2HC9A

Structure of caenorhabditis elegans leucine aminopeptidase-zinc complex (lap1)
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine aminopeptidase 1
publication title Crystal Structure and Function of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 168
structure length 489
sequence length 489
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hc9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hc9A02
1Q7LA 1GYTA 1Z2LA 4FUUA 5K8NA 3NH5A 1CX8A 2PJ5A 1XRYA 2RFHA 3GB0A 4P45A 2QYVA 4ZI6A 3V38A 2AFMA 1XBUA 2WYRA 3CPAA 5K8PA 3N5FA 4KSIA 1YMEA 4UIAA 4P4EA 5D29A 1Y0RA 1FNOA 3SI1A 4OC1A 2AFUA 2QJ8A 4F9VA 4P4DA 3TX8A 4DUKA 1OBRA 2Q43A 1ELLP 4IAVA 4UF4A 3VATA 2JBJA 4DJLA 4Q7AA 3KASA 3WT4A 3RBUA 1LCPA 4P4FA 1R43A 3CDXA 1TF8A 3SJXA 5IB9A 5LYIA 1UWYA 2AFOA 2PJ2A 4P6YA 2PJ4A 3KHZA 3H8EA 3FEEA 4NGNA 4FAIA 2PJ6A 4Z65A 1CPSA 1CBXA 4R7MA 2GLJA 2GU2A 4RUHA 2JBKA 4NGSA 4P44A 1H8LA 3T8WA 1ZG9A 4MMOA 1ZG8A 3B2YA 3B3VA 3NH8A 2QVPA 4MRIA 2PJ0A 2V77A 2PJ3A 3D67A 2Q51A 4NGRA 2GREA 1YLOA 4EFDA 5HXDA 4EMEA 4X2TA 4ZY1A 3NFZA 1LAPA 4NFRA 2XEGA 1QMUA 3IFEA 1TF9A 3B3WA 1VGYA 3FVLA 3SI2A 3TC8A 2EK8A 2PIYA 3FF3A 3SJEA 3IO1A 2ZEFA 5HVGA 3QNVA 4OC3A 4GM5A 2CF4A 5HVFA 2PJ9A 2PIZA 1CP7A 1F2OA 3DGVA 3FECA 1PCAA 2OR4A 4K3NA 4MHPA 4ZX9A 5K8OA 1TKFA 1YSJA 3BHXA 1VIXA 7CPAA 3KHXA 5LYFA 4PXBA 1VHOA 4ZY2A 4AXVA 3ISXA 3SJFA 1Z8LA 4PXDA 5K8MA 3BI1A 2XEIA 4MHZA 1F57A 2F8HA 4R8FA 1F2PA 3NA6A 2AFXA 5I4MA 2ZELA 2BO9A 1LANA 1BPNA 4NGQA 2ZEOA 2C6PA 3PBEA 3D7DA 3PFEA 5LRKA 4G1PA 4MXUA 3RAMA 4MHNA 4P4BA 4NGPA 3KZWA 1ZG7A 1IY7A 2PJCA 1EE3P 3LMSA 2C6CA 3IIBA 5THWA 2XEFA 3GUXA 4A39A 1ZLHA 2O53A 1RTQA 4TWEA 4PQAA 1AYEA 2JEWA 1IGBA 3KGQA 3WC7A 5LYLA 2CIJA 2HB6A 2AFZA 1AMPA 3D4UA 3IEHA 3D7GA 4FWUA 2O4HA 2NSMA 4CPAA 4MCRA 4ZY0A 4BD9A 3GLJA 2DEAA 1BAVA 2PE3A 4UIBA 2FVGA 2ZOFA 1ARMA 1CG2A 1XFOA 4OP4A 1BLLE 2XEJA 4JYWA 2RB7A 3JRUA 5LRJA 3SI0A 1ARLA 3WC5A 3IJ3A 4MHYA 1XMBA 4F9UA 3H8FA 2J9AA 4X3RA 2ZEGA 3FX6A 2VL1A 3FEDA 3PB8X 1LOKA 2C1CA 3CPXA 4MCSA 4PPZA 4NGMA 5JH9A 2V8GA 3B35A 4R6TA 3S9NA 3IWWA 2I3CA 3KR4A 3SJGA 3NH4A 3S9LA 3PFOA 4A37A 5F09A 2ZEPA 3PEIA 3PB4X 1LAMA 3B3TA 5HVHA 1Y7EA 1CP6A 4MCPA 1HDQA 1Z5RA 2CTBA 5J1QA 1YW4A 2IMOA 4OKOA 3PB7X 5ELYA 4F8ZA 4B6ZA 1PYTB 2NYQA 3RZAA 3MN8A 1HDUA 2EWBA 4ONWA 4OC4A 3KR5A 4YWYA 4ZYQA 1M4LA 4OIWA 3MRUA 4ZX8A 4MCQA 2EK9A 3FMCA 1TXRA 1TKHA 2V8VA 1HEEA 1DTDA 3B3SA 3D7FA 4OIDA 4UEEA 3KL9A 2PJAA 2WZNA 4EWTA 3DLJA 4PXEA 1YW6A 4A94A 1JQGA 4DYOA 2ABZA 4NJRA 3IC1A 5LRGA 4WWVA 1XJOA 3VARA 2GLFA 4W9YA 2Q4ZA 3K9TA 1KWMA 3VH9A 1R3NA 3CT9A 1CPXA 3BXMA 1ELMP 1VHEA 2BCOA 1TKJA 4UEFA 4O23A 2V8DA 2HC9A 3PB6X 2AFWA 2IQ6A 2PJBA 3PB9X 1DE4C 2OOTA 1BPMA 4P10A 3D7HA 2AFSA 2ZEDA 3B3CA 3V7ZA 2PJ1A 4JZ0A 2POKA 4FBEA 2ZENA 4TNUA 3BI0A 3KQXA 4LQGA 3D68A 4UEZA 5CPAA 3H8GA 1FT7A 3FJUA 2PJ7A 4X8IA 4IHMA 1QQ9A 2IJZA 3B7IA 3HLPA 2ZEMA 3FH4A 8CPAA 3PBBA 2PJ8A 3PRTA 2BOAA 2ZEHA 3WABA 3I1UA 2PVWA 5LYDA 4OC0A 2ANPA 2G9DA 4P4IA 4OMEA 2ZEEA 5JM6A 3KQZA 2PCUA 1LFWA 3ISZA 4YU9A 4WJBA 3L2NA 6CPAA 3D66A 3HUVA 4NJQA 4OC2A 3WC6A 5JGFA 4H2KA 3S9MA 5CBMA 4A38A 4IK2A 3LWUA 1ZLIA 5D8NA 3KI9A 2CTCA 1NSAA 2ZOGA 4R76A 4NGTA 2PRQA 2C6GA 3K2KA 1Y0YA 2V8HA 2PVVA 4OC5A 4P4JA 5DS0A 2F7VA 4PXCA
chains in the Genus database with same CATH superfamily
1SD2A 1DT3A 3OPQA 4CGLA 4Z86A 2ZUDA 5EI5A 4X90A 4IEEA 5CLHA 4BQSA 3VUEA 3IDOA 2NSHA 5HF6A 1POXA 2ZUBA 2NXNA 2RIPA 4WIAA 1DQPA 1IULA 4H6WA 5FTWA 2VK8A 4ITRC 2EP5A 1MG0A 1DRWA 1OLUA 5K3SA 2H2IA 1YIAA 4FFSA 4LMBA 1C9KA 2J3DA 3CF6R 2IX9A 2C5GA 2IE8A 4YC7A 4JLMA 3SXJA 4DMKA 1EHYA 1YS4A 2BRUA 1I14A 2PZLA 1G20E 4BQFA 2FN3A 4FE3A 4E94A 1T3LA 2Y6UA 5AM5A 2C4KA 4HWTA 1Z7GA 3VYWA 3D2MA 4NZMA 3T7RA 2DH5A 3B2YA 5J59A 2YUTA 3IAXA 4L4XA 3BUSA 3V4RA 3IKTA 5DXFA 3BDIA 2ZBVA 4RELA 5EE9A 1ONNA 1XHLA 3LT5A 1ML3A 1OGYA 2YY6A 3FVRA 2OGTA 2PZGA 1TKAA 5LQCA 1YE3A 4RXUA 4A8HA 1P72A 2DWPA 2IWHA 3K9NA 3CZ5A 5J5VA 4S0XA 1JFFB 5ECWA 1K4JA 1S2NA 2GPTA 3QW2A 3CWQA 3PNSA 1YBFA 3MC1A 4Q03A 3ISXA 4DLWA 4DRXA 2J6CA 2R66A 2P90A 4D4GA 4MWEA 1YGPA 1U5CA 4YCAA 5HE8A 3IJPA 2VDKB 4LF5B 4CZ2A 5GJCA 3R7SA 4PQYA 4GHWA 1XF1A 1T5IA 4UUPA 1QNFA 1DJPA 1C1HA 3ZDRA 3H2GA 2EU8A 2RH4A 2E49A 4N0QA 1J99A 4MRVA 1NNLA 1CF9A 1YDFA 3B6ZA 4JXRA 4GPD1 1E2QA 5BY2A 1W9HA 1E58A 5FR2A 1GTRA 3CZCA 3RVMA 2C4NA 1K89A 2CFSA 2COKA 3DE0X 5FWDA 3M34A 3JQAA 4FYYA 4X20B 3EGEA 3UUEA 2QP4A 4E14A 1S3FA 2R7NA 3UJCA 2VQ3A 4TS1A 4JUDX 3DZHA 3LDHA 5T4EA 1SOMA 4JJFA 4EGQA 4LUAA 1N8KA 3B35A 5CA0B 2K7FA 1K5GA 4YDRA 2HDWA 2IIBA 3GZTB 2UZ0A 2CTBA 4GL2A 1V11B 3HM2A 2BFBA 2XUDA 3EVCA 4CIWA 4WZBA 5FTJA 1A7AA 2GYVA 3E7WA 5KZMB 2WA1A 1KUXA 3ZWPA 1SEVA 3SEZA 4KFCA 4BNUA 5J2TA 2QZSA 3WOVA 1W34A 1GP2A 1NJSA 1H9CA 2JLWA 1LQTA 2XE4A 3ELBA 4K1XA 5DEIA 4ATNA 3JQFC 3S55A 1H6CA 1GWNA 1L4MA 1R3NA 4G0NA 3GNQA 4XFKA 3THXA 4WBNF 1VXRA 3WZ2A 3EC4A 1K8XB 1YMUA 3SR3A 2IF2A 1WPQA 4I4TA 3BRSA 3OZAA 1ZMXA 2D7JA 1E1CA 2H7XA 3PQ5A 4XPLA 1XYVA 2JVIA 3QKRB 3OZEA 1OBHA 3EOBI 2VSOA 1WG8A 3GWGA 2J6HA 3Q3IA 4RH1A 3WADA 5IEJA 4ZI2A 5FWAA 2FIAA 4G5RA 5DI3B 2NW6A 4QYIA 1YA6A 1Z2CA 4NV1A 3WV4A 2WDZA 4IJMA 4RGQA 4WZBE 3QA9A 3S2GA 1KQOA 3N2KB 3S6JA 1KH2A 2IDZA 4ND6A 3RC8A 4FQ8A 1PL6A 3L4JA 4NHEA 5DCYA 1TQ8A 1TD1A 2IUFA 5I7VA 2QRKA 2VUTA 4EJSC 5FPHA 4KSBA 1Y98A 4PFSA 2BM9A 2C8LA 2VSQA 2INGX 3G8BA 2GXAA 4L57A 1FVOA 4ZI6A 1FY7A 4CI9A 5JSFA 2QTLA 5EMKA 1QG6A 4QM6A 1IYLA 4KJZA 3D3EA 1PFVA 5K8PA 3ML1A 3RS2A 2PN1A 1NBEA 2EBHX 3WICA 1FNOA 2ZE7A 2IF0A 1O4VA 2OM6A 3RUHA 5HKBA 4IL5A 2WKQA 3ZHTA 1EBFA 3ZK9A 3DDHA 4PYOA 1CK4A 1C0LA 2O48X 3HA7A 4JKIA 3K6RA 1L0CA 1L5KA 1T8PA 1ATZA 1Z6YA 3SZGA 5ILQA 3U26A 1MJ5A 1KQNA 2HO4A 2ES4A 3KYCB 4LZNA 1I3OA 4I1SA 3DE5X 2WE8A 4BN0A 3ADDA 1U3FA 2VKTA 2VOJA 1B8NA 4YRBA 1II8B 4NTZA 5TY0A 1N6HA 5DYTA 1EVKA 4QOGA 4PRYA 4X7RA 1NLYA 4UTVA 5B1HA 4A0SA 4BGVA 4MB0A 1VE9A 2FI1A 1CUCA 2X1VA 1R6BX 3H6KA 3O8QB 4Q3EA 1S8OA 1OX4B 3OICA 4RHCA 2PUCA 4XQ9A 1JIIA 3OT1B 4WFKA 1VKJA 1TTTA 3KJHA 3PFGA 1GA6A 2CF4A 1CE8A 4P0TA 1IEQA 3GUUA 4L3VA 5DM4A 3FECA 5L7WA 3EPPA 1XVUA 3OLWA 3EBOA 1WQ4A 1QSNA 3VNRA 5EEGA 5AKGA 4R8KA 4K6OA 4JLUA 4LOHA 3B2NA 3WYCA 2VHTA 5DSXA 2MYPA 4TTIA 1DNPA 2I2AA 2WIKA 5C7LO 2C83A 4FWIB 4LJ4A 1PDVA 2FPPB 3LS2A 3DAFA 4HD8A 4U4AA 5HP4A 2YKGA 5A71A 1PK7A 1E2LA 3LLCA 2PBLA 1UBUS 1SVIA 4REQA 4NEXA 4MRNA 1F4PA 3X1ZA 3EOZA 3C5VA 1U9ZA 1JG1A 3I8XA 2P41A 4B3FX 5HEKA 4UE2A 4G0ZA 4ND5A 2WU4A 4F6RA 3U17A 2V58A 4EF5A 1RIFA 3KP1A 3UOGA 4ZCMA 2IUSA 3S9NA 4FGUA 5LBIA 4GLOA 3HA3A 4BJ1A 1U81A 1DO8A 2GNAA 2ZEPA 1ECLA 2BONA 3ZW9A 4EKGA 1QU3A 1Z08A 3W1EA 3IIEA 5TJHA 4CTNA 5CGZA 4NK5A 2VJBA 3UM9A 2FOIA 3ZY4A 2YW9A 2BKXA 2PSFA 1HE2A 3LLUA 4DTIA 4LY9A 1FEZA 2AZMA 1RWNA 2G1JA 1UPUA 4ZX8A 3GGPA 3TE7A 3E2IA 5HK8A 2REBA 2NVUB 1XTQA 1SG6A 3C45A 1IHXA 4A10A 1FS5A 2JB9A 4AG7A 2YY5A 5EFOA 4F5YA 3CINA 3HMQA 3KL2A 1AURA 1KY2A 1QGDA 2WU3A 5HKLA 4DL9A 3CNNA 4P8RA 3U13A 5A7HA 3ROMA 2QRHA 1PV2A 4OB6A 1XZCA 3V32A 4C22A 3C0KA 5HRCA 4FDVA 2JKYA 2H7CA 3FLBA 4KE9A 2EG5A 2Z6QA 1KMNA 1F9AA 3UW1A 3KSMA 1UZMA 2GHQA 5EWJA 4N6NA 1L5YA 4Q3LA 1W36C 1IMJA 3OFND 2OZLA 2WLTA 2B1RA 3ICWA 5JU6A 3N28A 3M1IA 5CGQB 1KARA 3V46A 3M89A 1QYWA 3FUXA 1CZHA 1RS0A 4E5YA 3HHPA 2PUAA 1XF9A 1A8UA 4J90A 4XD7D 4A8PA 4D3YA 5FWYB 1NIJA 2VNHA 2D00A 1XJ0A 3TDNA 4ZZ1A 4IDDA 2XCOA 2JHPA 4FOLA 1G9TA 4PR0A 1X10A 3W05A 4RPGA 1OBVA 1S9HA 2NO0A 1T1EA 1TL7C 2HCJB 3CXUA 4D6YA 4RZQA 2BFFA 3AK4A 4BAGA 3TB6A 1WZCA 2JF0A 5A7GA 3WHLA 5CAEA 2XTJA 3HYNA 3CUUA 1DC4A 4DJLA 3LCUA 3COPA 1P6UA 1SVNA 4BBPA 4X62B 1KBZA 1BH6A 1YMVA 1RZRD 2CUTA 3UKJA 3T95A 4Q1CA 1U6IA 3LX5A 5JW6A 2FETA 1P81A 1DV1A 3FCOA 1QTNA 4IYRA 1V4VA 3JTEA 3NH8A 1K92A 5LQRA 2IS6A 4MHOA 4MMYB 3HDGA 1IFXA 1S89A 3Q7PA 2J9FA 5AJYA 2FA9A 3F3MA 2J67A 5SZJA 3L7IA 4AG9A 2ZUEA 3BREA 5H02A 3PJRA 2NZJA 5CDSA 4F4HA 4RK5A 4KP7A 1W48A 3ZGOA 1IOFA 1JQAA 3WAKA 2GKGA 4XWOA 3ZDXB 4V0QA 3C8DA 2QMUA 2BZ0A 5TB5A 2CBZA 3LPLA 3UMRA 4HDRB 1WHTB 3F6SA 2BGRA 1WXGA 3KJEA 4DR6B 3QYPA 3WGIA 4XJSA 3TLCA 2BO9A 3IERA 2YY7A 2I4IA 4S2UA 1S9DA 4HUTA 4OO3A 2H5MA 1TPZA 5D3ZA 4IIYA 5THWA 1VJ5A 3UIEA 1QXSA 4XVQA 1DMRA 1SJ9A 4WFIA 1KZFA 2FW1A 2L42A 3VR6H 2D0DA 4L8VA 4ZVNA 1W35A 1N9ZA 4PLTA 5FOUA 1M76A 1MFPA 5JZ9A 1H4TA 3IAHA 1H1LA 3VV2A 1EUCA 3WRYC 2OO5C 3TLMA 4PLHA 3HBFA 3F4BA 2YFHA 1XCBA 4XDHA 5BV2P 3KE9A 3I8OA 1ZAKA 2ZVPX 2JDIA 1UDWA 4BFLA 1YONA 2GXSA 3FSGD 3CZ9A 3ZWQA 3V8NA 1CNMA 2ZSDA 3QXCA 2AX3A 1C7RA 2HF7A 2HA4A 4KC0A 4V0MA 1FX1A 2DQYA 1IAQA 2Q6VA 3RYCB 3FGPA 3R8FA 2XUGA 1RHUA 3ZQUA 3G0GA 1Q7CA 3OLZA 2W8BB 4I6EA 4GPEA 1ZDMA 4U8HA 4HG2A 4XIFA 1P0MA 1KJIA 4B6ZA 3PJDA 2W71A 4FPXA 3A1WA 2C5EA 4N01A 2CC2A 2C7RA 5D3QA 4KPUB 2X4LA 3V55A 5CX1A 3O9VA 2QMZA 2FWJA 3COZA 3OC6A 4DMCA 4LGCA 4P81A 3ZIAD 2I2WA 2MINA 1TX4B 4IHAA 2VDRB 4X94A 5BN5A 3HLKA 4YAKA 4PXEA 4GWGA 3OAAA 3IC1A 2QPLA 3EAFA 3I52A 2NTYC 3ZQJA 1R1DA 1L7DA 5HR5A 3BMNB 1BG6A 3MTBA 2R84A 2WT9A 5KMGA 1ORTA 4EABA 3KEFA 4N3CA 4CE6A 2GZ3A 3P9SA 3NBFA 1V5FA 4V0ME 4C0QC 5JDIA 1JQJC 3WFIA 4EPVA 3ZCRA 2GPAA 1G42A 2MSLA 3T99A 3PUWA 2ZYAA 4HNAB 4DJTA 1A1SA 3KTDA 5GCNA 4H77A 4DCTA 1PJBA 2JLMA 3GAMA 5JLJA 1CJCA 4BWYA 1C9DB 4WESA 2LGJA 3R41A 1ZP6A 3R7FA 4ZK6A 1NF2A 3WQBA 5CHYA 1O0SA 1RP1A 2BZSA 1AKWA 4S04A 2OBXA 3DBRB 2CT8A 3NXSA 4BFSA 5IV0A 4EPTA 1Z2PX 5TSDA 4BWFB 5EQDA 3FYUA 5ED4A 1EK1A 4N5LA 2XDQB 1PNVA 2HA0A 4GKJB 3GA0A 1YCGA 2DF5A 2PXCA 2HRCA 2JLVA 1RCFA 4FBMA 1E2JA 2HWXA 5FBWB 1W19A 2YHAA 2WVHA 1DIBA 1ZESA 3HCFA 3GFQA 1GUDA 4DNPA 3KEQA 2YCLA 3OF2A 1QSOA 4WXRA 4QJ3A 5DM0A 1MO2A 4RCVA 1EHCA 5EJ9A 1Q0HA 3G82C 2P0AA 3OQMA 2BTEA 1QH8B 3SYKA 2WC1A 4YRCA 2VDWA 3PYLA 4CQNA 3MRSA 1K6IA 3TLXA 5KYWB 2HLPA 1K2WA 2O7VA 2C7PA 4NBTA 4KR7A 1CNFA 1DFHA 1GPNA 3D6FA 1RJDA 1SQ6A 3NTXA 5F2OA 1U8XX 3ZCXA 1CPYA 3OJEA 2CVZA 1ULAA 3TOAA 2ZIEA 5KYGA 2WJIA 2B0CA 2V96A 4PQFA 3RC3A 4M0PA 4FU0A 1SVMA 3MQ4A 3HWRA 4A16A 1PCAA 1NBAA 2VA8A 2CZGA 4DDHA 5FF9A 2YFKA 3LZ6A 1NW5A 2JEYA 5EHNA 1KO7A 3ETEA 4C9BA 1FP7A 4J3FA 4RVNA 4DLVA 3K09A 2ZB7A 3SQOA 3EGWA 1H65A 1SXPA 4UOEA 1YJQA 4HNTA 1DBQA 4LSWA 1L7XA 4POOA 2W43A 3NVDA 3AESB 3CX4A 3L0YA 1J2TA 4QPJC 3VKUA 2PRKA 1L8LA 4A39A 4U2EA 5J5CA 1HFWA 4DWJA 3HCNA 4HDOB 2Y8EA 3Q85A 1DXQA 1N2CA 1GU7A 4QBFA 5H9VA 4BBHA 3H2HA 1FRNA 4J0DA 2JK1A 1T3SA 2DEAA 3OPMA 3VUFA 1YKGA 1ETUA 4R9VA 2A5GA 4EGJA 3P9RA 2W2PA 4PU0A 3TPCA 1Z8DA 3RIMA 1YU9A 3GUHA 4OU5A 4Z4IA 2V7UA 1NT2A 3DO6A 2PSJA 3RROA 4PGFA 5AMXA 3VPFA 2NNWB 4MQ4A 4WVFA 4C6TA 2NXJA 5KTMA 2WJ4A 4PCVA 5CRIA 2QYOA 1Y6GA 4BNKA 4XQEA 5IAOA 3ANTA 2WPDD 4OKOA 5JHHB 1XALA 5FOSA 5A6SB 1DFIA 2AFVA 2JGKA 3W5HA 2QTVB 3HB1A 4EMTA 4UOZA 5J2UA 1UM9B 2HREA 2AB0A 3D3QA 1U2QA 3GJ6A 3Q15C 1X0VA 3NU1A 1E2KA 4TS9A 1N2CE 5BVHA 4DV6B 2ATIA 1I3KA 4I5GA 1AQJA 1UWLA 4QFCA 3TNYA 1TYEB 4O0MA 5A05A 3IT3A 3PQDA 3AU9A 2W6IA 3A11A 3X2EA 1XPJA 4C14A 1U0EA 2LIVA 3VH3A 2B92A 2F3RA 1Y9EA 3LIIA 1Y89A 4EZEA 3GA7A 1F2DA 5IKOA 2PUHA 1TLTA 2DKOA 4IEFB 3AB8A 2JDDA 1JI0A 5C2JB 1JEEA 3ZH2A 5LQNA 1IDOA 1XEXA 3UPDA 3DKIA 1I3CA 4WX2B 1LFWA 1IUKA 4ERNA 4PSXA 2E37A 1GITA 4NBLA 3KR1A 2R7HA 1B41A 1GNPA 3JYNA 4BFCA 2JIZD 5L3RA 2TMYA 1LSSA 3UC5A 2OV8A 4G9BA 4KVFA 1HOXA 4JEIA 5BNWA 4D41A 5BSMA 3E8SA 4FD2A 1V3VA 5C7YA 1B23P 3PNVA 1MB4A 1N0IA 3ZXXA 3EZNA 1CZRA 3NHAA 5LU8A 3NBAA 1SQ5A 3TJMA 3SI1A 4P7BA 3TXAA 1W46A 2CYAA 4MGYR 4PNEA 1JKMA 2GUGA 1Z12A 4R84A 3AKYA 1FBTA 4Y2YA 1KWGA 2AFIA 5FI0B 3R3SA 1MOZA 1MOPA 1RRFA 4V0OA 1KI2A 3RWMB 1J49A 1JEYA 1JJVA 2NO1A 4CM7A 3A4MA 5J2TF 3AEQA 2MSWA 3L0SA 4DA7A 1FFYA 2NUPA 1JEQA 2REQB 1FFHA 1E0KA 4JB2A 1B8PA 1VM6A 4WXHA 3DZDA 4OJYA 4UNNA 2IS1A 4QBTA 1P4GA 2P9CA 5THQA 1HSZA 3M3DA 5J1TB 3TL2A 4ZA2A 4EHAA 4ZGGA 4I4TF 2OMKA 2A58A 2AN5A 5TQ2B 2XKAA 3BF8A 1PUXA 3RVNA 1MQAA 1XPOA 5AG7A 1X1AA 2X40A 1D09A 3G2NA 3ZD6A 2WWYA 4XYBA 3G2HA 3IWEA 1T0HB 1Z06A 5CVVA 3GOHA 4ALKA 2H54A 2YWJA 3EHEA 3VC2A 2FCAA 1N77A 3UWPA 1R9GA 4FMCB 2AFIE 2IPOA 1E9VA 1Z28A 4MYDA 1OI3A 3WK4A 3ZEAA 3U7HB 4UTPA 3FIUA 4P0QB 2P30A 1FX0B 4ZEXA 3JD2A 2FF5A 3O38A 3BWBA 5DHSA 4N49A 1QSGA 3P2YA 4XGRA 3RANA 3LYHA 1YR9A 1AKUA 1BW9B 4U02A 4BMVA 3NORA 3DEZA 1Q0QA 1P9RA 2W2KB 3M9XA 2RG7A 3B6EA 4JLAA 3WX0A 1N7JA 3W4JA 1TC1A 2V6JA 1CUFA 1JIXA 2EQBA 2QT9A 5CT4A 3DT8A 1EDEA 2JD2A 2H1HA 4IIDA 1GAQA 1UBGA 4BN4A 3D3KA 1P3DA 3LUFA 4F9UA 4C04A 5JFGA 3A3OA 4K6CA 4R1NA 1O54A 4RYDA 1MBZA 2WMDA 5COQA 4FFPA 2DKNA 4UQOA 1S3SA 3L1JA 1WQ3A 3HPRA 2VBIA 3N5CA 3MOGA 5ENVA 3DBLB 2OVBA 5AD1A 1OAOA 2VT7A 5DHUA 4J9VA 3NWPA 1MNAA 2GHTA 5C5CA 2ZE5A 3T61A 4BV8A 2D0PB 3U6BA 3D4IA 4YT5A 3KWLA 3EWAA 3PK0A 1O3YA 3GCDA 1EP2B 1YB5A 4MS4A 3HKDA 1OBFO 4R9NA 3IBCA 2VDUE 3W2EA 4P0PB 2PJAA 4GE0A 2VF8A 3C8HA 1N4AA 4IJ5A 1X3SA 3MBOA 2B98A 1QQTA 1J07A 2ZDHA 2PV7A 3DFMA 2OB1A 3PSHA 1QV9A 2HJWA 2CCKA 2WZQA 5AKZA 4HXFB 3T34A 1FZQA 4UARA 2V9ZA 3A37A 4EB6B 5K3AA 2XODA 4LRSB 2WAMA 4D44A 3ANLA 4CCSA 5A9SA 1XB2A 4K05A 5ERXA 1UFVA 3L7OA 2I2BA 4LJSA 2J8ZA 3FPFA 1ISHA 1CDZA 5FH9A 2YVAA 2J87A 3GMDA 1FNNA 1K88A 5LYDA 5ALMA 3BWEA 3FYDA 3BC1A 3ISZA 1SCUB 1R0BA 5F2NA 2F1HA 2O2EA 2DQ4A 3FCCA 4R2HA 4U0KA 1ES9A 1TQHA 3GJQA 5KSOA 4M0FA 3WO1A 4U7GA 4MA0A 5FB3A 2PKCA 2C95A 1HWYA 3RRNA 5B3LA 1Q92A 1SXQA 5K8NA 2WQZA 3O0TA 2AOTB 4ZTZB 2DSNA 3G0HA 1W88B 4RTLA 3B1WA 2C58A 3R6GA 2G28A 5DM70 4II7A 3UAGA 1ZCBA 3NHYA 1KJJA 2NT3A 1DV2A 2Q1TA 4E2AA 1TJNA 2QTCA 4BE4A 4IJ6A 2A78A 4LPKA 3DBHA 3LX6A 5L4LA 5IB9A 5AK5A 4GI1A 5GJWC 1Q74A 3P32A 4NMWA 2PLRA 1MFZA 2XVZA 3T3GA 4BQPA 2AFOA 2O1WA 4F8YA 4HNHA 1RAEA 3CRW1 3N0XA 4K2AA 1UKYA 3RR2A 4B7UA 3T8WA 3BLNA 3HL0A 1N5RA 2HUPA 2PH5A 1Z0KA 1IN7A 4YAJA 1JT2A 4HPWA 3IU2A 3S0JA 2XH8A 3UJDA 5EJ6A 4WK2B 1SIBE 2RG1A 1U1CA 2A2ZA 4C0XA 3OE4A 5LMZA 1UJ5A 4N54A 1TQ2A 1QMUA 2ZR7A 1RI5A 4NOMA 3ILHA 1NVBA 2IA5A 3ZI7A 3OE7D 2AUTA 2AYXA 4XX1A 3TVTA 2OV2A 3G7NA 3A9VA 3GLTA 5LIRA 4K3NA 2QMOA 1R66A 3QOXA 3EVTA 3U56A 4FDTA 2P11A 2CMKA 3M6AA 4QDUA 2YHIA 1QCDA 5TF0A 3GFSA 1LBTA 2VXBA 4JP8A 2XX3A 1EDZA 5E6RA 5TRTA 2WD7B 3R2JA 5TQ0A 2BR5A 1MDFA 2C61A 3WS7A 1IZYA 4CXMA 1BDJA 3VSCA 3D1JA 1PL8A 1NQVA 3RG2A 2O14A 1Z56C 4LJKA 2Q5EA 4HZUA 4B9AA 3DZIA 2PLAA 4RKEA 4J0GA 5HCNA 4D02A 2OE2A 2JLBA 2H29A 4ZI3A 2BGJA 3C87A 3E7DA 3HWWA 4QQNA 2BF7A 1EJ6A 3I04M 4LNUB 3IGRA 4WKPA 2Z1NA 1V8DA 2DPYA 1NI4A 4N76A 2XB6A 5EQFA 2R7KA 1NJ8A 3N75A 3LKVA 3QG5A 3W3ZB 2GXQA 3VVMA 4KV9A 3U7JA 5K9ZA 1XNJA 2D5BA 2VJCA 2I33A 4W5QA 1LW7A 2R6HA 3U9LA 5AGEA 4A37A 2H1SA 3QKTA 3DZ8A 4RK4A 1K0FA 3IKJA 2EKDA 2JLAA 3TAXA 1CQJB 5KEIA 2A3RA 2C3MA 2NYQA 1VLLA 3ZNOA 2QI9C 4XRGA 4PYIA 4MUGA 2A9PA 3QE4A 1XRNA 3DWIA 5ADVA 2JKZA 3NP9A 3F49S 4ND8B 1NAHA 4UWIA 4JGGA 3O1LA 2GN9A 1GTVA 1VQ1A 1ILWA 2R0QC 1Y6ZA 2VEOA 4HR7A 4BMOB 4G81A 1WD5A 2H52A 3G49A 4PWYA 1AS3A 3VHXA 5KNDA 2HPVA 3UT6A 3OPVA 2HXSA 3FY4A 3WMEA 1Q2XA 4LDPA 2F7SA 1FDVA 2UZ3A 4BQOA 4FR5A 4PTLA 3C70A 5LR6A 5BXYA 4UHFA 4NBUA 3PEEA 2PRJA 2PJBA 3QY9A 2GESA 1M9NA 1P29A 1PR1A 3DMRA 4HB4A 1DXYA 3MUNA 2ZCUA 3KVYA 4WZAB 3RSLA 2XSZD 2C5BA 4OGGA 1L3IA 4GECA 1LX6A 4ER0A 1OR8A 1WO8A 1J5EB 3WDMA 1PWEA 1VBMA 2FN8A 3MJHA 1I9GA 4Q1BA 3NDIA 2RONA 2H57A 2VAXA 1IWOA 2PSDA 3LBAA 1WX1A 2ID8A 4MICA 4QTZA 4HQ6A 3QZUA 1NRJB 3B9BA 4JXZA 4CF6A 4E1AA 4AXBA 2I6UA 2X86A 3VU0A 4NJQA 4WINA 2W22A 4YRRA 1XR3A 1EVIA 4MVJG 4IDCA 4E30A 3TYXA 2C4MA 4GC5A 3GEDA 4PWZA 3MF4A 1S3GA 1XTVA 3LW7A 4F4JA 4TS4A 2FR1A 4B3XA 1CR4A 1QP4A 1STOA 2XUKA 3ZWWA 1E9DA 1SO8A 4F7WA 5A3QA 1K7CA 3CKYA 1F4VA 3L7DA 2JGIA 1L1FA 4OI1A 1KAMA 2YYAA 1H85A 3MB5A 4KUEA 2J7PA 4CLRA 1T5OA 3OMXA 1GUFA 4OUDA 4R3UC 5EXEA 1W0KD 4BL5A 3DEAA 4LV5B 4HOYA 1UBKS 2Z3MA 1YQUA 5AXDA 4ARZA 3OUTA 2VUUA 4FHDA 2CLCX 1F06A 3AEUB 5IF3A 3LJKA 2YR0A 4RM3A 3OI7A 3C39A 2AMVA 1H8LA 1B76A 1N6RA 3N6XA 2FX3A 3DJFA 2L82A 5AO9A 1RYFA 2HTFA 1AO0A 4KDFA 2Z8ZA 3TUIC 4YGXB 1NKVA 1I36A 1YDWA 2TRSB 3NJ4A 3N0WA 4BASA 4QELA 4GFDA 2O2JA 3JQ8B 4GMKA 2PC1A 4F4FA 3GGSA 1XRJA 3H9GA 4PPFA 4PGHA 2B4RO 4WTOA 3VJMA 3GCGA 1ENZA 1GLGA 1D1SA 3TSYA 4JS0A 3VU1A 4CKBA 4JUCA 2IYOA 1KVTA 3RVOA 4EUKA 1L9XA 4IQ8A 3ANMA 4KLAA 4D79A 4PTZA 1GZHB 2VK4A 4HDAA 2D7CA 1Z0JA 1OWNA 4JX9A 2I7DA 3W2TA 2CSUA 2FPXA 4NAVA 2DJIA 4YRTA 1FDUA 3EXHC 4PXSA 3OLCX 2YX1A 3DDCA 4GGMX 3H86A 1IU9A 3QE0A 3CUVA 2P69A 4KLRA 1DAPA 1NXPA 1L5GB 2J9YB 4YUVA 4FOSA 1WU7A 4QARA 3ZBQA 5EPOA 2VVTA 1TVCA 2A9RA 3AY6A 4KG7A 3Q2KA 2ZTVA 2IS4A 2JEWA 4FFOA 1HGXA 3EE6A 1TEXA 3IJEB 4PX2A 4TRJA 1SIWA 4CPAA 1A9OA 3G9TA 3U7QB 1KK3A 5JD4A 4YCBA 4M1EA 2OD9A 2FJPA 4MIKA 3M6FA 4DIUA 2BHRA 2C7GA 1S1CA 3QPCA 4Q4JB 3NEPX 2RB4A 3ZE9A 4IVQA 1J2JA 1KOLA 1N78A 4N5IX 4OPMA 4O1HA 3KKZA 3W6UA 3HJHA 4MR8B 2X41A 2ZSEA 3AW9A 3H1BA 1OYVA 2X42A 2O8CA 2IPXA 3CPJB 3PNPA 1J1IA 1T91A 2ZITA 5TC4A 2WINI 1OH6A 2ETXA 1FRFS 2JC3A 4W5HA 2CFRA 5CCDA 3B3QA 1S2IA 5BSRA 3F1LA 1Z16A 3PR3A 3NW9A 2V7BA 4H6ZA 3GJXC 1KO1A 4CF5A 4F1KA 3TTVA 4WDQA 1X7WA 1HRDA 2BFEB 1QK3A 1N1EA 2HK8A 1U8EA 4N41A 3LDGA 4OQEA 1ONOA 4A36A 1GY8A 4YV0A 5ISVA 4R2WA 2R8VA 1R7RA 3JZAA 3B1VA 3DMGA 1JQ3A 3OSUA 4C89A 1WM1A 4DPKA 3GIWA 1ADYA 5ICMA 2QZZA 1Z4JA 1AHIA 4IH1A 2YQ4A 4JKYA 3TRDA 4DSNA 3A9UA 4TTQA 3AP1A 4IHMA 3ITKA 1EXNA 5EHGA 1BWSA 1F6WA 3WZMA 1IVYA 5BSKA 4G0MA 4DIFA 3W5JA 2JJQA 3GUZA 5JZOA 1NC1A 1TECE 4UU1A 1W47A 4HWRA 1UMDA 3QWIA 3CNEA 5HTOA 1JB9A 3DHVA 1CY4A 2CZCA 2H5JA 2HV8A 3OP4A 4WI1A 1IQRA 1CLUA 3HEAA 5GZ1A 4G89A 4PPGA 1NFFA 3AFMA 1SBHA 4FOOA 1MW9X 3CN9A 1E6CA 2DBYA 1G5RA 2PX4A 4KR2A 5D2CA 4P4GA 4RDIA 5JY1A 3P2JA 1EFAA 3R6DA 1ZD2P 4L9AA 2EKBA 4GWKA 4K6FA 5F73A 2I9KA 2ST1A 2Z9CA 4HNUA 2ACWA 2O0HA 5KYTA 2BJWA 3W91A 3GPDG 3ASZA 1HBJA 3EODA 5DWNA 4HYEA 1KS9A 2EFDB 1Y3BE 2O0KA 3KWMA 3L3BA 1YJAA 5J2UF 2WTXA 4K6HA 4ZMSA 3DC7A 1E3DA 5B1SA 3ICCA 2ZJ7A 4ADSG 3N8NA 4GOMD 1F8XA 1ZD9A 3NYQA 4BKOA 4DIKA 2G7MC 1MHPA 3OA2A 1CR6A 3I9V6 4IIGA 4YJKA 5DNAA 3L8CA 4RD6A 1P5RA 1XGKA 1QM5A 3GGOA 2EFJA 2WIGA 3PJGA 4AKSA 1VJGA 4CYNA 5B3JC 5M7EA 3R1IA 3QKSB 4LV6A 1JTEA 4UNPA 2FLWA 4BMPB 2EDAA 2IQIA 1HYHA 4FGSA 3KL4A 5ED0A 2ONKA 1JQ5A 1TCBA 4EKDA 2H2AA 4ARSA 4KQWA 3ODPA 4EMEA 1PR6A 1VE3A 5B53A 3OETA 2GN8A 3R6LA 5P8WA 3V3KA 4JVLA 1A7KA 2G25A 1JPNA 4FQ5A 2V4UA 2Q6TA 1JBQA 3WFZA 1Q0PA 2ZW9A 3I0MA 5HUJA 4LX8A 1O6ZA 1SUAA 1OGJA 1Y3FE 4MHPA 3OEEA 5GINE 3KKKA 1NFRA 2Z8YM 4KKXB 3DT9A 2WQ6A 3MUEA 2QY9A 3HN6A 3M4JA 1LBIA 4MRRA 2XXJA 4HAYA 1HZZA 4Q4CA 4QODA 2PUJA 2G1KA 5EVCA 3PQ7A 4KN9S 4CQMD 3MUFA 1GSAA 2B5OA 1I80A 3NHPA 2XQFA 2ZIXB 1DBVO 3UB2A 2K6GA 4ZEVA 3LSYA 1AKMA 1GCUA 4YAWA 4GPBA 1I33A 5EMIA 4J7AA 4IM7A 1WHSB 5CEEA 2VNAA 4YJDA 2I87A 1GQYA 2KQUA 3OQ6A 1ZU5A 1JGTA 2AFZA 4XOUA 1E9CA 4A1OA 1NDUA 2VHYA 4YAUA 5KYUA 1XQVA 1C2TA 2FZWA 2I3GA 4X20A 3KQVA 1NASA 3M6VA 5B6JA 2EZ8A 3D8BA 4AZ0B 5G02A 4J7CA 5HS6A 1Y3HA 2YXBA 5CFMA 2FU5C 4QIHA 3B5JA 3K71B 1G38A 1G8YA 3F3KA 5HRUA 1YR0A 1Z37A 3K0AA 4NJEB 3IWWA 3K9QO 5AI9A 4AIRA 3EDMA 1XXHA 2GCPA 1Y7LA 4FONA 1U0GA 5IX8A 2WILA 2FN4A 1YW4A 5GP1A 1AC5A 2EP7A 1MC5A 1CD5A 1LQ2A 3C7TA 3NTOA 3KB1A 5LA6B 4E5DA 2H7YA 3TNJA 3O1IC 2IGTA 3SP1A 3WA7A 1OTHA 2AJDA 1R9NA 1NWHA 4R8SA 4DBZA 1USKA 5ALIA 1H6BA 5AKKA 3HADA 4XTCS 4GRAA 3EK2A 3D2AA 1C3XA 3ZHRA 2ZWMA 4NJRA 1FYXA 2BMFA 4EHLA 2KYRA 4Z54A 1G5FA 3TKAA 3BIFA 3N8GA 1LVGA 3WKAA 3D4BA 3ZVLA 1UOOA 3HE3A 4KIFA 3CVOA 1ZXBA 1YJ8A 4OD0A 3QKRA 4ZO9A 1I24A 3HUFA 3OZFA 1HFJA 1HLPA 3FM9A 4LYDA 3II6X 4DMGA 3I2GA 2ZRFA 1F8UA 3D7MA 1MH9A 4EZBA 2QECA 4YPFA 3PRYA 4AUEA 2ZP1A 4A2ZA 2AL7A 4E5NA 3FX2A 1XXHE 4M0LA 2JCXA 2WJ3A 3PC3A 2A0UA 4H3VA 2H08A 3THSA 1XC7A 4DSTA 5IZ4A 1AQIA 3EZLA 4I5IA 4JI6B 4ND3A 3JATB 2DPSA 1O95C 1A82A 4KN8A 2ZYGA 1VE1A 2CXHA 1Q0LA 4LK2A 3WQQA 4UM7A 1YS7A 4LHEA 3VNBA 3UZUA 2O2IA 2WSBA 4H4DA 3RBAA 4R3WA 5DBFA 3LWDA 3W5DA 1E3MA 4AG3A 4BC0A 3FOAA 4AO8A 1PR9A 3OJWA 4EYOA 3MJ4A 4EDFA 4EJMA 4P4EA 4CGMA 4NFYA 4R54A 1Z6QA 1V1RA 4A73A 3D6JA 3OIYA 2R2GA 1GG5A 3KYCA 4EG0A 5GV8A 3CSSA 3EPLA 2F8TA 3GFOA 3IE1A 1UKVY 2PEYA 4UASA 3VZPA 4CRYB 3AEZA 4ZOEA 1BGXT 1DELA 3KXDA 4YRGA 2QLLA 4JYPA 3VPHA 1KL7A 1R64A 1JX6A 3BTOA 3UN1A 3NJRA 2ZROA 4YP6A 1GR0A 2WHPB 2VJQA 4KVGA 1T3GA 4N18A 5EZYB 2QUZA 2ONJA 3ZUPA 3NBKA 2V3CC 1JLLA 4N5HX 5HXDA 3B8GA 3SHPA 4CN9A 5EIBC 3M81A 1T6NA 4IHKA 1WDTA 2GHIA 3FLAA 4CAWA 1WTAA 3FPBA 3RVBA 1FNDA 5IUKC 1PWHA 1QJCA 3S3TA 2XQVA 3KO8A 3C14C 3M70A 3WBFA 4NRDA 3ZPXA 3ZZ1A 3RSQA 2J3JA 4L22A 3ZE2B 4TKVA 3RIGA 2ACKA 4NONA 1E9RA 3GEIA 4P35A 1DKPA 2NNLD 4K8RB 3FSRA 1VBNA 1IB6A 4ZQIA 2VPQA 5JE8A 3UFXA 1CYEA 2OK8A 3V2GA 3IIBA 1AB6A 1N3IA 3IBTA 1U9IA 3BJZA 2VZLA 4ETNA 3CF4G 1KAEA 2JJ1A 2EJVA 2J3EA 3TLBA 2GK3A 2HW8A 1ZHOA 3ZWDA 3BKXA 3BRQA 3S81A 2I29A 1CB0A 4KQFA 4CEIA 2W6MA 1QK5A 3L7LA 3LO5A 3GCWA 1FFSA 5JO9A 3Q3CA 3W6OA 2ZSFA 4B79A 2I67A 3CJTA 1E1KA 4L5AA 4CQMB 3JRUA 1ZVQA 3LL4A 4CM8B 3A1DA 4FP9A 3QF4B 1TTPB 1Y6QA 2YINC 3QFFA 4L74A 1VGVA 4N6GA 3KV3O 3QNUA 3B1KA 3I62A 2D4PA 4QA9A 5I8ZA 1DIAA 1K8QA 1U2TA 2NU6A 4CNBA 3D2LA 3VSEA 3SR0A 3LUDA 2R751 2TECE 2I4LA 3RK1A 1WSBA 5FTKA 1Q2DA 4L02A 4P32A 3OBBA 3F2IA 3SJ7A 5IN4A 4YAOA 1KEEA 1L4NA 4Q4AA 4MUEA 2OQRA 4LV8B 4OIWA 2QLFA 4G84A 4MWTA 1P2FA 5FOQA 1I2AA 2JIOA 1QYIA 3TCVA 1S6YA 2BJHA 3Q41A 4C2UA 3GRUA 2CLDX 1NFQA 4G4JA 1DCTA 1I1OA 2A0WA 5J3JA 3DLJA 2W9XA 2P9EA 5JEDA 3OJCA 1GOTA 1WXDA 4PO8A 4ZEWA 2IYZA 1JSZA 3EVZA 4HVAA 5C8YF 3N2ZB 4MW1A 3I53A 1R0RE 3VVBA 4HGQA 3RNOA 2IZ5A 4FSXA 4TVKA 1EGQA 4CCWA 4PHTA 2IV3A 3FJUA 5LJIA 3W8RA 2B4TO 1HT2E 2CDRA 3DOHA 2J08A 1JFRA 3U4MA 4RK0A 1OHHA 3C4VA 2QTAA 4YUYA 4PLCA 5HQ3B 2Z2JA 4KN5A 1WJGA 4YN3A 3T52A 1EHIA 1HG0A 1HL3A 4F60A 1XZ8A 2ZSIA 2IL1A 4OMCA 2OB2A 1UXKA 3SEAA 1P1RA 3GNSA 3QXGA 1AN0A 3H9JA 4NMLA 1G63A 4HYQA 1AKNA 1PHPA 1KZ7B 2VZEA 3KLPX 4TXHA 4S1OA 5A1JA 1CX8A 3WL6A 1N36B 2AJCA 4TN5A 1VYUA 2SICE 2DAPA 1U2DC 4B0OA 3WK8A 3IUBA 4N65A 2A4KA 1IJFA 2WJPA 3L79A 1MJ9A 2PZKA 4PF1A 3U9SA 1OWMA 1L9KA 1EDDA 3W0LB 1KDOA 4QTYA 4KWIA 4TT3D 5IK2A 4INZA 3WIEA 1R8QA 3INRA 2ORYA 4I8XA 3RAJA 1N6NA 3A04A 4FFVA 3DL7A 4EMUA 5DRYA 4KKVA 2ZWAA 3U3XA 4KAXA 1T2UA 4FSDA 5CXUA 2DHDA 1ZHFA 4QPPA 2G1AA 1CP2A 4OLLA 1E0SA 4HATA 4JBWA 1E3TA 3FUCA 4LFAB 1EK6A 4Y30A 2CD7A 4ABYA 2ZRCA 3FROA 8OHMA 3ZX5A 4Y9RA 3OZRA 5CM2Z 4EVYA 1MLDA 4RS3A 3P5SA 2PMKA 2IPNA 5EJGA 3TWOA 1Q95A 3IQHX 1ZSNA 1EXWA 4OAQA 3IVRA 3PU6A 4HLDA 1DHTA 3G0IA 1UOEA 4QWWA 5AI5A 4S1WA 4UVIA 3R0VA 1Q3KA 3R09A 3EGVA 4ZCSA 3G9QA 2Y1DA 3HN2A 4G4SO 3TQQA 4TXNA 2P79A 3GVHA 5THXA 1I6MA 2XZDA 3TIFA 3UANA 1EE3P 4IRMA 3TZQA 1ZN9A 2ZCVA 3IEUA 1G2IA 3I5MA 3URMA 1WXQA 4UM8B 1FIUA 5CYFA 3AUJB 5JD5A 2CXRA 1DDGA 2P4EA 1ABEA 1XQXA 4NQZA 4C68A 1HE1C 4HI0E 4EA8A 1ISRA 1FUYB 1JWBB 3CS3A 4DIEA 4P80A 2KW5A 2GCOB 4FJ0A 4TVBA 4E31A 2ODBA 4KITB 2QMQA 1LTKA 3LPMA 1W9MA 2YXEA 5EJ7A 3EXEB 4I99A 1NX9A 3IAS1 2O8FB 3FTDA 1AQYA 1WNTA 2B7CA 2FPMA 3FBGA 3TG8A 2VWGA 2Z5FA 1XZLA 4JDUA 1H9AA 5M04A 1NBHA 4R98A 5KS2A 2W8BA 5KDOA 3V9PA 2EDCA 3JVEA 3W6NA 4LXQA 2P6MA 4YRSA 1NJ2A 4UFVA 5F23A 1T9ZA 1E4VA 3TLZA 1ZCAA 4MCAA 4ZT5A 3R9GA 2EL7A 5G0VA 4NG4A 4K9KA 1P5HA 2VJNA 4GS5A 4E88A 2A88A 2NTEA 4AX4A 4QNMA 3JQQA 2WPWA 3HU5A 1ST2A 3D31A 2PL9A 2BBOA 3HI4A 2GEKA 3AFNA 5E9AA 3BMNA 1UWCA 3R7NA 4BAUA 5MN5A 1ZI6A 5HE9A 3ZWXA 4AZ3B 1SVWA 4HEA1 2OPHA 3KBOA 2R8PA 5ESRA 2JCBA 3CT9A 3I9JA 2J30A 3L6BA 4JODA 1XTPA 1Z07A 1DSSG 3SYMA 4QDKA 4NZYA 1QYCA 2X4IA 2HIGA 1L5OA 1IYZA 1PNOA 4DJAA 1Y81A 3LQKA 1JLSA 3IUEA 2OC9A 3DR3A 1UXOA 3FR7A 1NT4A 3WG9A 2VJPA 1XKTA 3HR4A 1M4IA 1QB7A 4JJ4A 5DK4A 1JHUA 1F20A 4XUGB 4I49A 3VRHA 1Y80A 4Q1EA 1Z29A 4E5SA 1VHJA 1HDZA 5A9TA 3NEAA 1NF9A 3UW3A 4RD3A 2COEA 4I14A 4AM8A 4ACAA 2XDQA 1E92A 2AC7A 4YJHB 6PFKA 5JSHA 2PVVA 2HSGA 3O4JA 1G5QA 2P6OA 3DR8A 4TMWA 3ITNA 2VDVE 2D54A 5LQSA 4HQFA 1N7HA 3A9CA 4DY4A 1TUEA 4LDJA 4MS1B 4XNHB 4EJ0A 2GH1A 4XD7A 5EY5B 1S7KA 4BX9A 4EYEA 3QLUA 4D97A 2D8AA 1I1DA 1CRQA 3SFVA 1QH8A 4HWSA 4YJ3A 1Z0SA 2OYCA 2BBTA 4QGAA 3NKLA 5B3KA 5JFTA 2WUDA 3KHZA 3AFOA 2VK1A 1Z4RA 1P2TA 1U2GA 3EEBA 3ACBA 3CLRC 4RLHA 1G19A 4CBVA 3E22A 2REOA 2W5UA 1NOIA 4OQLA 4E3WA 1YFKA 1CX9B 2VH5R 2ZRMA 2WWHA 3DV0B 2CVOA 3OF3A 5D7BA 1QB8A 2H4YA 4EY5A 4XQ0A 3TQFA 1Z4QA 1WKBA 4YFYA 3ZLTA 1HLDA 3Q10A 3IFEA 1PTJA 4Z0NA 3SI2A 1J06A 3HCBA 3QYFA 5K8CA 1MJFA 1SIOA 2G80A 3GO4A 1O8BA 3OZXA 4KXFB 5BYKA 3GPIA 3ND6A 5K8OA 1IY0A 3VPXA 2XJ9A 1TQ6A 4YAIA 1KJWA 4MEJA 2F3UA 1O2DA 1XEFA 3M6IA 3MBIA 1Y6FA 3PVZA 3AF5A 2ZEOA 3EQ8A 4RI1A 4OK3A 4D9BA 2XRZA 2XQIA 1KY3A 2OOKA 3QWAA 5ITZB 2QZJA 4F86A 4BU1A 5FPTA 2HMVA 3F90A 3HUEA 2YWXA 1U0FA 4G4GA 1IVNA 5BQXA 2JFWA 3BXEA 1MVLA 2ZRHA 3JD1A 4DCMA 4TLAA 2BUCA 1PU9A 4CV0A 1RHQA 5COBA 3ZOKA 3JQBA 1ZK2A 3AZOA 1THMA 3T7EA 3JXEA 5EHXA 2Q3JA 4MW5A 1NV8A 5KNBH 3F0TA 2HRQA 4XZ3A 3UXMA 4GZ3A 1SXGA 3GN2A 3B78A 3MLEA 1E60A 3GEEA 2AE1A 4G1UC 4LS3A 3CLTD 4XSGA 4ZAYA 2ODQA 2QRQA 2P9TA 1WCYA 2YMQA 2NQ2C 1DKRA 2GM4A 2PBZA 2ZBQA 4ARVA 3T4UA 3DVRX 3OJLA 2VF7A 1H1DA 4ZC8A 1UM9A 1ZGCA 1GPKA 2WIJA 1WAMA 3TD2A 1MX9A 1XMXA 1OXTA 2CDAA 1V25A 5CJ2A 3P2IA 3WIBA 2IEAA 2BMWA 4JI3B 2VH1A 3DKKA 4X97A 1YIDA 1V2HE 4QKQA 2I65A 1GFZA 5IKEA 2DWQA 3EPJA 1UOQA 3F73A 4Z4EA 1UDCA 2GLFA 3T6KA 5LUAA 1M2OA 3TJZA 1NMXA 4EAQA 1K6XA 4UEFA 4MR9B 2UVPB 2OGSA 4RL4A 3TI9A 3B3CA 3TDKA 1UH5A 3ZIAA 1DQSA 5FJIA 3AJ9A 4ZT6A 1NXVA 2VDQB 4ESEA 1MGOA 1WY5A 1ZR4A 3F96A 1KZ1A 2P9YA 2HF8A 2AI2A 3JTKA 2OH1A 1OI2A 2ZWVA 5JRZA 3EDOA 1BOFA 3GC6A 2OKGA 1T6ZA 2QD2A 1XD2B 4LZAA 1A71A 4JI7B 2Q3CA 5AG6A 3OQOA 2HA5A 2NZXA 2B9VA 5CA0F 1XTKA 2B8NA 4EA9A 1QVWA 2FUG6 4ZYWA 4IV0A 1KJYA 4WN3A 2NSYA 3O1JC 1J8QA 1EX1A 1LV7A 3TZEA 4JP2A 2ZJYA 1HMYA 5DNVA 2CNTA 1DJOA 1JPUA 3N2YA 4UIAA 1ML4A 4P22A 4HAUA 2ZANA 3VR5H 4B44A 2WHRA 1TK9A 1N5DA 4KFUA 4EPWA 3PITA 3D6TB 5AI8A 2UYYA 4LF7B 4G8BA 1GNTA 2PGJA 3FNCA 2QX6A 5DZSA 3TRJA 1G5TA 2X8AA 4OJNA 1QIGA 5LYIA 3E6AA 1BD4A 2JH8A 2XGMA 3G8CA 5T6MA 1XDBA 2I4OA 3FWHA 4DPLA 5IKPA 1JFLA 2CEKA 2J32A 1PBNA 3PC8C 3BHNA 2XB9A 2W42A 2Y1GA 4XUCA 1VTKA 5DWMA 1YZHA 4N7RA 3WLPA 4XR4A 1M67A 5LXTB 2I6QA 1RR6A 4MCJA 3VYVA 2Q44A 3BGOS 1CEXA 1VG9B 4URZR 4CV1A 1EVZA 5FBVB 5KCZA 2RARA 1E7QA 4X8LA 3RNZA 3UQZA 4WY8A 4MVJP 1P80A 3NNDA 1IMOA 4CTKA 5JZBA 1MR3F 1JQDA 4B35A 1BHSA 5IF9A 1QLJA 1P7PA 1S8NA 2PIYA 4JIMA 2ONYA 4YTEA 3VNAA 1YVPA 1JE0A 2B4BA 1V3TA 3MGAA 3NWBA 3GPLA 4PG6A 2QQFA 1SBIA 3F46A 3BHXA 5BW6B 3MCUA 3ORQA 2R86A 2QTRA 4A15A 3KZVA 2GCNA 4M76B 4FGWA 1YZ3A 4EJ6A 1YA4A 4DRYA 4L9RA 2YZGA 4NGQA 1NR5A 4OQQA 2WKRA 3UJ3X 5ALDA 2IU6A 2WP8J 4CEHB 4TLDA 3RAMA 5ICCA 2YOGA 1QOQB 3PGA1 5LP1A 3MVEA 2RGAA 1WXXA 3R0IA 1X74A 3DTVA 5TPWB 1BW9A 3OPNA 1EE2A 4LMPA 1OSNA 2A1TR 4ZHQB 2H65A 1JH9A 2EZUA 16PKA 5J5AA 1XA3A 2I3BA 4BNHA 2QF7A 3UEOA 9ATCA 3FOBA 4LYFA 3RARA 3ONWA 4AQDA 1DXHA 1MB9A 3GMIA 4CTOA 4ASUD 4TYWA 4QUBA 4JXXA 2JBAB 3GZNB 1QV6A 1L7MA 3QPBA 1LBSA 5SV2A 1LI7A 3NTQA 4QDJA 4XWAA 1PR2A 1ZNZA 1T2DA 3M82A 1EJ0A 4PLZA 2C1CA 5ELLA 5HS4A 2XVYA 4G5GA 5A5EA 4R9UC 1NLUA 2PT5A 4W9NC 4C7OB 2YDXA 4QC6A 2W90A 1SVUA 1OA1A 1MX3A 5JARA 2CJFA 1C7ZA 4ZAGA 3EXG2 5EMHA 4I4CA 2XNJA 2SKEA 4ZZ2A 3Q7IA 1JAZA 5MFZA 4KPYA 3JAWA 5B3AA 3J80A 4PC3A 2EJCA 2NQTA 2V97A 4CEJB 4R05A 2RC4A 1UMBB 1A2KC 4EG6A 3BWXA 4QVGA 2A9FA 2H18A 5WRFA 5JJBA 5CB8A 2J0EA 2ORWA 2NUAB 1K86A 4OJKA 4OGLA 4MY3A 3KJQA 5L3SA 3RJMA 2QLTA 3CF2A 3O03A 3N8IA 4X61A 4WUTA 4NU8X 2IU0A 1Z13A 4EB6A 1CJTC 5SYMA 1I8TA 1RC1A 1HT1E 2RH5A 4TV9B 2B4KA 3RODA 1GZ3A 1BPMA 2ZBDA 1QIMA 4BMYA 3D68A 4AMVA 4RETA 3NNNA 1QO7A 4PZAA 3QOWA 5A3RA 1QRUA 4BNFA 1IH8A 3EY9A 1J8YF 2K4MA 1NMQA 1NP3A 4D3FA 3E27A 1EESA 1E4OA 2BKUA 4UNRA 2DHRA 4MPJA 1BHO1 2P3SA 1W36D 3TZLA 2YW2A 5F35A 1R10A 5KDLA 3L6UA 2IYXA 3D5QA 1PD1A 3ZHOA 1I9CA 4IDAA 4Q82A 2Q3MA 1EQAA 4LDAA 3K8ZA 1SU8A 3NHUA 4V38A 1Y0YA 1GGMA 4MZDA 1BO6A 1HKUA 3ZDQA 4LUCA 1WZEA 3SBXA 3R3ZA 5DO9A 3HR8A 2F7VA 3VZBA 1ZO0A 1JIVA 1NHWA 4EFLA 4YP9A 5BN3A 1TJ4A 3ZN2A 4J16C 1DX4A 3H13A 1I0LA 4N8EA 2P6RA 5C8YA 3WLQA 4ZT2A 4EHKA 4F06A 1FJGB 1GRVA 1M2KA 2CJWB 5K8TA 5B58C 4KXLA 1KY5A 3LFUA 1P0QA 1MVOA 3R76A 1J8DA 4M0MA 1QONA 1DAFA 1XTTA 4P5EA 4ZOBA 4EJSB 4OXXA 1RLIA 4X65B 2WDPA 1GPH1 2B1JA 2FSVC 1VG0B 2XKBA 1CFJA 1D4FA 4AULA 1K2VN 3O84A 3UG6A 4W8GA 4XVHA 1B00A 1Q1NA 1XMOB 2V77A 3EQZA 1Q6YA 3BMXA 4QVIA 3KALA 3I72A 5I4BA 4MZXA 4LGYA 2Z2ZA 4F9EA 8ADHA 5DT2A 3USCS 4LJ5A 2E4VA 5SYNA 1E6UA 5FUMA 2ID9A 2PUBA 5C18A 1N9GA 4Y6RA 3ODGA 4MUBA 1TEHA 4GAEA 1XZIA 4EG8A 3TPFA 3KFLA 2WB4A 3MJVA 3QHQA 1QYDA 1R16A 4E5UA 4RW0A 4OY3A 3NHRA 3IMGA 5KWIA 5I4MA 1NVAA 3N9IA 3EWNA 1US8A 4EB8A 2E5FA 1FXSA 1A2OA 3A1CA 4WLUA 2RGWA 3ED1A 1YR1A 1CB7A 3LXMA 3LKBA 4Q00A 1IUOA 4R31A 3K0CC 4DIMA 1UZNA 2QP9X 4RACA 3U44A 1ADJA 2NSMA 4HNWB 2ISSD 2PMDA 2BTQA 4Q1AA 4H3KB 4LQLA 4FEYA 1ZS9A 2RB7A 3A2MA 4DNOA 3ROGA 3GLSA 2DR3A 1UPBA 2EARA 4FWBA 1N25A 5L3ZA 1T6XA 1L7OA 2AQIA 2B0JA 3C26A 1V0JA 3T1HB 1H2HA 2ZEGA 1QU2A 1OV6A 4CMCA 1YRWA 3DAHA 2CLFB 3SDZA 5A4JA 1LZLA 1CQJA 4E11A 1GYRA 2Q1SA 3FVVA 3AT1A 5CMLA 3IS3A 3A2LA 2C4HA 3C4QA 5T3UA 4AY4A 2C2MA 3HKBB 3THRA 1JZTA 2CXTA 3A6HA 3QM1A 4ND8A 2VHEA 5A0TA 1DEXA 1Y8QB 3PCRB 3LCJA 5D87A 3C15C 2EVWX 4HSGA 1SCNE 5JYCA 3AKZA 1RYZA 5C1DA 5EMJA 3DGFC 2X7BA 2M9MA 1FNSA 1AXRA 2H4FA 3GROA 1OW3B 3HVUA 3LZDA 1S7CA 3I01M 4J6FA 5TS2A 5JYBA 2CNSA 3OCZA 2BFOA 4LSZA 4MFKA 5I0CA 1J23A 3ONVA 2IYQA 4NCNA 2BI8A 5ANRB 1YJ5A 1A5SB 4TPKA 3TIXB 4B13A 4ZI7B 5I7WA 3NHJA 1NUTA 4XVUA 4ZTBA 2DFVA 1FVXA 4M46A 3PL5A 1JKIA 2RAFA 2YYZA 3ZJUA 1XF8A 4RVHA 3PUXA 3O3OB 3HXTA 1RWBA 4JZYA 3VR3D 4DANA 5FO0A 1GAEO 2X5JO 4E09A 4U39A 4DJFC 1KSHA 1U7ZA 4MI3A 3LHIA 4PZ0A 4TZ0A 2G5PA 2H59A 3QE3A 1K1EA 2VZ0A 1Z2DA 3L4SO 1D03A 2ASVA 2Z9DA 2ZOGA 3WZLA 1OH7A 3KKNA 1BO4A 1TLFA 3AF0A 1XZEA 3AX6A 3RFUA 2QYTA 4YRHA 2R00A 1PUAA 1NW3A 5LQUA 2BEIA 3HZHA 3EC7A 3HA5A 3GNLA 5ALNA 1W36B 3OPXA 1TAUA 5IN5A 4JJIA 4DWOA 3H17A 4DV4B 3OO1A 2B8JA 2JI4A 1QIDA 4IO0A 1NW8A 3HB4X 4YMLA 2CLIB 4J0EA 3CCCA 3OA0A 4EI8A 1UAAA 3H8EA 4L4ZA 1CFZA 2X9LA 4CMGA 2QAIA 2P2ZA 1AQNA 1FQJA 5IYZA 3ETDA 2CFIA 1VG8A 5DSZA 1YH3A 1JHAA 3HEBA 1J5PA 5CB4B 3W06A 3JQ8A 3EG5A 4B6PA 2ORED 2PJ3A 4LRXA 3BFKA 2FPIB 2ZYWX 4MFJA 4L5BA 4BLPA 1GZ6A 3FZYA 4ZC1A 4P08A 1IZZA 2H8GA 3BQ9A 2WHQA 2HO5A 2W6ZA 1B15A 3QOFA 3OEWA 4E51A 3PD7A 1D0SA 4AJOA 3WXBA 3OU6A 3OC0A 2UXBB 3BF7A 5DW3A 2GMWA 3MJDA 1ZM7A 2XB8A 4KOAA 4GXQA 1N7IA 5IT4A 5BWNA 3F2VA 2CW5A 1UT6A 4ZT7A 2XD9A 4FCTA 2EEPA 4KQHA 3AFHA 1D2AA 3H9EO 4I50B 3GQBB 3A05A 3D0OA 5BMVB 1ZUHA 3FG9A 5T41A 3BWMA 1OF1A 3AMVA 4M21A 4KGZA 3LHFA 3QVOA 4GUDA 4HFMA 1TYZA 4OJMX 2NACA 2JFHA 3OZVA 2O8VA 4NSNA 3MMNA 4X71A 3RU7A 1TMKA 1Y48E 4FWUA 5ER9A 2O4HA 3WKCA 2I1QA 1IBRA 3CZQA 1MO6A 4C7MA 4MB6A 1M2NA 3RS8A 3QEJA 4YJ3F 5B1YA 3L0DA 5A28A 2J59A 5IM4A 1GYPA 3NC1C 1JKFA 4DAEA 4AECA 3GUVA 3EIUA 2W83A 1HNNA 4FD5A 4O2LA 1Y7IA 1RPNA 2QT0A 4KACA 3ELYA 4N40A 3AZPA 4F3RA 3HCAA 2L18A 5IUJC 2I0FA 4J2OA 1YJBA 4W8HA 4EECA 1PS8A 5J1QA 2R6JA 1RQNA 5FDFA 3D59A 4F8ZA 1YGYA 4RQAA 4RIIA 1DOZA 1ZOSA 1MW8X 2IBSA 1AD2A 1H8ED 2GZDA 1TA0A 3INTA 3JYHA 1FJ2A 1X70A 2QMYA 2FRDA 1QE0A 2A4MA 1B43A 4LE0A 4H35A 4YREA 3URKA 3KSRA 4M60A 4XPIB 1Y37A 3ZU3A 2W6QA 1NYQA 2BEWB 2IYPA 1WABA 4RJIA 1AKRA 1FTYA 3CT6A 1YR3A 4U00A 5BUSA 1UC9A 1RPAA 2FE4A 1KUVA 2RHRA 3KRTA 1GLNA 4J3NA 3EEYA 1DPGA 2OHFA 4CRWB 1EVLA 1HNXB 3X1KA 1AUQA 4H15A 1O94A 3R40A 1GZSA 2O06A 3ZV6A 4JC0A 4E5VA 2NU9B 1MT0A 2VNSA 4WJKB 2WAYA 2R87A 4GIBA 2I4TA 4JWTA 4MMXB 3T15A 3SS7X 3TSWA 4MQBA 2RC6A 2UU9B 1C81A 1I6LA 3WK5A 1HYQA 4YAFA 1FCJA 2XSZA 3SLGA 4G4SP 1ZFNA 1QHGA 3A6JA 2JD0A 5DWVA 1JFFA 1G3RA 4KOVA 2JFOA 3UF0A 4ENPA 5LU9A 3CVWA 2RHMA 9MHTA 5U4QA 4CKEB 5TF4A 1KY4A 3INNA 3K5WA 2GANA 5KVCA 1RXWA 1ECFA 2RFHA 3IBFA 5K3OA 1IPHA 3GJRA 1YMEA 3DHEA 2CKDA 3F4KA 3OIDA 1KEPA 4CMEC 2QROA 3GJ5A 3HJCA 4LY6A 4LKOA 1CQWA 5KJCA 1A9QA 2VEZA 4ZYYA 4PCLA 1ELLP 2XNCA 1NQXA 1XO1A 3QBJA 4W1QA 1LCPA 2E48A 3NH9A 4UNSA 2J3LA 2YWBA 1EGHA 4R0NA 1CULC 4WPGA 5EIWA 1S2DA 1PJ8A 3IAFA 1UWVA 1U28A 3I2YX 3OY7A 3QKSA 4G23A 1U3CA 3QVMA 1ZXLA 4X92A 1YS2X 1RI4A 5KCMA 4D0LB 3KOXA 2NAPA 3V48A 3T9YA 1P7YA 1X19A 1IEVA 4N03A 3FIXA 4NLLA 3M33A 2O2DA 5KX5B 3FB1A 4XB6B 4I6GA 3O4GA 1EB8A 3IXMA 1ULHA 2C4VA 3RABA 3B9PA 5CH8A 4Z99A 5CA0A 1DTWB 1UEIA 4BZXA 1F2TB 4LW8A 4YV7A 5JQWA 2ZEFA 4FFNA 2IXEA 3DEHA 2WM9B 1V11A 5EXPA 1SD1A 1MH1A 3SVLA 3CSUA 1WPXA 1RRCA 4IINA 3W3AH 3GRZA 5KOYA 5MGNA 3WB2A 2Q3EA 2ZIUB 2MSEB 4BMNA 4QHSA 2Z57A 4D96A 5FOXA 3DR6A 2Z3VA 2RJNA 4UTOA 1D9ZA 1PUIA 1Z3IX 4REOA 4J49A 3A6EA 3BA1A 2WQ7A 4BNZA 2ZIXA 5L95A 4GMDA 1QIIA 3IPYA 1LLQA 4B48A 4XYEA 2IYSA 3HJRA 2FN9A 3EH2A 5I8WA 2AC4A 5K20A 3A4IA 3BSWA 5AW5A 2X23A 4EG3A 1LTHR 1NMYA 3EQ7A 3RRMA 5D3MB 3LY7A 2IQ5A 3CRZA 4ZAZA 2FOXA 3O94A 1EG7A 1RMTA 3WB9A 3GFVA 2ZAYA 2ZBUA 1DE0A 4J0KA 4YJ2B 1MK4A 2X0NA 3PHGA 3KAJA 3HYSA 2HA6A 3SHTA 3DL0A 1MENA 5DI3A 3NVKI 5BWCA 3VR6D 5DIFA 5EIHA 1GTJ1 2E1RA 3CH4B 1XAGA 2D1QA 4UAJA 3P9PA 5KREA 4X3RA 2MHCA 2ID4A 3N2KA 1XU4A 3HB7A 1CV2A 2GBLA 2XNSA 4C43A 1NOKA 3TLYA 4Y9DA 5CHEA 4OF4A 3WGVA 2X3YA 4U63A 3IO3A 2XGSA 2R6GA 4R8RA 1L6IA 1S7LA 2Y05A 2QAJA 3RU3A 5AW1A 4OYHA 2BE7A 3LUKA 4NL4H 2FPSA 5LA6A 1HDOA 4NBSA 1AE1A 3AR5A 5JNRA 1H2RS 2HYIC 3WL3A 3JY6A 3HJFA 4F4UA 2R1ZA 4IGKA 4AJKA 3PFHA 3BXGA 5B4UA 3K9UA 5IKMA 3EIHA 4BVFA 1R15A 2RKBA 4DM3A 1W7AA 4R3LA 2ZUSA 3AL0C 3D0RA 3X1XA 2AWNA 2HJHA 1P9OA 5E0OA 1K98A 1KNXA 4JLJA 4Q9HA 1YV9A 3NG1A 1ZUD1 3FXAA 2K5TA 5ADUS 2EEZA 2CY0A 4D26A 2F1RA 4XIJA 1L7QA 1BXGB 3L7MA 4CR7A 5KB3A 3UJNA 4R7TA 1JH8A 3DDUA 2JLCA 2ARKA 3G0DA 1HQYE 1FBNA 5JH7B 4FC6A 4PK3A 3OQBA 1II8A 3SHWA 4JZKA 4E2ZA 1IM5A 2QN2A 5DJ5A 5JS7A 3VZDA 4YXWD 4JENA 3C6MA 3U5TA 1UBNA 1DRUA 2WTNA 3PHBE 4FYPA 4EVIA 3O8QA 1WVMA 4OMEA 4GD3Q 1OX4A 1GPWB 1DEHA 3JATA 2IEBA 3OT1A 3OTGA 3IQDB 3F6BX 1MOSA 5LMCA 5CW1A 3U4AA 3TQOA 4GQAA 1G3UA 3SQXA 4Q7EA 3SZRA 5LN1A 5EPUA 5P21A 3HRIA 4RESA 2OFWA 1DP4A 3ABIA 1R0LA 2A86A 3C5CA 1BVHA 2ISQA 3N6VA 3IR5A 4KVZA 4KEAA 4R81A 2VBGA 5HBRA 3FCUB 3CPAA 4KSIA 3S6FA 4UBMA 5BQPA 5GADl 5CM8B 1ZGZA 2RIRA 5K4HA 1A4RA 4KGDA 2FPPA 3ND7A 5IC4A 2QPTA 3ZLUA 3WLFA 2FB9A 3V3TA 4ZRNA 1EP1B 2DZDA 3EVDA 3U1VA 4BFTA 5F3WB 1ZEMA 1QQ5A 1NNI1 1TE2A 2XNHA 2RE8A 1RCTE 4KYIB 3H5NA 3JWIA 4TXMA 1Z63A 4AZVA 1P3JA 1H4QA 2XUPA 3ZJ4A 1J7KA 2X5OA 5CFOA 5B4TA 1Q7TA 1U94A 1DINA 5BSGA 2J9RA 1CY1A 2H0AA 2VXYA 1QVRA 3KZMA 3LKDA 2G71A 1JG3A 2DQZA 4UTRA 4UW9A 1RQ2A 3M6LA 4JP3A 3C6XA 4G1BA 1IXYA 3QEOA 4C20A 3NDPA 4OOFA 2I5PO 1UT5A 2HF2A 1GPUA 2HPHA 1ZZGA 1X9GA 4HLNA 2JFBA 2PJDA 3DPUA 1QQAA 2YIDA 2AR7A 4ILEA 1YS9A 4NI5A 2H6EA 5I4IA 2VQEB 3V8RA 1NSLA 4DV3B 1ZK1A 2NVUA 3C16C 4N12A 4WKCA 1AF4A 3UMYA 4UA3A 5JQ4A 4NGPA 1NMEA 3HRKA 1HDEA 3G8AA 5HMNA 2LXNA 3V4PB 4DG8A 1NI5A 1TYDE 2IW3A 1RWOA 3L8FA 3QVLA 2Q27A 3VZCA 1YWGO 1B26A 4Z9XA 1CUHA 3HV2A 2CIJA 1YS6A 1OXXK 5GGYA 1IBMB 4L6CA 3ZS8A 2QN7A 2Z4SA 3L5OA 2MR6A 2REXB 4Y6GB 3THYB 4CQMA 3CVVA 4L76A 5KNCH 4LC1A 3L01A 3Q9LA 4I9UA 1FFCA 1QRTA 4AL4A 5LRJA 1Q11A 5D3KA 3REFA 1D3AA 3UYKA 1RWQA 2NUTB 4W5WA 5BN1A 4B4VA 2R3SA 4KVOE 3EQ6A 1NQAO 2CLHB 2JCYA 4A6XA 4D4JA 4W5NA 3IELA 3E8MA 3CEJA 1NNSA 1M0WA 2GLTA 3ROPA 2OXRA 4DRZA 1YCFA 5FWYA 1QGAA 3BE4A 5EJ5A 3DM9B 1F17A 1UP7A 4WADA 1LVHA 2QZ9A 1GT91 3TECE 3GLHB 3LWBA 1JP7A 1RVDA 4CDMA 5MF6A 4IIHA 5KTSA 5FYDA 4TRNA 3B53X 4DEXA 1YT5A 1KRXA 3LACA 4EVRA 3L1IA 2XEDA 2PLNA 5IDYA 4CTMA 3ICVA 1DZIA 3FVQA 3QYJA 4KU4A 2OBYA 1YTUA 1D1QA 5L3QB 3EYWA 2UUOA 1ZA2A 3VH9A 2X7HA 3N87A 1GZVA 1Z3CA 3SK0A 4ESOA 3AIKA 3G2JA 5JOQA 4RVUA 3KSDO 2KCWA 2OCBA 3H2JA 2WWVD 3BMOB 3MJSA 1Y4DE 3O8BA 3A2NA 5EHZA 3UICA 3K5HA 2F5IA 4WFJA 3OZTA 2H8KA 5B1EA 3PD1A 4FINA 3AOEC 1ID1A 4IRXA 3B6IA 4WA7A 1EFVB 4O6VA 2Q2OA 5KNBD 3RVLA 2G9QA 2AOVA 1E3LA 2PL3A 1GR1A 4OQNA 4IK2A 3RK4A 3I6IA 1QIFA 4HDRA 1WHTA 1RACA 4CLHA 1CDEA 4FXOA 5J58A 3PQFA 1MJAA 4RLQA 5HFJA 4A31A 3ZIUA 3WGTA 4B4DA 5K6AA 3E03A 4B8YA 5CBPB 3REOA 2HR1A 1OD6A 2RH9B 3IURA 3L8MA 4UHDA 2OXEA 3KXLA 4OM7A 1J8VA 2ZYTX 1Z2NX 2I1LA 3OFKA 3IQGX 2XWJI 2GCEA 4J1QA 2FJ0A 5L40A 1L5RA 4RNDB 4PC2A 5DYIA 3GWZA 4Q37A 3EGDB 4ENWA 1V5EA 2N0SA 3STVA 4EEZA 4M1TA 3BOSA 4MFZA 1K06A 3JSXA 1ZK0A 2AMFA 2OQIA 4JEHA 2P6UA 2IYFA 2ZE6A 1INLA 2GF9A 1AK1A 3F6CA 4LECA 4CIBA 2IXBA 4RVCA 3NGLA 1GEEA 3KB2A 4JQSA 2VBCA 4CKWB 5BQ3A 1QFSA 2QRMA 2RKWA 2XE7A 3N2GB 3JV7A 2V6MA 4M86A 4CWAA 1UPAA 2ZBGA 3WWPA 1XOVA 3RYCA 4CU2A 5CYGA 1OZGA 1C3VA 2VRNA 2WTUA 4RYLA 4C4RA 4IHJB 5EMLA 3RFVA 1Q6ZA 1IIBA 3D43A 4DCUA 4EPYA 4MR7B 2O23A 4NWIA 4N5DA 1YSJA 4PXBA 4CAEA 1V9SA 1KVRA 4KPUA 4FYMA 2RI0A 1EFPB 3UAVA 3TBHA 3LT2A 1NVTA 3INYA 3KTOA 4PAQA 4Q7MB 1OFIA 3ROQA 3HB5X 2X8JB 3PBEA 3D7DA 1LW6E 1SZPA 2NXWA 2ZVQX 3I45A 1LZKA 1XBTA 2QZ4A 4RY0A 2VAWA 1HE5A 1UJ6A 1I0ZA 5CH3A 2VNIA 4E21A 1T5BA 1IY1A 3I9MA 3PIDA 1X1RA 1ZYUA 1L4HA 3HO1A 1P0FA 4DQXA 3L49A 1NM5A 2XNKA 2IZ7A 1WRBA 4QX6A 2QW0X 1CZKA 2QUJA 4ITVA 3M5WA 4DT1B 1C30B 1OUMA 1UBRS 3HACA 5JYDA 3NPAA 5TGDA 5DCLA 2VPIA 3MLBA 4AJJA 4HNAA 3IEXA 1EZ1A 2KJQA 1WEHA 4Z4QA 4NCKA 1RBMA 1CZLA 3IJ3A 1X7GA 2HGSA 4E07A 4WQMA 5AM1A 4DGQA 3LLSA 1RWKA 4WVLA 4IIJB 1G4HA 1WDLA 4ARAA 4C3ZA 5IYZF 4G37A 3DCNA 3K0FB 2PVSA 5AOCA 3PFOA 1C8KA 4KO8A 1EWQA 3AP3A 3DBRA 4RTMA 3FCSB 2C1EA 2WZCA 1T2FA 3NFYA 4LBWA 5JASA 5FUQA 4CDNA 1Z35A 3REGA 3TTXA 3UH1A 1V8OA 4BTVA 4C4OA 2V6FA 3KKWA 2YNMC 4UCFA 3DE7X 3OFNA 3QU5A 4MQMA 4KXQA 3TOCA 2Q5HA 2Q0QA 3TTYA 3FMCA 1Z0FA 2WG1A 3U7FB 4WCFC 3PFKA 3QIVA 5C82A 4XWWA 3BB3A 4Q15A 1LUAA 2ZT7A 3ZNPA 1J8FA 5ERGB 1P3Y1 5T8KC 1BMDA 4W9YA 2DLNA 2NYUA 2YIVX 3LBYA 1MTZA 2AC2A 4TQGA 1PX0A 1W5SA 1KYQA 3DFIA 3OOWA 1V41E 2VYVD 1T1IA 3GV0A 2PU7A 3I23A 3TR5A 2TSYB 3KVOA 4ARIA 2QNBA 3HC7A 3IMFA 3F0AA 1MQ9A 1FT7A 5KYWA 3B7WA 4G0XA 4WZ6A 5ALJA 2CE7A 4M89A 2OD2A 4RFLA 4K87A 3R6TA 4U7WA 3B85A 3WWOA 3R3HA 3VYSB 3IVCA 2BFMA 4RHXA 3FOWA 4EW2A 1FQOA 3Q6MA 4JLVA 4YU9A 1I7LA 1WKCA 1RZRA 1VA5A 4YWHA 3S9MA 1Y63A 3Q3HA 5IM4F 1ZLIA 4OA8A 1PEAA 4GLFA 4O29A 5A2QA 1V48A 1ZJJA 4B71A 4YP0A 2A1TS 1FMFA 2PL5A 4DV1B 4TT8A 4UE3S 2FSIA 2M98A 4ND4A 4Q66C 5DS0A 2RGBA 1WWKA 4OX9Y 4L28A 2ADFA 1B6BA 4UM5A 2OV3A 2G3YA 3W4IA 3BHMA 4IX9A 1OXUA 3AESA 1YJCA 3ESZA 1GGHA 2XCIA 3CXRA 2OECA 1UK8A 4KLVA 4KBYA 2GZHA 4AY2A 3AB7A 2VHJA 3FGZA 5D6OA 5NULA 4WXMA 5ICFA 3OWCA 4W5RA 2J09A 3PXBA 5IHPA 3NIDB 3CRVA 3WMXA 4NX2A 2ZQ5A 2PJ2A 3G2KA 5CFRA 3OM8A 4CODB 1PFKA 3HJBA 1UBCA 3IE2A 3QX3A 4WLEA 1GNLA 3CTMA 3U4CA 2C9DA 5ALHA 1BFKA 1E3JA 1NVXQ 2PA0A 1W5BA 1QH1B 2OHOA 2IHTA 3C4JA 3D67A 5E1BA 4MQEB 3ILXA 4AJ2A 2Y93A 1E8NA 3PUJA 2H9YA 1Y4AE 2OBBA 3NFZA 5AW8A 4XWTA 5CFLA 1Z7WA 2F43B 3F74A 5AHOA 4NS4A 3OTIA 5A4AA 1A4XA 3IX7A 1VJRA 1E0JA 1E9AA 2GO7A 1N7GA 4M8IA 1GGNA 1RPJA 3ENKA 4WDRA 3EUWA 4U6QA 5JDCC 5A6SA 2JIQA 4A82A 2QTVA 1VIXA 1D2HA 2AZTA 4MHSA 2XE6A 4UNQA 2XJ4A 4L3OA 4HH1A 3FSGA 4J8PA 1I4TD 4BNVA 4E2YA 1TGVA 5ITZA 1Y5IA 3NNSA 2ZELA 2DPXA 1TVEA 4EVQA 4BNJA 1ECJA 1DBSA 4OXQA 3RVQA 5AESA 3FZGA 3NBYC 5FKJA 3PC6A 2ZJ1A 3Q2IA 3W8EA 3AHCA 2H63A 1JHRA 2J48A 3OBIA 4J43A 1JU4A 4WFQA 1P91A 1BEEA 2GNOA 3FKQA 2WJGA 2HV2A 3TDMA 1R18A 3PDCA 5FLKA 3GNTA 4IOKA 5I9IA 4X63A 4ZY0A 3VYUB 2FW6A 1LPBB 4IXWA 1DJNA 1GKLA 1QKKA 2EJTA 2OQ2A 4MUAA 5DLPA 3EXHB 4MKXA 5ALGA 5LUBA 3Q3GE 2F8SA 1PO7A 1RM3A 2EZTA 3GU3A 1K4MA 2QR2A 2V9CA 3PNBA 4R69A 3KD2A 2AEJA 3Q3VA 3THOA 3D8NA 1A2ZA 4CM9D 1C2YA 1EI9A 3PFNA 4URUR 2I9PA 5FNZA 4DC9A 4D8XA 2EKQA 2FW7A 3GRCA 4XASA 2QJFA 1SIUA 2WVAA 1ONBA 5LWHA 3QFCA 3MRUA 3MFYA 1PGJA 4D98A 1ZSVA 2IHVA 4DARA 2G4VA 3A7EA 5DI9A 3ESRA 1PQUA 3VWDA 4OHZA 1RFGE 3LY8A 3RGGA 2V74B 4MUJA 2AJLI 4PSAA 4E2WA 3VVCA 4Y6SA 4FIDA 3FRJA 3A70A 1KYXA 3QAYA 2M6KA 4EHFA 5TLSA 2HA2A 1R0XA 2GZAA 2YV5A 4B9EA 3RC7A 4TL9A 5I4CA 5CNIA 5LWQA 1FDIA 4FI3C 4LY3A 3NASA 2REQA 1G3MA 4Q12A 2ANCA 1HC7A 4RZ3A 3EEQA 3TO5A 2PAFA 4ONUA 4QC2A 4KMOA 2YVKA 5TQ2A 4J7XA 1HORA 4WNCA 3AHEA 3RVDA 5IZCC 1C7FA 1R6VA 1XK7A 2HYDA 1GARA 1WSDA 1I2MA 3HDTA 4FR0A 1XQ1A 5HF9A 4A38A 1XPRA 1FA9A 4KOEC 2H5EA 3IGFA 2E55A 5HUHA 1DBIA 1F0NA 2GILA 4HMPA 4ENUA 4D9JA 1KE2A 3TVYA 5CNPA 3GA5A 2PMCA 3RS7A 5DFAA 1QH0A 4WLNA 5BSUA 2VL7A 2FWIA 4MX8A 3WXMA 2UYHA 4MWZA 1VJDA 3UBTA 2II6A 4NDAA 3KT8A 5LA6F 5I5GA 2IL4A 3E5HA 1IJBA 1FX0A 2GIVA 1AX9A 1NQUA 1UBHS 2JEZA 1JWQA 4IGFA 1MO5A 3PX2A 3GMTA 3IEKA 5A3JA 3QVSA 1HQKA 2W2KA 1RI2A 3TVDA 4XM1A 3NZEA 3GR6A 3P94A 1H1TA 3AP2A 3MTIA 1SZJG 3FUUA 4MTCA 5T3YA 3SC2B 1A8QA 5AVOA 2X0IA 3ZDFA 1X1CA 1NA5A 1M5UA 1YI1A 4V24A 1K7YA 3LRXA 2YCBA 1LA2A 2R6DA 1DWPA 4HXEB 3V8QA 3B1ZA 3LQ2A 4D43A 1Z75A 4M1QA 2B78A 3PEUA 3VOSA 1MRZA 4ZOLB 4Q02A 3C5WP 3DBLA 4M37A 4O5OA 4PV7A 4RA6B 4B3SB 4QM7A 5HGJA 1U2RA 1RXEA 5CTAA 4PICA 1FP6A 2ZRDA 2FW8A 1V8PA 1NVVR 3E1GA 4F2WA 5K8MA 4KVXA 2C94A 3OFVA 2WW8A 3ZWNA 2P6FA 4O5AA 4GW3A 1E99A 1Z88A 3GT7A 4AQ7A 2H4XA 3Q88A 5AJZA 4FMPA 4FNGA 4BO2A 1YREA 1FP1D 4PR3A 5H82A 2AXEA 2WPDA 3BB1A 2PVCA 4K40A 2Z3NA 1Y82A 2OZEA 3T7JA 1WZ2A 3KOWA 5HJ2A 2RH8A 5GOZA 5EJAA 1DO2A 2Z2KA 1GZ5A 4MUIA 3LXXA 5BYJA 3H11B 3JQ9A 1BX1A 1S5PA 4Q5IA 2PRIA 2VTDA 4IQFA 2V0NA 3J81A 3SGLA 4ZVUA 2X7XA 2OILA 3I6MA 3K8YA 5F2EA 2JPDA 4K9DA 1SHTX 2NGRA 3RTBA 4WKNA 1LOKA 1SCUA 4P7KA 5EZYF 1S3IA 4OFXA 1UF9A 4NGMA 4Y1EA 4GVPA 1PGOA