA 3TEJA 1FW8A 2BLLA 5A4DA 4Q15A 4A95A 3CSDA 4DNOA 3RSFA 2HD4A 5JD4A 3NTVA 1GXSB 3QH4A 4YMSA 3O4GA 4B09A 4XFDA 4KEAA 1I13A 2ABWA 1PV2A 3D4PA 3ZYZA 4OHFA 3OZWA 3VR0A 1CUWA 5THXA 4MUAA 3TW8B 4IX1A 2FKNA 5GM1A 4ZXPA 1KI2A 2J9GA 2QMZA 1XTBA 2UVDA 4F6RA 1M75A 3PDWA 3QPAA 3ICPA 4L27A 2RB7A 1TFUA 4JLMA 4ZVUA 4EAAA 2O2GA 4AURA 3E8MA 2FZWA 5DB4A 3PPIA 1N33B 3B78A 4NCIA 1UBHS 4U8HA 5GJBA 1MC1A 2HT6A 2RBEA 1M9NA 5HIIA 5LOVA 1XMTA 4GXRA 3M34A 1VA4A 3HL4A 1ICIA 2ZXFA 2QL5A 3IEIA 2Z3LA 2A5YB 4IEFB 3ML1A 3OE7A 3N7TA 4IX9A 2HPVA 4IK2A 4O8CA 3GGGA 3TSCA 1ITZA 4HL6A 5KNCA 3D2LA 1R0CA 4UDOA 1YTUA 2JATA 3EPJA 1BWPA 3EW9A 1BW9B 1IU8A 3MGDA 2P6MA 2UZ1A 4ZIRA 2R60A 1IK6A 4UFOA 5A5EA 2L42A 5DS0A 3KKKA 2OXEA 3LUKA 1DBWA 2VSXA 4C1NA 3HJAA 3QKSA 1P0IA 4UMFA 4Z0NA 4R8LA 3BE4A 2BFWA 3FJUA 4M6GA 1QGZA 4L85A 4HSGA 3IIBA 1E77A 3D64A 4EJ2A 4OGLA 2ZYUX 2IHTA 3FDXA 1ZLYA 3AM1A 4CFYA 3PDJA 4ER3A 2IIQA 4TL9A 2Z6VA 1N6KA 2NYQA 3PPYA 3AR7A 3A1EA 3EXFB 4Q9JA 3REFA 2NXJA 4C4RA 1XJWA 4BGEA 4BYGA 1R88A 3LC1O 3ORYA 2WMDA 4EARA 4ZMBA 1YZFA 5FTWA 3E84A 4BX9A 1S8NA 5FUQA 1UJBA 3CTPA 5KX5F 1YA6A 3PX7A 5JR3A 4RIFA 3L5KA 3N53A 1RQ2A 4MV5A 1J56A 2PRZA 3NOVA 4D5EA 2EYUA 2GEUA 3IPRA 1ILWA 4FOSA 4FUQA 1GFWA 1FMTA 2BEWB 1IK4A 6REQA 4WCFB 2VVTA 4GKBA 4DZTA 2QM7A 4Q4JB 2EBHX 2YUIA 4IFEA 4ZAYA 5BYJA 1MOSA 4DUPA 1W0CA 4OH1A 4B45A 1QHSA 1ZIXA 4XGQA 1UMCA 1UPAA 4BLVA 4Q47A 3NMUF 3LRPA 3R9GA 4M54A 1VIXA 1J07A 1FFXB 1NFQA 1YAHA 4FFWA 4ARUA 4B81A 4NMWA 1R37A 5G41A 3A3KA 1T25A 4TUYB 4H2KA 1NV8A 1IMJA 2CZGA 2SCUB 3KOWA 4BQFA 4CCWA 4X8LA 4D6XA 1ZK4A 1IIDA 2KSQA 4JBNA 2ODFA 4FYWA 1ZVJA 4YAFA 4EVSA 2ZIFA 3H5VA 4DDTA 1M6VA 3W5SA 1D8AA 4QOGA 4IJQA 1VA5A 2JGDB 4TLMB 3TWOA 3TB6A 4U2KA 3ZHXA 1DG3A 1WMSA 1PT5A 2R00A 4Y6RA 4NCBA 2Z2JA 4C2TA 1UC5B 5KNBH 4M99A 1DP4A 2IT1A 4BRSA 1BOFA 3QMPA 4YDRA 1KZ9A 1Z7BA 1U9IC 5FB3A 3T5MA 2OGSA 1KPHA 5A2QA 1VHWA 2Q62A 2EO8A 3RK1A 1A7JA 3I1IA 4XR4A 4L4UA 1BX1A 2O7QA 1ODIA 3R9XB 1L3CA 4P4UA 1E5LA 4QG3A 2IEGA 4IXMA 2L19A 1GDHA 2IYFA 3HDJA 3GRPA 3OOSA 1CP6A 3DQZA 2CFIA 4HDSB 1SCBA 2ZB2A 3K35A 4I5EA 1TKHA 3D0QA 2FPPB 2C5SA 3PBEA 1N5OX 1KYWA 2C2WA 2I6QA 1H66A 5AJZA 3JQ9A 2FXVA 5TQ0A 1H23A 3H2JA 4ZTBA 1QFSA 1PTJC 2O14A 2Q4YA 2NPIA 2ANCA 3VDMA 3OA0A 1ORDA 1Y4SA 2X40A 3OKFA 4D3SA 3SJ7A 4EGCB 5DGDA 1CETA 4V38A 1Z5ZA 5J8FA 4ASUD 1QRTA 3SVZA 5FPPA 1T9AA 3LWBA 5JGFA 1E1LA 1D0VA 2Z6UA 2IP1A 2XSZA 3KXDA 5I4MA 1DTDA 1KBOA 1ELOA 1MBZA 1IBKB 4C0JA 2F64A 2PG3A 5CVVA 1XEWY 1DEKA 1QUFA 1A2BA 3PGMA 3VTZA 1QGOA 1PR3A 2A6PA 2CCGA 5BNFA 1GGHA 4CIAA 2OYSA 4EY3A 4KCGA 4IIUA 3WA6A 1COWA 1FRQA 2NU8B 1GD1O 4ZANA 1VRCA 3TG8A 4B6OA 3R4VA 1RWQA 1OAAA 2AQHA 4HCJA 3NDBB 2AC2A 2OOTA 1IB6A 3HABA 2BH9A 2AKEA 4U1RA 1QYWA 1LSOA 3ADBA 4WXPA 3DAPA 5D5HA 2WT4A 2IZOA 5CTAA 1YZNA 5HMMA 5EC4A 3WYAA 2AUNA 1ETUA 4Z4CA 2K6GA 1OMOA 1PSWA 1YMEA 3GI1A 1K88A 3RUEA 1PIWA 2YNEA 5CJPA 2BUBA 1DWQA 3KAKA 5DU2A 1ORTA 2GE3A 4KWCA 2RHTA 2VDUE 3HUUA 1U7PA 2Q4BA 1L5MA 4YV7A 2AOUB 3NHRA 4Y2QA 1HDQA 3VR5A 3DVRX 1NHWA 3E5RA 3X43A 3PZBA 4N6OA 1Q7EA 3E3MA 4XYEA 2BJVA 2XD4A 4A2CA 3UJHA 1C3EA 5FLXA 4AY4A 3C3XA 2H1OA 4JVSB 2DPLA 1UZLA 5J4YA 3FF1A 3BXFA 3UH1A 5HOEA 3AW9A 3TO9A 5DWNA 1TQ8A 4X54A 2WKQA 4RY9A 2A1IA 1P1HA 4AIRA 4M8KA 2PX0A 3USZA 4B79A 1E1NA 4CF7A 5C8ZA 1UXGA 1ENOA 1ZI6A 3W5IA 4DAOA 2ZAOA 2X22A 1G5PA 5IH7A 1GAWA 3DFMA 1E3EA 3LT2A 2SNIE 4AMVA 2D4OA 3HXPA 2TMGA 4UD6A 3MD9A 2ANPA 5C3UA 5IRCD 2GTHA 4KE6A 1Q7GA 1NNEA 3O75A 4FS3A 2AV6A 4BTEA 3TLXA 5JT1A 2GUWA 2P6OA 4RCZA 4KPUB 2X9GA 3WSWA 3B1ZA 1I32A 1IUPA 1IHYA 5CVTA 4KQKA 1I7LA 2XYQA 3HB9A 1L4YA 3GRKA 1RCFA 4URHA 4NBVA 2WB2A 2EFGA 4ZN6A 5JNRA 4NLLA 5J5CA 4FC6A 3FVWA 1KMIY 1XALA 4HVLA 1KI9A 3OQNA 3CLSC 1RP7A 3ABZA 3QMVA 2B3TA 3LD2A 3PC8C 4P98A 4FCWA 4BNFA 1T1EA 4NK5A 4YR9A 2DPGA 5DV9A 3I9V6 1L7RA 2MIIA 1SC4A 3MTGA 3B85A 2LTAA 2EGHA 2H1LA 3LO8A 1Z4RA 3PQ3A 5JD3A 5JY1A 2OZVA 4UHEA 3AHEA 4LI0A 2WWYA 4OYHA 5FPYA 2PQ0A 2B3VA 4KRFA 4NDNE 2QZPA 2ADMA 1ZISA 2Q7BA 5EOVA 4R68A 1R57A 4UFVA 3KX2A 4RKQA 1CUBA 2PSWA 1X15A 4DEYA 2YRXA 3TVDA 1OLUA 1L4GA 1PNQA 1BOOA 3A3NA 2B4AA 2BKEA 4EENA 4E7OA 2ZW6A 2PH1A 3FTEA 3BL8A 4RNCA 1Z6ZA 4C0SA 3EEOA 3EH1A 1NW3A 3CBQA 2QR3A 5JROA 1HE5A 2X6QA 3ZBQA 4FYHA 3KP1A 4KQ6A 2XCOA 2ZW5A 1BXRA 1BQ4A 2QTLA 4KSBA 4ZI7A 4IH1A 2H92A 2QSZA 1DJQA 4G9GA 4NAHA 3F5FA 3HCDA 1ULSA 1C0LA 2I79A 3MXOA 5P8WA 2JJQA 5EQDA 3ONEA 5TY0A 1JHMA 1SKMA 2JI6A 4Z7JA 4XPDB 1XVIA 1O0BA 2QNRA 3NW9A 3OC6A 3FYUC 1J1IA 1KZ6A 2PTHA 1EB8A 3R3UA 3HCBA 4D9MA 3JZFA 4IIDA 3E9EA 1OH8A 5B37A 4W82A 4KVXA 4LOHA 3KSRA 5T3YA 3O8BA 5IKOA 1ZC4A 3FSEA 4TZKA 3DKIA 2VPYA 3OOEA 3B1YA 3UA3A 1IM8A 1M1YB 3V32A 4Q34A 4MGZR 3HVIA 3TRDA 2Q27A 4LX8A 4WZAB 4BO5A 1USWA 4FD6A 4YRLA 5EFOA 4BO3A 2PU5A 1N5DA 2CB9A 1QV9A 5FVJA 1XCGB 2WZNA 3CRZA 4G25A 1PEYA 4ML3A 1V0CA 5KTCA 4O0LA 3T7IA 3DDHA 1AYEA 1VYHA 4RSMA 4UNQA 1FP6A 4ITVA 2Z56A 1HE4A 4UHJA 1P6UA 4M89A 3TLJA 3MUOA 2O3QA 3NNNA 2QTMA 2BSWA 5K51A 4KIGA 2IYXA 4LYFA 3GY9A 5IVIA 1J1ZA 3GJ8A 4X7RA 3GGSA 2FWRA 1IJKA 4DW8A 2A78A 2NPOA 3HG7A 2ATEA 4UM9D 4O5AA 4KE9A 3ZNOA 3D4LA 4DJ5X 1Z8DA 2G1AA 3GLKA 4IQ8A 4Q4AB 2CF5A 4H7HA 2GOYA 2O28A 2WHQA 2F4NA 4OH7A 3V5NA 4WN9B 4KG7A 3EEYA 4AG9A 3NWBA 2ZEPA 1NP7A 3MFQA 3QKWA 4B13A 1YR7A 4EDHA 1V1MB 2BEUB 3PC3A 1IEXA 2O05A 1NY5A 4ZI3A 3S6FA 4LHWA 3D8PA 3OX3A 3VPCA 1ZJ5A 3P0HA 5I0CA 3LQRA 2NYAA 3CPHA 1RKQA 3M6XA 2QL7A 2PSEA 1VFNA 1I0ZA 4RV9A 3T9AA 3AEKA 5MGBA 4LZAA 1KDOA 3UJAA 3LZ6A 3HDVA 1O8CA 1NMYA 3GDOA 1HLDA 4N01A 1PQ4A 4GR5A 1QGUA 4MGIR 3AESA 4HNYB 4PGGA 1E7QA 5DWVA 4F4CA 3SJUA 3COJA 5HH1A 4RLFA 3KTAB 2PSJA 3IPAA 1DI0A 1K6MA 2C2XA 2BBOA 1ZUWA 3WHKA 1X38A 3CN9A 5C82A 1ZD5A 3S4YA 4MDHA 3FETA 3IKJA 2HHCA 4X60A 3ZX4A 3C70A 4EGAA 4KQJA 3PPWA 2WG2A 1M8KA 4F04A 2B92A 2NTJA 3AHHA 5U4XA 2NZXA 5JPCA 3M6WA 3RVQA 2QM3A 1FPMA 4X8OA 3IXLA 3I9V1 2JH9A 1U1DA 1X7GA 4R1QA 1WXWA 4AWXA 3GRUA 3YASA 5LZ7A 3DMGA 4BLWA 2IU0A 4J0HA 4LXUA 5KYTA 3JVNA 1JFSA 1T4DA 2Z3PA 4EY6A 3F9IA 2UAGA 3E18A 1X14A 1T3ZA 1I7PA 2V0NA 2PE3A 4KGVA 4NEGA 2K4MA 1WDMA 4HMQA 3H97A 3N8DA 3MS7A 2QN8A 4WGFA 4YCAA 4PW0A 2B83A 3Q9NA 3OJFA 1CG6A 3VYTB 3IHKA 3IMEA 5FNVA 3AHDA 4V0SA 1QZZA 5F76A 1L8AA 4TQAA 4EUNA 3EDRA 3RQSA 1Z83A 1X92A 2GIVA 3TPCA 2AJCA 2ZJ1A 2HSZA 1NE9A 4EPYA 1OAOA 1JTEA 5IKXA 3G85A 2Y1FA 4KQ1A 2WD7A 3COPA 3S81A 3LDFA 2W0MA 3KE8A 4C7XA 3SYMA 2UXCB 3RF7A 1FFAA 4F9EA 2ERYA 5IHPA 2WD8A 2Y0EA 3RVLA 4C0BA 4D6PA 2X4DA 3MHPA 4WNAB 5IJXA 2B5OA 4A37A 2MR5A 4LX0A 4CQJA 2RGRA 3D4BA 1HYEA 1TTPB 4M9CA 4LJ9A 3TDKA 4HGYA 2DR3A 1A7KA 2BBWA 3IBCA 1T36A 4P4IA 3KJEA 3FNFA 1SQFA 4D56A 1L4EA 3B3SA 3N70A 1OILA 2J9FA