2HCFA

Crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
225
Chain Sequence
b'SRTLVLFDIDGTLLKVESMNRRVLADALIEVYGTEGSTDFSGKMDGAIIYEVLSNVGLERAEIADKFDKAKETYIALFRERARREDITLLEGVRELLDALSSRSDVLLGLLTGNFEASGRHKLKLPGIDHYFPFGAFADDALDRNELPHIALERARRMTGANYSPSQIVIIGDTEHDIRCARELDARSIAVATGNFTMEELARHKPGTLFKNFAETDEVLASILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title Crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from Chlorobium tepidum TLS at 1.80 A resolution
rcsb
source organism Chlorobaculum tepidum
molecule tags Hydrolase
total genus 84
structure length 225
sequence length 228
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hcfA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hcfA01
3ZX5A 1RLMA 4JDPA 1S2OA 2HHLA 3N1UA 3QUBA 1L6RA 5ALHA 1WR8A 4Y2VA 4QQFA 2B82A 2FUCA 2CFSA 2IOHA 5AI6A 3ZW7A 3AR9A 2AH5A 2YN4A 2JAWA 1K1EA 5A3QA 4Y2RA 2O2XA 3QUCA 5AVXA 1XP5A 5IT0A 3WK5A 3AR4A 4L57A 4JB3A 2HOQA 1EK1A 1MH9A 2EARA 3OCYA 3AR8A 3PCTA 4BEVA 1U7PA 5ALQA 3KOOA 2PKEA 2G1AA 1VFPA 3MC1A 2MU2A 2X4DA 1L7OA 2MSNA 2WF8A 1Z4IA 1Z4KA 3EF1A 4OFZA 5A3SA 2NO4A 2WHEA 3OTQA 5ALDA 3W5AA 5AKEA 1AQ6A 2ZBDA 1RDFA 1QQ5A 5AI0A 2AUTA 3AR2A 5AI5A 5AM0A 2JGAA 3WKEA 3E8MA 3FGOA 5AW2A 2AMYA 1TJ5A 4GIBA 1PW5A 1RC8A 4OCZA 3EPRA 4MWOA 2Q5EA 2RB5A 2FPWA 2R8ZA 3QUTA 3E81A 3W5DA 4RESA 3KBBA 2P11A 2YMMA 5AKJA 2W11A 3ONNA 2WF7A 1VJ5A 2RAVA 4C4TA 1J8DA 3OCZA 1N9KA 5AW8A 2P27A 1SWVA 4CF5A 4UU0A 4Y2PA 2YBDA 3L1UA 4FE3A 4IG4A 3BA6A 3QNMA 4J03A 1RMYA 2R8EA 1YDFA 3QYPA 2JAOA 2B30A 3EWIA 1YNSA 3HYCA 4HAIA 4Y2YA 4BX0A 2HDOA 3EF0A 1O03A 1NF2A 2GHQA 2ZBEA 3MMZA 3D6JA 2GMWA 4UMFA 2BDUA 2OYCA 2Q4RA 3KZXA 3SHQA 4YGYA 4MUMA 5ALNA 1TJ3A 4BNDA 2I55A 3U7HB 5ALWA 4UMVA 5IT4A 3FPBA 2I33A 5ALSA 5AIAA 3M9LA 2FI1A 2EATA 1RKQA 3OCXA 3B9RA 4OD0A 5AVQA 3QU4A 1IWOA 2HI0A 1RKVA 3OCUA 3N8GA 3L8EA 4UARA 2CFTA 3MPOA 3A3YA 5ALMA 3ZVNA 5AKIA 4KX5A 2ZBFA 5AW0A 1Q91A 5AKZA 5AW7A 4CF3A 3ZWKA 4Y2UA 1RMTA 2FPSA 4UATA 3L8HA 3L5KA 3AR3A 1ZJJA 2G07A 4BKMA 4BYGA 1O08A 3WK7A 4FFDA 4UM5A 4NABA 4EX7A 2B1RA 3AR5A 5IS2A 3L7YA 3FPSA 5AVWA 3UMGA 1RLTA 3PDWA 3DNPA 5ALJA 1Z4PX 3L8FA 3A1DA 3ZI4A 2C8KA 3FZQA 3WK4A 4HGNA 5ALFA 1LTQA 3PGVA 1Z4NA 3AR6A 3U13A 5AI4A 5AM4A 2P69A 5E0OA 1LVHA 2CFRA 2PQ0A 5ALZA 4XOUA 4BX3A 1L8OA 5AIBA 2G80A 3KDPA 1U02A 3I28A 2GHTA 5AK3A 2OBBA 2HX1A 3OPXA 4BX2A 5A3RA 4EX6A 3U26A 4I9FA 4XE5A 1KYTA 1Z88A 3KD3A 3L1VA 1L8LA 1RQLA 3NAMA 4QJBA 4EZEA 4UW9A 1ZD3A 5AW6A 2QYHA 1J97A 5AHXA 2JAUA 4NV0A 1U2TA 2HF2A 1RLOA 3S6JA 1F5SA 3WK6A 4Y2XA 3RFUA 3SMVA 4ZEWA 1ZD4A 3WKCA 3R9KA 2C9MA 5AESA 1ZOLA 2I6XA 4EELA 4EEKA 3UMBA 3N5KA 3J7TA 3WGVA 2RBKA 1ZD2P 5AVZA 2ZBGA 4F72A 2FPRA 2MU1A 3L0BA 4ZEXA 5AW5A 5JJBA 1VJRA 1T9ZA 1L7MA 1U2SA 3K1ZA 3FVVA 2WF5A 1WZCA 2AGVA 2YMQA 1ZD5A 1WVIA 5AW1A 3E84A 3SKYA 5AM5A 2VKQA 5AW9A 5ALRA 2GFHA 3WKAA 4HGOA 3RF6A 2EAUA 5AKGA 1Z4LA 1CR6A 1Z4JA 3U7EB 2W43A 5ALPA 5ALXA 3L8GA 4F71A 2C88A 2G06A 5AKLA 1RMQA 4J2TA 4XPZA 3CZ4A 4C4RA 3NUQA 4HGRA 2YJ5A 3ZVLA 1L7NA 5AM1A 3ZTWA 5AVRA 1QH9A 2P9JA 4Y3UA 3MN1A 3NANA 2QLTA 1T5SA 3W5BA 1S8OA 2ODAA 2W4MA 3DAOA 4UAVA 3UM9A 3ZTYA 1JUDA 1ZS9A 3SD7A 4UAUA 1SU4A 3IJ5A 2YY6A 4YIHA 2G08A 4L6CA 5AICA 1Q92A 1XPJA 3SLRA 4XQ0A 3W5CA 3U7GA 3DV9A 1TJ4A 1TA0A 2R8YA 4AP9A 3ZVMA 3QLEA 4C4SA 5T41A 4IFTA 2OA0A 5AM3A 1QQ7A 2R8XA 1RKUA 2YMLA 4B6JA 3ET4A 5ALKA 4CE6A 2YJ4A 2WF6A 2HEGA 1NNLA 3U7FB 5ALUA 2PR7A 3IB6A 3P96A 4Y2QA 4L6AA 2ZOSA 2NO5A 4ZEVA 4KNWA 4BBJA 3KC2A 3NIWA 3A1EA 2Q4TA 2GO7A 2FEAA 4DW8A 1WPGA 4UU1A 3E58A 2IA5A 3CNHA 3QU2A 1YJ5A 2WFAA 3VAYA 3WK8A 5FP0A 3ZU6A 3SF0A 4UMEA 3ZUPA 3QUQA 4DWOA 5AVUA 2C8LA 4YH1A 2HO4A 4OHFA 2YFYA 5AKHA 5AK5A 1QYIA 1Z5UA 4HGQA 1YMQA 1Z4MA 1L7PA 2ZXEA 3R4CA 2O9JA 1QQ6A 3QX7A 2IYEA 4AS3A 5ALTA 1YV9A 3QU9A 3N07A 4KN8A 4YIKA 1T5TA 4YCMA 4G9BA 4YCNA 2B1QA 3A1CA 3R09A 2B0CA 1TE2A 4RETA 4CF4A 3IRUA 5AK4A 3OCWA 5AI9A 2DQSA 4E88A 3WK9A 3FM9A 3ED5A 4YCLA 3ESRA 3TLMA 2FPUA 5AW4A 3AR7A 1SWWA 1XVIA 3HLTA 2NYVA 2WF9A 5AM2A 4Y2SA 2FPXA 3GYGA 4G63A 3L0CA 1RRCA 4UM7A 3B8EA 2C4NA 3NRJA 5ALYA 4Y2JA 5AI8A 5AKYA 4DCCA 3N28A 3ZWDA 3SKXA 2I54A 3B9BA 1RPZA 2D2VA 2FDRA 2CN1A 2I7DA 4HYTA 5AVSA 5AW3A 1ZRMA 3WKBA 2WM8A 1FEZA 4O8CA 5ALIA 1NRWA 4Y2TA 2BY4A 4FYPA 1RQNA 2BDEA 3ESQA 2IOFK 3U19A 4NAVA 3I76A 4DFDA 4AS2A 5AK6A 4EENA 2HF7A 4PNHA 4UMDA 4BEWA 2FUEA 3QXGA 2B8EA 5AVTA 3QU7A 3F9RA 1X42A 3ET5A 4H1WA 3ZX4A 3NALA 4NFLA 1N8NA 5AVVA 5ALEA 1YS9A 2G0AA 5AKKA 1Z5GA 3DDHA 5ALGA 1U7OA 2RARA 3M1YA 3QGMA 1EK2A 3UMCA 3WKDA 3L0YA 2YJ6A 2ZG6A 3WGUA 3OCVA 2G09A 4HGPA 2IOFA 2JARA 2HCFA 4KX3A 5ALOA 4BNDB 3PGLA 4I9GA 5AKXA 2OM6A 4CNQA 2HSZA 5ALLA 3I1YA 4KNVA 5AVYA 1ZRNA 2YMPA 1CQZA 2I34A 1Z4OA 3NASA 5ALVA 4KYTA 2B8JA 4NWIA 4GXTA 1Z4QA 3BWVA 3I6BA 1Y8AA 4UASA 3QU5A 2YJ3A
chains in the Genus database with same CATH superfamily
5H3HA 3KQKA 1Z8FA 4PRYA 1JZTA 5J0QA 2V1UA 1WR8A 4QQFA 3GMTA 4HY3A 1QHFA 4A4DA 1NYTA 4D1YA 4N7BA 4W8HA 1E1NA 1FLNA 1X3SA 5FQOA 4OY3A 4US2R 4FMDF 5JS7A 1Y9DA 3PR1A 3UGTA 1XJ5A 3OHMA 2H4WA 2HF9A 4YD2A 4UVIA 4B46A 1MX3A 1ZQBA 2Z3VA 3IKMB 2BGWA 4YY3B 3KE9A 2H3VA 3NDRA 3MS2A 4KJZA 2XUHA 4ZODA 2Q9AA 4QWMA 3L7AA 4W1SA 1TU3A 4RYLA 1B2LA 1C7RA 2C92A 4EA7A 3ESZA 1PZNA 1UF9A 1C30B 4GQIA 4H31A 5F1PA 1Q95A 3AEYA 2XY5A 2LCQA 1AQJA 4J0QA 3Q6NA 5IF3A 4B79A 2W6JA 3D02A 3WGMA 3MFHA 4B9LA 4RKEA 4ER7A 4M47A 4TTRA 4JKOA 4YJ3F 3TOCA 1RKQA 1RXUA 2GN4A 4G2TA 4MROA 2ESEA 1DTWA 3BCSA 2W42A 4RGVA 1Y4UA 1XRPA 3GUUA 2JFPA 4IJVA 4I4TB 1WQ4A 2GTPA 4FBUA 4O3OA 3MUNA 1NW5A 1W0KA 4ABYA 1J9EA 3E1GA 5F3WB 1U90A 4PG5A 4L8WB 1BCRB 4A0QA 5LDHA 3VNSA 1HO3A 3OLXA 1TUEA 4Q9JA 4YPFA 5E0OA 3ZH2A 3WBFA 4GPIB 3FG9A 1R37A 4ACOA 4I9FA 3MUFA 4O4IA 3IC5A 5KYYB 1EBBA 3KR2A 3S81A 4EBBA 1YRLA 3KTOA 4YRQA 4H6PA 5LOVA 2WTMA 4DANA 3PHIA 3JARA 3EYAA 2AW3A 4TTTS 4M87A 3GEGA 1NYLA 1YBMA 4DWWA 4JN6B 5FUBA 5GWXA 2XADA 5J2UB 5AKGA 4WZAB 1CR6A 1KJQA 3HKCA 3PFFA 1D5CA 3R3VA 4CYMA 1PTJA 5TVGA 4C3VA 1EM6A 3EGXB 2QLTA 2HU7A 2AHOB 3V48A 1CZOA 1TAHA 2H5EA 4GKJB 4S2UA 2RKBA 3VVCA 1CC1S 2GJSA 1MABA 3NH6A 4DO9A 4C06A 2LYAA 3B82A 2C78A 1QMGA 3SX0A 4JCCA 2OAEA 1NULA 3EUB2 2GM9A 1N32B 4N7JA 3WHIA 1NQXA 1ZJ5A 4DLZA 3E9ZA 5K51A 1S2LA 4UXIA 1U2DC 3E5HA 1L5HB 4KOAA 5G0WA 1WXFA 3R3JA 4NZ9A 1II0A 1K2VN 1NW3A 5BNWA 3R8XA 3RADC 4HZUB 1T0IA 5IU6A 4GOLD 3B38A 1X7ZB 4H7JA 4LBWA 3KQNA 2BMWA 3KPVA 2NW6A 3JZMA 3NWBA 2YWHA 4R2IA 4ESHA 4BX9A 1FJHA 2HMSA 4JWMA 1X1CA 2HNKA 4R9VA 1QOZA 2VAXA 3LD9A 4Z4GA 5D01A 3ZCQA 1JEAA 3BFVA 1DKMA 5CNJA 2JEIA 2WNSA 2DX7A 3WLIA 1Q12A 2A9RA 2QD3A 3GJRA 3DLHA 2HLPA 1H66A 2V7WA 3EZGA 3B5IA 3CCBA 5EMKA 3HMKA 5K8VA 1YB2A 2YH2A 3NT2A 2FN9A 2JFQA 1EB8A 2P3QA 3ZLJA 1ABEA 4KYVA 1KKXA 1ESZA 3SC2B 4F86A 1UXIA 2PLRA 5JWOA 3COSA 2K8BB 3I9KA 4NMXB 1W4CA 2QJTA 5KUTA 3IAAA 1NMXA 1F06A 3V2GA 4RULA 1UUFA 4WLNA 3BJIC 1A82A 5KFMA 3WB0A 2FETA 2G4VA 4Q8FA 3EASA 2VP3A 2GHIA 2IGBA 5U9CA 1QHXA 5NLLA 2IZ6A 3PXDA 5BO5A 3MTBA 2JL1A 4IFEA 5KYWA 5HKKA 2PVCA 3AVXA 3DH0A 3GARA 3THWA 5DDMA 3O91A 2JKYA 3GA7A 3CZ9A 2VZLA 2UYGA 3VR5H 3AR2A 4L8YA 4G9GA 4BVHA 1V8BA 5ADVA 1EDEA 2CDRA 1QCCA 4OGLA 2RQ5A 1RAHA 2FMXA 4K40A 3T5TA 3CX4A 1Z2CA 1T9AA 4D74A 1E9DA 3W2EA 2YXLA 3I37X 1KDZA 4NPAA 5CJ2A 4LTDA 2WAXA 4FE3A 1WP4A 7ICPA 2AOTB 1RYZA 4D56A 3LBAA 1EDDA 5FO1A 3PF9A 3KOYA 4RO0A 3RROA 1ZUNA 3H17A 4CKXA 5CW2A 1PP4A 2YHSA 4RGYA 2RJOA 2X7JA 3KEGA 3E5RA 1VB3A 2FR8A 5JS6A 3AI1A 3ITDA 5L3SB 1EUDB 4N65A 1NURA 4OD0A 1SVLA 3GLIB 2J0UA 1YCDA 2HHUA 1SBIA 1QCZA 4DIEA 3O4FA 1DLIA 1UBKS 1OBOA 5KVVA 4MIEA 3X43A 2Q5LA 3SR4A 1H23A 2JH9A 1USKA 4KQXA 2Q9UA 3WOHA 3AOEA 1RM3A 4MGZR 4TYNA 2E4ZA 2CFCA 1TQ6A 4UUOA 3VVBA 1OC4A 2DQYA 1EIWA 1KRWA 2QQFA 3OPNA 5FJJA 1Z4NA 1IEQA 2Y66A 3B6KA 2QVCA 5KJ6A 4EO9A 1T10A 5J2JA 2J1LA 3P0EA 2JRCA 1M0SA 3UJPA 4OQZA 3WA7A 2PX8A 1BCSB 2DWOA 1X8JA 1V45E 5EZSA 3ECAA 3I2GA 4BLTA 4X3CA 4DL2A 2BC9A 1YE8A 5DU2A 4HGYA 1PGJA 2VJYA 3ZV6A 3MGAA 4XUGB 1S0VA 1TV9A 3PYMA 2BEWB 3VPHA 5ECGC 3PC3A 4LMAA 2UYYA 2C9MA 2PE5A 5IARA 4RPZA 2FLNA 1FJGB 2X5KO 1Z13A 3HVHA 1QQAA 2WI8A 1S76D 4QOEA 1W34A 1K63A 1E7RA 1RI3A 3CZMA 2C99A 2AEMA 4DJ5X 1FDWA 9ICQA 2SNIE 3VVLA 1Z4JA 3JPOA 1I2CA 4XFDA 1E3MA 4ZT6A 3CR3C 4PN3A 2VWHA 4TUYA 2RC5A 2OG1A 2Y2UA 2FAXA 4UE6A 3W5BA 5CM9C 1VIAA 4CMJA 3OIDA 2VK4A 1P61B 3K05A 4JBWA 5KNLA 4E6EA 4BWVA 5KVSA 2VT6A 3LM8A 1X40A 4PLHA 4ZGWA 1P7WA 5L4SA 1R0KA 4UTZA 1NLUA 2QUIA 4HAYA 1N2OA 5SZKB 1JZSA 3L9WA 3MT0A 2WILA 4GHWA 2D3DA 4IQTA 4DSZA 4E5KA 3MR2A 2WP0A 3EY9A 4DPLA 1N3BA 4KLHA 3G9XA 3EJ6A 4JX8A 4AJEA 5JANA 4W82A 2JIRA 4CLRA 3CVYA 2R7NA 5J0PA 4D9NA 3U49A 4C1NA 1QYXA 2QTNA 3Q5DA 2E1PA 3BL5A 2O0KA 3I2IA 4BZQA 5BR8B 2QQGA 1JVSA 1ZUHA 3IR6A 4RK0A 3HB0A 3RC7A 3WYBA 2BONA 4YUYA 2B25A 4RQ2A 1T9DA 5B37A 2CHFA 4RZHA 2BIFA 4KSBA 2JGFA 4FZNA 2JDIA 3JQ9C 1L4GA 4CQNA 2VP5A 2NRWA 2QRUA 1NZPA 1XTRA 4O3QA 5KG7A 2XAUA 4DFKA 2QD2A 1BRTA 4NULA 2ZG6A 4JQSA 2JEOA 4U7WA 2R6AA 1V6AA 4XGQA 1DQZA 2UUOA 1ZQYA 2VPIA 4IZOA 3JQGA 3I12A 4CW7A 1CY0A 5J0XA 3X1WA 2CZQA 4Q6BA 4PC2A 9ICTA 1XQVA 2HRRA 5HQ3B 3A05A 3JQAB 3ZHCA 3JQ7B 2WYOA 1VYHA 4HQFA 1PNRA 4HBZA 4C8LA 4NCXA 4FUQA 3BWDD 5MF6A 1KI6B 5HS6A 1UBNA 5LNK6 4JC4A 1AGYA 3AF2A 1W0JD 3MQFA 1GTZA 1XZ8A 1K06A 5KOYA 2HBLA 3HYNA 3EMBA 4PYJA 1F0MA 4ACAA 2BFNA 7ICKA 1SWVA 1X6JA 1QP0A 2PO5A 3OM9A 4MOWA 4NECA 4PEVA 3VNRA 4TMYA 2Z9DA 1U7UA 4AICA 1XTSA 3DVSX 5CBPA 4K7JA 4S1WA 2HQSA 3TW8A 2X8WA 1HYGA 1G18A 4WJZA 1Y1LA 2I33A 3TARA 3SX4A 3C8UA 1KMIY 4ZQCB 2ECPA 5BUSA 4MMYB 4MW5A 2UVUA 3EVDA 2GCGA 1SHTX 2GFQA 1JFTA 4HPXB 3BRQA 2IYRA 4MYDA 5AW7A 3HB1A 4S1NA 2FPSA 5KHLB 1D2NA 1OYOA 1SRQA 2GYUA 1V5GA 3CA8A 2OD2A 1KU0A 4TL8A 4Q48A 1YQDA 1NVBA 5KFNA 3OQBA 4MPRA 4QSHA 4NJOA 4BY9E 1VKNA 2W2PA 1E0AA 1UOOA 4CNBA 2GEDA 3RF7A 1K6XA 3SZ3A 1N3LA 1P4HA 5LXTF 3KOMA 3EVFA 1RU3A 4TMFA 5DISB 4HS4A 1IQUA 2RGAA 2A88A 4BJ5A 1P75A 1W47A 4E51A 2G9UA 4Z3OA 4F72A 3F71A 3C21A 2IU4A 4D4GA 4KKXB 1YBAA 5AM5A 3DO6A 1ZA1A 3K70B 1UBCA 1M6VA 3BRSA 5ALPA 4D8YA 3EZ5A 5A6SA 2OILA 4HLDA 2RP5A 4E07A 1PYDA 4PHFA 3ZVLA 5AVRA 2WIKA 4E3WA 3STUA 5BXYA 4K1XA 4HD8A 1S8OA 2NNWB 3TLYA 1LNZA 4I2NA 3FCSB 4WEQA 1JUDA 2XEXA 5BWLA 4QECA 5FFMA 1CUDA 1NHWA 3CRRA 1PGQA 3LUDA 5J2HA 4G26A 2PUDA 4EYKA 3EEIA 2WJVA 1K8QA 1TJYA 2FZCA 2EBHX 4RENA 3C1AA 3G17A 3JVVA 4MRPA 1GSOA 1R6DA 2WJJA 4Q3DA 1B15A 3HCWA 3PW5A 3MTGA 4DABA 1LJUA 1RYYA 2OHVA 3WLMA 2CEAA 3OTOB 3I4LA 4OHFA 5CYFA 3WO1A 3T5AA 2H0RA 1GNRA 1NJXA 2KI5A 1XU9A 3VU1A 3FKSA 1MPXA 4QGFA 2D1FA 2AOUB 2L82A 1SHUX 1W44A 3B2NA 4ZAZA 4P31A 4FILA 4REQB 1TZBA 8GPBA 3GGOA 4K87A 3STWA 2DBYA 1XZHA 4QDKA 2JA1A 3GGCA 2FPXA 4ZQGA 2QX7A 4P4UA 1D1PA 3OIFA 4ODIA 2WOOA 1YFKA 2F8MA 1SD5A 2CJXA 4R31A 3T1OA 2Q7XA 5GY7A 2PV7A 5IHPA 4XDHA 4BFSA 3JQPA 2QRVB 2Y0CA 2I1QA 5IK2D 3A6LA 5EWLB 5SYNA 1ZQKA 1U0FA 1GKYA 2J3DA 3ZDAA 3PXBA 1OILA 1SHKA 1S0OA 3EVGA 2QG9A 5B1SA 4OI1A 3ESDA 3ETDA 2WWXA 3VRHA 4JYAB 3LQ4A 3TTVA 3ZV5A 3RIYA 1XRLA 3ZCVA 3MS7A 4MYCA 4MVJD 3T1NA 3AJDA 2H2IA 1M54A 4IWXA 1E2LA 2F1OA 3UH0A 4YPOA 5I7WA 2WBLC 3AR8A 1G6HA 2WTBA 4YUZA 1CQIB 4BP9A 4AMVA 3WS7A 4DUGA 1U8XX 4HR7A 2QZ9A 5IKOA 2VNKA 3WP0A 5HFNA 3PV8A 3OZEA 3E9RA 3ZU3A 1F2UB 3H3JA 3EEQA 2QTCA 3TAQA 3W5DA 5AKJA 4GXJA 3HFRA 5FPHA 2PS1A 1O95D 3OQHA 3OWXA 5MN5A 3BVPA 2O7QA 1YS2X 3ZJTA 2O2DA 3PX6A 1K7EB 3HDTA 4J0DA 2EDUA 3ZW9A 3HO8A 4O8ZA 4HKTA 2O8CA 5CM2Z 1H4SA 2ISQA 2PIDA 1J8YF 3MDAA 2B7BA 4HDKB 2ZTUA 4CEIB 5JAIA 3DM9B 2VDUE 4C0HA 4NMLA 4ZCRA 1CV2A 1DO8A 2QWXA 1BPEA 4RT3A 3SZRA 2YHIB 1EDZA 3IP1A 2OCEA 4EUSA 4MEYA 5L45A 4DMUB 2ASVA 4LOHA 2NU9B 4A0RA 2JANA 4TM8A 1Y6FA 4IEIA 4ZAFA 1EE9A 4H7IA 4OSPA 3JQFC 5CYGA 2UUPA 4AJNA 3GUYA 1ZI8A 2IZ7A 3JRNA 3JAMA 2Q3MA 5GZ3A 2R68A 2MAXA 1VLQA 4JVLA 1PQWA 2RK4A 2ETXA 2PH7A 3E2IA 4C2AA 4DIUA 1ZD4A 1SV4A 1ZHHA 3CFYA 3FE2A 4GPTA 4I19A 3MCZA 4QQRA 3AHJA 4Q43A 1EVEA 2AN5A 4M0EA 3SZOA 2XOKD 4WCFC 1JP7A 2BI7A 1Q3HA 3TSZA 3D4LA 5IN4A 4UB8U 2B9EA 3E84A 5CLQA 1ZMBA 4HRXA 2IX3A 2EGHA 1GO2A 5JSYA 4IQFA 3UN1A 4YAOA 3VHLB 3L7JA 3UAZA 2R1VB 3D31A 5SZIA 1TD1A 1UZMA 2D62A 4DOAA 1CIPA 1CQXA 1TK2A 1X80A 2P9JA 4C80A 3EODA 5FRDA 1JPVA 1OZ0A 1V16A 1RABA 1XX6A 1JKFA 4UUBA 4H1HA 1RZRA 4EFMA 4BQPA 5CLGA 2VF7A 2ZDGA 4DJDC 5ECYA 3KQHA 1M8FA 3Q98A 1IE3A 4II3A 3BGOS 3T15A 4LRYA 4AB1A 2W93A 4B3HA 3RYFA 4KMOB 3O4HA 3B6JA 3LZCA 4EF5A 3UAOA 4HQOA 2XW6A 4BO4A 5K4LA 4MWCA 4NPHA 3WGNA 1NW8A 2QR5A 4LS3A 2VP9A 2W54A 3O31A 2E7ZA 1U7WA 4UBOA 2C61A 1KTQA 2OMKA 4BKQA 5IBQA 3R6GA 4KSCA 2PCLA 2O1WA 4KPFC 3GT3A 2NVBA 2WUVA 1UFRA 1V9SA 5IAGA 3GXOA 3I0ZA 3EFEA 3C5CA 3ZXUB 1AC5A 1L5SA 1L5KA 2XDQB 1T5DX 2X3YA 1KETA 3ZR4B 4W5WA 5IWAB 4J9PA 5BQPA 4YMMA 5G3ZA 1RQNA 1SKAA 1VLHA 3BXHA 1KS2A 2FSGA 1KQFA 3AHFA 3BFXA 4XFJA 4PC7A 1AVTA 3DEZA 4CMEC 3BREA 3DTTA 5A4AA 4KQ2A 1O54A 3O6VA 1AG9A 4IKEA 4JAVC 3KHKA 2INGX 2PA3A 1N9GB 4QATA 5LZ4A 1YUBA 4G65A 3L49A 1CK4A 1JMKC 1P2TA 5CT5A 1F0PA 4P4OA 2QTRA 3URMA 4P5DA 4FFVA 1CJTC 1M74A 5C80A 1IB0A 1N6LA 3K9FC 1GCOA 4D97A 1FQOA 2ANBA 3ZY5A 4X1YB 4RY2A 1GLNA 5EKTA 1BEUB 3B13B 3SWWA 5IIJA 4DIDA 4IZ6A 2KD1A 4RH0A 4B3JA 4HYKA 1Q46A 1ZM9A 3AR4A 4YVFA 5HILA 1X14A 2OKGA 3KZ1E 2AD1A 1Z6ZA 3P26A 4P3NA 4Y2GA 5E8RA 4NENB 5H82A 1NM5C 1YFJA 4AQ7A 2GH1A 2HBRA 4BDTA 1I2DA 2ZTHA 4DJTA 1L7AA 2AMYA 5EHZA 3Q1LA 1PS8A 1NR1A 3MPUA 4KQGA 2Q5EA 3S28A 4TTAA 4LVSA 2YMMA 1MC1A 1U0OC 5KU1A 2EFDB 2ZSUA 3FHJA 2O6HA 4R16A 3RIGA 4EQ6A 1RRFA 5FIUA 4QZGA 2JHGA 2A1JB 3DOEA 1YDFA 3FPJA 4KW7A 5IUJC 4ZYYA 5FYQA 3RUCA 3R7NA 3N2YA 4C8KA 3KZXA 3SHQA 1Y9JA 3ZS9A 1VCOA 4BB0A 3FWHA 2OORA 2HSWA 5DMXA 3SSOA 3RSZA 2JS7A 4U0KA 2HNAA 3QU4A 3BD9A 1FVXA 2WHQA 1SIBE 3DXYA 4P4GA 1E64A 2OVBA 4G0XA 3T3MB 2VDMB 3ZDFA 2YQ5A 5EXDA 2LUOA 1ESCA 4EBFA 4J0HA 4FOTA 3HR8A 4EG7A 1KI7A 3C1UA 1RLIA 1Z0DA 3U44A 1JBKA 3SGLA 1JQAA 4Q3KA 5GAJA 2VQFB 2EWVA 3JWJA 4QUGA 2QTGA 4JV0A 2ZKIA 4HNQA 2I6QA 5CX1B 1KMHB 1M72A 5HX7A 3DAHA 2VL7A 3HPOA 3FTQA 4KZKA 4IKPA 4UPEA 2VQDA 3D64A 5FOTA 3KHRA 2YASA 3PZPA 2NVUB 1B4FA 1OX4A 4G84A 2KOBA 4BE4A 4F45A 2AU0A 4PYOA 2ZETA 4L95C 1OD6A 5AHWA 1TGYA 5DE3A 4LGVA 5BOSA 3L0ZA 2X7XA 2WIGA 1BVSA 4F4ZA 2Q0QA 2Z5VA 2M6SA 3PR2B 3BAZA 3MXOA 4DNPA 5LOVB 2XVYA 3WE7A 2HJ9A 4DSNA 1GQOA 4HYEA 3DBIA 3GN2A 1YR3A 3B53X 4XGRA 3D3EA 5E7JA 3RFTA 3F47A 4UAVA 5DBOA 2WIAA 3FNIA 2IHVA 4F4XA 4XLZA 2EQ5A 3FWYA 1J2RA 2VPZA 5G41A 3RQSA 1WAMA 3TQRA 4ENSA 2PNFA 4JLDA 4LJ9A 2D6FA 3M3HA 2XLCA 1EGQA 5KFZA 4JUDX 1XNHA 1WXIA 2AXTU 3ORHA 2EQBA 4LRUA 2X42A 3QXSA 1Q0QA 4MQUA 5KHAA 1ZRHA 3T7KA 4DZRA 2Q07A 1U4BA 4EPWA 1OLSB 5HJEA 4JD5A 1S3FA 4Y1RA 1FX0B 3K75D 3NTUA 3CO0S 1PU2A 4Q7MB 3PUWA 2CBGA 4XGIA 2GOLA 2WWGA 4ECAA 2NSLA 5DLEA 2X1HA 2O2EA 2PSDA 2WR8A 2ATVA 3PRKE 4WNYA 5DHAA 2BHLA 2Y67A 3DUFB 4FCVA 3GVCA 2IOFK 3TRHA 2UU9B 4K03A 3LTNC 9ICMA 2BFBA 4EK9A 4GC7A 4FJ2A 5EKDA 1J9ZA 1V8OA 3KJFA 4O2AA 1GPKA 4F2HA 2ZRLA 5A04A 4I36A 4QZ9A 1V1RB 5AXCA 1N4AA 3CRXA 1RM4A 4M04A 1NY5A 4Z1OA 4BGEA 4Q4LA 1CQZA 2ZUFA 3ITKA 3WRXA 4R01A 4EKDA 4Q1CA 1JFLA 4TUSA 2PMCA 4ER6A 2VT7A 2ZJ5A 2W4IA 1C41A 1M2KA 5KI6A 1JROA 3BCUA 1P45A 1W36B 2MINB 4IVPA 2AZDA 3CW9A 1NPDA 3ZU5A 4IM7A 5DCYA 1BEZA 4C7YA 2J3KA 1VFPA 3RYIA 4EGCB 5B4UA 3OURA 4EB3A 1AQ6A 1MFPA 3PD0A 2HMAA 1QS0B 4BWYA 4FGWA 1HMPA 5TRTA 4MHTA 4WOPA 3TW6A 1JXEA 2KV2A 1EDOA 1B76A 1D07A 2W11A 4EMTA 2ZUTA 2Y1CA 4F21A 1JSRA 1PWZA 1VOTA 1K88A 3FDIA 4OFXA 1G8GA 3AQFA 1NDHA 4YDSA 1AJEA 3H9GA 5F23A 4Y2YA 2BPFA 3GLVA 4Q18A 1XIVA 2NZJA 3Q0TA 2AOVA 3DFMA 1G66A 4HWPA 3HCOA 4L7QA 2WUFA 1N0WA 4TQUS 2KFZA 2QM7A 1XTTA 4AWXA 1XRMA 3CKMA 1PZEA 5BWCA 3VPGA 3HCAA 2OH2A 3A3YA 2RDMA 4OQNA 3I5UA 2P1ZA 1YRYE 5ARBA 3AVTA 4PPGA 1FNBA 1CJCA 3RK1A 4G89A 1PD0A 3UC9A 3QLUA 1XQXA 1XKXA 2YZKA 3UMGA 4GR9A 4ZAGA 4FHEA 3H4IA 2RD2A 2ZWPA 3EISA 2QNBA 4QWDA 2VDQB 3ASUA 1K4KA 4UBIA 1UQTA 1TI7A 2EQAA 4Q4AB 1XMPA 5AK3A 1KBZA 1E3WA 3T4EA 1HPLA 3CYMA 3B6ZA 3GCXA 1U2GC 3KU1A 4JUCA 1FFBA 3U40A 3EG9A 1L3IA 3G59A 5B1YA 4NV0A 2IVZA 5A7FA 1E59A 2H31A 4OHRA 1IPFA 4P0QA 3WZLA 3U9TA 3AF6A 2EH9A 1E69A 5JVDF 2C94A 2BFFA 3Q10A 3IKTA 4B7ZA 2PFQA 4ZEXA 2P5UA 5DYTA 5GIOE 2FZ4A 4M1SA 5EWGA 1ZJZA 3FDXA 3NP9A 5MFPA 3D2CA 4FZRA 5A4IS 2JFGA 7ICIA 3L8GA 1GPJA 4L22A 2G5CA 1L7NA 5JYDA 2RGCA 1CR0A 3K0SA 5BN1A 4EY6A 2Z56A 4X7BA 2Y2VA 4IDQA 3BF8A 1DBRA 1TK9A 3EDQA 3QX9A 4RQ6A 4BECA 1R74A 3WLKX 2VPXA 1YIOA 1PLLA 1XSEA 3LXMA 4GYKA 1E2KA 2WB2A 1AHPA 3E9MA 1JMYA 1BWPA 4WOJA 3AESB 2NADA 2QV7A 1U4OA 5KKAA 2FRDC 3U4QA 4CBVA 1YXMA 5AK5A 4DAOA 1JHXA 3QA9A 1A4XA 2PH3A 3KFXA 2CDBA 3R0VA 1HT2E 3RU3A 4XI9A 5I7EA 4RJJA 5B6IA 3OZVA 3FOZA 4OA5A 3AKZA 5JD5A 3KJXA 1KZYC 4UTRA 2GBLA 4DDVA 4L3OA 1J1IA 2E85A 1QYVA 1E9FA 1MRSA 3NWOA 1R00A 1C1HA 3GRFA 2FGJA 2P0EA 2N0SA 2W8KA 3NRBA 4WKNA 2GEJA 4Q1EA 1R64A 1YGYA 2IF2A 4LWOA 5I7RA 4G09A 4HUQB 5CW1A 2UYHA 4B7AA 4K9LA 4JR0A 4CCYA 1N2JA 2IPAB 5FLKA 1U8UA 2FLVA 4D44A 2G17A 2AWOA 1SU7A 4ARVA 2WPDA 4RMGA 1BDIA 1CUJA 3WMXA 5KJCA 3QA3E 2ZLBA 5J1TB 3H3FA 3PU6A 1D8LA 1AB5A 5BWBA 3ZHXA 2Q3EA 4GWKA 2HAEA 1XO1A 1O94C 2FCAA 5K8JB 2O3RA 3VOAA 2JAPA 2Q9BA 3CEHA 5DNVA 3GEMA 1CVRA 3ZZMA 1S0NA 3W2TA 1HGXA 1O57A 2EWMA 3VBCA 5LP1A 4EI8A 4BNGA 4MV9A 3VJKA 3DP7A 1YVPA 2HEIA 1VBMA 2NO7A 2AKAB 4WAUA 2K2WA 3KL4A 2WYIA 4DF8A 4G85A 3WYGA 4TYQA 1VGRA 4MEXA 3NTXA 5EPUA 1UKYA 1XTBA 4IDOA 4EKYA 2HVHA 3G2QA 1VRCA 3FNGA 5AVJA 2PBZA 3GAFA 4KLNA 3KOWA 4UQPA 2DWQA 4HNTA 1TVMA 1D6MA 1A5ZA 4H15A 3CX8A 5DG8A 1D4ZA 3KQVA 3C3JA 3T7CA 4DLAA 3O8QA 5TPZD 5IIKA 7REQB 2WTXA 3VV2A 4NBSA 1W48A 3WZ2A 2G7ZA 1ZXBA 1OGYA 3D8UA 4HEA1 1KC1A 1D1TA 3I58A 4ID3A 3TW8B 3EZ7A 1C4OA 2YN2A 5EIFA 2RHDA 3QKRB 4QIWC 2GBPA 1V0JA 1RLUA 5FAKA 4KBGA 1RAFA 3K9BA 3T7EA 2PKQO 2ZWOA 1VE1A 1I2ZA 3TLZA 1EHIA 3TQIA 3MMNA 3HLKA 4ZOHC 4R71A 2VEDA 4K6OA 1AX9A 3RIEA 4I99A 1W46A 2DFDA 5BN4B 5TSDA 2BE7A 1TOAA 1HYEA 5IX8A 4KPYA 2BUCA 4RVGA 5FOXA 2REQB 4C30A 4EY7A 4BKRA 3HLYA 5BWOA 4YCCA 3QE9Y 1RI5A 3VCBA 1SXPA 2D8AA 2PBFA 2PWBA 5FTWA 4ZC8A 2XB9A 5F98A 2BGTA 1YZGA 4J16C 1S8NA 4TGLA 2DECA 2D00A 5EIWA 5JJBA 1H1TA 1NONA 3AETA 3C5FA 4UAWA 3VJMA 3GEIA 2W58A 3STHA 3EBOA 5THKA 5KYXA 2XMZA 3OE1A 3Q2OA 1H93A 4LTMA 2CL6X 3N6RA 4P7GA 4RK1A 1VLJA 4E33A 3SG0A 1PEAA 4QLOA 5P8WA 2IYYA 1LNQA 3TZ6A 4RE5A 1W4RA 1FYFA 3AUFA 2VYFA 3WX0A 4GOJA 4S12A 3AVOA 1IN4A 1Q7RA 5JAQA 3QLEA 4QIHA 4UE3S 2R8XA 5T4HA 1M2OB 2HT6A 2NV3A 2ZIUB 1U6KA 2ID7A 4BGDA 4PSKA 1JQEA 2QJWA 1YU6A 3K92A 3H0RB 4XKJA 1E3EA 2VA9A 1SB8A 3HZZA 3IKVA 1NVFA 4BVAA 3E3OA 2EP8A 4YXWA 1XEAA 2C0PA 5EI5A 4ECUA 4AF7A 4NL4H 3ROEA 3PB3A 4UUPA 1KZ4A 3EOBI 4RVDA 4F2RA 4XJVA 3KZKA 2F17A 3FHLA 1J2EA 1KSFX 4TWAA 1FNMA 1Q7TA 3B6MA 3O1IC 2A5GA 4S0XA 3TSAA 4F2DA 3OZBA 1C8VB 3A7EA 3I0MA 4Q1DA 4N3BA 4CIWA 1I6WA 3CONA 3PUIA 4RSMA 5EP4A 2H1IA 3B7PA 2XZLA 1L4EA 4PNHA 2HRDA 2F1IA 3DAPA 3M1LA 2CYAA 4HX5A 3DHEA 1L5MA 4Q1BA 2HLHA 2XAAA 5KFQA 3HE3A 3H5VA 1OQAA 3FAHA 1G0NA 3L4PA 1UJ6A 3BORA 3DF7A 3LWMA 5COBA 2ZRCA 5U1PA 3ZQUA 2W8LA 1Z36A 1S3IA 1RBYA 3ID6C 3A3NA 1XMSA 3LIIA 1ZI6A 4EG8A 3C5EA 3DXXA 4BPBA 4TYPA 4RPKA 3IUPA 3CVXA 3UB4A 5I7SA 5K0FA 3FTPA 1WXDA 5EINA 3ZY3A 1XKQA 1O6FA 5TJ9A 1WPXA 4AKSA 4YJGA 2EYQA 3LHFA 2Y1GA 5KFKA 4Q9LA 3PSTA 4EPTA 3OBBA 1XZBA 1HDEA 2ZZNA 1FLDA 1XGKA 1QIGA 3ZDDA 3K1AA 3LP6A 3G8AA 3GJ6A 3TX2A 2RHTA 5C46F 4ILKA 1KI1A 5AKEA 3L6CA 1GUAA 1MQSA 4G1VA 3F3SA 1DARA 4LHWA 4V02A 1K3FA 1BHQ1 3AM9A 1E1QD 1LF5A 4M98A 3EIFA 2R8ZA 1FYEA 1R8YA 1NE2A 5A7HA 3HP7A 1MOPA 4I1OA 2CJWA 5JOQA 1YS6A 3OFKA 1GA4A 4GL2A 1VE6A 2PZMA 1YA8A 1YL7A 5C34B 4BMZA 5J4LA 2GS9A 2CXTA 2G1PA 3EA4A 1I36A 1STOA 2XYHA 4KSYA 4YAJA 3THYB 1XWLA 3LYHA 2R6JA 2OGUA 3EZYA 4BB5A 3HZHA 3AMVA 2IYLD 1WZ2A 4J1TC 3GUVA 1YKSA 1JAIA 2FEWB 4C3UA 4OHUA 4LXTA 3SR3A 4J90A 1QIIA 4C0AC 1BX1A 3KUXA 1P4GA 2B1RA 3UPQA 1PTKA 4R8UA 1C9NA 4W6QA 4XB2A 3WAJA 4EZIA 4WNAA 3OEEA 5CA0F 5G4KA 5DN6D 2ZCJA 1Y33E 1TFUA 1WCXA 3OOSA 5DWDA 1Y1QA 4G3XA 4BB6A 4PGGA 3S55A 1G6Q1 3OZSA 4JGGA 3BFKA 2X41A 2AKYA 4RV4A 4TWBA 2J87A 3IAFA 1VGVA 4JEUA 4DSFA 1L8LA 4NK5A 2MA1A 5ER9A 3BMCA 3AM4A 3D59A 4PZYA 3L5OA 2Y1DA 3BIOA 3ZWNA 4BC1A 2OY0A 1FSZA 3N2EA 2VIIA 4AYXA 1H5UA 3WDSA 1DEHA 3VHXB 3QW2A 4EWLA 2YVUA 2P1RA 2Q3BA 2ACWA 1EYZA 5IYZA 2BVNA 3DVLA 2QP3A 1L0BA 4CM6A 1K97A 4E4TA 4JWKA 5IVKA 4F9GA 4PG8A 4V0OA 3ZJ4A 3BC1A 3B9PA 4NCAA 1TO2E 3BKWA 4DV2B 1BZYA 3E82A 1BTOA 3H5OA 2NACA 4L8VA 5FPTA 3DPIA 2P3OA 1E4VA 4FMCB 2R0QC 1LD3A 3TSYA 2R8JA 2RKWA 2V4QA 3ZVMA 3LXUX 3ER9A 1X80B 3JWIA 2YY5A 1T0HB 1JIQA 3FYUC 2ZRAA 3OLZA 1G4AE 4J9UE 3ZE2B 4CEJB 3AJ9A 4UEOA 3CVVA 3KXKA 3PSFA 3UQYS 4QT4A 1OJLA 4L9SA 2JGEA 1Y34E 3LT5A 1IHOA 1YDEA 3V33A 4WZ6A 1QYIA 4XSGA 4HGQA 5LQMA 2UZ1A 4MV7A 3HTXA 5HKBA 2XR1A 3FOCA 1OY1A 2IUUA 2A3RA 1Z7GA 4QFMA 4I55F 3IIIA 3L2OB 4EJMA 1E9VA 1LVGA 2VAMA 4QUEA 3JQ6A 1NFQA 4CLOA 4RKWA 3WFJA 1KL9A 2QM3A 1SGWA 5EHIA 2VATA 5J0OA 3T0IA 3ZDEA 3G6KA 2BMEA 3EMVA 2BZSA 3JR7A 1YB7A 7ICOA 2OCIA 4QWEA 4WIAA 4JUZA 5EQDA 1PVDA 2EX1A 2FCRA 4G0PA 4AZ0A 2EAOA 1PR6A 3K0FB 4FDMA 1WEHA 1D9XA 4YLGA 2G0AA 3NIFB 1XJQA 1RQRA 4QULA 1QSYA 2XVZA 3WLSA 4LNHA 2II6A 1QDEA 2Y1FA 1YJXA 4C05A 2JARA 1VMKA 4HH3C 1MXHA 4TTIA 13PKA 1LSOA 4YQWA 4Z0NA 1SK9A 3TFQA 2ZJ0A 2JCSA 3OX4A 5IC6A 3EDCA 2YYYA 2F8TA 2RJNA 1IUKA 5J2TB 5KL1B 3ZWXA 2PX3A 1FPMA 4KLJA 4FYJA 5B55A 2ZR8A 4RTMA 3VDXA 2YVKA 1CJMA 1MR3F 4R98A 4QTTB 4X45A 1M1NA 3HEAA 5F35A 3WIEA 2PXXA 1MA7A 3PCXA 3UJ7A 5CA1A 1IZZA 5FWAA 5ALDA 4NL9A 4MUJA 2X0NA 4K8OA 5KAMA 5T8KC 4EVIA 3PHJA 1IWBB 3PRJA 3RSGA 4R1TA 4KWIA 4P4SB 1MNAA 2QJOA 1MDBA 3OWOA 2XYQA 9ICRA 3K16A 4A2QA 3A9UA 3UWMA 1QUFA 4IVQA 1C7YA 3EPHA 1FMLA 3KHHA 5LYYA 4HAIA 1NW6A 4EG4A 1Z7BA 2Y6VA 5KPJA 1G6KA 1Q3VA 2VHCA 3QOWA 2G77B 2ZE5A 3FD8A 3GVHA 5T67A 1YIAA 4RLSA 5BSRA 3AFIA 4ED6A 1GNVA 5BQ3A 3NYQA 1ONNA 2G25A 2JBHA 4XWWA 4HADA 3FN4A 2RK3A 1UWCA 2LCIA 4B81A 2V3VA 3A4NA 1RRKA 4PN7A 2NU6A 4LPSA 3L1JA 1JXQA 4TT3A 2XMSA 3FPSA 2XY7A 1SOWA 1XQ1A 3I9NA 5L40A 4M7PA 4PBTA 5F2EA 1QOPB 2XHZA 4G25A 4NHOA 4XVQA 3ZPXA 2P69A 1Z0AA 5DGBA 5DYIA 2W22A 3TF5A 4EY8A 1JDVA 4UB1A 3CPSA 4MWDA 3V1YA 3PXGA 4OO1J 3WAKA 4C7ZA 2GUWA 1M2VB 2XMBA 3ICCA 1H0HA 1ZNWA 4OHVA 4Y1GA 1BQ4A 1J39A 5F7XA 1ZQTA 4GLOA 4GFDA 4CQMB 1YL6A 4KTTE 1KOLA 3SEQA 1ZOLA 4A8JA 4H0FA 3GFBA 3J7TA 3T99A 1M1UA 1JHRA 1CR4A 1XD2A 5B4TA 4YN3A 1OROA 3WJAA 3P4YA 5KTNA 2X5XA 1LSUA 4Z99A 1V1JA 2DFKB 2CDAA 2IIPA 1AE1A 4JOQA 1C81A 4QZDA 4AK9A 1Z0IA 1HA3A 5KG1A 1V9CA 2BJVA 4BFYA 4DPKA 4XPZA 4KQ6A 1COWD 2VWPA 1ISHA 3JD1A 3IP8A 1X1BA 2C2YA 1OBCA 4ARIA 5TGTA 3TPZA 4WY2A 2R48A 1QM5A 4KMMA 3G5TA 5AHKA 3ESCA 5LLTA 2QLLA 3RREA 1P8JA 1DXSA 1MF7A 4YRRA 3BILA 1U5CA 2JLRA 2HJWA 5EPEA 1ZN2A 4R5HA 4RQMA 2CXUA 1UWKA 2FR1A 3IX7A 3DKPA 4KMUA 4RQAA 5JSHA 1U2EA 3O1JC 3UMSA 1H2WA 2PFNA 3NVMB 4KAAA 1KFDA 4KXFB 2JIDA 1ACLA 4LFCB 1C7IA 5EFOA 1YMQA 1NUUA 1D2GA 1EFVA 4MA0A 2VBIA 4JUAA 3L7CA 1ZQUA 1E60A 2GZDA 3G0CA 5B3KA 3WAGA 5NULA 4PQRA 4KE7A 4XWTA 3QVSA 3G1UA 3F7MA 4KAJA 1C0EA 3G5LA 2C95A 3PDUA 3NRJA 1O4WA 3D5EA 3MIZA 4YWJA 2DF4B 3FYSA 4UNPA 3NPMA 4JB8A 1XA4A 2UZ4A 4ND6A 2NN3C 4Y2TA 5CCEA 4ZD6A 1PK1B 1NVGA 5JC8A 4EY4A 1IFXA 4AKEA 1CE8B 1ZQCA 4FYMA 5E0KB 4EHNA 4L9AA 3D3JA 3MFYA 1I0ZA 1PWYE 2CXPA 3PKJA 3SXUA 1MENA 1IXRA 4X20A 4C2UA 3BJZA 2BFBB 1BE0A 4F4YA 1VIVA 4CKEA 3K0AA 3M0EA 4TS9A 4LZWA 4N7RA 5TS2A 5HR7A 3BDPA 3VO8A 2YHAA 5H83A 1M0WA 1ORWA 3UGKA 2EKBA 4Y2VA 3PV0A 2B82A 5DTRA 4CTMA 4IIEA 1VPTA 1MBZA 4PL2A 3N74A 2DT5A 1WUJS 4X3PA 4L57A 3RH4A 3LY8A 2IXTA 1P18A 2D2IA 1CY2A 3M6FA 4P8RA 4EGQA 2YV3A 4LOKA 3HWRA 4N9QA 3VUFA 5HJ7A 3FZEA 3HW8A 1ND5A 2P78A 3M6IA 1NF3A 1DKPA 1IH8A 4CT5A 2IHZA 3VNAA 4DL9A 3IDSA 4G5XA 3PT9A 9ABPA 4IIVA 8ICPA 5CEEA 3LKVA 1DRGA 2CRXA 2OV4A 1D2HA 1N7JA 3M8SA 4J9OA 1IU9A 2GJKA 1S02A 4KWTA 3D8BA 2HHSA 3FSGA 1F38A 4R2XA 1UQUA 1VPVA 3A9CA 1EK0A 4HBGA 4KAFA 4PTYA 3UANA 3OIWA 4ZQIA 1R0YA 1Y7HA 2LW7A 2AG6A 3E7DA 3ISVA 2KSOA 3TIIA 4CMGA 2Q1WA 4MYUA 5A5EA 2XY4A 3T41A 1Y80A 4I50F 1ZAKA 4H7EA 4Y2UA 1JKJA 1MOQA 9ICUA 4WJKB 3PPYA 3T5PA 3RIXA 4LZOA 2D0IA 3AIMA 4Z6EA 4ZYVA 1XSNA 1U0BB 3H2ZA 1Z4PX 3RYTC 4B7UA 5H4HA 2HMVA 4IQUA 2AXQA 5KTRA 4PH5A 1L8OA 3HABA 1XLTC 1ISGA 3ZGZA 2JZCA 1F0NA 1LPAB 2A59A 2R00C 4BLRA 5BV2P 2O8FB 1IN6A 5C8XA 4UCQA 3D6AA 3DOHA 5LYJA 1J8QA 3IT1A 3WL8A 3KKOA 1TRKA 2QARB 2JLUA 1KWKA 2NV0A 4UBNA 1K5HA 1SOMA 1R6AA 2FPRA 3T5JA 2YOGA 2HA2A 1CNEA 2W2LA 4B9MA 4HNRA 1PR0A 4JXXA 4JJAA 4QKQA 4MKIA 2VTVA 4UVGA 1C8BA 5A3VA 1EJ6A 3CZ4A 5C1OA 3T1TA 4ZN6A 2ZI4A 1L3VA 1W8IA 2GZMA 3K2EA 3UM9A 3PNOA 2BI8A 1J5PA 3VZRA 2OO5A 2XVTA 3SHVA 1UZUA 3OF2A 1SELA 1I30A 3ZDZB 3NH9A 1E6WA 4GP7A 1O6ZA 4DBLE 3IAS1 3KYBA 4I9NA 3AU9A 1GRNA 3G5AA 1EFRD 1QH8B 4W7IA 4RYDA 2EV9A 1W35A 1PK8A 4Q0MA 3AXSA 2AQ4A 1M8JA 4URYR 3HN2A 1KQQA 3U4QB 3ZNNA 3KKPA 3WK9A 4RAQA 5AD1A 4F06A 4TLBA 3AFHA 1ZIOA 4F5YA 3GY0A 1N61A 3HP1A 4Z53A 1R8JA 2WTUA 1BPXA 1NXTA 1DUVG 4J49A 3RI3A 3KR1A 1JNXX 5A6VA 1XJWA 4OHPA 3UCXA 3HXPA 4KRFA 5FX2A 5UKDA 1VE9A 4ZEMA 3QBDA 2YB1A 3TAPA 4I2HA 2H11A 2F7SA 1KFCB 3IAM1 4JIGA 4R69A 4YRTA 3WKDA 5LA6F 1A69A 4OHBA 2WE8A 5AMXA 1F17A 2QNRA 2FWIA 2EBUA 4H4DA 4HFJA 1XQYA 1IEVA 1BNPA 3F2CA 1GUDA 1YZHA 4JFAA 2IZOA 1I7LA 3DDNA 4BLOA 3NGLA 4R1PA 2R4TA 5BW6B 2A5FA 4ZYXA 3NBQA 2JK1A 3QUCA 3M34A 1LS6A 1ZQMA 3LUCA 4LQLA 1XI2A 1X7YA 3QZ7A 1Q15A 5D6NA 1Z4IA 2XYGA 3L7OA 3R6DA 5I8ZA 1ZKDA 4RJTA 1SV0A 1PYGA 4Q9KA 3QH4A 4EKGA 5GGXA 4EHBA 1N1EA 4LF6B 2PD6A 3N76A 1QPBA 4YO8A 3NO4A 5CCXA 1JR3D 1MJ5A 3R3HA 4ZIRA 1PUIA 2Z57A 1PNTA 3OLVA 1RC1A 2Z83A 3I0NA 1WRBA 3RS8A 3LBIA 1UBRS 3NS1A 3PKZA 3THXA 1L7VC 1DV2A 1WUHS 2QLNA 4LRSB 4QOGA 4DFJA 2FMHA 1IY0A 4OQXA 2C8VA 2PLNA 3SEZA 2P6PA 1XRNA 3ELUA 4NXNB 5H2FU 3BE8A 4KXYA 3L84A 2LKYA 1PR9A 2IDJA 1VG8A 3MTEA 1YVUA 4CN8A 5CVCA 3BL6A 1BQEA 3KYCB 3PDWA 4XWKA 1LTHR 4QGSA 5DCLA 5FULA 4NLKA 3AUAA 4GMHA 3UA3A 2Z9CA 1ECBA 2LZ0A 2DKFA 1LVHA 2H7VA 2QX9A 4C88A 1Y6ZA 3ILVA 1B7GO 3QLVC 1ESMA 1KNXA 1W5SA 1YQ9A 2AA3A 2A4KA 1MJGA 3BD8A 1WCNA 3D6MA 4JKIA 5B5EU 5A1JA 2ON6A 2WFZA 5JZVA 2XB2A 2HSGA 3QEJA 1KAQA 1T2FA 5ITZA 2A1TS 5AW5A 3KKQA 5SZJA 2WF5A 4FFNA 5M5BA 1NXSA 3IA7A 4G4SP 5KFXA 5JD6A 4HGOA 1NW7A 1AMOA 1UOEA 1SNYA 1T8RA 4MQBA 1BNCA 4N6NA 4QX6A 5K8TA 2R8BA 4TSRA 2R6ZA 1YS4A 1UC9A 5SYAA 1XNSA 4NCKA 5CFNA 4E2ZA 5KG4A 1G1MA 5CITA 2QQ5A 5KYXB 1T5HX 1MOSA 3TJMA 1NXXA 2I3ZA 5H70A 3OTWA 3R3SA 5CWRA 2E8PA 1L7QA 1TCCA 2GKOA 1U9ZA 3B1WA 1SKWA 3FBWA 1SN7A 2PR7A 4WLVA 1XZAA 2GDZA 3N9IA 5FFNA 4EZBA 1F20A 4BQFA 1WHSB 2IHKA 2O0HA 4QZFA 5KVAA 5GGYA 2J09A 4DOCA 1L9KA 2FA9A 1MH1A 5BORA 3UBTA 4GI3A 4M0FA 3L0IB 1DFIA 1IG6A 5H16A 1MOZA 1XC7A 3I2YX 1ISPA 3P9QA 4TS4A 5EESA 1D1SA 1FK8A 3CO5A 4O02B 2R86A 3H4BA 4UOEA 2Q5FA 2LI6A 4RTPA 4Y2SA 3L0CA 1LLUA 5ILGA 3JATA 3P9SA 1SUIA 1UPBA 2Q6KA 5IDWA 4BMYA 1O97C 5JAOA 1FP4A 3KHGA 5JZMA 2ZBRA 4CKWA 3A4LA 3K0HA 1FE8A 2TS1A 3LX5A 4YYEA 1WDWB 3TI0A 5ALGA 2BUAA 1EK2A 4XVHA 1AZLA 3QXCA 1ORIA 4M9ZA 3D4PA 8ICSA 3MD9A 3O82A 4QRHA 4L5CA 4UBLA 2GTIA 4WV3A 1K8YB 4ZQFA 2BQ3A 3ZZUA 1Z37A 3LL7A 1DTWB 2YHUA 3GV7B 1G9XA 1QO0A 1OXKB 2C07A 5D1NA 1PK7A 1VLMA 2A33A 3GEEA 2QBYA 3F78A 5JDIA 1U7PA 3OPQA 4UNNA 2WJGA 5TMBA 4DE5A 2HC9A 1RWVA 2Y76A 2C31A 1TECE 4MGEA 2V97A 4CR6A 1CP3A 4Q4HA 4YUWA 2C2DA 4QIWF 2ZBDA 3FMFA 2W98A 3WISA 3HN6A 4TTSA 4RHTA 4TLMB 2X4GA 2ST1A 4O4IB 1U8AA 3M6UA 4P3YA 1MP0A 4M9UA 2I29A 3LPAA 1I5EA 3WG9A 4IJKA 4DA6A 3JARB 2Y77A 3VQTA 2UZ0A 4UBJA 1N4DA 2VDVE 5HR6A 1D1QA 3R3YA 4P7JA 5GJCA 1YTLA 4TSFA 1T1JA 4R0NA 3E03A 5AVQA 2JXJA 3SDBA 3HKCB 2EFEB 3LE8A 1WCYA 1IBCA 3K8YA 3CCCA 2IEDA 4I1SA 1X9SA 5GADl 1E4OA 4RNOA 2B4RO 3AUYA 1S1CA 2QDXA 1GV0A 4XUEA 4G5RA 5ICSA 4KODA 4PLFA 3DNPA 2RI0A 1KJ8A 1RE0A 4U7FA 2ORIA 3E2PA 4EHLA 3QV2A 5BRAA 3VDNB 1MABB 5FOVA 3A31A 3LKBA 3B52X 3ZJ5A 1TUBA 2NAPA 1ZGCA 1CF4A 2VXBA 1NP6A 1NN1A 4EFDA 5K0BA 1A4UA 2IY8A 2BM9A 4D9MA 1A9YA 4Q93A 3HCPA 1QZTA 3RBXA 1XZEA 2PSSA 1SUPA 5E9AA 3MJ4A 5EE3A 8ICIA 4V3CA 4DY6A 4LV6A 3G2PA 3NBYC 2YFHA 5A5FA 3KB6A 5AW9A 4LF7B 3AVWA 1MB4A 4MV6A 2XUQA 1B0ZA 1NVVQ 3T61A 1QHGA 3HGQA 2OFOA 3R6WA 5IZ4A 4XRHA 1GAEO 2IPOA 1ZS9A 4EBCA 4YRBA 5AH0A 3QNUA 2DG2A 4NFYA 1TTQB 5CCDA 2NZ8A 3DVAA 3V2IA 2GB4A 3SQIA 1LW6E 3SQDA 3W3AH 1QVVA 1XZCA 1R6VA 3ZK7A 2AUNA 4IGIA 5KJFA 1UZLA 3CURA 4B34A 4IS3A 5KVCA 3F74A 4NU0A 2K7ZA 2C8LA 2ZAMA 4F38A 1XAGA 3VXKA 3G0GA 2ECOA 3O95A 4JVOA 4C87A 4X8LA 5C1PA 5CNKA 2H9IA 1N57A 3C5GA 2BGNA 1FNDA 3A0RB 2FSVC 3RBZA 1QHEA 1FP6A 5KYWB 4G5OA 5EXTA 4X84A 1DAIA 2HJRA 2FDCA 4AG3A 3EIXA 4RVHA 5A9RA 3E3NA 1D6SA 3THWB 1ODKA 1DC5A 5TB5A 3H86A 3OT5A 1MA0A 3A8TA 1XXHA 1U4NA 1S6YA 1UBTS 5AVKA 3GK3A 2GLEA 5F9MA 1QCYA 3UO8B 4B5KA 1H2FA 4RD6A 3ZX4A 1UK8A 1MC8A 1DUIA 1W52X 4I3GA 2GESA 3UMCA 1ORRA 1ZUNB 2WV7A 3EIQA 4AUNA 1RYFA 5JMOA 2GPJA 4JSTA 3GN1A 1EMDA 3HCRA 4DLVA 1FBNA 1E1KA 5KFOA 7ICLA 4RPIA 4OJ6A 5HK8A 3EUFA 5THXA 5E3HA 3D0OA 3RS0A 4L5IA 2J0UB 3HU2A 3JQBC 2V5AA 4R2HA 3I5AA 2OOSA 3Q3VA 4L6IA 1UJCA 1VRVA 2A84A 3LPDA 4U5QA 2AC4A 2ZUWA 4QYWA 2DL0A 4KI0A 2ZI3A 5L3RA 4GZ5A 1RAIA 1WHTA 2IY7A 3KJNA 7ICUA 3FRJA 1SCNE 3GFGA 1YB5A 1VLBA 3IDZA 1QLHA 1WSBA 3CPJB 4YAFA 1LDNA 2PD3A 4DNXA 1V41E 1FXWA 1JYEA 4BGUA 1XZDA 2O48X 3GVIA 1FP2A 1U3FA 2VYVA 1WLYA 4JOSA 5E7QA 4BVLA 4PTZA 3K30A 2G0NA 4LVCA 3LKZA 1IVYA 2YRFA 1OFVA 2Q4BA 2R8OA 3CU5A 1FSPA 3PGJA 3MR3A 3BCHA 4FB5A 1AO0A 3G2MA 2X2PA 2JG3A 1TMOA 2PUAA 3MERA 2WIFA 3P97A 2FWMX 2FI1A 2Z43A 4C5AA 2I62A 1I4EB 4W1RA 1E9CA 4X6XA 5JT1A 1WMEA 4L74A 3AQEA 4J1SA 4MF2A 5T3YA 1ZN7A 2ET6A 4TUYB 5DSXA 1RZ3A 3RPEA 2PL5A 4BKMA 3R8CA 3FF1A 4QGAA 3WBBA 5JLJA 4UB2A 1BFUA 4LMBA 1RTTA 1VMEA 4QAQA 4MDHA 2QNIA 5BY2A 4Z4QA 3VC3A 1A8PA 3NMUF 4MWSA 4ZCSA 5C81A 4FFSA 5A03A 1XU7A 2IS1A 3OKFA 1AGNA 4R9SA 4UEJA 3DL4A 1G38A 2CEKA 4D99A 1SXJD 4L78A 2HMTA 3ABIA 3WWYA 5IABA 3IELA 3LT0A 4GX5A 1TNDA 4P9NA 3Q8RB 3FPEA 1UC8A 3DDWA 5CLHA 1SVIA 3DDUA 3NCHA 4BO1A 4XD7A 2O3QA 2BGUA 2WM9B 3GGDA 4CM8A 1KHHA 3PC2A 2WNHA 2C7VA 3CE9A 1VJRA 3Q12A 3GI1A 4J2HA 4CLRB 3R4VA 3FJ1A 1DAOA 3DNMA 2AGVA 4KVGA 5CFOA 3O0FA 5KC8A 4M53A 2WM3A 3BXEA 1A2OA 1XD2B 3V55A 3ZHOA 4K28A 2A35A 3V00A 4MB6A 3AUKA 2RHFA 4I7EA 4C7VA 3VYUB 2QXUA 4H35A 4RY8A 2HHAA 1ZR4A 3E7PA 1HKUA 1OYVA 4ML3A 1I3OA 4PNZA 5K9ZA 2AF3C 2BEUA 4C0SA 4ZQHA 5AM3A 3B3AA 3TNYA 4PPFA 1LH0A 4TRJA 4IFIA 5CH5A 3F3KA 3PO4A 1XZMA 4JLPA 2Q4TA 1Z15A 3CUEF 4BVFA 1ZQSA 2DTDA 4HLUA 3ZN2A 4LMPA 1P2DA 2P68A 3IMFA 3WLJA 4Q37A 5K5EA 3JQGB 2C2BA 1JTFA 1TD9A 2IYEA 1UEIA 4D9HA 4KN8A 1UP7A 1VL8A 1LZLA 2GA8A 2PFSA 3NUZA 1UA1A 2DCMA 1EFVB 2NYVA 4NLNA 4DVGA 4BC0A 1X38A 2OR3A 5HGXA 5JI2E 2AR0A 1K2WA 3G68A 3PF8A 2P4QA 1N3YA 3IDAA 1OTXA 4TQAA 2IDMA 2BDTA 4ZVRA 1JS1X 2K87A 2NVWA 2FLLA 2BY4A 3O8BA 5C4IA 1IN1A 5EKXA 2V54A 3FWPA 1YFZA 4YHBA 4WJ3B 3KALA 2W6MA 1KL7A 3C7CB 4ELTA 3RTEA 1W75A 1UCFA 3FPCA 4FJ1A 1X42A 5JWRA 5KAFU 2I2FA 4C04A 3IXMA 3DBVO 4C29A 4RORA 3RKRA 3IHQB 9ICJA 5CBPB 3MGVA 2LCFA 2G09A 4E7PA 1I9GA 2O4CA 3WQQA 2JASA 1PNQA 1Z6YA 5FPQA 4X62B 4NE7A 3RS3A 1BMFD 3P0HA 3ANYB 4BAGA 1N60A 4PHCA 4PQGA 4EHKA 3QVTA 4CG2A 2BCGY 1ST3A 2GAOA 5LDDC 5JO9A 2OXEA 3WLFA 5B1EA 3N1UA 1OWMA 2ATXA 1RPTA 2DBQA 3GCWA 3BRCA 5JXGA 1FNNA 1ZIXA 2ZB8A 2DUWA 5CB0A 1PFQA 5KFPA 2YHBA 3D0QA 5ADUS 4BU1A 3IHWA 1AA9A 3NKFA 5FO0A 4RPJA 2FZEA 3M8KA 4FJ0A 1QGAA 4BATA 5JNWA 5IJZA 1LV5A 1HUOA 2ENWA 3GPCA 5EQFA 4KFRA 1FDRA 3KK0A 2RHBA 5F3DA 3OHAA 1T34A 1TQDA 3V9AA 4X94A 5GTIU 4TM7A 2AHRA 2PRKA 3ZE8A 3ETHA 4CCSA 2D06A 3D4BA 4MZXA 5I47A 1K9VF 4QJ3A 2I66A 2OCDA 9ICKA 3UW1A 2QSZA 3NDPA 1O9GA 3SCZA 1RHQA 1OH8A 5C4MA 4GOMD 4WMLA 1AN0A 1M6VB 3U4MA 3OCUA 4UARA 3KU4A 5A6SB 2GZAA 4KX5A 1NPTO 5K09A 2XECA 3LCCA 4NYIR 2I4LA 2KSOB 3K4HA 5K3CA 2YS7A 2H0AA 4EX7A 3SICE 4B4OA 1GTVA 1WBBA 2QRQA 8ADHA 1OXTA 1GADO 2XCUA 4MUEA 4MW1A 2JFNA 3NTLA 1L5VA 2DH6A 2H5IA 4L0CA 4FX2A 1VL5A 3KQWA 1J8FA 3U26A 4H4EA 3NHJA 5L1JA 2X23A 2FSIA 5CJJA 4GOXA 5FLEX 9ICWA 1KK3A 3DC7A 5KTPA 3BYZA 4CL8A 2HNBA 4KLEA 1QH1A 1UP6A 3B70A 3CF6R 2OFFA 5LYJB 4P3OA 5DYYA 3GVXA 3NBMA 4TTJA 2PRYA 5D3MA 1X9XA 1AMNA 4NYJQ 4II2A 5IFKA 3M9MB 2ERXA 1U1EA 4LDQA 1IN7A 2CHEA 1NBIA 5JUWA 1QV9A 2HQBA 1ZGAA 5KNDD 3HL0A 2AN4A 4TURA 3EE6A 3HILA 2QIPA 4U2DA 5A5DA 4K88A 3OCJA 2YY6A 1SVNA 4PLTA 1P7YA 1N48A 3EPIA 1FCJA 5FJIA 4NNPA 1J2MA 2WZQA 3WJ2A 3L8DA 3D9QX 3TJRA 2VIXA 2Q3DA 4FLMA 4IVNA 4UQOA 2KZMA 4ETNA 1YA6A 4NX2A 3JV7A 4DMLA 1B8PA 4PYLA 4PSAA 1YQWA 4YT8A 1U98A 1U5BA 4RM3A 2QT0A 4Z4EA 1OUMA 4RHEA 3UV6A 1NBMD 2SECE 2IV2X 3DGEC 4CIVA 1L7PA 2WG1A 4JASB 4ZJPA 2BH2A 3AHGA 1S3GA 2ZSFA 3PC4A 4QARA 1BPDA 3K9LA 4PAQA 3H5WA 3B7WA 1N2EA 1S9HA 1FVHA 3FM9A 1ZJWA 3IUYA 2YV5A 3LW8A 4YX9A 2AJDA 5ISMA 2Q5CA 3OWHA 1HYQA 2ZQ5A 1SCKA 1KQNA 5IUNC 4D57A 2EKDA 1DQSA 4BWGA 4V1CA 3OF3A 4GXKA 1A8IA 2E4UA 4LHVA 2FPPA 5BOMA 4YI5A 3W8NA 2PX2A 1QCKA 2XITA 1X9IA 1W1UA 4MS4A 3DTVA 4GE0A 1AKVA 2L42A 2PR2A 2B1GA 4X44A 7ICQA 1G8HA 2O8CB 5TQ2A 4DQSA 3AEQA 3FLEA 3CUWA 4G0UA 1QR6A 1KVSA 2ZJFA 1B8OA 3WL4A 4CM4A 4CPDA 3UXNA 5EJ9A 5EZ6B 4MEJA 1PL7A 4UOZA 4N6GA 3CF4A 4LUCA 4YXMA 3AHIA 2W5UA 1Y1TA 4QVIA 2B8TA 1RHUA 4QBTA 2FVYA 5DHSA 3FFTA 5BMVF 4L3VA 4ASUA 2D1RA 2D8CA 2P40A 1Z1VA 4FW9A 1EVJA 1KQPA 2G1AA 4HVLA 2ZAGA 4TVOA 1ZGJA 4TLDA 4J75A 3TRDA 2DVMA 2P90A 5CIWA 1OW3B 1U3GA 4DV6B 3T9BA 4TQRA 1CW2B 4WWHA 3D81A 4C5CA 4AD8A 5COQA 3N3BC 3E81A 4OAPA 2N3ZA 4OGWA 1PHRA 4E2FA 3H1AA 1VJ5A 2X76A 4M88A 4B6EA 1OAAA 4WDRA 2C3UA 1QLJA 1NXOA 2VWGA 3GPBA 3V5NA 1H5NA 4ZIRB 4QQNA 4D9JA 1T94A 3RUEA 4BNHA 1E5DA 2P8SA 5DGCA 5DLPA 2HWXA 2W3SA 3OHBA 1G17A 3OJLA 1PYOA 3HCEA 2KJ8A 3LO5A 3KQUA 4MJLA 4UCWA 1QP8A 4BRSA 1WWVA 1A5AB 2UXCB 2C84A 4NU8X 3AV3A 1V16B 2VT3A 2QUBA 1UEJA 1W5FA 4LF9B 4BTEA 4UFPA 2WE7A 4H60A 5IM4A 5CT4A 4WVFA 2R87A 3U13A 4HN4B 1GTL1 4RSHA 4U1RA 1KVRA 4XUDA 5F9HA 3HJFA 2G80A 2EZXA 4U7DA 1E92A 3TSCA 2KICA 5L8VA 1ZN9A 1XZJA 3NEJA 4QXAA 2PRJA 3RYFB 2UXDB 4PGXA 1KJ9A 2BF4A 3C3XA 5CG1A 5T14A 3GPDG 4NDAA 2C0CA 5DLGA 3MGCA 1AQIA 2XMRA 4CLHA 3A9RA 5JRDS 4KLUA 3IBGA 3JVEA 5FA6A 4DDHA 2WV9A 5E6UA 3L6RA 2M32A 3V7NA 4Y6PA 3ST7A 4MVJP 2EJBA 4ADSG 4AJ1A 3OPVA 5ALXA 1M1YA 3TOXA 1LBEA 2IYUA 4JIMA 3E18A 3PQCA 2NZYA 1YRWA 4BRZA 1VJ0A 4DUPA 2JAHA 2V7QD 1WJGA 1AA6A 4FKBA 3HXKA 4JH0A 1LPOA 3R0JA 4IIJA 1P0MA 3ZGXA 3ANTA 1ZQVA 1V7PC 2HU2A 4BZXA 3TIGA 1RYNA 5IJWA 1PJSA 4G23A 1I1HA 1I1OA 4MW2A 3PFKA 1QQ7A 3CISA 2P9HA 4FOOA 1GY8A 2Q8QA 4RV5A 2CK3A 3LP8A 1OXXK 1N7HA 2FQXA 4RLHA 4DSTA 1G8YA 4DQXA 3KUDA 4YAUA 4EFNA 1N75A 4RPLA 3WK8A 5G40A 3QIAA 3DS8A 4I4CA 3WXMA 4YD1A 2Z0MA 4JZKA 1GRCA 2XSZD 5I9SA 2B37A 3N7AA 3ZHBA 3TLBA 4GOKA 2GCIA 2PKRA 1X77A 4YPVA 1EP9A 5JCJD 2PT9A 1T9GR 2ZS9A 2J0VA 4B2LA 2VPWA 2VRNA 3DBHA 3AY7A 3CPEA 4QYXA 2YWRA 1PI3A 4DSEA 3GELA 3RJIA 4HL6A 1VJDA 3SSAA 1NUSA 1NT4A 2A78A 4YTEA 3ZD8A 1G3UA 4IV8A 4C4YA 1BHJA 1ZM4A 3W9SA 5E6RA 4IDGA 3JATB 5DULA 2QVGA 1S3SA 1H6DA 8ICUA 4FZVA 1T9BA 4OJTA 5GZ6A 4H6VA 2SKEA 5FUXA 2AG5A 4HWTA 4F4UA 5D5QA 3AVYA 3R77A 1FP4B 4EQ6B 3JWGA 4CKWB 1YS9A 5CD9A 1YZNA 4JK1A 4F91B 4HH4A 3JPSA 4DVJA 4PICA 2D7CA 1RI4A 2C4VA 2J7PA 3UVEA 2PFGA 2XIQA 1DG9A 4XUSA 1A8SA 1L4NA 4U7PB 2AE1A 2GXSA 2CW5A 3NEPX 5KNIA 3TMAA 4NWIA 3PRHA 1Y1PA 4DIOA 1LPNA 5JUMA 3T4UA 3WJ7A 5HF6A 5M2QA 3PHBE 1R5BA 3ASYA 1NI3A 5DNYB 5AI6A 4YG2A 2IW1A 2HOIA 2ES6A 1E0SA 4U00A 1D7AA 5FPKA 4LDZA 3RK0A 3IE0A 2O3UA 1RYUA 1UQVA 2OEHA 3TM5A 2WUWE 2X4DA 4M8NE 3U44B 1MVOA 5JQGA 1A5BB 3RJZA 1QVAA 2GBFA 3ZDRA 4R2KA 5K05A 5E1DA 2GGSA 2GEBA 1PW5A 3S2SA 1XAHA 4KO8A 1KDHA 5CMLA 5I6DA 4JY7A 2OBYA 3DGFC 1SPXA 2ZANA 1R0SA 4JSRA 1OX4B 3B60A 2B30A 4H08A 2Q3HA 4GR5A 3CEMA 1CHDA 4GRAA 1BMTA 4DRYA 5BOSB 3V7WA 2HREA 3QZ8A 4FFRA 3WWOA 4CQJA 2J4DA 3D6HA 3EQ6A 4W99A 5BPCA 3FCXA 5CLLA 1A9OA 1V8DA 5EOVA 4KLLA 1IWPB 4OMDA 4R8RA 4UATA 2Z8YA 4OQYA 3DFKA 1FTQA 1WIWA 1U5AA 2HHJA 4HWKA 1FZTA 3GJ5A 1Q7GA 4MI6A 1DOHA 1PFGA 4L4YA 3H84A 1TQ4A 2CCGA 4H1TA 1VXRA 4OF4A 3N05A 5KFYA 2W2MA 4JUBA 3W34A 3UMJA 4AUKA 3S2UA 2WWTA 5F51A 5HRCA 2WWIA 2Y1JA 3GRZA 3Q11A 1HT3A 3LG2A 4DFMA 2ZM6B 4KB5A 1A8UA 2FFHA 5L95A 2X8AA 3RVSA 4UBMA 1TVAA 3WNZA 2Z8XA 1AO3A 3JW8A 3Q9SA 1GAXA 4QDZA 1U1FA 1NV8A 1O77A 3UBMA 2FRXA 1RYMA 2PVSA 1EWQA 4U6PA 5K0CA 1J09A 4MRMA 4L27A 3L0SA 3NONA 1AQYA 4Y1RB 3HUUA 5B6JA 1RKXA 1Z2OX 5JAPA 4QWWA 5KTQA 4YONB 5DYNA 3CM0A 2V4ZA 1J2NA 4KHPB 4WNIA 1JQKA 3ZDCA 4C1BA 1NUPA 5K3OA 1QHIA 4Z9YA 5BR7A 3ORFA 4LWQA 4X64B 3EH2A 4ND1A 4E22A 1PV1A 4C5BA 3WQSB 1B8NA 1F7VA 3DZ8A 2LNDA 4D6YA 4O2AB 2JKVA 5JATA 3PPWA 1ZMRA 4ZVOA 4Q21A 2VI5A 3CTPA 3T7RA 1INLA 1Z63A 1Z2DA 3QFRA 4IDFA 3C45A 4URXR 1K27A 2YIMA 4TQ9A 3A37A 4FN4A 3NJ8A 2AT1A 1MO3A 3P0JA 4OBBA 1IM4A 3SI8A 3RAFC 4DLGA 3WLTA 4PE5B 2LGJA 4KN6A 3NI2A 5D7BA 1TQHA 2OAGA 3V1LA 3KB8A 1L4LA 3AR7A 4MDEA 2GM4A 3Q8PB 1GCIA 2EXXA 1XCPA 2RFLA 1GLVA 1NKBA 3RYIB 3LQ2A 2VRCD 1CF2O 3FYTA 1PSDA 1MEOA 4AMZA 5F5XA 3LBHA 2DSNA 3PQ2A 2FEKA 3OI7A 3RWMB 1BU8A 2J4FA 5F1OA 1TTPB 2NYRA 3U4DA 4Z8XA 5EA2A 2H17A 1XXHB 4NLGA 5JHGB 3DOIA 3CRW1 2ID8A 3M6VA 3I73A 1DFHA 1U8ZA 2ZSIA 3R7LA 3U4IA 2VJDA 2BCSA 1RHRA 2H3EA 3KZOA 1HC7A 5CIQA 3WGLA 5C3MA 4MVJG 3RD5A 1HTWA 1WY5A 4RMIA 5J4VA 4F93B 4U2KA 2VK8A 3K9GA 2X6TA 2ACEA 1EHCA 2XZPA 3UJCA 1YR1A 4ZAYA 3EYZA 1ZEMA 1UBLS 4QU0A 5HK9A 3N0WA 3PGA1 2EKLA 1G5FA 2A9PA 5EIBD 2O06A 3TRFA 1PKXA 3ZI7A 1OZFA 3ESAA 4RFLA 2WUGA 2FKNA 3DCJA 4K9PA 3C5HA 2QP4A 4AQDA 3WSVA 3X2EA 4ZA2A 1AS3A 1R16A 1D9FA 2B92A 2D7DA 2XE4A 1WMDA 1E3WB 1R8XA 1E32A 1U65A 4BASA 3QUTA 3EG9B 1N6PA 2IITA 1IQPA 3DMFA 3V2UA 5C8YA 2YTZA 4P0QB 4NS4A 4P33A 1WKBA 4YAWA 4HH1A 3EF0A 2BFFB 3RAXA 1TK5A 3T9FA 4NLZA 5F5LA 3QMPA 3ESBA 4WA7A 2J6HA 1T24A 1ZUD1 1N92A 1V37A 4OXQA 4QOHA 2HHCA 3G2IA 3B9RA 3LXRA 1Y7LA 3BHMA 4DT1A 1E3LA 1V9PA 2OXTA 1O6BA 1P1RA 3GLGA 2HPVA 3QWAA 1P6XA 4YP6A 1YQEA 5EJFA 4FBLA 4MUNA 2Q21A 2G1KA 1ZJJA 4D3XA 2V6FA 4ZCMA 3I30X 3MNFA 2D13A 1WB9A 1C0PA 1FUEA 3JPNA 2I1LA 5AJWA 2DGZA 3IILA 1DIRA 3W7VA 2PV0A 3AEXA 5LDGA 3QITA 2QEQA 3O4JA 2CXYA 2WSBA 3ZZNA 1ULSA 1U02A 1E8NA 1OCEA 3AF0A 3REGA 5DTMA 7MDHA 2FX3A 3LK6A 3KT3A 2JW5A 4IQVA 1EEHA 3F7NA 2YCLA 1F8YA 3R75A 4XTCS 1E20A 3DEYX 1GCAA 3STVA 3UA4A 1EEXB 3CVOA 2D2FA 4JEMA 4K5QA 2QUZA 2A5DA 3H5LA 4ZT3A 1KAHA 2FFJA 4P54A 4KQWA 1XS9D 4OYYA 1XXHE 5GP1A 3RYHA 1DI0A 4HT3B 3VH4A 1X7DA 3CRNA 4I5FA 3D4IA 2CUTA 3N2NA 4PO9A 3OFVA 4KO3S 3MILA 1CJUC 4Y3UA 2Q1YA 3R20A 4RK7A 4OATA 5KOHA 2PLAA 1JALA 2WVGA 2P91A 4YIHA 3ELYA 1JKMA 3EXG2 5IAEA 4H17A 1BN7A 3DVRX 3PNYA 4ZEVA 5FXMA 1E1RA 2BMJA 3WBKA 1DCTA 1BGXT 4CCYB 4EY3A 3HDQA 2R96A 1UT6A 2CD7A 4XYMA 2C2ZA 1QRDA 4FSXA 4N5IX 3GJTA 4QFDA 1HF3A 3JYLA 3IV9A 4AQYB 4G8DA 5KNBH 3VPAA 4LY3A 1EE1A 3G6VA 3MGHA 2LHTA 3HNPA 1PG2A 4LXIA 1T3GA 1G2PA 1ISMA 4O29A 3ZZTA 1HT0A 4JXJA 2WJPA 3QVGA 3FYCA 3QOXA 1A9PA 3R3ZA 1J99A 4OKIA 4MFCA 4DYVA 4E88A 9ATCA 7ICMA 4FZLA 3A6ZA 4M9GA 4FHGA 1OW5A 4AZ3A 2EDAA 3CF4G 1H2XA 4TKLA 3B8EA 3R7SA 5ALYA 4IILA 2I2DA 4DC0A 4QZCA 1D0VA 2PGOA 2VNJA 3IIKA 4G8JA 3ENQA 4S05A 1I10A 1HWYA 1T13A 2YJZA 2XNSA 3R40A 4KGDA 1EKXA 2PEZA 1ZQIA 2MSWA 2F59A 1KDVA 3CZRA 2IYPA 4MAAA 5A4JA 1F2DA 3EUAA 5DHTA 1AROP 2FSUA 4IQGA 3H9CA 3K2IA 3ITNA 1MJHA 1YJQA 1Y3CE 1YS1X 3DVQX 1W2GA 4PZDA 1SIWA 2D1YA 1IIPA 3O8QB 3I1YA 3VR4H 3RC9A 5J8YA 3TGLA 3F4BA 2ZYTX 2DXIA 1H9BA 3C2LA 5KBYA 3T7SA 3LQYA 4HO1X 3VPCA 3JX9A 1GQ2A 1QMPA 2J46A 4PYQA 5J0WA 3NJ4A 4FOLA 5ALQA 1H0SA 4YJ3A 1GPMA 1JTVA 1A4RA 1ZXIA 1TPYA 3WLQA 3I64A 1EAYA 4OSOA 3D7SA 2HR1A 4YASA 1CS0A 4KXWA 4ZC1A 4FFOA 5ARDA 2XUIA 3QE3A 3DOOA 4K2AA 1PV4A 1KEVA 5FAXA 2ASLA 4HDSA 2FZWA 3BTOA 3UKOA 3SBOA 3V6MA 4EB0A 2K60A 3PTZA 4CF5A 2IODA 2FWAA 4RD4A 2V6IA 3QYPA 1VG0B 4A5OA 3EWIA 1YNSA 5CB8A 3ZCRA 2X0RA 1QP7A 4S1PA 5DBGA 4R65A 3DOUA 4BNDA 3AETB 3G1WA 3SVLA 3GLQA 1OVGA 1R3DA 4GNKA 4GYWA 2DF8A 3V42A 2FDXA 3MG9A 2WRZA 2M98A 4RY9A 3VC7A 4WXMA 6GPBA 1ZICA 2VAPA 3N2IA 4PS1A 4R81A 4PGFA 1BD3A 2H85A 2PPVA 2KE5A 2PSJA 1OGJA 5K4GA 2XTAA 2BSXA 2H2DA 3D2SA 1LTQA 3NORA 5BYJA 1KJJA 2ZWAA 3RASA 3FSRA 3BQ0A 3MSCA 5A2GA 3NP7A 3PX3A 2YTUA 4FT4A 1ZVMA 2IXFA 1APBA 2UKDA 4PSVA 4UW9A 1ZMOA 4UAJA 5IANA 4JLUA 4LV8B 2M6LA 2GLTA 3F6PA 1W4ZA 2XVMA 4ZEWA 3GJ0A 4LQ4A 3WKCA 3L06A 2QX4A 2VYND 2G40A 2PL1A 1FYWA 1OXBB 1F6BA 2ZI7A 2F67A 2DCUA 3UQZA 4LZPA 5JAHA 5AR1A 3OM0A 2F9MA 3RK4A 4A2CA 1E7SA 3R5XA 5TPWA 3DD1A 5F1YA 5D3MB 4DADA 2BDPA 1TQ8A 4Y0VA 3IFSA 3NAGA 2ZRBA 5T64A 3ZCSA 4IH4A 2KEYA 1ZW6A 4NONA 4DA7A 1FNCA 2H07A 2QGNA 3NKLA 5COAA 2JLAA 4KVAA 1IZ8A 5FWXA 3E70C 3PR3A 1GGKA 4RJLA 3U7GA 3P9KA 4B31A 1UKZA 4J7UA 5ALKA 1H0KA 4Y6GB 4YA6A 3U7FB 4NG4A 4E09A 2GZ3A 3GZ4A 1HXHA 4RTSA 2WWWA 2CL7X 1YULA 1WPGA 3GLTA 3QWIA 4IY1A 3Q72A 4O5KA 1WUTA 4B85A 3ILHA 2BKUA 3D54D 1Y81A 3JTMA 4HNAA 4JNKA 3BZCA 4YUXA 1HR0B 4IAOA 3NS7A 4OH7A 1KP9A 1T4DA 3CF2A 4FX5A 3W90A 2ZXEA 1TQ2A 3HKZC 1UXJA 5KDLA 2VO1A 4YJGB 2F64A 2B1QA 3OM8A 1TEZA 4K6MA 4PX3A 1NK7A 5AOVA 4AIRA 2ZKLA 4QU9A 3MMSA 2PKQP 2BGIA 1Y98A 3NATA 2NM0A 3F73A 1CY7A 5KYKA 3K1AB 4U3JA 2BISA 4A6EA 2WB4A 4Q9AA 1A9QA 1XNJA 1XEFA 1G21A 2YWXA 4JNCA 2ZITA 5U4XA 5IILA 1GQYA 3HBJA 3GRKA 2ECKA 1KP3A 3KSZO 3FVTA 4DS4A 4N3GA 3VR1A 5TX7A 3ETEA 5DLYA 5HCUA 3QEOA 2X2OA 3H04A 2CJWB 2AJCA 1GRRA 4M46A 4Q00A 3GUZA 4V1CB 2HVIA 2PT7A 3H13A 4G0WA 1QRTA 3AUSA 3IT0A 1ODTC 2ACKA 2A9VA 2GM3A 2N1MA 2XZTA 1ZQAA 4IDAA 1THTA 2XVXA 1TKDA 5KQSA 3I05A 1BXZA 4OQLA 2IE0A 4HEA6 4P5EA 2HO5A 2CDCA 3G0DA 1ZRNA 2XTZA 1SY7A 3LDGA 4UTVA 5KX5F 4TX1A