2HC9A

Structure of caenorhabditis elegans leucine aminopeptidase-zinc complex (lap1)
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine aminopeptidase 1
publication title Crystal Structure and Function of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 168
structure length 489
sequence length 489
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hc9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hc9A02
3NH4A 3SI2A 1TKFA 1YLOA 5CBMA 4H2KA 1XFOA 5CPAA 2PIZA 2ZEEA 3PEIA 5LRKA 1TF9A 2PIYA 1KWMA 3NH8A 1ZLHA 4P4IA 4UEZA 5LRJA 4EFDA 4PQAA 2JBJA 4EWTA 5LYDA 2GREA 3PBBA 2AFOA 5IB9A 1XMBA 2PJ2A 1TKJA 2G9DA 1AMPA 3S9NA 1CPXA 3FX6A 3L2NA 1F2OA 2AFUA 4GM5A 3PB4X 3PB9X 4P6YA 5LYIA 3BHXA 2GLFA 4IK2A 2F8HA 1LCPA 2AFZA 3FF3A 4MCSA 2JEWA 4ZI6A 2ZEGA 2PJ3A 4ONWA 2RB7A 2ZEDA 3CDXA 3H8EA 1XBUA 4OIDA 3V7ZA 1QMUA 4MXUA 4RUHA 8CPAA 3KZWA 4MCPA 2PCUA 3GLJA 4LQGA 2PJ5A 3RAMA 3SJXA 2ZOGA 2PJ6A 1ZLIA 3KR5A 2AFWA 2XEGA 4PXDA 4FWUA 2WYRA 3D68A 2ANPA 2PRQA 1VIXA 3SJFA 1XJOA 3K9TA 1HDUA 2PJ0A 3WT4A 4A94A 4NGMA 3B35A 3CT9A 2WZNA 2ZEOA 2PJAA 2VL1A 1Y0RA 3VATA 5K8PA 4DUKA 5K8MA 3KASA 4P4EA 2QVPA 3B3TA 4MCQA 4ZX8A 2ZENA 5K8NA 3PBEA 1TKHA 3KR4A 3NFZA 3NA6A 2HB6A 1VHEA 4JYWA 1JQGA 3D7HA 3IFEA 4NGPA 4OC0A 1QQ9A 1HDQA 1ZG7A 2Q43A 4OKOA 2FVGA 3D7GA 4PXCA 3RZAA 3FH4A 5D29A 3B3WA 2ZEPA 3KI9A 4WWVA 2OR4A 1R43A 4UF4A 2CTCA 3NH5A 4P10A 4IHMA 3WC5A 3JRUA 3FVLA 3V38A 4K3NA 3ISZA 4NGQA 3TX8A 2PE3A 1Q7LA 1ARMA 4NGRA 2DEAA 4OP4A 4X8IA 1TXRA 1EE3P 2RFHA 5I4MA 2ABZA 1CP7A 1GYTA 3LWUA 2AFXA 3PB7X 3CPXA 4ZYQA 5D8NA 1ARLA 4R76A 5J1QA 7CPAA 3FMCA 4PXEA 2NSMA 4CPAA 4UEEA 2XEIA 3QNVA 4AXVA 1FNOA 1RTQA 5JGFA 1YSJA 4MRIA 3BXMA 1DE4C 2J9AA 5F09A 2ZEMA 1LFWA 3SJGA 3N5FA 1Y7EA 1YMEA 2EK9A 3MRUA 3S9LA 1PYTB 3KHXA 2F7VA 3RBUA 3PFEA 3K2KA 5HVGA 2PJBA 4UIBA 2IMOA 1Z2LA 5K8OA 1R3NA 2O4HA 4OC1A 2PJ7A 1LAMA 2PJ9A 3HLPA 3PRTA 3B7IA 2AFMA 1OBRA 4R6TA 2V8VA 4MHNA 1ZG8A 1ELLP 4A39A 5HVFA 2EWBA 2EK8A 4OMEA 3D66A 1PCAA 2AFSA 1XRYA 4P4BA 5JH9A 4BD9A 3D7DA 4YU9A 1LANA 2V77A 3DLJA 4A38A 3TC8A 4MHYA 3IIBA 1BLLE 2POKA 3S9MA 4X3RA 4G1PA 5LYFA 2ZEHA 2JBKA 3D7FA 5ELYA 1F57A 5DS0A 2I3CA 3B3VA 3FEDA 4FBEA 4PPZA 5LRGA 2C6GA 5HVHA 3KQXA 4P4DA 2V8GA 1H8LA 4NJQA 2CF4A 1LOKA 2QJ8A 3MN8A 1CP6A 3IJ3A 4EMEA 4NGNA 4P45A 3FJUA 1ZG9A 1HEEA 5HXDA 2C6PA 3IO1A 4KSIA 2PJ1A 4MMOA 4JZ0A 3D67A 3GUXA 4MCRA 2PVWA 2HC9A 4X2TA 1YW4A 4FUUA 2OOTA 3GB0A 3KL9A 4ZX9A 3FEEA 2Q4ZA 2C6CA 4R7MA 1UWYA 4B6ZA 3WC7A 4UIAA 4P4JA 2CTBA 1NSAA 4OIWA 3SJEA 2C1CA 2BOAA 1YW6A 1AYEA 1ELMP 3VH9A 1LAPA 1Y0YA 1Z5RA 2PVVA 1CPSA 3H8GA 3SI0A 2V8HA 3VARA 4OC5A 3PFOA 2ZOFA 4MHPA 4PXBA 4W9YA 3PB8X 4DYOA 3D4UA 3DGVA 3ISXA 4ZY0A 4Q7AA 4OC2A 3B3CA 3CPAA 4Z65A 3IWWA 2QYVA 1BAVA 3H8FA 1BPMA 1DTDA 4IAVA 3SI1A 4ZY1A 3KQZA 4F9UA 1TF8A 3HUVA 4F8ZA 4A37A 2IJZA 3PB6X 4TNUA 1CX8A 3KHZA 4OC3A 1IGBA 4P44A 3WC6A 2ZELA 3T8WA 4NGSA 4ZY2A 3BI0A 5JM6A 2GLJA 4O23A 3B3SA 2XEFA 4P4FA 1F2PA 2PJ8A 3BI1A 2CIJA 3I1UA 4OC4A 4FAIA 1VHOA 1M4LA 3LMSA 4MHZA 4NFRA 4F9VA 2PJ4A 4YWYA 4DJLA 1FT7A 2GU2A 2PJCA 3IC1A 4UEFA 1CG2A 4R8FA 1IY7A 2O53A 4NGTA 4WJBA 3WABA 3B2YA 2IQ6A 2V8DA 2XEJA 6CPAA 2Q51A 3FECA 1VGYA 2ZEFA 3KGQA 2NYQA 4TWEA 5LYLA 5THWA 1BPNA 3IEHA 2BCOA 1Z8LA 4NJRA 1CBXA 2BO9A
chains in the Genus database with same CATH superfamily
1OFUA 3NEPX 1L5HA 4WE3A 1B8NA 3B53X 4JJ8A 4C4TA 2QTVB 5C8VA 1XMJA 3INTA 5G41A 2IYRA 4RKYA 5FUYA 4MFPA 4OQMA 4DUYB 3I83A 3STTA 3WAKA 3J80A 2R4TA 3LFHA 4OI0A 5FCDA 3PXCX 5A2GA 3PJRA 4W5OA 2FMUA 3KLNA 1B4DA 3UCFA 2Z2IA 3PB9X 3OPVA 4F86A 5KQGA 4N0MA 3JWJA 4YAGA 1SCJA 1KYVA 4PAQA 3RVOA 3E22A 3UFBA 3R1KA 3VZCA 1KJ8A 1TTTA 1TAHA 4CODB 4JJKA 1REQB 3CJRA 2DPSA 2Q1UA 5JE8A 3JALA 1VP3A 2I2XB 2WYIA 1NM5A 1KJ9A 1M9NA 3NDIA 3M6UA 3ZWNA 4E1BA 5TE9A 1W47A 4D8YA 5FADA 2WMYA 3TN7A 2R1VA 1Z45A 1WP4A 4FXPA 2WWGA 2IHNA 4D8TA 3VZRA 3K1TA 4TTIA 4R51A 4CKZA 3SJBA 2ILTA 3EQ8A 4XPDB 2ZPAA 4P92A 2VDVE 3ETNA 1FFWA 3G9ZA 1AO0A 5BYAA 1F48A 2XX3A 5FL3A 4D5GA 2NG1A 4BTLA 5H7XA 4DIDA 3GC6A 5FWNA 5PGMA 1F6DA 2A0YA 3OJFA 1TDJA 1KDZA 4XIIA 5F5NA 2BGIA 4G0OA 1G20B 1DV1A 4R76A 1HFWA 4XZ3A 2B98A 1K1EA 1ZK4A 4ZI7A 1Z37A 4BMXA 1XFAA 4R83A 5AO9A 1KL7A 2ZREA 1QK3A 4PXSA 3PHLA 3O0TA 4IXDA 2ZQ5A 1G8SA 4EDFA 2REXB 1QU3A 1XOVA 5JQGA 1UIMA 4BQSA 5JFOA 2ZJ1A 1V7PC 4XEHA 1IBLB 4Q1DA 5E6UB 1OWMA 4M1TA 3K70D 2Q46A 1U0GA 1Y3HA 5AXBA 5HJ5A 4TZTA 1R0YA 1NR5A 2E4ZA 4FINA 4YP9A 2O05A 1SOUA 2P9ZA 3SVLA 3OZGA 1HQYE 3H0EA 1UQTA 1E89A 4A0FA 2EVNA 4B3HA 4GFDA 3IIBA 3IIKA 4M83A 1L7XA 2QAJA 4UEKA 3DMGA 4Z1MA 4M86A 2IZ1A 5JRJA 4E0BA 5DM70 4BRUA 2H2AA 3BCUA 3EY4A 4EELA 4IY1A 2QT0A 4NH0A 4AXXA 4CE6A 1RWOA 4FILA 3HBAA 3ZHZA 4PRYA 3RSZA 4EABA 2YHIB 1RJEA 1HEEA 3MWDA 2AR7A 4OLHA 3H5OA 2QZ4A 2FU5C 1YDEA 4QTYA 3OQOA 3EJWA 4EHJA 1KY2A 4WK6A 3LCMA 3DZDA 2W83A 4LYDA 3CEHA 1NI4A 3K1ZA 5CD1A 4FNMA 1QR6A 1OYWA 4ZOEA 4RI1A 3JU3A 1IK4A 2BMEA 4DVGA 5DJ5A 3TLZA 4ZHQF 3A4LA 5JCJD 4IIGA 5EIFA 3KAQA 3TAHA 3PB8X 1K7FB 5A05A 1GGMA 1J2TA 2J9RA 3V7WA 3TO9A 3ADBA 4R7ZA 4TQGA 4F4JA 2HO4A 1BXZA 1P1RA 3V1TC 3UB3A 1MMFB 1KIAA 4I2VA 2FI1A 1NVWQ 2GPJA 1R6XA 4IKEA 3VYSB 5EC8A 1L5FA 3F5BA 2EO8A 2M1ZA 4R9RA 3HFGA 1NHGA 3HCOA 2A92A 3T5AA 4KXNA 1NFFA 3LPCA 3HDQA 1EQ2A 2COEA 5LBTA 1QYIA 3BE6A 2X7HA 3R7LA 1UXJA 3RIGA 1JHUA 1CNEA 4P5EA 4LQCA 1E6UA 1QQ7A 1ZA2A 1VYHA 1LI4A 3H5ZA 2PVPA 2FPIB 3H9GA 4KHZA 2CDRA 1TU3A 4FFBA 4IWYA 5KWVA 4G4SP 4PTZA 1X7GA 5I9SA 4TWEA 5FD8A 4BBPA 5CXQA 1JBQA 4YJDA 5IDYA 5CEEA 4Q3BA 1VKOA 3ZBPA 2VHEA 3TTUA 3ESZA 4D9NA 1E32A 3DDCA 2X8JB 3E7DA 2LDBA 2Z0ZA 3HRHA 5JPIA 4IF5A 2QTRA 3A4IA 4WLEA 3H16A 3B6KA 4CCSA 3BD8A 2IE0A 1QRTA 5C8YB 4FGWA 2GN9A 2OUIA 5BMVB 3LPNA 2B6HA 1B6GA 2B6NA 5FLKA 1HDIA 5L3QA 3ZX4A 1HH4A 1XL1A 5JAUA 2PFSA 3RT1A 1ESCA 4PZCA 3HI6A 5JQWA 3K5IA 1Z6AA 4RDIA 3WKDA 5CDHA 2HIMA 1GKYA 5HSGA 5FPQA 1KZYC 3DB1A 4D99A 1EVEA 4A8JB 3QPWA 2CYAA 2EC5A 4B3FX 4C6RA 5I47A 4ZX8A 4YYEA 3V7NA 3TEFA 2DPTA 1UDAA 3ZWXA 1CQXA 1ESMA 4EI9A 3QA9A 4GXHA 1C1XB 5EXTA 2FLWA 3RKRA 4BJ1A 1UJ4A 2AG5A 1IXRC 4P4SA 4JYWA 1Y4AE 1E98A 2JI6A 2HSWA 5DNAA 4RK5A 3KVVA 3HCWA 1T3HA 4L2IA 4HWGA 4B85A 2HYDA 5DXAA 2PT7A 4TL7A 4ZICA 1W29A 4LPSA 4LWPA 1XF1A 2G7MC 3F3MA 3LW8A 3TQCA 5KQRA 1EA7A 2B21A 3GY0A 3QE9Y 2Z3MA 1DX6A 5H9VA 3HTXA 1PJ8A 5DO9A 2P3SA 4DMCA 1NVBA 3GFPA 3UMCA 1U0OC 1Z6ZA 2PS3A 4DGQA 3G5TA 4CEIA 1ZKMA 1NJSA 2GF0A 3DTVB 4YRQA 4ONEA 4DARA 2YYAA 1MOQA 2XNCA 2XJ4A 5CDSA 3HO1A 4ZRNA 1TQ6A 4IDCA 3OE5A 5GGXA 2PD3A 1VSBA 2Q7BA 1JQEA 2OT3B 1Z9BA 1RQGA 1W5TA 4LSMA 1QVVA 3WXMA 4IIUA 4DRXA 5AOVA 2ZI7A 1TJNA 4LZPA 4A6XA 2IXTA 1G59A 2B58A 2RHHA 2UVPB 5IJZA 1CY8A 2WD7A 1L4GA 3KK0A 5H4GA 1N2HA 1T3TA 1XEXB 5TY0A 1CJUC 2OXEA 2CB0A 2Q3DA 4NATA 4B3RB 4FW9A 5CDTA 1K06A 5GADl 1WXGA 2BAGA 5LMUB 3V1NA 4F3CA 5DF1A 3X0DA 4FMDF 1U3CA 1M2OA 2QPTA 3FNHA 3VR5D 1KRWA 4B34A 3ZWVA 2DWUA 3OEHD 4Q3NA 2OP1A 2W2KA 3I9KA 2XYQA 4LECA 3QBVA 1QP4A 1U9IC 1B23P 4B5OA 2HRBA 6ABPA 4MUNA 2VAVA 2NT4A 5LMNB 1CC1S 2PWBA 2V6BA 4YJGA 2CTBA 1D2GA 3HL4A 3QF4A 3CF0A 3WQSB 2LKDA 1G8GA 5KOHB 4EFMA 1T9GS 4HWOA 3R5XA 2IYWA 1SB9A 5ARCA 3ORHA 4LFBB 2GK7A 4B3XA 5IMBA 3IO3A 4E3WA 1EVZA 1DXYA 1JTVA 4IS3A 4CMKA 4EYOA 3R5FA 2PH5A 2YC4C 4XX1A 3COVA 4YJ3B 2RKBA 3UUGA 1EXNA 3BIWA 4MLCA 3ETLA 3ZXIA 3ETHA 5CTAA 5EUMA 4KOTA 2OQ2A 2X0NA 3NTXA 2MR5A 2DUWA 4D74A 4P44A 1TQ2A 5SZIA 4U9ZA 3VNBA 1NMEA 2XVXA 2XQVA 2BZ0A 4K9OA 1PZHA 4WK4B 3ONVA 2OMEA 4UMEA 4UUMA 2R6HA 3C3JA 2QR2A 2Y76A 3SZMA 1YQQA 4OX9B 4EHDA 3MUEA 1P2GA 1Z6TA 3GH3A 3OD1A 4HKTA 1ZHFA 1T2FA 3OZXA 4QQNA 1OGYA 4R8KA 3D4PA 4PBRA 4C4YA 3VH4A 1ATIA 2XI4A 3I52A 4UHDA 1DX9A 3MLBA 5H70A 3EBOA 3R6TA 5EZYB 1FC0A 2E1PA 5CVCA 4BRWA 3FPBA 3LP5A 4XOIA 1B6SA 3E4DA 3CGWA 3T7SA 4WA8A 1DLIA 3PQ7A 4AAYA 4ZAZA 1JI0A 5E8RA 4IDGA 3SYLA 3OOJA 2FTKE 2F8HA 1MO2A 3RIXA 2JFZA 2H48A 2I7CA 5T8KA 3RREA 3PNSA 2NVOA 4NENB 2VQ6A 2G0TA 3STYA 3LBAA 3KTDA 1D6JA 4XKJA 1KYYA 5JXIA 4EJSA 4ARZB 4EPYA 5TMPA 4AWXA 3EN0A 1TM4E 5IVHA 2PH3A 3QE2A 1VLMA 3QOWA 1BW9A 2DUMA 1DT3A 1VI6A 3G8CA 2VAWA 3CGGA 3W7AA 2Y0BA 1K9SA 1QIGA 3DOIA 2ZQZA 3AEUB 3SBOA 4M1WA 3FMFA 4C68A 1KZ4A 3CYFA 4IOKA 3AW8A 2DZDA 1ZD8A 3KHUA 4P10A 2GRAA 5IXSA 3PNYA 4PW0A 3DWIA 4HUQA 1NT4A 4NEHB 2JHPA 2Z3KA 2D7JA 1WB5A 2PE3A 1OFTA 3VI3B 1PZMA 1YQ9A 4MK4A 1TA4A 1CHDA 4DVJA 2OZVA 5LMCA 1VQ1A 4UM5A 2AX4A 5DIZA 3VPAA 2A9QA 5HMLA 3K0CC 2NYUA 4U8GA 2JGJA 2HFKA 4H3HB 4II2A 1HE5A 4B3TB 4HC4A 1Y6ZA 1DE4C 3DDOA 4WBSA 4CKCB 2O52A 3PUKA 1GV0A 4ESOA 4RGBA 3CVXA 2GZDA 3QA3E 1E3IA 1OAKA 1QIIA 4NWIA 2WB2A 2I2BA 2LKCA 4EKGA 3K9QO 1VG9B 2RHCA 3LY9A 1XVUA 5IW8A 2VHUA 2JBWA 1Y7HA 3KC2A 2O8FA 2QYHA 1NOJA 3DAYA 3L7AA 2NU7A 5IEBA 3OUTA 4CKEB 4OAEA 2IT1A 5BY2A 4TLEA 2VXBA 4AKIA 3VC1A 3YASA 3G0OA 1WHTA 5ALQA 1EDDA 1NKTA 2I8CA 1FTYA 4ADSG 2CXRA 3R0XA 1EZ1A 4ZOLB 1OR8A 2IUTA 4M6WA 1L4HA 3UOAB 3NM4A 2ZRQA 4KC0A 3ZBQA 2QU7A 1PFQA 2BRUA 4AYTA 4ZGWA 2G1KA 4H1HA 2BBTA 2FRDC 1ZSNA 1KY3A 2P1DA 1JFLA 4YLYA 1B0ZA 1NJ2A 1L2TA 2BFFA 2QTZA 2HMYB 3MT8A 2PAAA 2ZS7A 2OAEA 4Z3DA 5IDQA 3T95A 3A2NA 1VGRA 4WH0A 2XUHA 3EIUA 1D2HA 3P71T 3UYLA 5HYVA 1XU7A 3ZWPA 4LXGA 1P3Y1 5ALNA 2A35A 3CVOA 1GLVA 5DW3A 1DJNA 1N2CB 3TINA 1I5RA 2CGEA 5AKHA 1OLUB 1DTSA 2VPPA 5KVQA 1LVGA 1L5LA 1BS1A 4D5EA 1O96B 1U6JA 2SECE 2YH2A 2IPAB 4R16A 1TF8A 4JK3A 1EZZA 4CT4B 1JR6A 1I9GA 1QGED 4F8YA 3A4YA 2B5GB 5DM60 2Y71A 5JM6A 1NMXA 1XNGA 5FWDA 2WF6A 2NSDA 2JJMA 1WSDA 3BJMA 2VATA 4G86A 4QB9A 3IESA 2P4HX 4RSRA 1CJWA 5FUXA 4A9AA 2GJKA 2H3EA 4DLAA 2H1WA 4QLOA 4EA7A 3QVMA 1JE1A 5TDHA 5HF9A 5LP6C 2JAWA 1Z8LA 1L0CA 3PXGA 5ESRA 4N5IX 4D02A 3D6FA 5BOSA 5GM1A 3ZCRA 3L1HA 1U80A 3RC9A 3T06B 3ZGOA 3CX6A 4F0JA 5J40A 2MT9A 4CR7A 3H2GA 1EUDB 1Z74A 1J1IA 3IR6A 3IERA 4AZWA 4IQGA 3UH0A 1TOAA 5KTPA 2O14A 2ZUBA 3ACCA 1RHKA 1R8SA 2BEVA 2ASEA 2Q5LA 3ZHUA 3X1ZA 3ZVMA 3NVAA 5FHQA 4MHOA 4ERXA 1PJCA 3R75A 1OGIA 4MV9A 4R84A 2P2NA 4KSBA 3BCSA 3TJZA 2QL9A 3W6XA 1QVWA 2VJLA 2VQDA 2ONKA 3A4TA 2AI2A 4GKKB 3V2GA 1ONOA 1G8PA 1ZU5A 4B4OA 1JQGA 1G5PA 1S4MA 1NA5A 1X1AA 5FYQA 3STUA 1VJRA 1M66A 1T24A 4TKVA 5K2OA 4ILEA 1XDSA 5HM6A 2I3BA 4HSEA 2C03A 5HNKA 1J09A 1NV8A 4HGQA 3IELA 3KLMX 1UT5A 3QXHA 4ZOBA 2FQXA 4A23A 4P08A 4CPAA 3SCZA 1HNXB 4MPTA 1I4TD 3TLGA 1SCBA 1ILWA 1CTQA 3DTTA 4PV6A 1DCKA 3MTGA 3PS9A 3MTJA 3TLEA 1ZUNA 4N7MA 3HO6A 4H16A 3EZXA 1K5DA 4U00A 1JR3D 5M5BA 1RXWA 1AQUA 3GN2A 3QWIA 4JR1A 5KAMA 4UE3S 4OJMX 2JCXA 3DR6A 1HLGA 1EI9A 2DWCA 5DU2A 3W9SA 3KSDO 3TM4A 4BVGA 2N3ZA 4P4BA 4BNKA 3AUKA 2WRZA 4EGQA 1EA5A 1ULUA 1XAJA 4L5YA 2OKGA 2VL7A 1G8FA 5ELYA 3FTCA 3L8CA 1F9AA 4MROA 3DCIA 5JAIA 1RPJA 3EIHA 4J43A 2BCGY 4WXEA 3S2SA 4P4DA 4QUBA 1J0AA 1YB1A 3CTMA 4LJ5A 1A2KC 4DR2B 4EENA 2PT9A 2PX8A 2WJGA 4BATA 2YBDA 3H9BA 2QQEA 1N7JA 1HQKA 3PGXA 1II8A 2XYVA 3WSWA 3IMFA 3W6NA 2GDZA 4YFVA 4TQUS 2CLEB 2P65A 4DSZA 1Z83A 1OWPA 4D96A 2CCGA 1EWVA 2MINA 4RFSB 3IDZA 1AF7A 2ZB3A 2G4VA 2ABWA 2VDWA 3MIIA 3N70A 1IBKB 5G21A 1X8KA 3FVTA 1M4DA 3AV0B 1ZMOA 4KXVA 4PLTA 1P31A 1E79A 1QMGA 4FFPA 2XTNA 1CRLA 2IJGX 1AZLA 3PRJA 4PC3A 3IAXA 1LTKA 2QSZA 3PB6X 2Y2UA 2V97A 4D1YA 4HUJA 2JIDA 3WV5A 2WJZB 1E5DA 4ZY2A 4P86A 2HJVA 1MORA 1NW7A 4PO3X 5E6SB 3WHIA 4YBRA 3LZ6A 4EL0A 3ZLUA 2CIJA 5AVJA 5HWSA 5JDCA 3COSA 1UKAA 2DWPA 4D4KA 4BWYA 3DSBA 3NHLA 1I3KA 5CHYA 1WMAA 3X3HA 2A1UB 2RHWA 5SYAA 5LOVF 3RLIA 5CVEA 2WIBA 2C58A 4QUDA 2G3AA 1M8PA 5H68A 2WF9A 1YQTA 2J5RA 3A36A 5B6IA 2HF8A 5M04A 3A1SA 2OGWA 1R3UA 4QTTB 4I4TF 2PKQO 4TL6A 2NU6B 1MH1A 1ZNQO 3B70A 3VU1A 2ZIGA 5ALOA 1NTRA 3U7IA 2QBYB 1EVQA 1FYXA 3JQ7A 5CFNA 4OHXA 3MC1A 2EW1A 1TL7C 1QSOA 4YCDA 4U02A 2YASA 2ZZKA 4GAEA 3AF4A 2OZUA 4NONA 4IOJA 1DFHA 1AK9A 1I33A 1RAEA 3A1UA 2JCGA 1K2VN 1JS1X 4D42A 4G5SA 5CCEA 3AKYA 3RAMA 2F1JA 3OF3A 3M5DA 3FTQA 4DB4A 3HGMA 1OZGA 1N32B 3WFJA 4CW7A 2V1UA 1N78A 2WMDA 3KQWA 4FR5A 1YDWA 3S4YA 4IWNA 1RE1A 4KYUA 3D1LA 1CJKC 5CVJA 4PC7A 2BYTA 3RSQA 2VUSA 4AVYA 3RTAA 4EY5A 5FBLB 2BFEB 2HQSA 4EAQA 3MCAA 1ESNA 3I42A 3M4NA 5KQLA 3TR5A 3HMQA 1DB3A 3UWDA 3JSAA 3UFXB 4MW9A 3SLKA 4XQEA 2B4TO 4X63A 4A91A 1E2FA 1A69A 4BKPA 1ULAA 1G3UA 2C2YA 2JGNA 3V5NA 1GUZA 3TLXA 5JFTA 4HWSA 2AZXA 4P84A 2IPNA 2BEJA 3SC3A 2B7CA 4PLHA 2MSEB 1F4PA 1SEPA 2HUPA 4CIAA 3WVNA 4P2BA 1S1MA 3OLQA 3JAWB 3THSA 1A77A 1GNQA 1NNUA 3OE1A 1OPRA 4JOSA 4W5RA 3U44B 3QWBA 1PYTB 2G88A 3VH1A 1L8LA 4X6YA 3MJHA 3OEWA 1C4WA 4DLBA 3GJRA 4X3CA 2RB5A 1GCUA 5CAEA 4BMYA 2J3JA 2B1QA 1ENPA 5DHPA 4AMBA 3VVLA 2QRJA 4PANA 1MGOA 4LRQA 2EWBA 5IEJA 4UATA 4TV9F 4EW3A 1VPEA 1JPJA 5AM0A 3N5CA 5C4GB 3BE8A 5CX1A 4LJ7A 1GA4A 2B1IA 2WK1A 4JI7B 4HNGA 2UZ1B 4O4IB 2ZIWB 1OGJA 2WP8J 2DLNA 4N48A 3WJ7A 1DWOA 3A6LA 5LD2B 2YW9A 5DBOA 2EQ5A 4PSDA 3J81k 3AUUA 3VJRA 1ZGBA 4DMHA 5FWAA 4YDRA 5CT8A 2XUOA 1D1SA 2BHLA 2B0JA 5GWXA 5LU9A 4UCFA 1LSJA 4YRZA 2I6GA 5CB4A 5JSZA 3MGCA 5C8DA 4B75A 1NR7A 2DTXA 3DFZA 4MIKA 1UZAA 3W91A 5K3EA 1UJBA 5TQ2A 4CKBA 4LE2A 4RK1A 3FSEA 1XALA 4LYEA 1MR3F 4YV1A 5F47A 3K3PA 1YACA 4GI7A 2V7XA 2PMBA 1U1FA 1P4AA 1KBQA 1Y5MA 5EHGA 3KTAB 4KQCA 1VHQA 1BKDR 3ENVA 4CGZA 1QE5A 2XIQA 5C5CA 3EF0A 4WK2B 4ZY1A 2VRCA 2E4WA 4Q66C 4RJ2A 3AB3A 2PS0A 5DRYA 1W5EA 3HDHA 5FPTA 4C7XA 2VYND 2FNAA 2J4CA 4N0PA 4BLQA 3FPFA 1I2DA 5IHPA 4HVLA 3EPJA 1WV1A 3WGNA 4FM9A 4MUBA 3SJCA 4IIFA 5L53A 3PL5A 3D7SA 3KBBA 1Z07A 1UPTA 4CG0A 5K6RA 1KYIA 1V1JA 3QQ5A 4F06A 2HHAA 2HPAA 4PICA 1XCJA 1XZNA 2D06A 3QPDA 4AMGA 2I2FA 1CUCA 1VLZA 1OIVA 4TWIA 1C1HA 3IVAA 5THWA 5KYVA 3ABOB 4NJRA 1TKFA 2J5KA 1E8MA 2HNAA 3EG9A 3A9LA 3CE9A 4RTKA 3EGCA 1XMSA 1V1RB 4ZAFA 3ZU5A 2EJVA 2B4BA 3WYEA 4PN3A 3DQQA 1V16A 3EC2A 1HNNA 4GBED 4PYQA 4MJXA 1IYKA 4ZVRA 1PUIA 3ZHXA 2HT1A 4BO1A 4QODA 4JXJA 2VS1A 4EA8A 3R3WA 2FEKA 4K1LA 1MIOB 1P9RA 3FPHA 2AFZA 2QW1A 5K4HA 4DKJA 3ZVRA 1QX3A 3KM0A 3N8DA 3KBOA 4AZTA 3SJXA 1WDWB 4DLZA 5HE9A 4GYJA 5DCWA 1YDMA 4OGGA 1D0VA 4BN0A 2X3YA 4RMGA 2R8XA 4I4LA 2EERA 5T6MA 3QU4A 2P30A 4MWTA 4MI3A 4ZYXA 3OURA 3CX7A 3D3WB 3R9XB 1TF2A 1RXYA 4NBSA 2R6GA 3RS4A 2K7FA 2MHCA 1U4SA 3G79A 1M1ZA 4YUVA 3W1WA 3G3SA 3AT1A 4WWVA 2WABA 3L79A 4QPPA 2OU2A 4FGKA 1JP7A 4G0WA 2Q41A 3GJXC 5ILQA 3NBKA 1N4AA 4IHMA 1E2UA 1V1MB 3LSTA 2X15A 4G4JA 4A8PA 1JKFA 2H2FA 4ZO6A 1VLJA 4TMYA 2ZSIA 4PYOA 3GEPA 4R87A 3LXRA 4BX2A 3E8SA 3REOA 1Z4QA 3AHCA 3U3MA 2P8JA 3IMEA 5F2NA 5KPDA 2I6UA 2HO5A 1NIJA 3S2UA 4G9GA 5FORA 2ENWA 1Z0KA 4CF3A 2XCTB 1HLFA 3KQKA 5C35A 2QRVB 4UCPA 1DC5A 1CJBA 3L8DA 3FDJA 5CBPA 3MJSA 1OXBB 4X24A 3M6WA 3ANMA 5CK5A 4L5IA 3PDHA 4CMBA 2DX7A 4FWIB 4MHNA 4TMKA 3WWZA 4OATA 2HN9A 3BULA 5BVGB 5JAZA 3P9NA 2B1GA 3RUEA 4DRZA 2AJLI 4E5KA 3P4XA 5F12A 3HY3A 3B8HA 1AURA 4IDFA 2VQ3A 5HZMA 1YF3A 3ZQKA 1BCRB 3UYKA 2QNIA 4G65A 5FEMA 4KBGA 3V8VA 1CR1A 5JFGA 4J94A 3L7OA 3N8IA 4NYJR 2ZKIA 2ESRA 1NV9A 3DPSA 4YDQA 4KTVE 3IEXA 3BK2A 4J90A 1FUIA 1UQUA 1IQUA 1V39A 2HREA 1LPOA 5BMOA 3N6VA 3L02A 1SOAA 5HF6A 4B81A 4MB2A 2PG3A 3LVRE 4AIRA 4FGSA 2Z2KA 4O6VA 1NZJA 3B3JA 5DLDA 3F6CA 1L5QA 4NULA 2PJRA 2D5LA 4D0GA 5I4IA 1Y8QB 1KMHB 2YMLA 3QBJA 3K7EA 4GGPA 1QF6A 1P6UA 4PWYA 2D6FA 1XXHA 1GR1A 4RLFA 1JB1A 4IZOA 3D2PA 4KVOE 1TLTA 1JG3A 4CAXA 2IDJA 1TIKA 3ITEA 3O38A 2NN3C 4DILA 3UKOA 3Q41A 1W2HA 5EEGA 3WQHA 3KQYA 3OJCA 4OYRA 5A3JA 2Z2YA 2V6FA 1XLVA 1VHOA 4WY5A 4U2FA 4OQDA 3BJ8A 5CDFA 5J2TF 5U9CA 5TGTA 4PQYA 3HYTA 3GAAA 5GJWC 1XO1A 1JFRA 2AJDA 3N2GA 3GRPA 2AG0A 4BEWA 1UINA 4L73A 4WDRA 3B7WA 4RHCA 3GEEA 5KYYA 3LW7A 4AZVA 4B87A 5AKJA 4YACA 2ZJBA 4N4AA 2DR0A 1JEJA 1OX4B 2HF7A 5JHHB 4LHXA 4F5DA 3K6SA 5KQSA 1W4CA 5DVZA 2GVNA 3BH7A 2JRCA 1WUTA 3UMYA 1V8PA 4G0UA 3PWZA 3IKVA 1RXIA 4I50B 3I6QA 4CLRA 1OZPA 2PX0A 3TBHA 3VZBA 1M2WA 1T0BA 1Q95A 4GPIB 5GY7A 4QBJA 4HEA6 1EE9A 1FQJA 5AVWA 5EHZA 3KKWA 5F49A 3GJYA 5D2CA 1Y8RA 5BO5A 3NHPA 2FL4A 3G8BA 2BEUB 3RKSA 3KAKA 3AHFA 4U5XA 3SC2B 1RQLA 2V8OA 4JOBA 2PO5A 2A1TS 5L9AA 3DZFA 1K5PA 1XJOA 1I9CA 2IIQA 3WBBA 3H1EA 4R9MA 1XVLA 3WAJA 3QLVA 4LBVA 1K6EA 4MCQA 2ZTHA 5AVTA 5EWMA 4DSOA 5KKAA 2D2VA 2MYNA 4FI3F 5DTRA 1CUUA 2C9BA 1KO5A 2J5QA 2YWEA 2XQKA 1HOXA 2YRFA 4ZJYA 4F85A 2FV8A 3WMGA 3C6KA 4PZAA 2FZKA 1JA0A 2WAXA 4CF5A 4ZEVA 4K6KA 1WPRA 1VRVA 3KPVA 5BT8A 3ZJ4A 2OV3A 3GJ3A 3L0IB 2GPSA 4QOFA 1B43A 5BNFA 3HP1A 2DQYA 4CL8A 5FUBA 1YX0A 3PBKA 1KEWA 4PR3A 2I3GA 3K8QA 2E21A 4MRMA 1BE1A 4QVKA 1D1QA 2DHQA 3IP1A 1J8YF 1N5LA 3CPJB 4U2GA 3BC1A 5D8NA 3R7WB 4S1VA 2XLBA 2F43A 4O4JF 1YVEI 4HG2A 2GS9A 1Q0RA 5I7SA 4J9UE 4XDHA 1Y34E 1W8DA 1MB9A 3FFBA 1ULSA 2BDUA 1L7AA 4S1PA 5CH8A 2F7VA 4DLUA 3P96A 4DMGA 3QKSB 1G16A 1GQ2A 1RPNA 2YIJA 1SRRA 2BZGA 4XWYA 3OH8A 3I5UA 1S2NA 5BW4A 4Q9IA 1XPUA 5DNEA 2Z98A 3GFBA 3QFHA 2C97A 4DXHA 4XCVA 1M1YB 4CM8B 1C7EA 1SXJD 3IHWA 1FNMA 4GP6A 2XCRB 5JJKA 3Q1KA 3GQVA 4E5SA 3DC2A 4PHTA 4RVGA 5KMGB 2QW8A 2UYYA 1AKUA 1BGVA 1V8ZA 2NNLD 2FW1A 4DPMA 2AQIA 4D9HA 4N65A 2Y0MA 1C80A 1NBAA 2XWPA 5C4IA 1QLJA 3G9UA 3JARB 1O57A 2QRUA 3TECE 1MD9A 4QQ8A 3KLBA 3IVXA 3GVHA 3R9KA 2XCQA 4BO5A 1B00A 3FI9A 1Y7PA 2GEFA 3ZIDA 2AN1A 4UU7A 4LS3A 1AC5A 3RYIA 1NN1A 5DK4A 2NSYA 3KEMA 1RRCA 1WRBA 5MN5A 5DTJA 1H1LB 3MBKA 3GB0A 3CZRA 3ZZNA 5BSHA 2P6PA 2UZIR 4J0CA 1ADCA 4HTFB 3IEPA 2UUBB 4TXJA 1NMZA 1UBNA 4J0HA 4KLWA 1TAGA 1GFSA 3TOXA 3PEYA 1YB4A 4JBHA 3JQGB 1TO2E 4JCOA 1UDWA 3UGKA 1FNDA 3G1UA 2FDRA 1ZJYA 1KTVA 5K8VA 4DL9A 2PX3A 3WQQA 5CFZA 2IXGA 3MEQA 1ND6A 4EPTA 4OC3A 1UMCA 1X8JA 4JOQA 5BXYA 3WGHA 2Z6AA 4GNKA 4QECA 2EKQA 1Z5VA 1C29B 2FRVA 2OPHA 4X9XA 3WGYA 3C3XA 4ND4A 5JNLA 1SH7A 2BH2A 1M1NA 5JAMA 3TRDA 2KI5A 1ODLA 3K73O 2WT4A 3DV9A 1PIWA 2QDXA 4HGYA 3A4NA 2FPGB 4QL3A 1IULA 3VR5H 1C7QA 3L40A 4CGLA 1ZNXA 3GHYA 1OLXB 1XTRA 5CIWA 4R81A 2H4WA 2LCIA 3RARA 3CR8A 4HMOA 5BSTA 5GPBA 1ZVKA 4R3UC 3VSEA 1JDUA 3VU9A 3L0ZA 4DCGA 4MJLA 4ENPA 3RBZA 4YROA 1NZDA 2JZNA 1GL7A 4N18A 3TVTA 4AFNA 1YZHA 3VZQA 3VYRB 1P5FA 2BGMA 3IAAA 4KK4A 4F4CA 4CTOA 1L5MA 2IUSA 2FSUA 4H1VA 3NC0C 3NMUF 5F2KA 3M6LA 4IGEA 1W96A 1VDZA 2IHUA 4W9MC 3E3AA 1V7QA 5CEFA 2PRSA 1GPUA 1XMXA 3WGQA 2R8YA 1T3LA 2DLCX 2K2WA 1TIQA 4BIMA 3C6XA 3DE0X 1Z4JA 2B4QA 4XPZA 3V97A 3VC7A 2V55B 3FF1A 3KI9A 3EARA 3X1JA 1Z13A 1P9WA 1R0BA 1QNLA 1XMTA 1O94A 3NH5A 4EZBA 4TTAA 1OBCA 3P0EA 1BQEA 4YMUA 1ZICA 5B2FA 1S8OA 5JYBA 4PTYA 3AL0C 1E9EA 1P0MA 3L8MA 3OA2A 2AH5A 1X1RA 2XDQA 4JLWA 1TXRA 3O0DA 1XYVA 3HCNA 1RM5A 3U7GA 4NJEB 3DW1X 3ZKAA 1N77A 4L4SA 3RRYA 4CEJB 1UBCA 3AXSA 4BAGA 4XNHC 1JJFA 4TMTA 3COZA 3NTVA 1XTPA 1NAIA 5LZ7A 4AXVA 3T99A 2ZE7A 1XTIA 2QZSA 1VJ1A 1GPYA 1YSJA 2P41A 5G2OA 1UL1X 3JPWA 1A9SA 3QITA 3ZCUA 4JJ4A 2Z5LA 1J24A 2FX5A 4D8UA 4NDNE 1PX2A 2D2FA 1ZH6A 5IJ0A 3G0DA 5M7EA 1MX3A 1A8IA 4XPIB 4BE9A 5KYNA 2JIQA 5JD4A 1EESA 3OQ1A 2G06A 2XE4A 3H18A 4GGMX 2DERA 1M6WA 5CLHA 2CXQA 4EM6A 1BX3A 3MSCA 1U8UA 4HBZA 1EPUA 3WI7A 2P8SA 3H6GA 4A0RA 2YNDA 2PQ0A 1LJLA 4WBNF 1QIKA 4JP3A 2ZW6A 3VHXB 3P2IA 2ZAIA 1X7ZB 4S2UA 1U7TA 4RL6A 3WWOA 2DULA 1EXMA 4DRYA 4LBYA 5FNVB 3QVGA 1M6EX 3QBDA 2AYYA 4LGVA 4O63O 2WWRA 1W5BA 4YWJA 2OCIA 1BXGB 4MI6A 2EYUA 3PUJA 3OLVA 2QTWB 1TJ3A 4Z4GA 3FMIA 4UCNA 2Q7OE 1YZLA 4E5VA 2NYRA 4O4HA 1GKKA 1AK1A 2BOVA 1ZBQA 4FFRA 1JVSA 3EDYA 1MX9A 4LC1A 1UWLA 4K1XA 3C43A 2OG1A 1L1QA 3HRIA 1X1DA 2NPOA 1TLLA 2NLOA 3OEEA 5B6JA 2HJGA 3ND9A 2ZQYA 5B7QA 1SQHA 2WSBA 4PSVA 1GV1A 1IZ7A 3EFBA 3IODA 1ZESA 1EHCA 2JDIA 3RVNA 1NM5C 1RRMA 4WOJA 5LQMA 1WJGA 1L9XA 4QU5A 4WFJA 1PJZA 1C0IA 1C5KA 2OQVA 4NCIA 3IT3A 1ENOA 1FT7A 5BSFA 1HDCA 3D02A 3C6MA 4Q12A 5CCBA 1R3DA 4K2HA 4MUGA 4NPHA 5C31A 1VG1A 2RGNC 2ZW5A 2YWCA 2AE2A 3H4TA 1NJ1A 5AJXA 2GEKA 2PX4A 4NHEA 5F1OA 5CBMA 5IK2A 3PQEA 4RIFA 1MRSA 1E3SA 5F7JA 5A5FA 2DYKA 2YN2A 1UXHA 1GZ7A 3VPCA 3K53A 2EL9A 1YB7A 4RF4A 3TX6A 3IUEA 1KZFA 1Q83A 2GJ8A 3IOBA 1B3BA 3MTQA 3EB9A 2H3HA 3TT2A 2HADA 2XBMA 2BEWB 2UAGA 4JX8A 1QF9A 2W2LA 3TQSA 2LBPA 5TQ0A 3DMFA 1UMDB 4JBGA 5TT0A 1WCIB 3QHQA 3N59A 1ML3A 3RADC 3BWVA 2GZHA 1LV8A 1A76A 3DR8A 5HDQA 4JBWA 3UHFA 4F4DA 3KB8A 1Z0SA 2X1MA 4HMPA 5FOVA 1IY8A 2KW5A 3ZW9A 2G4CA 4YRBA 1XP8A 3NVMB 3F98A 4FX5A 4CYQA 2OM6A 1MG0A 3HKBA 4PYIA 2X2OA 3K6KA 1NXTA 3FDIA 1BE8A 2GARA 3I2GA 2NYVA 3FWNA 4S12A 3I4LA 3OIYA 1N8KA 1WP9A 4HR7A 1I2AA 2GAIA 2W6PA 2UYOA 3TX8A 1G41A 3VPHA 5KI6A 1TECE 3GX1A 2GLUA 1NF2A 3RR2A 2YV1A 1C2YA 3DL7A 4RTLA 5TX7A 1POXA 4K30A 1L9KA 4UDNA 5BPFA 1XZPA 1CB0A 4UXHA 3CV3A 2D3TA 5HX7A 5L4LA 2IS4A 2XJ9A 5E4FA 2J9AA 5GZ6A 4Q4DA 2O8CA 4L76A 1WSBA 3FCCA 3RABA 1QH0A 5T4FA 1QR2A 4OHZA 4BC1A 1KGDA 4MGKR 3FOFC 4L07A 4QC2A 1NW9B 3NTQA 2VJQA 3ICOA 2PR8A 1G1MA 4N7JA 2PGXA 3GNLA 2FPKA 4OMEA 1W0CA 3RFUA 2XDWA 1KMCA 4ZQBA 3GZNB 3PUYA 1FRFS 5KPJA 1QVZA 3NORA 4MW7A 3OPNA 6AT1A 1F8FA 4KSCA 1F57A 4FBEA 5A4IS 3W9UA 4HMQA 5TJHA 2XVAA 4I99A 3G2MA 1H8LA 2C61A 6ADHA 2SNIE 2OEPA 5TPWA 1Z3CA 3ZYZA 2BMAA 4MYHA 2HNKA 2B34A 4LF8B 3BM5A 1KRHA 3ZVNA 1EP9A 2VVTA 3GROA 2FG6C 4YJFB 4MV3A 1QOPB 3T7JA 1P1KA 1OV6A 1K7SN 1RPAA 3E35A 1T1SA 4A0HA 3M4YA 3E61A 3U4HA 1CDEA 3R6DA 3AEQA 1JGTA 2H2GA 1BE0A 1Z35A 4DA6A 3AVVA 1QTIA 1U02A 2TMYA 1DTDA 3RJMA 2YN0A 3F5QA 1XDUA 1AHNA 1B8OA 4CM9A 2H5EA 2V7GA 1M2EA 1XL0A 2VC2B 3FCXA 4I55A 5HMMA 4AZ0A 1C0KA 1ZVMA 4A10A 3BI1A 3N58A 1XCGB 4ZCSA 1DBPA 2J0VA 1AY0A 5AW2A 4YONB 3LLUA 4MW6A 2GLTA 3IVRA 3I8XA 3BWEA 1N9GA 6YASA 5F5LA 3FNCA 1C3VA 1DVRA 3ONEA 1IATA 3JYNA 3AZPA 1P77A 2I66A 3B85A 1SBQA 1CJTC 2Z3VA 2FSSA 2SHKA 1CZHA 4G97A 2WNHA 1R8YA 2E4VA 5BN4A 4FOLA 4FWBA 3NB0A 3PEIA 3B5EA 1RYFA 2DTDA 1PT8A 3E7PA 4XB1A 1NGSA 3UEOA 1OWNA 4JUIA 2ZJ0A 5C34B 3N2KB 1PFYA 1YCGA 3BFXA 4K9LA 2ZRJA 2QMHA 3HA3A 4ZQEA 2POCA 2EJWA 3AHDA 2VAXA 2GE3A 1IBSA 2WPXA 3NJRA 3SQXA 4ONWA 2BI8A 3RWMB 4Y98A 1XUOA 1U8FO 4TL8A 5ERYA 1M0SA 3II6X 2SKDA 2JIBA 3BRCA 5CGZA 1SU4A 4TYNA 3IBSA 1A8PA 3B89A 3FDZB 2WLTA 4QEZA 1Y7RA 4PYKA 4JJIA 5F9MA 3GGJA 4KKXB 4YS6A 2A2ZA 4MLDA 4JDPA 4JQCA 4Q4JB 2NXCA 1UFRA 1QPGA 1E2DA 1O6ZA 2WOJA 2JGRA 2ARKA 3VUFA 4L8FA 2R65A 1J97A 5K51A 2AQHA 4RNCA 2QYOA 5KTMA 2EBHX 3GJTA 1XHLA 2G5PA 4WXYB 2JIRA 3LQ1A 1E0DA 4QU9A 3FB3A 4BX8A 4OB7A 2P2CA 2VR1A 3O26A 4JT8A 5A1JA 3QHAA 2A33A 3PCRB 1TM1E 4ZT7A 5A4KA 2IEZA 2C1ZA 4DLKA 1K8RA 4DM3A 4FW8A 2I80A 2NAFA 3ZVLA 4JJZA 1Z16A 4OHBA 3S2ZA 3ZX5A 3CEMA 4CIXA 3LUPA 2HWUA 1KKMA 4E5NA 4XYMA 2IU4A 3ZDDA 1QSRA 3L1IA 2AFVA 4DV4B 2O4HA 1A82A 4JKIA 2D5IA 4MARA 4UFWA 2PH7A 4M7OA 4YC7A 3DOEA 3TQFA 5BR8B 4XGIA 3RSOA 1E1LA 4KV7A 1JIIA 1IQ0A 2NXNA 2BL1A 3EC1A 2X58A 4Y6GB 1YJ5A 2I34A 3PNOA 2B9VA 3KQSA 4KMOA 1QUEA 3EZYA 1DQZA 2RGCA 3AHGA 1R4AA 2L18A 2G9RA 1QHYA 4KHPB 4WCVA 1P60A 4P31A 2C83A 3V8RA 3NU1A 4Q48A 1O8BA 3DVAB 1KI6A 2OXTA 4DIBA 3IT2A 4L0DA 2I2AA 1RJWA 3FCOA 3KKPA 4BAZA 4Q03A 5BN3A 4IHJB 1A7JA 5EJ2A 4TLAA 3GA7A 3OTHA 3V80A 1JT2A 2GEBA 1MB3A 2PJ1A 3EZ7A 1X86B 4CFSA 5ALWA 3GUXA 2CNWA 2Z4RA 5JCJA 1N71A 1YSCA 4M85A 3OM8A 2IHVA 3TX2A 2F90A 3KT8A 1WF3A 4U6QA 721PA 2X7XA 3CZXA 3OO0A 5KWSA 5BW6B 4GM4A 2OB2A 2Q6LA 2C0PA 3QWFA 3K0BA 3NRJA 3HXTA 2G3TA 1NASA 3WAGA 3CKYA 4PXBA 1JI3A 4F1WA 1PVDA 3R9FA 4GE0A 4OXKA 3TZBA 3UHOA 3GPCA 4WNAA 3DM9B 4E21A 2B5WA 4YRDA 4QJ3A 4G1EB 4RPLA 4QVTA 1ZUD1 2V5AA 5J4KA 2FJPA 4F8ZA 1KI3A 3QFFA 4RSHA 2ZWOA 3U3DA 1T4BA 2D59A 1SOVA 1NWHA 4UBMA 5H1YA 2AMLA 1OZAA 2NUTA 3B3SA 4KFSA 4LYHA 4HQFA 2AJTA 1EXDA 3FKQA 1T3ZA 4JMPA 4UFNA 1MFZA 2C3OA 1KHHA 2IHZA 3KZKA 5FPPA 1N9ZA 3HZZA 3PQ2A 3NUQA 5DHQA 1Q0QA 2R1TA 1PSWA 4YCJA 4YMTA 4G9BA 4OU4A 2VZ9A 3T1YB 1JMVA 3U49A 3QKWA 4JJXA 4BJ5A 2MCFA 4BEVA 1XZFA 3H7AA 3BGSA 2E87A 4KQWA 3LQYA 5A02A 2WUUA 4OHVA 1AG9A 1R6BX 4G9EA 5A4JA 3X43A 2MYPA 5IZCA 1RRGA 4G67A 1O58A 2HSDA 1E6CA 5DH9A 3W77A 2ZJ3A 2R85A 1EM6A 2WMNB 1UPCA 4UZEA 1H93A 4M87A 1VL6A 2PAFA 1G8YA 4K8RB 1IBRA 3JQAD 2WQ6A 4LZJA 1QGUB 4R2LA 2FUCA 2GLXA 4HGOA 3TKYA 3F1KA 1RI4A 4AO8A 2FFAA 2BDEA 1F2VA 4GLLA 1SCQA 4GXQA 4CF4A 4N01A 1V48A 3DGFC 4N39A 4Z7JA 4OUKX 4IPTA 3TL3A 4GGOA 4FBGA 4FMCF 3HSSA 2PGIA 2XY4A 4EHIA 2AUNA 4IKOA 4IEEA 2I00A 1MF7A 3ZWAA 3BOSA 4F6LA 1OJLA 4OFXA 3TB4A 2ERCA 3EVZA 3UQYS 4BMZA 4LCBA 2B30A 4ARIA 4EL5A 3ZH2A 4JSRA 1X3SA 4HATA 3UV6A 1W1WA 4U2EA 3C85A 3IKJA 1QKJA 1K7EB 1F7VA 3U4QB 4ZI3A 3TNYA 2QA5A 2L0XA 3ELYA 5ITVA 5C1IA 1RAAA 2IVZA 1BQ3A 2I8LA 4LQLA 4GSKA 4Y2RA 3UNXA 4KPYA 4AO6A 3VGJA 1YS6A 1O6GA 2RGWA 2X5XA 2X3UA 4FYYA 4XYEA 2FXFA 3TR6A 2OLEA 1YH3A 2XMPA 4QFCA 5JG7A 5JHGB 3U6KA 3AP3A 2DKNA 2YMPA 2PUBA 4KUEA 1WUKS 1DTWA 1U8EA 3I5YA 3O03A 2WVAA 3O2QB 2X5OA 3K1YA 4HAYA 2ZS9A 5LIRA 3WMWA 4J7UA 1QHXA 2XNJA 9LDBA 3W3AD 5J59A 3I6ZA 3I58A 1WWZA 2F3PA 1MG5A 3PRHA 3B3VA 3P9IA 4XAQA 2WJPA 3VR5A 4JUBA 2IGTA 4WTOA 3FD8A 2G63A 4ZD6A 2JKVA 2VPTA 1EM8A 3FYCA 3OESA 1AUPA 2KLHA 3DJYA 3HNRA 1RXCA 5AJUA 3GBVA 1YTLA 3ZHOA 3DB2A 1HA3A 1B8VA 4TV8A 2O3UA 3BMNB 1VA4A 4LRYA 2OCDA 2WUWE 1A4IA 2A86A 3EUEA 3IV6A 3LOPA 2Y0DA 4AQDA 2VLIA 4IG4A 3B52X 2P5TB 1GRNA 3JWIA 3EGIA 1A2QA 4DJJA 5K6AC 2ZR7A 3B5IA 2JEOA 4BNMA 5D6NA 3RYFA 2OGSA 5EEHA 3IMCA 1ZUHA 4E70A 2CMKA 1F14A 2XB4A 4PQRA 1PKEA 1GTVA 1XZMA 4MKGA 4H7IA 5MGBA 4GZ6A 3A04A 2NU9B 1LDYA 2NUPB 4E2WA 1SC4A 1TKRA 4DC9A 3IAM1 4AG5A 4BIIA 1D7OA 1YGHA 4L02A 4F3NA 2I1LA 1PGJA 1CUYA 1Q74A 5ARBA 3VISA 2PL1A 1EBUA 3KOOA 2ZW9A 4RK0A 1HNWB 2IU3A 4KXMA 4OXIA 1W44A 4JJ6A 2AOTA 3DLIA 2BIFA 5LIPA 1BSVA 3T9CA 2YWFA 5KYTA 2CFRA 1IU9A 3LHFA 4QVIA 2Q9AA 1KZ9A 3P4UA 1IY1A 4PR0A 2RHMA 1JIUA 1JBEA 3EOBI 1L7DA 1OWOA 2COUA 3I45A 4GZLA 1F6WA 3NHFA 4UUNA 3NDBB 2C2WA 1YA4A 4HLQB 3X1KA 1WIWA 4FZVA 3THXA 1ADYA 3PBBA 2XQIA 3FGNA 1T2UA 3U3RA 1KFBB 4CMAA 5LQNA 1CEQA 4F72A 5IT4A 1CPXA 4MUFA 4X1OA 2AK2A 1YAHA 3K0AA 4P6YA 4MYDA 2WKSA 1NC1A 5FULA 1GNVA 2PS9A 2G1UA 2OA0A 3SLGA 1QYRA 5HCNA 1AO3A 1O95D 2YJ5A 4L1KA 1J9EA 5JUWA 5D86A 2ZYSA 3MUFA 4IIBA 1UM9B 1YVDA 1QCZA 2PJ6A 4YP1A 2PQMA 4OB8A 2Q9UA 4HT3B 3DQZA 3FF4A 2WI8A 3A1TA 2CVZA 3ZDQA 1ISHA 5JMPA 3KQPA 2AT1A 5D3MA 4FOOA 3N87A 1G64A 1WUIS 4A27A 2YNCC 1Y8AA 5BUQA 3JD4A 4JELA 2ZWPA 2AA3A 4B3IA 4PNHA 4KRGA 5AVZA 1IVNA 2CN1A 4L4ZA 4BB5A 1T13A 1LFDB 5LXTA 3RSGA 4MR9A 4U2DA 1GGNA 2W2PA 2CD7A 2Q8QA 1SHUX 4F9FA 3VPFA 5AI9A 3EFHA 2HJHA 5FOXA 1XQ6A 1RCFA 2ZYDA 3VR6D 3LXXA 3BHIA 3LGSA 2EX4A 3NOQA 3PUIA 1F51E 4KLAA 1UKZA 1FNOA 2BR4A 1BXRB 3R6LA 3ABRB 4YA6A 3CKMA 1NN5A 3H9QA 3K4HA 5LCXA 4KMRA 1D2NA 3REGA 1NUQA 1C3OA 3M4ZA 3W1EA 4JQYA 4ZXFA 4Y7DA 4TMFA 1BEUB 3GUUA 2WJWA 1K63A 3ACDA 5FI3A 4IIJB 5KX5B 4EUKA 3B7IA 3O4GA 2ANCA 3I04M 1G5FA 3B6JA 3VPGA 2BD0A 4FK8A 5CFMA 3MW8A 1QGAA 5FOSA 1SWVA 4HNAB 1W76A 1JJ7A 2P68A 2EJUA 4M6IA 4RDHA 1N7IA 1M0EA 4Y3UA 2XGJA 3FX2A 2HU5A 3RGGA 3PK0A 2BV3A 4HH3C 1QCDA 3WLTA 3LG2A 2EAUA 4PX2A 3PJEA 1SUCA 2E4UA 3ZH9B 5JNVA 1BE6A 5HVHA 2RHJA 4OLJA 2UYQA 3QENA 1JQLB 1CYEA 3CC8A 4M4SA 1JKXA 4C2TA 3L41A 4L78A 2WWXA 3TTYA 4MAAA 3WISA 3PRYA 4N3BA 1SG9A 1QTQA 5HQ3A 4DCNA 3CWCA 4CM3A 1PR0A 3AR4A 2ZB4A 2HLDA 1WY5A 3RI3A 1VPWA 5LBUA 4W5JA 1FJXA 1IOZA 3CEAA 3UPTA 1QO0D 3D81A 4MQFA 2AN5A 1NE2A 1NLYA 5GZ1A 4DJEC 2VP3A 1PO7A 4OSOA 3RS7A 2OG2A 4P80A 5AVXA 2H0AA 4B13A 6REQB 4U8HA 1PBNA 4IXTA 3ZR4B 1NYLA 3D6AA 1JIJA 1IXYA 2GBLC 4RHFA 5TF0A 1A4RA 1M5TA 5IAOA 1OAAA 3AHIA 2RHRA 4MVWA 4GLFA 4JYZA 1FFHA 1PU2A 3IUPA 5L8VA 4PZUA 4RZIA 3NO4A 3TRHA 4JIGA 2GK6A 3EFAA 1QDEA 2KLBA 4A73A 3H2ZA 4X90A 3E9ZA 5DBEX 3WNBA 3L7IA 3ZCPA 3IC1A 2V0CA 2WA2A 2LV8A 2NV6A 2CW5A 5BW8A 3TW0A 1KEVA 1YJCA 3IA2A 4JBXA 3NKVA 3DKPA 1IEVA 4YAIA 5EIBC 3L9WA 5JCZA 4IJWA 1LPNA 2QHXA 4WFKA 1XXHE 1V9CA 2C7GA 3NASA 3KQLA 2BCOA 5BN5B 4EW2A 2NP6A 3NHBA 4P54A 5F52A 2Q1WA 4FEGA 4WESA 1UBMS 3Q7QA 4KJZA 5IJWA 3DZJA 2YNMD 1PW5A 2Y9MB 1RTTA 2PBLA 3UHJA 2WYWA 1W34A 1ZI9A 2Z1DA 3A32A 2SICE 5AW4A 3W8NA 1LCPA 3GUVA 4AULA 3U4CA 5KJ6A 1DQNA 2XMDA 4XEUA 4O59O 5JZMA 3FUCA 2B2XA 1L8AA 1ST3A 1XDDA 1V4VA 3DL2A 3DHWC 3NETA 5KHLB 1ZLYA 1ZOLA 4KP7A 4BRZA 2W90A 1M6VA 1LS6A 1NQTA 1ZH8A 3HUEA 4TSFD 2O6LA 3PHCA 2HBRA 4IDAA 1GA6A 1Y5LA 2PU5A 4B11A 1LSSA 2P4QA 4XYGA 5E6RA 1ZZEA 2YQ5A 3DNPA 1FYWA 3OM9A 1P3JA 1BHO1 1E3EA 4ER3A 3H2YA 3S6HA 4CIWA 4P4LA 3DAFA 4ACAA 4GVLA 1OBOA 2J0UA 3A3YA 3SEAA 1CDZA 1R5BA 1JWBB 3EXEB 1LRLA 3UWKA 5HBGA 1YA8A 2F3RA 3W4IA 3JQPA 3WWCA 3ZS8A 4FU0A 4P3OA 2GUGA 1RKVA 2PMFA 2FR1A 4AQYB 4Y1RA 4RKFA 1Z8WA 4K28A 4QATA 3D31A 2HLHA 2R1UA 2BHTA 2QD3A 1YZVA 5LP6B 3PA6A 3P0FA 1T6ZA 5H4HA 3BH0A 1E3QA 3FVRA 1GQRA 1I0IA 3Q5DA 5B3LA 4LPKA 3NVKI 1QSMA 3NPAA 5ALDA 2BL4A 1N1DA 1OZHA 3LWZA 4Z2AA 3W3ZB 1TZJA 1XTTA 3I23A 4C5AA 3VR4D 1RHQA 3G0BA 3EZFA 4ZO4A 2WT8A 2J48A 1C1DA 1TXGA 2BE7A 5HJ7A 4X3RA 3WLMA 3AW9A 3ETJA 2Z10A 5GONF 2B35A 2QVYX 3DKVA 13PKA 4D0SA 3H05A 1RM0A 4JIMA 3M2TA 5BW5A 1TPZA 1Z22A 3RJ9A 1OE0A 1YFJA 2NZ8A 1W7AA 4MS4A 2HGSA 4HJXA 3EC7A 3BCHA 1KFCB 1L8QA 4RKWA 8GPBA 1I94B 3T9FA 3N3BC 3DMHA 3ONDA 4ZYYA 4HEJA 4JR0A 1KZ7B 2JL1A 2I7XA 2JAUA 3CG0A 1B74A 5HIIA 3G6WA 4C0LA 3G0HA 1T15A 1EFDN 1QLHA 4ON9A 4GI2A 1PGNA 3RF7A 3ROFA 4II9A 1SQFA 4D4HA 3RE1A 1Y9EA 2ZTUA 1HMPA 3S44A 1J6UA 3CPAA 4OHWA 2FPMA 3CZMA 4F6CA 2BKUA 4FYKA 3QG5A 5DCLA 2FR8A 4Q3DA 3UXMA 4C6SA 1MU0A 1PEDA 5U4XA 5IX3A 3ESBA 3DTNA 1QU2A 1E7RA 4MWBA 4LTDA 3ESXA 5EAIA 5A7GA 3DE6X 4OC4A 4YLGA 4FOTA 5LYJB 4F9VA 2V7TA 4TLLB 2P11A 4LX9A 5KYUA 4B7ZA 5I45A 4BQOA 4TZ0A 1B42A 1CKEA 2XSZA 3DBHB 1JHYA 5JR3A 4UTZA 1DFGA 5CFQA 4V1CI 4TKUA 3H2SA 3DDNA 4O2AF 2BM0A 3IEVA 3AC0A 5BXQC 5DWDA 4LWQA 4TM8A 1U2ZA 2O48X 4DE5A 3EWAA 4QJBA 2DXQA 2HK8A 1JJAA 2D0PB 1UCFA 2V7WA 1M2HA 2W9XA 2C5EA 4CAVA 4JU9A 5HZKA 1KK2A 3HKDB 3T1QA 1DG1G 4MPDA 3L7YA 3MWLA 3QKRB 3T6KA 4C3OB 4AX8A 3OFNA 1JHVA 2IYXA 2JEWA 1P8JA 3DZHA 5DHAA 3OPQA 4CCAA 2PBFA 4HAVA 3DOFA 3CDXA 2DCUA 5A0TA 4C6TB 2VTDA 2JLWA 4F46A 1TQ4A 4L9SA 2Z3OA 3QSYA 1VIYA 2QP4A 1IY0A 1MAAA 3CNHA 4M0DA 4YRNA 3DE3X 1TF5A 1YQGA 3ZJTA 3FTDA 4UTNA 2J8NA 1ISGA 4WMLA 4ENSA 4LOIA 5ESXA 1H2ZA 4KRFA 4KIWA 4ZVKA 3R9WA 3QELB 4X7MA 4CM5A 2PXCA 4FSHA 1DC8A 3GGPA 3HJBA 3BLNA 4G8DA 2C8LA 1ZJJA 4IKPA 3CW8X 2A4MA 3AFOA 1FMFA 1HDYA 2CVQA 5CA1A 3UA3A 1PL6A 4Y0NA 1XD9A 3KU4A 4XIFA 4MSUA 4YR9A 2CNDA 1NBHA 3C15C 1LTQA 1QC5A 1KEEB 4QQFA 3RG2A 4Y0AA 2QP3A 3X1DA 1YDHA 3N7TA 3DKIA 2EWMA 3AGQA 3S2EA 4Y6SA 4EG1A 3KKOA 3ZJ5A 2WFMA 4L5AA 1GYTA 1MZVA 4Y0VA 1VIMA 3LM8A 1NPYA 3I9SA 1XELA 3CQ9A 3KCQA 2I4MA 2ZVPX 4KOVA 1NRWA 1GGHA 3KJHA 5DWMA 4GC9A 5C7YA 5KNBD 1I3CA 3K1AB 1IN8A 3UWOA 1G2QA 1Q3TA 3PLNA 2WTUA 4Y67A 2PPVA 3W2IA 1R3NA 4WHMA 4B44A 4FDVA 4OJKA 3EUAA 3QQPA 1CERA 4IIEA 2H4ZA 4QSMA 2QX7A 3GY9A 2HJSA 2O2EA 1IUPA 1YR2A 3R2JA 1Q77A 3ZV3A 4WNCA 3O92A 1E5LA 1DG9A 1VZ3A 3I62A 2VUTA 4C2XA 2PGOA 2Z04A 3P2OA 4AJ2A 4JMLA 3GL9A 1OFIA 4AJ9A 3D7DA 3HKEB 1SCUB 2Q6KA 2IEAA 3UTCA 3VGPA 3TC8A 3WGOA 3I3OA 4P93A 4G1PA 3C70A 1VKZA 2AEMA 2QVGA 4ZHSA 3O8NA 2XCOA 1YS9A 4Q15A 5HOEA 1P0FA 4QBHA 1XRMA 3NOVA 5BV8A 4DSUA 3L7MA 5FI5A 3IEMA 1D0IA 4JI6B 3AF0A 2AFIA 1VZ2A 3V4VB 3KHKA 4FYMA 1V11B 1PNRA 4JLOA 4F6RA 5AM3A 4CU2A 5TVKA 4TROA 5EIOA 2SCUB 2YQ4A 2ETXA 5IWAB 3KYIB 4X7BA 4FXOA 4B3CA 2EWWA 2FUG1 2O57A 3ZLVA 3WFIA 4MVJP 1D3AA 3EH1A 2EIHA 2HQRA 5FFMA 4CN9A 3PG5A 5JIBA 1R57A 2HQOA 3VSDA 1TMKA 1ZQ1A 5B4VA 4WUVA 3BXHA 2IHYA 4PCUA 2VDPB 3X2EA 3GELA 5FV4A 3PQCA 2X9VA 2IYFA 3MTBA 1E4EB 1V0CA 4F9UA 4I8DA 1JHQA 2C07A 3EVDA 4JC5A 3NDRA 4JWPA 1CUHA 3W5AA 2PZKA 3NR2A 2CD9A 4E1VA 5E9AA 3G8YA 2XCSB 1W85B 1P0IA 2Y05A 3LC0A 1H4VB 2O7RA 2BKVA 2CLIB 5B30A 1PFKA 4AF6A 1PNTA 2P62A 5AUOB 4P7FA 1USUA 4DCJA 2DE0X 5BQOA 3GK3A 1T91A 4B7UA 3EEYA 2JGMA 1G66A 2FGKA 2CBXA 3N8GA 5EY5B 1AKNA 2O5VA 4BNWA 1QG2A 4IINA 4NYMR 3PXDA 3WL4A 4RPIA 2XMSA 5H86A 3IJRA 4C20A 3EIFA 1P1JA 1VL1A 2DPMA 5ADUS 1YR3A 3AY3A 4M38A 4KXUA 4TT3D 1B0UA 1NQWA 1E7WA 1H05A 4BX9A 4AK9A 4BINA 1R2QA 1N25A 3S29A 1QK4A 3I5XA 5KJCA 3CISA 1SGWA 1N5RA 3IBGA 2FX2A 2CMFA 5HFNA 3GFRA 5BV2P 5EZ6B 2Q6IA 3SM9A 3DXYA 2UU9B 4C0AC 4BMSA 2QQFA 5A5GA 4PQGA 1PJ4A 4NJMB 4KZTA 3H8EA 3V8EA 2HSZA 3LE8A 5C51B 4GT1A 2VP4A 1T6YA 3E7XA 1KARA 3C8DA 3VYVA 4XM2A 3PUVA 4UAJA 4MW0A 4QTZA 3NEYA 2H1OA 1A8SA 2G5TA 3TUZC 2F4NA 1H5NA 3ICEA 3BHNA 1E9RA 3UMVA 4UA3A 1JVBA 1KO7A 1NLZA 5L3RA 1BN7A 3V9AA 2P79A 5AHOA 4JBLA 3UWMA 5GVRA 3PGA1 4B7AA 4I8XA 4BP8A 3RYCB 2C4UA 2JJ1A 1SOWA 3WGUA 3DHVA 4QOJA 5A0VA 1X8LA 3GEDA 3HB4X 4MMYB 2PGAA 1DL5A 4UEJA 4YRIA 1CZUA 2Y27A 4CPDA 1PQYA 2ZJOA 4YDHB 3A9TA 3H5RA 2Y4OA 3OZIA 1ZR2A 4C22A 4M8LA 3I2KA 4EVYA 3D7KA 1J8DA 2A58A 1RBQA 4L8YA 1UKEA 2BM1A 4KQKA 2A0XA 3P9KA 1DAIA 2WICA 1JKJA 4ER5A 3QX7A 3NE8A 2D8MA 4JH0A 5A9RA 3KT6A 4E13A 3IURA 2C99A 1OH7A 4DTCA 1NXQA 1JZSA 4D6YA 1RO5A 4OJTA 1WVIA 2X6TA 5EJGA 3M49A 2Q99A 2PXAA 1V2GA 2FHSA 1EVIA 1S0UA 3Q40A 3GBSA 3ELBA 3I64A 3H11B 4KU4A 1UDBA 3DVSX 3HLTA 3FUWA 1P2DA 4NVRA 2X3FA 2PNFA 1KO8A 4L28A 3V1KA 3L0BA 4YCAA 1B93A 2GN8A 1GTL1 3LHIA 3ZQ6A 2WG0A 3TQHA 3QV2A 3C7KA 3JTEA 5GTDA 5EE0A 4ZYZA 1MVLA 2GCOB 2GEDA 4PZDA 2QRQA 3A1FA 2AEJA 4JA2A 1K75A 3FZNA 2XGMA 1R6UA 2VDKB 4NFLA 5AR1A 1WNTA 2QPLA 2AJ6A 3IXLA 2AMJA 3LKZA 5LM3A 2FSVA 5JS8A 2P69A 3U40A 4FGZA 1Y1SA 3Q8LA 4UOEA 2G6BA 2CVHA 4BOYA 4IXMA 4M6GA 1DT5A 3U4IA 4ETIA 3GOQA 4CN8A 3FEEA 3MWEB 3NAMA 4QYWA 3PSAA 2NVUA 5I7WA 4G89A 1YTUA 2FE1A 3T5PA 3C1TA 3LCRA 5FAKA 3W8FA 4C7OB 4CDMA 1AVTA 1VBKA 4TRRA 2VT6A 4ECAA 5CXUA 2O8DB 2A8YA 2IYYA 3ISXA 3DC7A 1W48A 4OVKA 4RORA 4RD4A 4J7XA 3TQRA 1SCKA 1H0SA 2Y0PA 2Y77A 2DM6A 2GF9A 3TD9A 1O1YA 3HJUA 2N47A 1PG5A 2GZ1A 1GTZA 1P2BA 4CAFA 1HORA 3UUWA 1M2VA 2PA0A 3K9NA 4QYIB 2I79A 3RG8A 3VU0A 1UMBA 2XEFA 3TH5A 4KOYA 1AF4A 2VF8A 2DR2A 3M4JA 1E0KA 3CUWA 4JI3B 3MWFA 2Y1DA 1VHLA 4YWYA 2PZJA 4L3WA 4GR9A 2V59A 1Q19A 4D9FA 2JFQA 2CJPA 2VHXA 1YZKA 1MN6A 2WD9A 1MJGM 4UNSA 4GWLA 1OI2A 1HK7A 1V3QE 2BMJA 2OP0A 3NYRA 1XTSA 4LVNA 1EFRD 4DUZB 2Q3BA 3QPCA 4MH0R 4GNRA 4S24A 1QAMA 3ZI4A 5DBGA 2XUGA 2O19A 3AFMA 3GW8A 1HFKA 2OXRA 3TQTA 1PJ2A 5TIIA 1X1CA 1MT0A 3EXAA 5CLJA 1AQIA 2FZ5A 3D3JA 5EWJA 4BTVA 4QRHA 3R7SA 3UATA 3EWSA 3P2KA 4MTLA 4OGWA 4Y2TA 2QN9A 1X6VA 3G82C 1D0SA 3GLJA 1F60A 1V3TA 4FBMA 4IJ6A 4BS9A 3RM3A 3ACBA 4JLKA 3GYGA 5KCMA 3CXPA 4LX0A 3UB4A 3CZPA 5A3RA 5K3BA 2V96A 1Q6ZA 2FP4B 2MJLA 3A1VA 4ZV4A 7REQB 1VHEA 1G9SA 3QVXA 2HU7A 4CR8A 4C04A 3M6VA 3T9EA 4JB2A 5FX2A 2ZYIA 5EMNA 5I8ZA 3KPYA 3SXPA 2PX2A 3B2QA 3C4QA 1Y5NA 3GA0A 3MZ0A 3HCDA 4KNVA 1U81A 4H3KB 2JLRA 4N6GA 1HQDA 5FWYB 4OIMA 1BO6A 2DBVO 2F62A 3WLPA 4X97A 5CPFA 1X1BA 1XE3A 3ENNA 2C9CA 1G1AA 2QVCA 4NECA 2XB6A 5B7PA 4R7TA 2FUG6 1WQ1R 2WAAA 4K87A 3QEKA 4RGVA 1GFIA 3DCJA 4TSKA 3KQQA 3BIJA 4ND6A 2J3KA 4QDOA 4MY3A 4OJNA 1JZQA 4H6UA 3F8KA 1SZDA 5JMWA 3MIZA 4Y6LA 4NKRA 2CNTA 1Y7IA 4IUSA 4RMIA 2HQ1A 1E9BA 5ALTA 3DP9A 3OJEA 1SXJA 1W19A 1VHTA 3CLKA 3A6KA 3WNQA 3TKLA 2KE5A 3PNLA 3ENKA 4TUYA 3PQ8A 5ALFA 1LSUA 1G21B 1CP3A 3LO8A 2AHOA 4LMBA 3GDWA 4V39A 1P18A 3ILXA 3DBLA 2V3VA 1A9TA 4QUSA 3QX3A 4GOOD 1WXIA 4WY2A 5I01A 3JZIA 2VP9A 2YHBA 3TVYA 5AVKA 1J56A 3DEJA 2FX3A 2CLOB 2V0GA 4NOMA 1ZQ9A 5K3AA 3I76A 4DLLA 3V4OA 1ST2A 5B1HA 1DKLA 4CMCA 3RJ5A 3TZQA 2YN4A 3EMDA 2G72A 3RAJA 2BGJA 3Q6MA 1KNQA 2NSLA 3FMGA 4ZU1X 2VJBA 1H22A 2QTTA 3AM3A 4LNUB 5E3JA 4CKWA 4N6NA 3QNUA 4ZC1A 4BNXA 3PZBA 1U9YA 2I3ZA 1VPLA 2PJUA 3QVLA 1Y48E 3FWHA 1N92A 1VJGA 2P6MA 4XIGS 3T3DA 5KVVA 3GI1A 5B55A 1FNSA 2VT2A 5CIQA 1JA9A 1XU9A 2JLAA 1RZRD 4YCBA 2QRPA 4L9AA 4E08A 2GQ0A 3RS9A 4C2BA 1X7YB 3GUHA 4Q21A 2QX9A 4KWEA 1VSUA 1WW3A 2ES4A 1K0FA 3AETB 2YCLA 3ZC3A 3F3KA 3T3EA 5EPOA 1CWUA 2XKJE 1M34A 3KSRA 1XZBA 5BV1A 3S2YA 3B3FA 2VHVA 1JDZA 1C0LA 4FS8A 1ZK2A 5DK6A 3PD0A 5FLEX 3W3AH 2WPDD 4U2CA 4F3TA 2Z95A 3EEOA 3LNCA 4PBTA 3OIVA 4J75A 4P82A 1KJIA 3AHJA 4HNRA 3DMRA 1I7QB 1CG2A 3EIXA 3FRHA 3N2EA 4GMGA 3HCFA 1SD1A 3QX9A 4IGAA 4Q18A 1MJAA 5I4BA 4FR0A 1W4BA 3H04A 3ZK8A 4Z0PA 4YN3A 1ZN8A 5KIAA 2EF1A 3B8EA 4PX3A 3OBIA 4X66B 4AG3A 3RU2A 4G0QA 3GZTB 5LA6F 1PHRA 2ZIZA 3HJTA 3FIJA 5EVCA 4GH5A 4JX9A 1YQEA 3MCUA 3F7OA 1YT5A 5DI3B 2ORWA 1BDHA 1Z7YA 5JMTA 2JEVA 3K2IA 1DQSA 1KHTA 4UBOA 3DPIA 3FOCA 4DFDA 3GCZA 4LMAA 4WSOA 3JQQA 1A96A 3HNPA 1QWOA 4KFTA 4IGFA 3VSCA 3GPBA 5CT9A 2IPMA 5LWQA 4UFVA 1RDFA 1SQ6A 4BB6A 4ZT3A 2UKDA 3EFOA 1L3CA 4EPXA 1RTKA 1UWCA 1R0CA 4OJQA 3PC7A 3CTPA 3P97A 4P1ZA 4W1RA 4DPKA 2P75A 1E7MA 4JZYA 2WD8A 2FK8A 4FNOA 2O9JA 4EKEA 2ONYA 2R8PA 1CYDA 3OLYA 2VP5A 3EZNA 4TVBA 4C2YA 1G3QA 2FIAA 1YKFA 3KOYA 5G1ZA 4LC9A 4P5DA 2ZEPA 1LWNA 4RV5A 3PFGA 4LTNA 3HGTA 2X7JA 1QIJA 2WHPA 1KVRA 2G0AA 4KPUB 1YMUA 3ZW7A 1ZR4A 3Q3GE 4WLFA 3TCXB 1JDVA 1DEHA 1G63A 5EOVA 2F59A 3LPMA 1JNXX 2VUUA 4BL5A 3A05A 1Y80A 4Q1CA 2BFOA 3GGGA 4BO3A 4K8OA 4TKZA 1P33A 3HKCA 3FPGA 4JLNA 4IZ6A 3UHAA 2GI4A 5JH7A 1U0TA 2F3QA 1L6RA 2ZT7A 3R77A 1AQNA 3C6QA 2XEIA 3RROA 1SZCA 2WAYA 3L1KA 2KWIA 1WV0A 3B2EA 4WN9A 3BRSA 1K89A 2RG7A 4E5DA 621PA 3E5MA 3K2KA 1WU8A 4BVHA 1QHEA 2I1QA 2ZR8A 2FFJA 2XWQA 5JMOA 5T8KC 4V38A 2ZIEA 3O4VA 4Q1AA 2X42A 5IB0A 2V6MA 2RC5A 3E18A 1DOHA 1EINA 5HVFA 4EJSC 2JD1A 4AUMA 3WLFA 1YAJA 1EK5A 4YAJA 1TEVA 3ZU3A 1HSOA 3HB9A 5IYZA 3DFFA 2A30A 2C04A 1WUHS 2ONJA 1Q7GA 1WDMA 1Z39A 3UV3A 1Z2AA 4KE6A 2RH5A 4GZ3A 3B51X 4HS9A 3F2IA 4OLBA 4IEIA 2YHAA 1GXSB 3ISTA 4S3MA 1YMQA 5AW0A 4AG7A 3WG9A 4S2EA 3ZU4A 1W2GA 3VOSA 2PMWB 4H7FA 3SXUA 3E5RA 1SBCA 4TYMA 4FHFA 5HGJA 1DNPA 3IJ3A 3ZGXA 3S6JA 2ZUWA 2JZOA 5D3KA 2CCJA 2QM7A 4LXIA 1JAHA 3VR6H 1JR2A 4JZ0A 2QIOA 4C43A 3FB4A 4RA6B 3FLAA 2PUTA 1NT2A 3PB3A 3HS3A 1F2UB 4CLHA 1Z82A 1CM0A 2Y4NA 1FYVA 4X1YB 3NT5A 3IALA 3HJGA 2WTEA 1PAUA 2FEAA 2XNKA 4W8HA 4MWSA 3SS8A 3I4FA 4LZNA 5GMOA 1EUCB 2Q1TA 2AZDA 4XNHB 2PWYA 4QBFA 2Y1LA 1PZGA 1MAVA 4LYAA 4KE8A 5I51A 4FZRA 4L8LA 5F77A 2X8WA 4A3SA 4C0BA 3HFSA 3D3QA 3CWQA 2PBZA 1SC1A 2GAAA 4INAA 1QFJA 4YY3B 1FA9A 3LHDA 4IOMA 3B1VA 2JCBA 1U3VA 3TGWA 1VHDA 1RYBA 5U4QA 2GHRA 2TYSB 4HPXB 4DMFA 1R0XA 5DLPA 1SOMA 1WLSA 3HXKA 5AK3A 2BRUC 4BZWA 4M49A 3PT9A 3QLUA 1Y1TA 4XTCS 4CQLB 5A27A 4J1NA 1B3RA 4O2BA 1WKVA 1OI3A 3UJBA 4JWTA 3R20A 4LDNA 4BNGA 4A32A 1V8DA 3F90A 1HV8A 1BKSB 4DBLE 3OQIB 3FUUA 5ALSA 1CFZA 5ESWA 2N75A 3OQHA 4UNIA 4L3OA 3DD1A 1YR9A 3VDQA 1RM3A 1S3GA 4V0MA 4DIFA 5TF4A 3FNQA 3UT6A 4HNWB 3QNMA 4L3VA 2C3MA 4RJTA 1JEQA 2JGLA 2IP1A 4PK2A 3QZUA 1NBMD 2QMZA 3N6XA 3HVRA 2HA7A 4C1BA 3HUTA 1ZUIA 3QP9A 2DQ4A 3DO6A 3RO7A 1ZINA 3BN3A 4IJMA 1ZN9A 3PWKA 2RK4A 4UQLA 3OQMA 3K9TA 2Q3JA 4Q00A 3RWBA 5JS7A 4WIAA 4HB2A 2ZEOA 5ED4A 3U9TA 5DZSA 3REQB 4EF4A 1XLUA 3IE2A 2NZUG 4FUQA 2JVKA 1DIGA 4LDPA 3NA6A 4Q02A 3EZ2A 3MD9A 3DV0A 4XSVA 5AI4A 2V4UA 1XRRA 3F2VA 5CM8B 4G8CA 2C2BA 2R5FA 3F7MA 3QPVA 2XMRA 1JAXA 2GH1A 2R751 1YU6A 3OEHA 5JW6A 1NUPA 3GPIA 3P0JA 4TTPA 4ND8B 2RAFA 4MEJA 2W0SA 1K8ZB 2DQKA 3ISZA 1DOAA 2ET6A 5BWOA 1PJRA 4M22A 3UT5B 4B73A 4LOLA 4TS3A 3LLCA 2UYGA 5F7XA 3BT7A 2VFAA 2OFXA 3IEIA 3BUSA 4WLNA 5J1SB 1JIQA 1EFTA 2WJ3A 2Z3LA 4W1PA 4MRIA 2AC2A 1CD5A 1RVDA 4ABYA 1YMEA 2JNWA 3QE4A 4KXQA 3NP7A 5ENVA 1RC0A 1DAFA 1EX7A 1SCNE 3RUAA 3M6FA 2PYIA 3BXPA 5MFPA 5H0IA 4P5PA 2XUPA 1Q16A 3ZKWA 2JFBA 2FQYA 1CY7A 4B2YA 2OBYA 1P1FA 2ORIA 3D43A 1IRXA 4XX0A 4ND5A 1CY2A 2C3YA 4UZSA 4EK9A 1QBGA 4N82A 5IUNC 2QORA 3L1JA 3SWWA 5JROA 4ZT6A 4B12A 4BUCA 2OCXA 3MTDA 4D56A 3G9XA 4V2UA 2RGEA 3PC2A 4W1QA 4DIEA 2Q0QA 1WXFA 1PKXA 2W4MA 2ZCJA 1QTNA 2PX6A 5FWXB 4S1OA 5IC4A 1AA9A 2INGX 3WIDA 4WVLA 3R5SA 5CA0F 4LRWA 3DDHA 4L5BA 2CXUA 3LWBA 5AVQA 1V5IA 2RK3A 3H1GA 1CFJA 2GJ4A 2B20A 3C6YA 1JMKC 5BYKA 3NBZC 4RZ2A 5H82A 3CEPB 3EGXA 4YJHB 4YRLA 1EFVB 3UAZA 4EI7A 1QZUA 2CE2X 2JGDA 2WP0A 2XDAA 1WE2A 1AKTA 1AYEA 4V0OA 2XKAA 5DX8A 4TQAA 5C8YF 1GQOA 2Q07A 2ZDHA 1DWUA 2EZ4A 5BMVF 1GSIA 3MB5A 1NP6A 3WK9A 3VR4H 3INRA 3C39A 4ZQHA 2VKTA 3L4BA 1GGEA 1H4SA 3R8CA 1BU5A 4GZMA 1V26A 3SI7A 1E2MA 2R6CA 5B58T 1Z0JA 4MV5A 2QRHA 4QHYA 1S7FA 2MOKA 2G67A 3QUAA 2JH8A 2B3TA 2IP2A 3NAZA 5DYNA 3K4PA 2D74A 5GJCA 3A6FA 3C8MA 3NIFB 2NX2A 4RM3A 3UKJA 1L5OA 2ODBA 2OAQ1 1GDTA 3GLKA 4Q05A 2ECPA 3DMTA 2V5UA 3TB6A 2W2TA 4ED9A 4MDYA 1CVRA 1FY2A 3RHSA 2AWOA 2R6ZA 4AB7A 1X19A 2PUCA 4GSYA 4CQMD 4CLDA 3MMPA 4WOCA 1WW2A 3JATB 5EKSA 4G0YA 5ALXA 4RA9A 3FTPA 2RCYA 2FHPA 5DM2A 4U2BA 5AHKA 5BYBA 1SVUA 3M6IA 3LD9A 4W4TA 4MFJA 2WIJA 4FFBB 1U8AA 1SVNA 4GPZA 3IU2A 3T5GA 4CM1A 4HWPA 4IK2A 3A9WA 4OBBA 3UV7A 1AXGA 4DSAA 1L1FA 3TW8A 4CJXA 3D59A 5CRIA 4JNKA 1SFRA 1MJHA 2H5MA 4XB6B 2VDOB 1POWA 2GRUA 2J67A 2V7PA 3WWDA 3O3NB 4M6HA 2ZJ7A 1OXVA 1VJCA 4KQGA 4U1RA 2ANPA 1WB6A 3AZQA 1PCXA 4AJJA 4X5KA 1PJTA 1JU9A 2DPLA 5I6DA 5DYIA 3AEKB 1XTUA 4WI1A 4FNGA 3TIXB 3N0TA 1RYDA 5JDCC 1QHSA 3EXIA 4AN1A 5EGSA 1LUAA 5GV8A 4N3GA 1SHLA 1U0BB 2WSAA 3ORSA 3R3ZA 1K88A 1CJSA 3O7WA 3JQ9A 5A28A 5I8PA 3OKPA 3I2JA 1G5HA 3DMNA 2ZXEA 4M3NA 5CNPA 1H6CA 5JLAA 3T94A 2G9QA 1X1QA 1PLLA 1NLUA 4ATNA 2GOYA 3TSYA 4DCSA 3AUYA 2CV1A 4GQIA 1Y6JA 3H13A 3D54D 1JQDA 2AYXA 4Y18A 3WX0A 3ZTYA 1L5ZA 4K05A 1V95A 5KSWB 4BCCA 1ODKA 5HIJA 2NOAA 1R6DA 4ID3A 1FX0B 3TCKA 2Z1MA 3BRWD 4WZZA 1RWVA 1Z2LA 5A6SB 1Q7CA 2JBHA 3O31A 2PJ7A 3V8NA 2OESA 5AKIA 4UBNA 2Y92A 1R8XA 4IJUA 1OHHD 4A39A 3IIMA 3G9TA 4WL0A 4CEIB 1ZJZA 4WBXC 3ROPA 3JASA 2EK8A 1RYYA 2H2DA 4UTPA 4IXWA 4YRKA 3CSUA 2VJYA 4DBLC 2UUPA 4DDTA 1SRQA 1FXSA 2KYRA 5LZ2A 3FTFA 5BUZA 4QAJA 4HD8A 3MS2A 3L7BA 2BM8A 4F2GA 4D6PA 3C7TA 2OCPA 3K8YA 4DHEA 4N76A 3RV3A 2V8GA 4F9GA 1JDTA 2BBWA 5EKTA 1NW6A 2Z9DA 3JZDA 1GRRA 3BD7A 1GZ5A 1MVOA 1GQFA 1KYTA 2QF7A 3ND8A 4BHTA 4XVQA 3KPUA 1MBZA 1N5DA 4BBZA 1MTZA 1YL6A 2AE1A 4HDMA 3NM5A 1NRXA 3IC5A 5LZ5A 2W0MA