2HC9A

Structure of caenorhabditis elegans leucine aminopeptidase-zinc complex (lap1)
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
489
structure length
489
Chain Sequence
TQVLVRNGIQAVGDGLTSLIIVGKKSVLKNVTFEGKFKEVAQKFVTDGDSWNSMISRIPASGRHPLHYELAHLITVPDASSRGNTPTNAHSIYKELKPINYPEDTKNVHFVLFAEYPDVLSHVAAIARTFCKFSMKTSGIRELNVNIDVVCDKLTNEDAVFLTDLSESVRETARLIDTPANILTTDALVDEAVKVGNATGSKITVIRGEELLKAGFGGIYHVGKAGPTPPAFVVLSHEVPGSTEHIALVGKGVVYDTGGLQIKTKTGMPNMKRDMGGAAGMLEAYSALVKHGFSQTLHACLCIVENNVSPIANKPDDIIKMLSGKTVEINNTDAEGRLILADGVFYAKETLKATTIFDMATLTGAQAWLSGRLHGAAMTNDEQLENEIIKAGKASGDLVAPMLFAPDLFFGDLKSSIADMKNSNLGKMDGPPSAVAGLLIGAHIGFGEGLRWLHLDIAAPAEVGDRGTGYGPALFSTLLGKYTSVPMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure and Function of Caenorhabditis Elegans Leucine Aminopeptidase
rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
molecule keywords Leucine aminopeptidase 1
total genus 168
structure length 489
sequence length 489
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2006-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF18295 Pdase_M17_N2 M17 aminopeptidase N-terminal domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10590 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Zn-dependent exopeptidases 2hc9A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2hc9A02
5ELYA 4MHYA 2ZEGA 2RB7A 4MRIA 3TC8A 2WYRA 3D7GA 2HB6A 3S9LA 2POKA 3D68A 1Y0RA 4NGSA 1EE3P 2ZENA 5JM6A 3B2YA 3FECA 2O4HA 4MHNA 2NSMA 2ZELA 1QMUA 4MCQA 3IWWA 4JYWA 4NGTA 2AFUA 3KR4A 1LCPA 2GLFA 1YSJA 3L2NA 5K8MA 4R6TA 3B3VA 3D7HA 1TKFA 4OP4A 2C6PA 2PCUA 4P44A 1JQGA 1TXRA 1PYTB 5HVFA 1H8LA 4OIWA 1TKJA 1F2PA 3JRUA 2BO9A 1TF9A 2Q4ZA 2V77A 1LFWA 4NGPA 3NH8A 2O53A 4G1PA 4IHMA 2ZEMA 1ARMA 2RFHA 2PJ0A 3H8EA 5CPAA 3GUXA 3T8WA 3PRTA 3KASA 5F09A 4DJLA 1AYEA 1R43A 1FT7A 5DS0A 4YU9A 2V8GA 2VL1A 4NGRA 1XRYA 2CIJA 3GLJA 3D7DA 2PE3A 3GB0A 2ANPA 1CBXA 3WC5A 2V8DA 5LRGA 3FMCA 4MCPA 3I1UA 2PRQA 3DGVA 3PB6X 2JEWA 3WC7A 4IAVA 2AFSA 5LYLA 4OC3A 4OC4A 1ARLA 4NGNA 3V38A 4X8IA 5LRKA 3HUVA 4A94A 3KR5A 2PJBA 3NFZA 4PXBA 2PJAA 4EWTA 1TKHA 4WJBA 1Z2LA 2PJ8A 1AMPA 5JGFA 3KI9A 3NA6A 3IIBA 1F57A 2IMOA 2NYQA 4ZY1A 1NSAA 2ZEEA 4X3RA 1YLOA 3S9MA 2IJZA 4PPZA 3KZWA 1BPNA 1QQ9A 4IK2A 1CPXA 3CPXA 4OC1A 2GREA 4P4FA 3IFEA 4OC2A 2XEGA 3KQZA 3D7FA 4P10A 5I4MA 4NGQA 5K8NA 3CDXA 2PJ7A 2QJ8A 4BD9A 3SJXA 1CPSA 2ZEDA 2ABZA 2Q51A 3FJUA 5D8NA 1ZG9A 2PIYA 3D66A 4MHZA 1LAPA 3LMSA 4UEEA 3K9TA 1CP6A 1VHEA 1UWYA 4DYOA 3VH9A 1BLLE 3SJGA 4NJQA 2PJ5A 3H8FA 2WZNA 2XEFA 2PVWA 2F7VA 4Z65A 3NH4A 4GM5A 1Y0YA 5CBMA 3SJEA 1VIXA 4X2TA 3PBBA 2CF4A 5HVHA 1XFOA 5LRJA 4MMOA 4F8ZA 3BI0A 2C6CA 4O23A 4F9VA 4EMEA 4F9UA 5K8OA 1DE4C 2AFMA 3H8GA 5D29A 3B7IA 3CPAA 4WWVA 2OR4A 4KSIA 4OMEA 2F8HA 3KHZA 2JBJA 4JZ0A 2FVGA 3SI0A 4P4EA 2Q43A 3SJFA 3RAMA 1LANA 2EK8A 1CG2A 4UIAA 7CPAA 4MXUA 4B6ZA 3KGQA 4ZY0A 4ZX9A 2C6GA 2QYVA 1HDUA 1Z8LA 2PJ9A 1BAVA 2ZOFA 4MHPA 3WT4A 2G9DA 3WABA 4A38A 1RTQA 3KHXA 4LQGA 2BCOA 1R3NA 1ELMP 2C1CA 4R8FA 2GLJA 2J9AA 2EWBA 1M4LA 5HXDA 5LYFA 4UEZA 4YWYA 3PFOA 3FF3A 3DLJA 1ZG8A 2JBKA 2PJ2A 4MCSA 3PB9X 2PJ6A 1CX8A 2PVVA 4MCRA 3PB4X 1FNOA 1YMEA 1IGBA 8CPAA 4OIDA 4P4BA 2V8HA 3SI1A 2AFWA 3MN8A 1ZG7A 4A39A 3HLPA 1LOKA 3PEIA 3B3SA 3WC6A 4UEFA 3PB8X 3QNVA 1KWMA 4TWEA 1PCAA 1BPMA 4H2KA 2ZEPA 4DUKA 3VATA 2OOTA 6CPAA 3BXMA 2PJCA 1ELLP 1CP7A 2BOAA 3N5FA 3TX8A 4AXVA 4FBEA 4P45A 2DEAA 3D4UA 4OC5A 2PJ1A 2AFXA 4RUHA 3D67A 1DTDA 3FVLA 2XEJA 4PXEA 1OBRA 2ZOGA 4UF4A 3PB7X 2XEIA 4W9YA 2ZEOA 3B3CA 4ONWA 2IQ6A 4ZX8A 1XMBA 4A37A 3B3TA 4P4IA 3SI2A 2CTBA 5IB9A 2CTCA 1VHOA 4FWUA 3IO1A 2AFZA 5J1QA 4PXCA 3S9NA 2AFOA 3ISXA 4NJRA 1XBUA 2ZEHA 2HC9A 3ISZA 4FAIA 3IJ3A 1HDQA 4ZI6A 3FX6A 2V8VA 4NFRA 2PJ3A 1XJOA 3K2KA 4OC0A 3FEDA 1VGYA 2PIZA 1YW4A 1ZLHA 1TF8A 3PFEA 4R76A 1IY7A 3IEHA 5JH9A 4UIBA 4NGMA 5K8PA 1YW6A 3MRUA 1F2OA 1Q7LA 2PJ4A 3NH5A 5HVGA 3PBEA 3BHXA 4P6YA 3V7ZA 2GU2A 4Q7AA 3KQXA 4P4DA 1HEEA 3FH4A 1GYTA 5LYDA 2EK9A 2QVPA 3B3WA 3B35A 3KL9A 4P4JA 4K3NA 3BI1A 5THWA 3VARA 3FEEA 4FUUA 3LWUA 3RZAA 4OKOA 3IC1A 4PXDA 3RBUA 4CPAA 4PQAA 4EFDA 4TNUA 4R7MA 3CT9A 1LAMA 4ZY2A 1Z5RA 1ZLIA 5LYIA 1Y7EA 2I3CA 2ZEFA 4ZYQA
chains in the Genus database with same CATH superfamily
3MMZA 1ITZA 1A9QA 2CFOA 1EDEA 4QUBA 5TMPA 5L6LB 3THXB 2B3VA 1S5PA 2ZEGA 3VJRA 4CQLA 2ZT8A 4GP6A 4JI2B 3BL8A 2D4HA 3I83A 3TFOA 3L77A 3O38A 2J5BA 4X45A 1SD1A 1ENPA 5C8XA 4RK4A 2PUCA 4Q21A 4MV9A 1E6LA 1JSRA 1E63A 1H2WA 1V1JA 3PJDA 1ZD5A 2FTKE 4FS8A 2FFAA 2JHCA 4J0HA 1RKBA 1ZCZA 4H0NA 5JQGB 2P2NA 4LZNA 2H48A 3GGPA 4NXMB 4EB8A 3KWFA 3GJTA 4W82A 1HQYE 5B58T 1CNEA 3TNLA 2J48A 3HDQA 2FJUA 3SN6A 2JD1A 3T1TA 3CZ9A 3M9WA 5KNLA 4KBFA 2NPOA 1JHAA 3I76A 1W85A 1REQB 3Q3IA 1P9WA 2ZBFA 2ZRCA 3L4SO 4Y2TA 3UV6A 3ZZ1A 2JLYA 4YMGA 1CUBA 4QICA 4TS4A 5IAOA 1MABB 3NW9A 1PU9A 4S1NA 3BCSA 2A9OA 2O6HA 1NPYA 5EJIA 1K6IA 4J3FA 2FVXA 2ZXVA 4CYNA 3KWJA 2GLFA 3OG9A 1HMYA 4Q34A 5IZCA 1A7KA 1EG7A 2P6PA 3N2KA 5BSMA 4U9YA 3IT0A 3CZPA 4WLEA 1TUBB 1QFXA 2O8CB 1K75A 1TZ2A 2C4UA 3AR7A 1ZMOA 3QWFA 1R5NA 2XH8A 4RABA 4ZARA 5JECA 3VWEA 4V3BA 2VHVA 5JAUA 5JSQA 4IM7A 3D2AA 4BMPB 3HSKA 2E4ZA 2Z0MA 3F90A 4KXXA 1CJKC 3KYCB 1OHHD 4Q1AA 4ZZIA 1OZAA 5CD1A 2YKGA 3CU5A 5CCDA 3C39A 3PNVA 3NG1A 1MH9A 1WABA 2PPVA 2ZYDA 3PXCX 4FD6A 4IHMA 4MGKR 3A9RA 4B45A 1WZIA 1P19A 1FLDA 1JG3A 2QAGC 4RDHA 4XLTA 2YASA 1HURA 3O0TA 3W5DA 1B16A 2QE6A 3BL6A 7ABPA 2PYIA 1YB7A 2F8LA 4KV7A 3TSYA 3PHLA 4WOPA 5E1OA 1DV2A 3NBFA 4M8KA 5CRIA 1BXRA 5DGTA 3ZCVA 1GZ7A 1RWQA 3VKVA 7MDHA 3IP3A 3D2MA 5A27A 1G7SA 4X8OA 3ZDRA 1U3UA 1HM5A 1HT1E 1OIXA 4IJVA 4UM5A 1T4DA 4WXPA 2PEZA 3P2IA 4KE6A 4ND4A 4C3ZA 3SVZA 2WSYB 3LHIA 2H5IA 1L5MA 1OQAA 1KUXA 2OV2A 4AZVA 3G0GA 1PEDA 2QRQA 3ZU5A 3THWA 1P4HA 4R6XA 4EYEA 1RCUA 2HDOA 5DNAA 3CUTA 1UP4A 1OT5A 1ENYA 1V3TA 4K6CA 2HMUA 4LE0A 1FNMA 2BMWA 3BRCA 3OZCA 5JS2A 1PVVA 1PAUA 2X77A 3KU4A 3NIBA 4JITA 3WNDA 2GO7A 3PYXA 4YRQA 1T8PA 1HDGO 2X9QA 4UMEA 2JI9A 4CGOA 3G2IA 2VAXA 4OKIA 4OI1A 4DADA 2YQ5A 3P97A 1N77A 1I7LA 2G82A 1LS6A 4NBNA 3DEJA 1M6VB 3OPXA 4RA6A 3SF8A 3V6MA 2QD4A 5KQRA 2UZIR 4IDQA 4L8AA 4QOGA 3EZGA 2BKLA 1AZSC 3CE9A 3EY4A 4Y1EA 2H1VA 1VIDA 4R2LA 4Z7OB 1QHEA 1RWXA 1U7XA 4Q03A 1HYQA 1BHQ1 1IMOA 1RZ3A 1A4XA 1IOVA 2OD7A 2VBIA 1XHLA 4FHGA 4XRRA 4EQ6B 2EXXA 4I46A 4L5CA 5J23A 3LS2A 5E7JA 3C7DB 2HXGA 5KYKA 1FS6A 2A7QA 1B26A 5GPBA 3GMTA 2O8BA 1VGQA 4H2DA 4HY3A 1XZJA 5BNFA 3E1GA 3K8YA 2CJWB 3R7WB 1X1EA 3TZLA 4DF3A 1CQZA 2Z0ZA 1U5BB 3N0XA 2SICE 3NT4A 2J9FB 4W5TA 3O92A 5J63A 1WZUA 4K9MA 2ZRDA 4OHPA 3NX4A 2PZBA 2ANBA 2P4QA 1GNVA 3ZXSA 2MT9A 4R7GA 1QOZA 5I5GA 3WIOA 1JHDA 5HJ5A 3AM3A 2EIXA 4RGYA 4EO4A 2Q46A 3HHPA 2DPTA 3NA6A 3E82A 4U7WA 4EFMA 1XQ6A 2WSMA 4GKVA 4IJQA 4KQMA 5JD6A 4CZ2A 2LDBA 5CB6A 1VB5A 3ON5A 1K4YA 5IXYA 5TF4A 2D4PA 2JFQA 4KOYA 2G7ZA 2DFPA 4EUKA 2AK2A 2R1VB 2ZEEA 1NI4B 4I4TA 1YLOA 1Z33A 2Q7DA 4BLPA 3LD2A 1M54A 1V5FA 1B6BA 5BSFA 4IZIA 2X0JA 4LOKA 1KOLA 2G1AA 1COWD 1KYWA 4FIDA 3ROFA 2Q4BA 3ZBQA 5IYZB 1UQRA 2I76A 4OI2A 4OJMX 4RIGA 4RBNA 2FUEA 1Y82A 5FUYA 1R4AA 1OUMA 3NYWA 4A10A 3DCYA 1SY7A 1Y37A 1ZN7A 3UQYS 2ZP1A 1KVTA 3IBTA 1XCMA 1YR8A 1U0LA 2VRWA 1WA5A 4YQYA 3AJ9A 3O73A 1PNRA 1YNSA 3D3EA 3LT4A 3WJ1A 4GR5A 4UZSA 5FYQA 1EXWA 2H08A 1OU0A 2X8BA 3EOAI 1EVKA 3F7OA 3GB9A 3GFRA 5JXGA 1Z29A 1DINA 1E5DA 1SBTA 2PIAA 3RM3A 3KKWA 1ZS9A 1UBRS 2QI9F 3GH3A 2X19A 5AO9A 2MYTA 2D6FA 5BN3B 3ZZ0A 2OO5C 2X6RA 1J8MF 2P90A 2VQ3A 4GPTA 4ZOEA 4B13A 1OXXK 1ZD8A 1DX4A 2HBYA 3PCXA 1PJCA 3ZVRA 4DIOA 3WGVA 4TKUA 1Z4QA 2EL9A 1RU3A 3SJXA 3QENA 4UTNA 4QYIB 1JLKA 1T5IA 3S2GA 5T6BA 1RZRA 3ZGNA 3T7JA 5AXCA 2BMVA 1N9GA 2FN7A 2VPYA 3SXUB 5TQVA 4MWGA 3FM9A 1TVKB 1I0IA 4A8PA 1BMDA 3PEVA 1F51E 4GQIA 3WGIA 1TAHA 4WN9B 4MR7A 4UEEA 1TM4E 1QK4A 3ZHYA 1L8QA 3QVGB 5EJ8A 1ESEA 1DC6A 4PSCA 1B3BA 3FPJA 3GWGA 3X3HA 4DG8A 4EYOA 3WLFA 1ZL0A 4F5DA 5JAHA 2NMTA 1DWPA 3G0HA 1LRLA 2WJ4A 5EIAA 5EPEA 1JQ5A 1NVMB 5DM0A 2GA8A 4KXQA 5EC8A 4KI7A 2K5TA 4YPVA 3V42A 3REQB 1JT9A 4WAUA 1ZH0A 1ADCA 2BZ1A 13PKA 1EZZA 2P4UA 2ZDHA 1G3MA 4UDXX 1E2QA 5C34B 4CN9A 3VR5D 4BRUA 4QARA 4KZTA 4LDNA 2P4EA 2ZSJA 2ZXEA 2RB4A 3C6QA 1NP6A 4I9NA 5TEWA 3DTNA 3ZK9A 1VPDA 5IJ9B 2LE0A 4M22A 1KRHA 1ZIYA 2CXNA 3M2PA 3BFVA 4D4GA 2BHTA 2Q99A 4E22A 4KTTE 2HRZA 2WYVA 5DTMA 3THXA 1U99A 3L7CA 2O8BB 3RGWS 1WDWB 3E7PA 2WJ6A 1YDFA 3GXOA 4OF4A 1NBMA 4KYUA 4N48A 2ZUTA 3QHQA 1CEYA 1N2OA 1XXHB 1X1DA 3AVTA 1TE2A 3GT4A 4KO4S 1K63A 4XUCA 1ZC4A 4XI9A 4C2AA 2IE8A 2FPWA 3QLTA 3DBRB 3U60B 3OQJA 2FJ0A 1A2BA 1ZESA 1JE1A 2WF7A 1W94A 3KB8A 3KO8A 4KJZA 4QOFA 4B3JA 3TG2A 1UOEA 2VHTA 2ZZKA 3MJEA 3TEMA 3HBMA 1WS6A 3T34A 3PDIB 5ESDA 3SHFA 2GBPA 4XQEA 2A67A 5AW3A 4ZI7A 5EPUA 4A2QA 4YCMA 4L5IA 2Q2NA 3AEQB 4F9EA 2VKQA 4ISCA 2FP4B 3UYKA 3Q0EA 2O07A 2Q6KA 4I8XA 4BNXA 4MKRA 4LVCA 4DNQA 1IY8A 2P69A 3IMFA 4DQXA 2E7ZA 4US2R 2EO8A 2F4NA 1ISRA 4QU8A 2AQHA 5F1PA 4MYCA 3DOEA 1JJVA 3FBWA 2YHSA 3W90A 5EJ9A 3A6PC 3PD1A 1HWYA 1KO8A 3MWFA 3QVKA 3R1KA 4UUNA 3WK8A 4EG7A 2I00A 1PDOA 2VJPA 3RNLA 2HA6A 3GLGB 5GJBA 2CBGA 3JR3A 4NXNB 3SNHA 4Q3BA 2J5KA 3IVXA 1XMIA 1BW9B 4NSNA 1RD4A 1T26A 1UBOS 5DLQC 4O25A 5FR2A 4KIWA 3W4KA 3L9WA 3OQNA 3K8OE 4NP6A 2A9VA 2IE0A 1YB4A 3M4JA 3BYZA 3ZWKA 3CUVA 2DBYA 1PFVA 4NQZA 1OWLA 1N5OX 5I7SA 1CWUA 5EEGA 2QRNA 4KPEC 1SIOA 5G0UA 3GRRA 2WIDA 3OX2A 4QUAA 3RS2A 1JAHA 1IZZA 3EVBA 1V48A 3TM5A 2HF7A 1RKQA 2WJGA 3GNTA 1Q0LA 4ZZ2A 4EBFA 2Q4YA 1LOKA 1CQPA 1P6UA 2PR2A 3ENWA 4HVCA 4X85A 2GAFA 1PR2A 1J0XO 1PFUA 1J33A 5E3JA 2FX3A 5SICE 4MCRA 3KLNA 1CX8A 4JKOA 3TR5A 4CDNA 4N7MA 1L5NA 1GPYA 3JQFA 4Y9SA 2VJYA 3PB4X 4DRYA 9ABPA 5EHNA 5H8WA 4R16A 3CT4A 1WUJS 1BVHA 2ORED 3BH7A 4PM4A 3TW6A 1A7AA 4KXLA 2FG5A 2II6A 4NCNA 1KFJB 4C0SA 2PKYX 2ZWIA 3JRNA 4HAVA 1JEYA 4CIYA 3THYA 3JQGB 3P4XA 4G37A 4RMGA 3ICEA 1G5FA 5IM5A 4EX6A 1B6SA 1IOZA 5KYYA 1A5AB 2CVZA 3CUYA 3LY5A 3SX4A 4DKXA 1TM3E 2TYSB 4FW8A 5LQSA 3B9RA 3TX6A 3O75A 3KZ1E 1YR6A 4KVAA 4HK4A 5K4AA 4TWEA 4MWEA 4E4YA 1I2AA 1ZM7A 3PHCA 4NCKA 4QBIA 5CEFA 1K1EA 3FJYA 4PC6A 1YA8A 4WLUA 1FP6A 4Y67A 5CLIA 2YVQA 2OORC 4C0QC 2J41A 4YALA 3BL5A 4EKYA 4UD6A 4DUKA 1G8GA 1DXYA 1JJIA 3PIDA 3D2CA 3RYHA 4BRZA 4J3NA 1X1QA 5B53A 3S40A 2UYGA 5CB4B 1KMHA 2IP4A 1VHWA 2G0TA 2EYUA 1PZHA 2ACKA 2VEZA 3D6MA 5AI6A 5COAA 2IEYA 3GG2A 4OSOA 1P7YA 2QI9C 2OU2A 2ZI6A 5JMTA 1GADO 2P68A 1RXIA 2QNRA 3FSJX 1WP4A 1YT5A 1JDNA 4MUGA 1E3JA 2OR3A 5HBRA 4EY3A 2DUWA 4J9UE 4IIFA 4PYQA 4RUHA 1K3TA 1UK8A 1DTDA 3T9FA 2FQQA 3CM0A 2RG1A 4JJFA 3RB8A 2PEYA 3FVLA 1OZPA 1HL3A 1GWNA 3BDVA 4E1VA 1OPXA 1BNCA 1C1HA 3ZY3A 4BEWA 1XQ1A 3ZE2B 4GOLD 2Q9CA 3DZJA 4PYKA 2X40A 4MWTA 2ZG6A 1GCAA 1COWA 2IEZA 4C0HA 2PUGA 3NU1A 2I6QA 1A9YA 1H2BA 2Y1GA 4U0JA 3K0SA 4MS3A 2YHUA 4N6GA 1O0CA 1GUAA 2CWWA 3X1DA 1X7WA 3EDOA 4RLHA 3BXEA 5TPWA 2FE4A 3SYKA 5JWOA 3ZZTA 1JAIA 2JGLA 2X9GA 2F48A 3GL9A 4Y2SA 4PSXA 4EG3A 1QZUA 4RVFA 4AWBA 4B76A 3DTTA 3WRWA 5E3HA 4XQ0A 4OJQA 4WINA 1O9GA 2FFRA 5U1PA 3JQBC 5ITWA 1SK8A 2IH5A 1WLYA 3RD5A 3WK6A 1QHNA 4BKOA 1AQLA 2JIZD 5EFZA 3LJKA 3MQFA 2C58A 4PXCA 3HBLA 2HCTA 1YZHA 4GPEA 2EYQA 1ZVMA 2UZ1B 3C14C 2VNHA 3L7OA 4FFMA 5LZ8A 2M6RA 3H5NA 1WF3A 5KDLA 2A1TR 1KIAA 4IZ6A 4JI1B 2A58A 3WLIA 2A5GA 2O54A 3WLMA 4CV0A 1UMBB 3IDZA 4NTZA 2CNWA 1OBCA 3RRMA 4L8WB 4MKZA 3BWCA 2DUUA 2X23A 1SC9A 2PSDA 3QZUA 4FYJA 4EB6B 4NOLA 3TOVA 1UBEA 2ZT7A 4M1ZA 1VKJA 4WZAE 1MNQA 3MF4A 1JIKA 2DEUA 1ZOIA 3MT0A 1OXVA 1RHQA 1ECCA 5ALRA 2R9VA 2N1MA 4DDKA 1G5PA 2PS1A 3OJEA 1XTQA 2FI1A 2A33A 4XIJA 2PX0A 3HVJA 5FBQB 5CYFA 4EJSB 1FSZA 1VP3A 1U0RA 1X7YB 2P65A 3N7TA 4RVSA 4UDOA 1XBTA 2GDZA 3NASA 5EZYF 3MRUA 1KOJA 2AHOA 3I09A 4IHJA 4DMUB 3BMXA 1PGQA 1P1CA 3H5RA 3IO5A 3O91A 5TT1A 1WXFA 1K4MA 2YN4A 1S2NA 2EJBA 3NUQA 2IL4A 2IX9A 3ESRA 3ZKAA 2PKEA 1PX2A 4R54A 2J6CA 3KQXA 4KRXA 2XXBA 1XPJA 3QG5A 4NG5A 4MDYA 3A4VA 1Y1KE 2JL1A 2ODAA 3BJRA 1W29A 3ZHXA 4ROTA 3LQYA 4RJIA 2QVPA 3FNQA 2PBFA 1YBHA 4RVDA 1U5AA 5DYWA 3VWDA 4F9TA 1QIKA 1OR8A 3HY6A 4N5IX 3SIWA 3UMRA 3CLSD 3K1AB 1MDBA 4JAVC 2Q1TA 4ZVKA 4N4AA 1VPVA 1FU8A 1DJOA 1P61B 1WIWA 2CK3A 2FH5B 2FUNB 3D6JA 4D3XA 3TRHA 4U2FA 5BYJA 2W2KA 4BNJA 2PWBA 2R2AA 1PJQA 4Y7CA 4FHZA 3U6KA 2AUNA 1USIA 1NGSA 3L7IA 3DV0A 4DJEC 2UZ3A 4HVLA 4DNCA 2GM5A 3GRFA 4TT3D 2ZW7A 1Z8DA 1HV8A 4PF1A 3L5OA 4QHTA 4FVTA 4MZDA 4ERXA 3PQ8A 3I2FA 2HREA 4L0CA 4OD0A 4B31A 4ZICA 3E3MA 5DW3A 3FHTA 3KFLA 2OFPA 2VJMB 3OUUA 3PUVA 4IIJB 4US0R 2FEXA 1NMXA 3D4OA 5ERYA 3I61A 5LYIA 1F0NA 1R6XA 1RLMA 5JG7A 1N3YA 4Z7JA 1LA2A 4ZYQA 5CLLA 1PJ2A 4ZVTA 4KAFA 1YR1A 2ZR7A 3DDSA 2JB9A 2OTCA 3E9EA 3ET5A 3FNHA 3KKEA 3LVRE 3OQ6A 1P1BA 3HJFA 5EIBD 1QH0A 1FSSA 1TZBA 1HA3A 3KKQA 1QCCA 2WF5A 4JOCA 4FYPA 2BC9A 4H08A 4MW9A 2EIHA 1C4OA 1P2UA 1OAOA 2KM1A 2Q4OA 1TRKA 2WHXA 2Z3WA 3GZTB 5JFGA 1A8HA 3TMKA 1WBBA 3L0BA 1ILWA 5B4TA 1MNAA 3WL5A 3JQ9C 2CNTA 5JSKA 5AVXA 4KFCA 4HDRB 2PZEA 3W8DA 3E8SA 3FNEA 2C5HA 4YROA 3GGCA 2OYCA 2FPKA 3SLRA 4JBXA 2WT4A 3BQ9A 4CUZA 3KQUA 3FUCA 4LJ9A 3HYCA 5FB3A 2GEKA 2VT3A 3PFHA 3PGPA 2ZUVA 4WNIA 5HK9A 2VC2B 2C7VA 2Z04A 3VU1A 1JDPA 1NBMD 1V3UA 1B42A 1SU8A 3Q7PA 4PNHA 5K0GA 5FWYA 1XKQA 4QJ3A 1EX9A 3KXPA 4ECAA 1E1LA 1I0LA 1QPBA 2Q3CA 3VR0A 4TKZA 4ARUA 4C87A 4CDGA 1TLLA 1PE0A 1UBUS 2QTRA 3DZKA 1OFUA 3I64A 1PN3A 3PJEA 3PLNA 4ZVVA 1XPRA 1CDEA 1G8AA 2YYZA 1MRZA 1BAPA 3LV8A 4KIJA 5EMKA 3AR5A 4C1NA 4J07A 3H2ZA 3QWAA 3TQFA 3K20A 4ENSA 1RTTA 2NQ2C 4Y0VA 4HSGA 2C95A 4E88A 3IXQA 1Q0RA 3ZPXA 1AA6A 3OWCA 3AO0B 3AF5A 4JH0A 2DFTA 1E32A 4F6LA 1MQAA 1KK2A 2D3WA 2FPXA 1QUEA 3JQ6A 3PUJA 5A3RA 1J5EB 3WZMA 3DNFA 4CKXA 3PCRB 4RHTA 5JNSA 2Z3LA 3LDUA 3ZGLA 3TUJC 1Y80A 2ZRQA 1XZAA 3LL4A 4CNBA 4Q1CA 3LTNC 1XRNA 1ZX1A 2C0CA 4R1PA 4BUZA 4WJKB 3OICA 2HF8A 4MS4A 4UULA 3TTSA 2AJCA 4MUMA 2CIJA 2VPIA 4BMSA 3OEEA 1ILEA 1U0HC 1T0BA 2NUBA 3Q3JB 1UMCB 3FZEA 2NO5A 4PX2A 4WKNA 5TVGA 5HZMA 1Z2NX 3EDCA 4D9HA 3GA5A 2JI4A 1RXTA 1UPAA 3TCKA 1MJ5A 4QPCA 3WC5A 4M54A 1YZFA 4R2KA 3COJA 2CZQA 2VQEB 1N4DA 1E66A 2POCA 4A0HA 2EGGA 5CNPA 1V71A 4CHGA 5ECDA 2Q5JA 1LBIA 4UBIA 1VCOA 3SHOA 5JH7F 2FKAA 2OV3A 1JZSA 2UUAB 1ZA2A 2FXVA 2QVXX 3IEXA 1RVV1 1ULHA 2GZAA 2YXLA 4YQZA 4C5CA 1ZGJA 1E9AA 3GO4A 1YK1A 2SNIE 2VUTA 3G7UA 5BN4B 2JLSA 5TJ9A 2YWJA 1X80A 2SCUB 2PLFA 1JE0A 4IOKA 1AZTA 1G18A 1R0YA 2OCKA 3O2SB 4QREA 1G5HA 1NURA 2B4RO 1N3BA 2WU1A 4S0ZA 5EYPA 3L6RA 4UXHA 5LZ7A 3TQQA 3O3NB 3EB9A 4K28A 2RH4A 4Z7NB 1VKCA 2ZJ5A 3IODA 1X1AA 5H3CA 4K8RB 1HDXA 4IJ5A 1WXHA 1RE0A 4DM7A 4M6WA 1MIHA 1G0NA 1VHLA 1O77A 1NJ5A 2AT1A 2EEPA 4BP9A 2Q1UA 2HK9A 1Y3AA 1WBDA 3NVMB 1ORWA 3ZK8A 3P52A 2OCDA 4PZUA 4S24A 4ND6A 3EGIA 4EECA 2XZPA 3QQ5A 1ULZA 2V5UA 2WAMA 3DH0A 3KQNA 4DWOA 4B12A 3GKRA 1P18A 2AYZA 3HJHA 1RLTA 2UYYA 3L0DA 4C03A 5KMGB 4II2A 4MW7A 4R4JA 1UAGA 2I6FA 3LYUA 4ON9A 1BKSB 1UUFA 2CHFA 3NHLA 5CM9C 4Z4FA 1VP9A 3E5HA 3OOYA 4PXSA 3W7AA 2ASVA 1KEPA 1FFEA 4YAGA 3JQ7B 4OHKA 2FE7A 3KQKA 1I51A 3BWEA 3ELWA 3GK3A 2FP3A 4MWCA 1PYGA 5TRTA 3CXUA 2AD1A 2HFKA 3JVIA 3MTBA 5D8DA 1Y5LA 1VBFA 3NOQA 3ZV7A 3IAHA 1BPNA 5F64A 3K94A 2ZIVB 3EHDA 1ICEA 5E7QA 2GQ0A 2ZSAA 4AY6A 3FMVA 3QXJA 3QNUA 1GGVA 4DR4B 3OCWA 1Q7GA 2FCRA 2Y1WA 4EPXA 5LJLA 4BFXA 2I2CA 1NU6A 16PKA 2ZTLA 4J8PA 4R68A 4M55A 4GLJA 2J8NA 4XQCA 2D1TA 5C3MA 1V35A 2WM8A 1R4NA 3FAKA 3E8XA 3AYXB 3OJWA 3PYMA 1E2LA 1FNSA 4D56A 4N0EA 3GBVA 4A15A 4PZYA 1OH7A 1QLWA 2BUEA 3CDXA 3P4UA 1T4BA 4BKUA 2IIPA 3TEJA 5LLTA 3IJRA 3GFQA 4KH1A 4CL0A 4YMLA 3K0CC 3VI4B 4Y0AA 1CUZA 1Z4EA 5CG2A 4DIMA 1B7GO 1ZNYA 4FN4A 3KPUA 1X7WB 1MF7A 5TPWB 5C7IO 4DV1B 4PU0A 4E46A 2PIYA 2H51A 3P2YA 2F8MA 2FX2A 2AE1A 5HF8A 1HDOA 3P94A 2ESRA 2IXDA 1LAPA 2YUTA 2PTHA 1GQ2A 2QGZA 3K5WA 4JL8A 3FOFC 3MK31 4K6OA 3TRIA 4KWTA 5B12A 1TF5A 1V4VA 3IPYA 4KVGA 1H3NA 4R1UA 1L1QA 4UASA 1DAEA 1JHMA 2Y4NA 5G4KA 2BBWA 3P2JA 1Z74A 3A1TA 2JDCA 4A23A 2QNIA 1CIPA 1E5XA 1HRDA 4Z2YA 2P91A 3FHOA 2O14A 2P6EA 3DEHA 3KJQA 2ZBPA 5G0VA 4PRYA 3DV0B 2BFDA 3SYRA 4XVUA 1R9JA 1WZNA 1OX6A 2B35A 2FNAA 2GHTA 3WRVA 1DKPA 4PN3A 5C7YA 4P0QB 2HJWA 4UFPA 5EXTA 5KNDH 1F2UB 2O50A 2QJ8A 4GIBA 1S9HA 2FG7C 4ZCQA 2IYPA 3C98A 1CDZA 4LJ4A 4IDOA 5L4LA 1BVYF 1ZYUA 2I22A 3BTOA 1AHPA 5JOQA 1N57A 4OHUA 2PJDA 1A4RA 4M85A 4TLCA 1RI3A 5FPSA 3YASA 5HVHA 1TMYA 2ODTX 4TTAA 4HG2A 1K9SA 3CY6A 5EWLB 3TB4A 4QQRA 3WP0A 1TIPA 4RU1A 1CSEE 3QAYA 3UHFA 3FMGA 1OFIA 3ND8A 4I4IA 2ZJ2A 5DISB 5JI3E 4QXAA 4Q4AB 1NULA 2IT1A 2D2FA 2WE8A 4S35A 4M9XA 5JVDB 3LMKA 2IX3A 1TCUA 3IP9A 3PNKA 5L7WA 3A9CA 3OT5A 3R3SA 3DAHA 2F8HA 3KHZA 4ZC8A 4N40A 1VOTA 2K87A 3IJ5A 1MAWA 2V7QD 3TQOA 1A8IA 2ZE7A 3VO2A 1ZNZA 3HB1A 5C5DA 3R3HA 4OK6A 4U00A 1GG5A 3LTEA 5HCUA 5BYAA 3CF2A 3VJKA 3O8RA 4A31A 3QFCA 2ZAOA 3LKBA 1O4VA 2YXDA 1RAFA 3PE6A 3RSHA 3B85A 3HNOA 2WE7A 3JALA 4ZMSA 4E2AA 4UDYX 1MABA 4EG6A 2RHJA 1E99A 4LGYA 1OTYA 1JSLA 3LUBA 2G70A 2CXHA 2PS0A 4GOKA 4LK3A 3EZ2A 3BT7A 3WR5A 2UYOA 3CNOA 4IIEA 1JSXA 1RTQA 4JK3A 3DF7A 2XA2A 3TNJA 1KU0A 1QDUA 4HNRA 1Q3HA 4RLFA 2BKEA 2WTAA 1X9IA 1Q14A 3NBZC 1UJ5A 5J59A 3V34A 1Z8LA 2NU8A 2PZ8A 3K53A 3I01M 1AUOA 2XR1A 5LYFA 3RVKA 3Q6MA 5K8UA 3M3HA 5C5EA 2PX6A 3QHPA 1R27A 2XXAA 3GUUA 4FFWA 5AJXA 1XD8A 2Z2XA 1CZRA 3NAZA 4K3VA 2XKBA 2XVAA 5AK4A 5ES4B 2L2QA 3CUEF 3B7PA 1CJSA 2R62A 1FBTA 1XD9A 2W90A 3I5UA 3VDNB 5AW5A 4PX5A 1OZ0A 1W87A 1Q95A 2V54A 1E3TA 1E9EA 2XDQA 3K1TA 3NXKA 4IY1A 4K6HA 1S89A 1OH6A 3G89A 4NY1A 1NN0A 3O9VA 2PJ6A 3L8EA 1BGXT 3JU3A 2G71A 4TTVA 1BWPA 1LV8A 3GFVA 2B1GA 2O57A 5F33A 2B8JA 3KYIB 1C4KA 3VOSA 4C14A 3C4QA 4DLLA 4KSAA 1E1RA 3HDYA 3Q7RA 4G9BA 4AJOA 4YRZA 1KQPA 2I3BA 3A7DA 3JQEA 1MLDA 3N7UA 1MGOA 1EUCA 1C7RA 2O0HA 4RXTA 5FWYB 4YYEA 1Q12A 2OZVA 4MVWA 3PHJA 4MGHA 4QBFA 4Q9IA 2VQSA 2V0CA 4PSUA 1I8TA 3TAHA 3I9MA 4OQPA 3ZXUB 1EGVB 4HRVA 5ER9A 3U3DA 1GHEA 4EL5A 3GRUA 1MX3A 2WICA 1TJ4A 4ZU1X 4B3DA 2ZJBA 3HO6A 1JWAB 2NWQA 3IPAA 3LBIA 4WCFB 4TSKA 4HPSA 2CY0A 3THRA 4LV8B 1SBYA 5E3IA 4DA8A 3NTUA 3WE7A 2UYCA 5CFPA 5HJEA 1CUFA 1G1MA 4TRMA 1KKUA 4HTFA 5LZ2A 1XPOA 3B8HA 3IP5A 3JWGA 3DUWA 3S2SA 4CGMA 1YSCA 4BQIA 2G6TA 2MSDB 4ED9A 1DBQA 1B73A 4KIGA 4PG8A 3EX7C 4JDUA 4RHCA 5LLDA 1EJ6A 3JW8A 3K35A 3P2EA 3PPXA 3IIIA 4FW9A 4HH3C 4OHRA 4U7HA 1E0JA 2R79A 5T8KC 1BVUA 3VYVA 2FDXA 4D6YA 1O8CA 1G60A 5BN1A 5I8WA 1KYTA 4XCQA 2PKXA 2J9FA 2DBRA 4HZUB 3ZWCA 5KYXA 2AA3A 2GCIA 1BYIA 3GGOA 5SZJA 1SQ5A 2XYGA 3NGXA 1OW3B 1YU6A 3EASA 3UT5A 3WFZA 5KOHA 4G2NA 5A7HA 3Q8KA 2IZ0A 3UPTA 1Y6FA 1HH4A 4DJAA 1GKUB 1NYLA 3KB6A 2PFSA 1FEZA 4HMOA 1NRIA 1TA9A 5CMLA 3BCRA 3PXAA 5FWXB 3DC7A 4W7HA 3UIEA 1R88A 1JR4A 2Y77A 1L2TA 4UHEA 2XODA 3KSZO 3VM6A 4HS4A 3K32A 5JBNA 3H84A 1BOFA 4PAOA 5D5HA 1MW9X 1X77A 3DE2X 1ZI6A 1KJNA 1NW6A 3BFPA 5KQPA 4D7AA 5HNKA 1YQWA 3QSYA 4ZX8A 2AZDA 2CCGA 3JQ9A 1MN6A 3QKSB 5TX7A 3WFIA 1FOEB 4GMDA 1PJ8A 1RYNA 5KIAA 3KZXA 3CX3A 3QBTA 2W22A 3QV1A 4Z4CA 2W6MA 3KYDB 1ONSA 3C3CA 3P9XA 1DC4A 4NZZA 5EXPA 3HVKA 2PRJA 3LHFA 4K7JA 4RENA 2QTWB 2YMLA 5ESRA 2BV3A 1C81A 1DEHA 3G8BA 3C6XA 1B2LA 4KDEA 1RCTE 2OHJA 1QQBA 1YBMA 3UCFA 1XTBA 3RYIB 2R68A 1RYYA 3FOCA 1NBWB 3JQ8A 3OFJA 3ROEA 3WNCA 4UWJA 1C80A 4G5FA 4X9XA 1NLFA 1A8SA 1F20A 4FMDF 1T36B 4Q7LA 4RDCA 1W47A 3MERA 1GD1O 5PGMA 1SZJG 4NZ9A 4D5EA 3CXQA 3PF9A 1TYCA 5KJ1A 1G6Q1 2LW7A 3LWBA 4DTCA 1KPGA 2J3MA 3R3WA 1XWFA 1J23A 2JCXA 3IWGA 4RNDB 4AKGA 2YYSA 5CDFE 1ZUNB 4GMXA 5LWHA 2ZTMA 2AQIA 3AETB 3JAKA 4J4TA 4P4SA 4N5DA 1V2HE 2QMZA 5AJWA 3T4UA 4AMVA 4ZHQB 2XY4A 5FEUA 2ZUUA 5E4JA 3T9DA 2P0EA 1BZYA 3NHSA 1ODIA 1W8IA 2RGDA 3MT8A 3RANA 4A4DA 2AYYA 2YWRA 2Z09A 4N3BA 5FX2A 2I3DA 3ETEA 3NHKA 5ADHA 3GLFE 1YACA 2JJMA 3N07A 1OHHA 4ZTZB 4QU9A 4PRKA 5HVGA 5CP8A 2R751 4XVHA 2IODA 2LNDA 3HZRA 4ZO4A 4DPKA 3U5ZB 3TWOA 2OQRA 3H75A 3FLBA 3P2MA 4CL2A 1NOIA 1JXAA 1E62A 2C7GA 2PHZA 4LDJA 5B5SA 4EKGA 2R8ZA 1ZEMA 3UHOA 2G4VA 3NE7A 2B2XA 3LBNA 3BWYA 5JYEA 4QVTA 1TUBA 4DDMA 2WDZA 2RHLA 3L8HA 2IZ1A 2BL4A 3BWXA 4J2HA 3WRXC 3E15A 4ILKA 3BJ7A 1WX1A 4KRYA 4H17A 2O8FA 3OO1A 1SXIA 3M4ZA 1XCLA 3CTPA 1CG6A 3UUWA 6AT1A 5D3MB 1RKVA 3LOPA 4DLBA 1R5JA 1TT7A 5JQGA 2JLBA 3U39A 4OMCA 2Z3KA 4XPDB 4LYGA 2IUYA 4AU1A 2W6JA 3PGVA 4JR1A 4ZOLF 3VR4H 3P71T 2PL9A 4PR3A 2NIPA 4TVKA 4R7MA 1PGOA 4YO8A 3OJXA 1Z5RA 5KX5F 1EG2A 3WHLA 3ZS9A 3QRWA 2IWRA 1EWQA 2FMKA 3DHVA 4LN1A 2CXOA 3IAUA 4AY2A 1J39A 1JEAA 3GRCA 1R16A 1KMMA 1THMA 4WACA 3HHEA 3F5FA 3T12A 2FGKA 3CT6A 3SZGA 4MRIA 3LPCA 4QOSA 1Z26A 3RABA 3ZD8A 3IS3A 1XAIA 4MWZA 5D1HA 4UUOA 1CRLA 1QE0A 2HX1A 3H7IA 4KQGA 2MTBA 1XNRB 2X8LA 2Y2VA 2QVLA 3AV0B 4YB8A 3O4RA 2QE7D 1TC2A 3VTAA 1SNYA 3AEQA 1UJ2A 1WMBA 3CLVA 3E9MA 1YE5A 4X8HA 3U4QA 3B6EA 4LHSA 3HXOA 421PA 1A9RA 3MLEA 3SLGA 4XXHA 3PPYA 1I3NA 1X70A 1XRLA 6NULA 4TV9B 1UP7A 2PRYA 2WIJA 3EVCA 1N2EA 1Y6JA 2ODEA 1OLOA 4MJXA 3CISA 2KBEA 1JYFA 1K27A 1MO2A 1Y0BA 3PXDA 1IIRA 3ZWVA 4DMFA 3B20A 5KDDA 2Q0HA 4R9VA 4RPIA 1U9JA 1WTCA 2FQYA 1ZOPA 2HEGA 1X7HA 5IKOA 1XUOA 1ODKA 4EHHA 2ERCA 1Y6RA 2B8NA 2GA9A 4LOJA 3OA0A 2CK3D 2Z10A 5KTCA 2VPTA 2Q3FA 5J8FA 1PRYA 3OKPA 1AK9A 1E3DA 3W2FA 3ZQKA 4N03A 3B3VA 3DG9A 2XE4A 2ZI3A 3T52A 2A0YA 4EYGA 2M1XA 3BH6A 3EYWA 1ECJA 3HR8A 2PCUA 4OP4A 4AKHA 2FUG6 4LFAB 5E7IA 3V2UA 3RVOA 1H2ZA 3DD5A 4CG3A 1NX6A 1VL8A 1M8JA 4BWGA 4RS3A 4MPPA 2W2LD 1MFZA 1KFKB 2ZYGA 2P9EA 2Q5LA 3U4CA 4YCAA 5CXXA 4LYDA 1BX0A 5KWVA 5A1TA 3W5HA 2YWFA 2C7QA 2B9VA 1FJHA 3AUKA 3LE8A 2Q5CA 3L0SA 4P7GA 4H1WA 3IEPA 1T8WA 3RKRA 2YJTD 1RI1A 3MIZA 1DXHA 2W6IA 4J16C 1IIBA 5ICGA 1KSFX 3KPWA 2C9YA 3FPEA 4C88A 5L4NA 2Q9BA 4XPDC 4BAZA 3D4IA 4GXRA 2C83A 1BSVA 2DLDA 1AIPA 4HLCA 4TMVA 1GGMA 5KVCA 4XYBA 4NE9A 4AQYB 3H4MA 5JY6A 2CKDA 4EYSA 4WBNF 3ZJ0A 4GI7A 4WKBA 2W70A 3UXMA 3GAMA 4W8OA 5D3QA 3M49A 1RS0A 1R43A 4LBWA 1JEQA 4M83A 3RIGA 1CLEA 3WTCA 3JD3A 3UMFA 2ZXFA 1L4NA 2PX5A 3KAKA 4R9MA 3AY0A 3HZHA 4CKWB 1RIIA 2CNWD 3S1LA 1ZDMA 3TSOA 1F2TB 1I1NA 1PNQA 2GTIA 2JZCA 3EC1A 2JEZA 4QVIA 4RKEA 1QP0A 2Q4DA 3WICA 1N1EA 1RI5A 2PMBA 3G2KA 5DCWA 2IUEA 3ERCA 3QUAA 1KP2A 2G1PA 2XGGA 2GZ1A 5AVRA 3UM9A 3R5XA 1FLAA 3ZW7A 2ZRLA 4V0RA 2IZOA 4C68A 5AG4A 3UKDA 1R66A 1UC9A 1P7ZA 1ZU5A 5F48A 4R2JA 1ODSA 4ZANA 3E3NA 4B73A 3B52X 4R71A 1IG3A 1T2DA 4ITRC 4ENVA 4V1CB 5DHSA 4LHVA 4LYFA 1WE2A 3OWHA 1LBQA 2BFAA 4UUQA 3VPGA 4CU2A 2EZUA 3W4IA 4OX9B 4KDCA 4YUVA 2X3YA 4LCEA 4RADA 3MGCA 3RSCA 2FT0A 3OIWA 2FFBA 3ZIAA 1AHIA 4KWHA 4YRJA 4UEQA 2Q3BA 1MK4A 4F1WA 1P9OA 4A0RA 1WW2A 2DPXA 2OYSA 3ITKA 4EKIA 5CX4A 4K9RA 3PFGA 1AGNA 3FPBA 1W5EA 1MT3A 1SUFA 1U4SA 3STHA 2FVYA 3TDMA 1VIAA 1VE1A 3P27A 4RMNA 1WUTA 3CR7A 5GM2A 3THSA 3MLBA 4HDKB 3WXBA 4TXJA 4X00A 1PDWA 1IZ8A 1EK1A 1MHPA 1SKAA 2XXJA 2YJ3A 3QKWA 4G5RA 5DBFA 3H18A 4MRNA 4YH1A 4ZEOA 1Y8CA 3ZLVA 4BX8A 4CKZA 3QB8A 1T1SA 3W8EA 3QQPA 4IIUA 4EY8A 1ZM2A 1FPMA 1RM5A 4IP0A 4PNZA 3BJIC 1PVOA 2G3AA 5JQ4A 4RK7A 5LOVA 1KMQA 2ANCA 4QDTA 5C51B 1PFWA 1N0HA 3GJ3A 3AF3A 4LC9A 4FB4A 3Q9SA 2C2HA 4U2GA 1OYWA 1PZXA 1YVEI 1BYUA 3V4FA 1AMUA 2WB4A 1GNRA 4TLMB 3UWKA 3ORRA 4TM7A 3ETDA 3ITEA 3O1JC 3L7KA 3NHWA 1C0EA 2QX7A 4OXQA 4QD3A 4G07A 2Z4SA 2ZI5A 1T9ZA 2C9DA 3TK1A 5CIYA 2FEOA 4GLLA 5AK3A 4BO2A 2XCTB 4LQ6A 3V8IA 4YGOA 5DNWA 1IJEA 4CCYB 1II0A 2P2DA 5F35A 4IDHA 4F71A 4YP6A 4JWPA 3Q15C 4KAXA 3SZOA 3I30X 5CLHA 2A3NA 3CIFA 1L7EA 1HZJA 2A0WA 1C29B 1UIMA 2WFAA 5KOHB 4LQLA 4NYIQ 2LCFA 1W4CA 2YHAA 5ALYA 3GAZA 2DF8A 2WC1A 3AB7A 4F6RA 3MBKA 3PHBE 3L07A 2QROA 3DVRX 3WJ7A 5I4KA 2E82A 4NFHA 3BTSA 1DKNA 3I34X 5DBIA 3T1HB 3I9LA 4P4UA 3U0BA 2CJPA 3SJBA 2B6HA 1PJ4A 3L3BA 3JQFC 1XRPA 4REQA 2OT3B 3MSCA 4Y1GA 1DC8A 1QG6A 2GVNA 4CYPA 2Q1XA 1JXOA 2MYUA 3TOAA 1KQNA 4DB2A 4ZCPA 4QQNA 4TTJA 4TZKA 2IPAB 3EDQA 2FSSA 4HQ0A 2ZEOA 1E6CA 4PONA 1RXEA 4W1PA 4PX3A 4X6YA 3Q9UA 2FUKA 4QATA 1M1YA 3K6SB 4WNAB 5BO5A 3GN1A 1CP6A 2AN9A 2XYPA 3CF4G 5ULLA 4EIWA 4ZVNA 4U9ZA 4WY8A 1QMGA 1SB8A 4I0WB 3T5GA 2JANA 2NTEA 1U6JA 4Y2HA 4DNOA 1SHUX 2Z3NA 2NO0A 1KYIA 3CUSA 4XYLA 1GPWB 2VDKB 1TTQB 2O7QA 3NBYC 1O5IA 4NEXA 2BRUC 3TTVA 4FGLA 1CRQA 4JJXA 3BE8A 1IEWA 3QLVA 3K0BA 1XD2A 3E4DA 2B92A 2HK7A 4FGUA 1HOTA 3HBJA 3B6MA 4PPFA 3KB1A 2HLNA 5CVDA 3PLAE 3C87A 3L4EA 1UKZA 2I6TA 3PBKA 1HKUA 4N3GA 3T4EA 4HAUA 1BHJA 1OXTA 2ONCA 3OIGA 3OTOB 3RFUA 2E0IA 5CDSA 2F4VB 2WM2A 2RAVA 2ZROA 2CLSA 1LVGA 3LC1O 4MEJA 3ZDCA 1GTSA 2WUFA 2XJ4A 3R7FA 3SSAA 3KAPA 1XN4A 4OYYA 3I1YA 3B2EA 4MLZA 3KSDO 4M0MA 1M8PA 1L7DA 4OJYA 2F8TA 1JR3E 4MO2A 4RLQA 1X13A 2CKMA 1RSZA 4R8SA 4ZO7A 4TRNA 2H16A 3DW3X 1S2LA 2LGJA 1HQDA 2BR4A 3OCVA 1VCNA 4TROA 5KNDA 1V39A 2IY8A 4UW9A 2QIRA 3I9V6 1U94A 2PU5A 2OAQ1 3LX6A 4KSIA 2DVMA 3IAM6 2DYKA 2ABWA 1M7BA 1TQ8A 3DS8A 1VHDA 3O83A 5BV7A 3RUFA 5F9HA 2QVGA 5TARA 1I3KA 4I1SA 1E2JA 4U9HS 4S1OA 1Y3BE 1TCBA 2FZVA 4ZQIA 2Q43A 1KZ9A 1HR0B 3P9PA 1NG9A 3GLIB 1EE2A 4RIHA 4XSGA 4S2UA 3QVWA 3BJZA 3AVVA 1LBHA 2O2ZA 2WV9A 3GNSA 5JS7A 1IBSA 2CNDA 4RKYA 3JS5A 3UPDA 4CODB 1IBKB 2NAFA 3IHWA 4UIAA 2J46A 1ZGZA 2C2YA 3BSYA 1J1UA 5F4BA 2GK4A 2Q4RA 5IULC 3UXYA 1GRQA 2Z1NA 5LVAA 3BE6A 4CTMA 1KO4A 4ACBA 4ARAA 2VN8A 3N2ZB 1KEZA 3HKBB 1H3FA 1TPZA 5F5NA 3GEBA 2RGBA 3MSXA 3H3FA 1J4JA 1IVYA 3GCDA 1QHIA 4RZIA 4PFQA 5FOVA 3FVWA 4B9EA 3LRPA 3NXSA 1ELMP 4Q19A 4EZEA 4NF2A 2YWCA 2Q50A 4R8FA 4NPAA 3ZWQA 4PGAA 4R0MA 4PHCA 1DQZA 1R10A 3BK7A 1QORA 3G23A 5CAEA 2OHGA 3NH6A 2YNMD 4PGGA 4WN3A 2IK8A 2HCRA 1HTBA 1AO0A 4ERNA 1PTJC 2XUHA 3OPYB 1BO4A 3PFOA 4AG9A 4PCVA 1B15A 2J5RA 2P3LA 4FXOA 4A6XA 4F11A 5IYZA 4AY5A 3QX9A 3ZZNA 2BIFA 1VL6A 5FIUA 4MCSA 1FBNA 2AQKA 4G4SO 3A6ZA 2RBEA 1HNNA 2XJ9A 3E05A 3I62A 4TMXA 5I8ZA 2WTEA 1AV6A 5EIEA 5EUMA 1NWCA 2AXEA 4IX9A 3EWAA 1X94A 5HBGA 4RIEA 4BO0A 4LCJA 1EE9A 1WTAA 4ZT7A 1LFDB 1CLUA 1O08A 2O8EB 2JASA 4W5HA 1E0DA 3DUFA 3DJYA 4MMZB 1V7QA 4RZQA 3V2IA 2PX2A 2IYOA 3CYFA 3LVFO 5J9FA 3OQIB 4XB1A 3TLYA 1P2SA 4C76A 1ISHA 1GOTA 2XZTA 3ACDA 4GLFA 1H66A 3MCAA 3Q6NA 4MI6A 4RVUA 5ELMA 2PG3A 5KSWB 1SCUA 1C30B 5BSWA 1SCUB 2H7YA 2SKDA 1ORIA 5CVUA 1AGPA 3VAYA 1FMFA 1PCAA 1G59A 4Z9FA 3NM4A 3DXYA 3JALB 4O59O 3BF8A 2NO9A 4JKYA 3UA3A 4KPGA 1YTLA 1T5SA 1V7PC 1J8VA 1JDBB 2GN6A 4C3VA 4RDXA 1DLIA 1VI2A 3O5AA 5HOEA 1GA4A 5KTAA 3HLTA 4HDMA 3A4NA 3RS4A 4FQ8A 3ZHUA 2GN4A 3D9QX 4R81A 1AD2A 3ENZA 2WWFA 5CNKA 3HVHA 5KOIA 1Q91A 1QKIA 2NYUA 4OLHA 4FQ5A 4RF4A 1MVLA 1MFPA 1PI3A 3D7DA 1FB5A 2PGJA 4MKXA 2ACWA 4HDKA 2A78A 2RKWA 3DE7X 4TZ6A 3Q40A 3HY3A 4P31A 1H3EA 4BNFA 2PZLA 4BNDA 4Z3OA 1JVSA 3W9SA 1IWOA 3MNFA 4N3AA 1IN5A 1VG0B 1PWHA 2JLCA 3B12A 4JJ7A 3BZWA 4M38A 4M9ZA 1EVLA 4NH0A 3H0CA 4RGVA 4MQUA 4V02A 3CNBA 5EXDA 3SDZA 3ENNA 4IIXA 4P83A 4WBXC 4RCZA 2QB5A 1MX1A 2C2GA 2Q6TA 3AJAA 2YQ4A 4UE2A 4A5SA 3N05A 5EVJA 1KI1A 4XX1A 3I6BA 2O5RA 2AJ8A 1KQGA 2J6IA 4EI8A 2QTZA 2ZWMA 3EO4A 2XTAA 1T25A 4LY9A 1QSMA 1SMKA 4ONWA 2CLOB 1F3OA 1ZICA 1JHYA 4C5AA 3EF1A 1BOOA 3M7IA 3U49A 3JTKA 1A7JA 4QPDA 3VMMA 2BFPA 3IV9A 2YOFA 1HDYA 4W5WA 4UM7A 3TQTA 1DUIA 1SG9A 2FPIA 4WZ6A 1UWVA 1ZUWA 2YNEA 4KE7A 4RL6A 4P34A 5LSAA 1G2IA 3H8JA 5J1QA 3HUUA 2ZCUA 1JKMA 1IQUA 3DKIA 3T7CA 4HADA 4PAQA 3C1UA 5K8TA 1FFDA 3ISXA 4ID3A 4JVMA 3OZEA 4J43A 2VL7A 2HC9A 1I80A 1WPXA 4RKFA 4D8XA 5KKCA 4HDNA 1F9AA 4L8YA 1IDN1 4FD4A 3CSUA 3D8RA 2VRNA 2C1ZA 4FEYA 1SBQA 4LAFA 2IUUA 3ANMA 3C8HA 3GD5A 3PEUA 4QT0A 4A1OA 3SHVA 3A9LA 3K2KA 4DZTA 1XA4A 4OA5A 5G3YA 4D9EA 1DCTA 1PTJA 4Z7QB 1WY5A 1N2HA 1OTXA 2WFZA 3QEMB 5G1OA 1GXSA 2AJDA 3TKAA 10MHA 4UBNA 3IV7A 3T15A 1JUDA 1XMPA 4DDHA 1LVUA 3AM1A 1FF9A 1XVIA 2F9LA 2SHKA 1MZPA 4QA9A 4ZOLA 4H27A 1HNWB 1QF7A 3EK2A 5EJGA 3PR3A 3QBDA 1L1RA 1GQSA 4R41A 4RF5A 2GPSA 3MTGA 1QHSA 5BNZA 1EBBA 2JGRA 3EPPA 5FLKA 3JWHA 4L02A 2QG6A 1AHHA 1V95A 4MULA 3QVJA 2FQXA 2WF6A 4I66A 2G9UA 4JB3A 3A2KA 3ULKA 4LDAA 3RKUA 4E7PA 1BKDR 2A2ZA 3OEED 1EGHA 4ETWA 3IQGX 4LW8A 3WX0A 4EZIA 1W1WA 1SCIA 4E21A 4ZZ0A 3FH4A 4NZPA 4ASUD 2GCOB 1NRWA 1H2HA 1ZVVA 1GL3A 1W75A 4HS9A 2P40A 3CURA 2FFHA 1T0HB 3OZIA 1EINA 1VL1A 4L15A 3ZIDA 1T9GR 1NZFA 2ATVA 1TEHA 5G1ZA 1EUZA 2Q27A 2VSQA 3IUEA 3JAWB 2UXCB 4AUKA 1EIWA 4A3SA 2OWEA 1VJCA 4M1KA 3R8XA 1GUYA 2FWJA 4NAVA 4YUAA 2HZBA 4R3UC 3MAGA 2HPAA 4H15A 4P4JA 2ZIXB 3HDHA 1O94A 1R6DA 4F4IA 2ZPUA 4MCPA 1B0AA 2JI8A 1Y8QA 3C3PA 3IT1A 3VARA 4KL8S 3HJUA 1MAUA 4R6WA 1X19A 5AHOA 3V80A 4YREA 1MKYA 3WA6A 2R8EA 1EDZA 1DTWA 4GPZA 2XRZA 4MUFA 2W4IA 3N58A 5EZYA 1RQGA 1I1HA 2YBEA 1CZLA 1G8PA 3GJ8A 3GPBA 4GWLA 4GX2A 4E0BA 4JUBA 4DAOA 4LRSB 2C4MA 3FDZB 4K6FA 4KVZA 3EPKA 3E9QA 3HCNA 1BFKA 1XGKA 1LDNA 3O93A 1Z2CA 1FDTA 4MDEA 3IR5A 1VSVA 1WSWA 2OZKA 4OGFA 1KQ3A 1JGTA 2BFNA 4RLSA 1JN0A 3RIMA 4RCYA 4IIDA 4JFRA 1T15A 3WLPA 2TMGA 2FEWB 4TYPA 1W0KD 1XXLA 3QA3E 4GECA 4TN1A 2NTYC 4X8MA 4ZQBA 5G0TA 3G1TA 3LBYA 2V03A 4CCWA 2MSCB 1RQLA 3BDAA 3DR3A 1M34B 2VWGA 4XLLA 2ZCJA 4G0WA 2HCBA 3DV2A 1KSGA 1PWYE 4UA3A 3EIOA 3DZFA 4UJ3A 2YIJA 5HZGA 5E1MA 4CM8B 2N47A 4YT5A 2GZMA 2UYQA 4UHKA 4OFXA 1YQTA 1RC1A 3AFOA 4TWZA 4TYMA 1JIUA 4TTTS 4JNCA 1U8TA 2QUKA 4KQIA 5KOYA 5H5JA 3NTQA 2QRVB 3D8TA 2VK1A 2QDXA 1D5CA 1E18A 3DDWA 4NXYA 1Y89A 1KDOA 2KHZA 3E22A 1A5TA 3GZ4A 2HJRA 3ONNA 3RBXA 4YJ2A 1IYKA 1PGNA 3IVGA 2V7VA 4FR0A 2NU7B 3QK7A 4WZBE 2ZUFA 3EW7A 1DAOA 1V5GA 3DMGA 1L4GA 2EZ8A 4PSDA 3CSDA 2IS6A 1XQYA 4MUNA 4BRSA 3EISA 1Y9KA 3W3AA 5SYMA 1I1DA 3HSYA 4P44A 5HF9A 1MJHA 1RJWA 1UC4B 1U2RA 2IP1A 4JUFA 2C2ZA 2EW8A 3R95A 4AUEA 2A7XA 2MWMA 3H1BA 2B58A 2AOWA 3AV3A 2QL6A 1A95A 3FFWA 4MVJG 5DRYA 2I67A 1NSTA 2GCGA 2QRPA 4OL9A 4CQMA 1F2PA 1IAQA 3DO5A 5U4XA 3G2QA 4NGPA 4PK3A 5B64A 2VJBA 3IUQA 2VJLA 4WADA 5J4LA 1IXSB 1UKBA 1ZGBA 2IH2A 4YRLA 1XVUA 2C5SA 2WK1A 1ZIXA 4WHMA 3SR4A 3C6BA 1D1PA 1N6KA 2WJJA 4YDHB 4ZEWA 1EEXB 4YV0A 2DGDA 3H2BA 4RMHA 1EFRA 1Y5RA 2WJWA 1DJNA 4QUHA 1NYTA 3EUEA 1KFBB 5FA5A 2QT9A 5GOTA 2C5EA 2OE2A 1IICA 2WUWE 4YEDA 4AJ9A 4KOVA 1C0KA 4F3KA 3LU1A 1UMCA 1AQNA 4UNSA 3OX4A 1TO2E 1T9HA 3I3OA 1U9IC 4YGYA 1T91A 1PL0A 5C9ZA 1XOVA 3F1KA 4B5LA 4CI9A 4B7CA 1MAHA 3AWDA 3NEJA 3KIPA 2R8XA 5ALMA 5F12A 5EUBA 5DS0A 1B41A 1PFQA 2DCMA 2HTFA 5B7NA 5CYPA 3LIPA 3A05A 3MJHA 3C3AA 3FH0A 4HWPA 1Y4SA 4TMTA 1NVTA 1UIRA 2GD6A 2OG2A 2ANPA 1FX0B 4II3A 3BRWD 2ES4A 4H9GA 4KUBA 1XCGB 1ZHFA 2XBMA 1N8NA 1QLJA 5IM4A 1GAWA 1WNTA 4HKTA 3I0NA 1C0IA 4O1MA 4EITA 2V8DA 5LOVF 1LQTA 3VR3A 4IVQA 1EWVA 3PA8A 4K6MA 3R24A 3U26A 2IYZA 2B99A 1XB2A 3JYLA 4B8WA 4F92B 5GTDA 2PRQA 5BW5A 1KI2A 2F9FA 4G26A 1IEXA 4EHKA 1T1EA 1QCYA 2JZNA 4DSOA 4FMPA 4MVCA 4KH0A 1K06A 2QMEA 2WM9B 2M98A 1TCCA 3SFVA 3G85A 4AY4A 4MFPA 2KYRA 5LRKA 4LG1A 3PUIA 1RP1A 2H1HA 1I36A 2R5NA 3UAGA 2Y0PA 3U1TA 5A0FA 4HRAA 1NNLA 4PXBA 1C9JA 4RK0A 1TK2A 4NECA 4TSRA 4BWVA 2C0PA 1FSPA 1X1RA 1X1TA 2H4JA 2W2MA 4FKBA 4FKZA 1CYEA 4XFDA 4QBKA 4BTEA 4TQAA 3I9JA 1KJJA 5FTKA 5IEBA 4U2CA 5JYCA 3PNLA 2BSWA 3RRYA 4OOEA 1VRCA 4F85A 1I32A 2V7PA 3NAQA 1FUIA 2ZU0C 1IBLB 3DTYA 4E3ZA 3ABZA 2FWNA 4HXEB 4JVNA 3WNBA 2C8LA 4KQHA 4X3PA 2H18A 3S2UA 2D1SA 3W77A 4BY9E 5KTTA 2W2XA 1KI9A 3S9MA 1YVDA 3IKTA 4WCDA 3F78A 3UO8B 1JILA 3Q41A 4B48A 4EUEA 4PSVA 2UXBB 3OX3A 3MJVA 4P53A 4YP7A 1PU2A 2VO1A 4GC5A 4F7DA 1U80A 3SEQA 1KY3A 2ADMA 1MEJA 3JTMA 3QW4B 6Q21A 3S6HA 4YJ2F 2H4WA 1IQPA 2E18A 1HNZB 1IE3A 1YWGO 5HM6A 1M6WA 2H5EA 1FVHA 1QONA 1SU4A 1S7FA 3V5NA 5EJ7A 1QH8A 3GR6A 4FWTA 2Y9PB 2RGRA 2YV1A 5KC8A 2EQAA 3ABOB 2BBTA 3GLGE 1G6KA 1M4GA 2IEGA 4OQ4A 2A1UB 1EYZA 3HP4A 2C3YA 2VJCA 4AVYA 4NCAA 2W43A 4N65A 5BWOA 4EA7A 5K6RA 5KUTA 2G8LA 4NYIR 4CFZA 2FWMX 3MCWA 3R5HA 2V6MA 5JDIC 3S44A 2HHLA 2NXCA 3IFSA 4FHCA 5FCDA 3CLHA 2W2KB 4Z9XA 1CPSA 3SIRA 3IIEA 1MW8X 1NQWA 3DXXA 3KTAA 4QRDA 1G21E 4B74A 4YAIA 5C8YB 1ZG9A 1ZK2A 2W2VA 4IF5A 1S1MA 3EZ9A 1LRJA 1AQ6A 3ETJA 1J0AA 4NIMA 3KBBA 4F0JA 2VP0A 2Z9DA 4NMWA 2Q6VA 2P2ZA 5SY9A 4GM4A 2ZRAA 1JDUA 3QU5A 3COZA 4FMCF 3GIUA 4OBEA 1UMBA 4WASA 1OV4A 2VVTA 3PQFA 4CLOB 4ENUA 3OQMA 4KPYA 2F00A 4Q3KA 4HT3B 3FDZA 1D2AA 1KJ9A 1MXHA 1BWSA 1G8KA 1F8GA 1IUOA 2V9PA 1JIXA 1UM8A 2WQZA 3EGEA 3BB3A 4BNNA 3F6SA 3H83A 5A06A 4UHFA 4QNRA 4EUHA 3GVIA 3MUFA 2W9XA 2VFAA 1O6ZA 3PRYA 1QR2A 5BSRA 2XT9A 5KEIA 3LF2A 3OU2A 4DLSA 2DBQA 1V25A 2QAJA 2QRUA 4BVGA 5D5QA 2CJYA 5D87A 1NXQA 3SD7A 1QH9A 3JWJA 3UJBA 3VX4A 4BHTA 3E8MA 3GT7A 1EP1B 3DV9A 5ITVA 1Z6ZA 2ONJA 1K6XA 4CV1A 1GAQA 4JL6A 2JIDA 1KS2A 3DOIA 4AYTA 5IC6A 4GDFA 3CMMA 2ZJ1A 4UCMA 2XUIA 2YW9A 1Q92A 5TPZD 4GM1A 2I1QA 3VI3B 2EDAA 1TKRA 2IUTA 2X3UA 3A28A 4FC6A 4Y6SA 5B3KA 2ZQZA 2IPOA 4PLGA 1K0UA 1BO6A 4QO8A 4B3BA 2ZPAA 3IOCA 4HZUA 1NW8A 2RCYA 1RKUA 1XTUA 3PTZA 1A98A 4MUBA 2K5UA 2YRWA 4Z8YA 2J0VA 2RJNA 2VP5A 5K8OA 2PAAA 1E1KA 2QQ5A 1V9SA 1Z8HA 3D6AA 2XECA 3NYRA 1SKYE 4BO3A 2ETVA 3UGTA 2XBLA 1NW7A 5B37A 1TUEA 1BFDA 4WWVA 1GZ5A 4CM8A 3GLIE 1XVTA 3L18A 5FP0A 4UBLA 2H0AA 2ZRGA 2MYPA 3I2GA 1KQFA 4WKPA 3SYLA 2JIBA 1J90A 4C08A 5K8LA 2NZXA 4LMPA 4Q3NA 4ZV7A 4MUJA 5K8IA 3Q5DA 2KLBA 2BBOA 2V1UA 3D6TB 4BN4A 1SUAA 2YMPA 4MJ3A 1HE5A 1OPRA 3CLTD 1V37A 4R9NA 2DPLA 1C0PA 4KZPA 3QJYA 3HXTA 3IP6A 3QY0A 4NCZA 3AVXA 3ZDDA 3EFEA 3GWZA 2AB0A 2HQ1A 2Y76A 4LXGA 2EKDA 2WAXA 2C6GA 4AKIA 2XAAA 3DZCA 4I81A 4MWDA 1R9NA 2JIPA 4MHPA 4HLDA 3A70A 4Q4JB 3NT5A 2P5YA 2G9DA 2IP2A 1BGVA 2C8VA 1Q74A 1D9XA 2L18A 1WSDA 1N33B 2FRDC 2EEZA 4O4LB 3U3KA 3HO1A 1XZNA 1Q0PA 3L8CA 3KHTA 3OQIA 2O20A 3IQEA 1UEIA 2E37A 3Q98A 5JW6A 3L6BA 4LJ8A 3LCJA 2ENWA 1HBJA 2H29A 4UCPA 3ZJ4A 5I47A 1AKMA 1B74A 1VQ1A 4FINA 5F52A 5IDXA 2YNCA 2A6PA 3FTCA 2J3HA 1GZUA 2AOUB 4IO0A 3L1UA 5BWMA 4ENWA 1UJCA 2RE8A 4PV6A 2JRCA 1QPZA 2AN3A 4LJLA 1M8FA 3DLJA 5SZIA 3ZQJA 1EA7A 1E6KA 1L7OA 2G25A 2NSLA 1EFTA 1L0BA 4Q39A 4Z0NA 5CFQA 8AT1A 3FYDA 4M1EA 3QY9A 5KPDA 3VR5A 4AIRA 2ZYSA 4ILEA 3E5RA 5H80A 1XNJA 4R1MA 4DA9A 3UMGA 3I53A 1Z6YA 1NBEA 3WIDA 5B7GA 4HNTA 1Q0TA 1P62B 1JV2B 1GYQA 1Q6ZA 2JFXA 3R0JA 2IHTA 4TSFA 1E5QA 1ZD9A 4IDBA 4QFCA 3GEIA 4GBMA 5DIZA 2PJBA 2JF0A 5CNIA 5E6SB 3UFXA 4AJPA 1OXKB 4DCMA 2RGEA 2OO7A 4RGQA 5C5CA 5THQA 3G13A 5EXSA 3RRFA 4OQQA 2H3HA 1T9GS 2V8HA 5P21A 1YZ3A 3E2PA 1JX6A 3C6ZA 2ZM6B 1Z6TA 2H4XA 2Y68A 3LPDA 5FORA 2ZRPA 4D98A 1S7KA 4RSGA 1LBSA 1P1JA 4H6XA 5FYDA 3HLPA 1E20A 3DT9A 3DVSX 1W34A 1MOPA 4HD8A 1E7YA 1HZZC 2R2GA 2WW8A 1FUKA 5BW8A 1MB4A 1M2VA 2AI3A 2PQ8A 3PB8X 3QNVA 4D97A 1C7FA 2Q5IA 4OHOA 2NTJA 2QTBA 4FFSA 3EGDA 2C4TA 4CM6A 3FD8A 4Z3KA 4BE4A 2CT8A 2VF4X 4R3KA 4UTXA 3AGPA 1L5RA 2MOKA 1D8TA 4YLEA 1RPNA 2IYQA 4ARCA 1AX9A 4CRYB 3N86A 1V8FA 2OLJA 2Q9AA 2W2OA 3FZQA 3GFBA 2HYIC 1ZUHA 1Q7BA 1UC8A 3BG5A 4U2DA 4QDKA 3EY9A 4XQGA 3RFVA 3UPUA 4PPGA 1D03A 4EI7A 4B5PB 2G67A 5IC5A 5E9AA 4HNQA 3HBNA 2H4FA 3L4BC 3IRUA 3VBEA 5IABA 4UNRA 2HADA 4YJFB 1XWWA 4C2ZA 3HXMA 2NYAA 2XWBF 4XD7D 2YOGA 4S04A 2JIZA 1A8QA 2P9HA 4NBVA 4PN7A 5CFLA 2I3CA 1IU9A 2MJLA 3NBAA 5AOCA 1T3SA 1HE1C 1VPEA 4CLOA 4UU8A 1FSFA 2GBIA 5EWLA 3T4XA 2DULA 4AG3A 3DO8A 4DZRA 2HA4A 3EXG2 3OEYA 5BY2A 3S6GA 1XT6A 2O8NA 1VXOA 1W48A 2QZJA 3FFTA 3M1YA 4JIMA 3OF2A 1WCV1 3KD2A 4DMGA 3V2HA 1U28A 1XELA 1YAJA 3F0TA 3JD4A 1RADA 2VWQA 2WG0A 4M46A 3T6KA 4W9YA 4D0LB 1C8VB 3KOXA 4JELA 3PQ3A 2FN9A 3DMHA 3RVJA 4WESA 2FEAA 2P1DA 2OC9A 2R6ZA 2HL6A 2VRCA 5A3VA 1KU6A 4BQPA 2CTBA 2NZ8A 2XNDD 1IN8A 4ZDWA 4KGZA 2HWKA 1IIDA 1S7NA 2LKCA 3RRBA 1CFJA 4LYEA 4DC9A 2CTCA 2IH4A 5G02A 1HT2E 4HO1X 2FCAA 4QDOA 4GKJB 4P0PB 1YULA 4GP7A 1OA1A 2C5GA 1OIWA 1E1QD 1UQUA 2X2EA 3LBFA 3U80A 1RWWA 1MPXA 5CGQB 4KITB 4NJRA 4H3KB 1NLZA 4BGEA 3C26A 3OF3A 4J9VA 3RU7A 3UC9A 3AHHA 2NZJA 5B7PA 5ICSA 5LXTA 4F2HA 3SX0A 1Y81A 2IYRA 1WK4A 3GDFA 3D3QA 2FPPA 5IXJA 3B8GA 4LKRA 3VHXA 1U0GA 4N47A 2ZSEA 3AFMA 2DP4E 2QTTA 3AINA 1UOQA 1NVVR 3T1VA 1E7RA 4I14A 4MWBA 3H65A 1PQUA 5CVTA 1U65A 4MMYB 3CZAA 1R6UA 4Z4IA 3D8PA 2Y9MB 2NO6A 5JSZB 4NKRA 2WMDA 5JCPA 4NR0A 4BB5A 4E70A 1CX9B 1UOOA 3GRKA 5JDCA 2GD0A 2IQIA 2IYSA 2WYHA 4N5NA 1SEPA 1Z7YA 3JARA 4RHXA 5JPDA 1EIZA 1GDHA 4I3HA 2WF8A 3R9XB 5K51A 2JAQA 4AI6A 4Q3DA 3GY0A 2WFLA 2B2CA 4AMUA 1SVKA 2QMLA 4E7OA 2VHEA 3WISA 1RYDA 4AICA 3EXIA 4MB2A 4P6YA 2I62A 5JATA 3V8NA 3QTTA 2JLUA 1X8KA 1S4MA 4MTLA 3EY5A 5REQB 1KY5A 1YX0A 4DV3B 1EESA 1AOXA 1EM8B 1BTOA 1M1XB 1UADA 4C7VA 1BN7A 2V5AA 4MS4B 1ZPDA 3C6KA 1AZWA 3DFMA 3FW1A 4LZJA 5DASA 3WADA 4CKCA 3MINA 4L5YA 3I52A 3C2QA 3CR8A 4MITA 4C0LA 3N39C 1VHSA 5FUBA 3B3WA 1C1XB 1W52X 2PT7A 3AGQA 2OHFA 2Z3MA 2AJ6A 1IRIA 2IIQA 2QLFA 2QS9A 3HCAA 1DBVO 1LJLA 1ESNA 5I9NA 3R9EA 4LRTB 1GILA 3IVMA 1I4TD 1OI3A 1ULSA 3ZOZA 3R5TA 2HSDA 4M37A 3PEWA 3DWGA 3MUOA 1NL3A 3FEEA 3B9QA 4C89A 3IEUA 5T41A 4TLDA 3WLQA 1JHXA 1TYAE 4FFBA 4E0AA 1T9BA 2V6IA 3ETLA 4FZJA 1N36B 4BZWA 3PJGA 4YXFA 5CVEA 2BKXA 4OQDA 3M4NA 4KI0A 4IUCS 1KK3A 4G25A 4MW5A 4A30A 2NV2B 3QVOA 1RM0A 1PR6A 3H2JA 4QEKA 3UATA 1ESMA 2ZWPA 3K70C 1YK3A 3FF1A 3RSZA 1FYXA 3MTEA 1T9AA 4F5WA 5BWAB 1L9XA 2AOTB 4J7XA 2RHHA 3K0HA 3FTQA 1T8RA 4EVQA 5C8DA 4MHYA 1SGWA 1U04A 4CCSA 3DMTC 3FFXA 1QNLA 2HB6A 3BIFA 2CWDA 4HHEA 3W9YA 2XXAB 2QK4A 3PWKA 1UM9B 3OEHD 1MIOA 1RMTA 3H87A 4YP0A 5JE8A 2V55B 4EI2A 2AIRA 5JH7B 3ED1A 1E9RA 3QLEA 4BRWA 1DG9A 1MRNA 1VKNA 2N46A 5ELLA 2AFHB 1DG3A 3LUPA 4DBLC 4DUPA 4WVFA 3H8SA 3OHPA 4OX9Y 2ID4A 1O95D 2PX8A 2YXNA 4QGBA 3CNNA 2X3FA 2P9QA 2NGRA 2XQVA 3D4BA 4UC0A 4OU4A 2W6JD 3R76A 4D6XA 2NSMA 4Q15A 3OH8A 3ILHA 4XIGS 4LF4B 4R83A 1N92A 3ZWAA 4OG2A 2EL7A 2G1JA 3L84A 3QELB 5ALFA 1GPKA 2PS9A 3NONA 2CMGA 4FEAA 4RK1A 2EBUA 4JLMA 3QPWA 3HACA 4URZR 1BJTA 3KR4A 4LJ5A 1OLUA 3MQ4A 4KB5A 2H11A 2DPSA 2J5QA 5T64A 4OGLA 4E4TA 1D09A 1Z2OX 3PGKA 4MGIR 2OKGA 5GMOA 2IXAA 1WHSB 3T7DA 3Q2IA 1NVDA 1Y6GA 5AHKA 5DNDA 1XYVA 1HXHA 1EH5A 5CAEB 2C3MA 1HGXA 3UC5A 1D6NA 1TVEA 4GT1A 5E9WA 1BS1A 2BZGA 3N3BC 5NULA 5JRZA 2ARHA 4DLTA 1KI8A 2JJ8A 1TKJA 5A9RA 2KBFA 2WYWA 4RULA 1HE2A 2XMBA 3I28A 1Y8QB 5GVRA 3TXYA 1IY9A 3V1NA 3PGMA 4R1NA 3TD6A 4CTNA 2NX2A 1HEIA 2RJOA 3SE0A 2JH8A 5GIPE 2OZLA 3ROQA 2FK8A 3I6YA 1XDZA 2YL2A 1NF8A 3BXHA 2VF5X 3OQHA 3QF4B 3VZDA 2GBLA 4MDFA 4K30A 2MIIA 1QF9A 4NV0A 1HKHA 3ESDA 4WFIA 3LA8A 1RWVA 2H2HA 4Y1FA 4DLPA 3K6SA 5LCXA 1GQOA 1KYQA 4KU4A 1SC4A 2ZTHA 1LRKA 3EAQA 3WRYA 3ROGA 5AOBA 5DYYA 3H9UA 3JYQA 5TQ2B 1PG5A 3C1AA 4DEYA 1G7RA 2P1ZA 2I6GA 3C8MA 4YU9A 5FD8A 3KQHA 2J0SA 4MH0R 2P6MA 4L5BA 4BWYA 3VPCA 3WTBA 1RHKA 3ZKWB 4EEKA 3BE4A 3PC8A 4L2IB 3RE1A 4EA9A 1G5TA 2Z8ZA 3I2HA 2R6R1 5BOVA 3URKA 1FZQA 2QLTA 2WF9A 1EX7A 1NR5A 3Q3GE 4IS2A 2O6LA 1U6IA 3PFCA 1Q0SA 4YP1A 1KDYA 2J59A 2IYVA 3L4JA 2GRJA 1TVCA 3KZCA 2VK2A 1DO2A 1MCZA 2A30A 1VG1A 1W8DA 5CBPA 4FYHA 4XWGA 2AFSA 1P91A 3FCAA 1H6CA 3L06A 4YCBA 4EJ6A 1KBZA 4MUEA 5JD5A 5KKAA 1ONBA 3MMXA 4ALNA 3G9ZA 2YCBA 1G4HA 1TC1A 3G6KA 2I7TA 4JUCA 5C2JB 5HF5A 5BQOA 3VNRA 1UPXA 3O1IC 1S2OA 2YRFA 5CT8A 2P9FA 4IG4A 3DE3X 2X7BA 4ZVUA 4BLWA 1C9NA 2R5FA 4P84A 4YAUA 5DULA 1ZOOA 3JQDA 1YU9A 1XZLA 2JKZA 2JHGA 1YGYA 2GAIA 2X5OA 4FI3C 4EMSA 5L8VA 1Z2LA 4GGMX 5JGFA 5LMNB 5C0OE 4BX0A 4KR2A 5I6DA 4W5QA 4Y2QA 3ZTWA 1F57A 2ZYHA 2DECA 3OTIA 3GQBA 3JD0A 2JIOA 2V6BA 2V9CA 3VFDA 2VP6A 3CF0A 1ONPA 2FR1A 2XZLA 3KTDA 2VNKA 3FHJA 2X4LA 2PWPA 3TTTA 1TYDE 3PVZA 2XCRB 1C7ZA 1YCDA 3D6VA 3SSNA 2C29D 3ZNNA 3WNQA 2XNCA 5AKXA 4QFBA 4TN5A 3O8BA 4CCYA 2BFCB 4EENA 3CNLA 4ND1A 1P75A 2V7TA 3R7DA 3VR1A 1NN1A 1L8OA 4WN9A 1VGRA 3H1FA 1R9GA 4G1MB 1GKKA 1TF2A 2NP6A 2NTVA 4OGKA 3KZWA 4ZALA 1OIVA 4CMEA 4ZP1A 3QEJA 5A6SB 2Q45A 4XUGB 2OFFA 2VNSA 3FMPB 5HJ7A 1CD5A 4MQLA 3EEOA 2CFIA 2I34A 3PDIA 2HM7A 3A1FA 4P5EA 2XQKA 2X86A 3GRVA 1Z4LA 3KQZA 2DC1A 3PSAA 5TIIA 1DQNA 3EQ8A 1N2SA 3GFSA 4RXMA 2FDCA 4P10A 3GQVA 1NJ1A 4MIEA 3FBGA 3S29A 4JD5A 1MJFA 2J9YB 3Q12A 1LPMA 2PMEA 4QXOA 4AKSA 3DDZX 4IJ6A 3SQMA 5AH0A 1G6HA 1NY5A 4DLRA 3LQKA 5J5VA 2WUGA 5EGSA 3KYCA 3WYDA 3HM9A 1I21A 1HK7A 2QGNA 3EG5A 2PN1A 2D13A 1H8EA 1L7RA 2OP0A 2QP3A 4H7EA 1EVJA 1AQYA 1D2GA 1FYFA 1BX1A 3KR1A 1USUA 2BCEA 2RGAA 1SQHA 4CAEA 1L3BA 2BFMA 1R50A 3A1SA 4Q4DA 5B3AA 4KORA 2CD7A 2PGAA 1H9AA 1I7PA 1TZKA 3V32A 4ASUA 1WV0A 2R84A 3B51X 3KS9A 3NBXX 1W9HA 2Y27A 4OHXA 4PHHA 2G4LA 4Y1RB 1ZHHA 3V1KA 2G77B 1YJAA 2JCGA 2VHYA 2FSVA 1Z7GA 1L8XA 4FSDA 2A9PA 3HXPA 1WVIA 2UV8A 2E4UA 3NWPA 1AKVA 3RVQA 4H35A 1C9KA 4FNMA 4LXXA 4PCUA 3HNPA 4TVBA 1IB0A 4UAVA 3T61A 4ESVA 4I1VA 1D5WA 3SICE 1N5IA 4EY5A 1DWUA 3ZW9A 1VPLA 4W5OA 2JGNA 2QD5A 1QANA 1LNSA 4KN5A 3WKAA 4ACAA 1ZGGA 2PKCA 4IEFB 4NFSA 3SJCA 2FFJA 3FPSA 1T3LA 3H11B 3QU7A 4UM9D 1JQLB 4R2HA 5FOUA 5HJ2A 2QMUA 2LBPA 5GAJA 4Z65A 1O8BA 5CBMA 3EFHA 4UHBA 5G2OA 1EUQA 3LUHA 1KARA 1H8HA 5DGCA 1JHUA 3UHPA 3MYRA 1RRCA 1LTKA 1PYOA 2XCLA 2O23A 4J3JA 4W9RA 5H16A 2CUTA 2AJTA 2F43A 2IEDA 3USCS 2GKOA 1B2RA 4BN5A 1NSLA 4YRRA 3X1YA 1GRRA 3KLPX 4BNKA 2KSQA 3LT0A 4WXMA 3HI4A 2VTBA 5JZVA 5LRJA 1PBNA 2PQ0A 1JR2A 1DO8A 1O1YA 1KZ1A 2ZJ3A 3KKKA 4J2OA 4IJMA 1L5LA 3W3AH 2YY7A 1T8TA 3ZJVA 4UM8B 4WGGA 1NXVA 1DVRA 1II8A 3WB0A 4WBSA 2OBYA 4FLFA 4R1SA 3B3FA 5FLEX 1LPAB 4RTLA 5JD4A 2OR4A 2CHGA 4HGYA 2VQYA 3B1VA 4LNAA 1IBCA 4B6PA 3U4MA 5ALJA 3SJ7A 3KRTA 5M29A 3FCUB 2OKCA 5H83A 5IU6A 3V8QA 2RHDA 4RD0A 1N2GA 1L5SA 2EGHA 2HA5A 3SBXA 1KH2A 3UWDA 2HO4A 2I9KA 1ZOLA 2QXTA 2V97A 5KB3A 2H5MA 4YP5A 2CJFA 2O2EA 4AZ3A 3DWEX 4B32A 4AZTA 1DHRA 1HFEL 1P4JA 2IIBA 2DHEA 3IPXA 3P0IA 5D51S 4I50B 1U3WA 2YN2A 3T5CA 1H8HD 2O28A 1U3VA 3WT4A 2FPGB 3AVYA 1OC4A 3EIHA 4HWTA 1XRRA 2JBAB 1DL5A 3VU3A 4C30A 4QTZA 2WFLB 3K2QA 4LDZA 3E7WA 1GUBA 1IY0A 1AQUA 3TX2A 3G1WA 3QBVA 2F90A 3PNPA 3WDKA 1M2HA 4MRMA 1XEAA 4EO9A 2GLJA 3NV7A 3CN7A 4NABA 4RJJA 1ZEJA 3FAZA 3IC5A 1B8UA 2QL9A 1N3IA 4UBOA 3ZGVA 2PLRA 3DTVA 2BCGY 5GINE 4NV3A 3L7LA 5C82A 4LZWA 3TJRA 1EXVA 3UB2A 1U2TA 4HEHA 1SVLA 1F2DA 2AUMA 3EWNA 4DAEA 4NJOA 1WLSA 5AJZA 3AFHA 1DC5A 4GGPA 4KFTA 5AHRA 1A1VA 2H65A 4IVRA 4ROSA 2B4DB 1Q50A 4FD5A 2C59A 3AL2A 4H7JA 4B87A 4BJ1A 3RLFA 1POXA 3TIVA 4KWEA 3A9VA 4OYLA 4D0SA 4KVME 3MUEA 2XMDA 3U7QA 4TVSA 3BK2A 3LYLA 1YMEA 1IGBA 4DQKA 3AQ4A 3PDWA 3W2HA 1X7DA 3D43A 1U0FA 3GEEA 4KMOA 5FOSA 1QV7A 1E2PA 4Q4HB 5I45A 4X20A 1Y9DA 2FQWA 2GFHA 3FTEA 1XNHA 5ALWA 4EDFA 3M89A 4BFUA 1MORA 1SCBA 3IBGA 4KQJA 3LOUA 4GE0A 1ISPA 4XTCS 4IPTA 3WRXA 3DJFA 3BN3A 4LF9B 3SR0A 2QW8A 2AK3A 1RBMA 2ZBQA 3HWX1 3RSQA 3A3YA 3FIJA 5KTDA 3DNMA 4CGPA 5LFAA 2D5CA 3FMIA 3PHIA 1T5LA 4ANFA 3E81A 2BUCA 2UYHA 1YZGA 4HTFB 2JZOA 3ICPA 3PZRA 4WQMA 1SCJA 3WGJA 2TMDA 4BL5A 2WKQA 3OF5A 5CFNA 2OOTA 2QHXA 4D3SA 2PFGA 1RC0A 4MI3A 2FPMA 2NSJA