2HCFA

Crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
225
Chain Sequence
SRTLVLFDIDGTLLKVESMNRRVLADALIEVYGTEGSTDFSGKMDGAIIYEVLSNVGLERAEIADKFDKAKETYIALFRERARREDITLLEGVRELLDALSSRSDVLLGLLTGNFEASGRHKLKLPGIDHYFPFGAFADDALDRNELPHIALERARRMTGANYSPSQIVIIGDTEHDIRCARELDARSIAVATGNFTMEELARHKPGTLFKNFAETDEVLASILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, haloacid dehalogenase-like family
publication title Crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from Chlorobium tepidum TLS at 1.80 A resolution
rcsb
source organism Chlorobaculum tepidum
molecule tags Hydrolase
total genus 84
structure length 225
sequence length 228
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hcfA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hcfA01
3ONNA 3KZXA 4FE3A 3QUQA 3OCXA 2G07A 4YCNA 3M1YA 5ALNA 5AVRA 5AKJA 5AM1A 2HDOA 1U7OA 1Z88A 3EF0A 2PQ0A 4I9GA 3MN1A 4UMDA 4UAUA 5ALZA 4KYTA 4YIHA 3E84A 5A3SA 4BEWA 2FI1A 5AK6A 3ZTWA 1QQ7A 2NYVA 1XP5A 5AM0A 5AM4A 3QU7A 2ZBDA 4BKMA 2RAVA 1RQLA 3PCTA 2EARA 3DNPA 5AIAA 1ZD2P 5AM3A 2P69A 1Z4MA 3ZI4A 4HGNA 3WK8A 1Y8AA 4UATA 3QU4A 2EATA 2YMPA 3ZVLA 4C4RA 1LTQA 4IG4A 2JAOA 3N8GA 5ALLA 4BEVA 1QYIA 1RDFA 1L7NA 2ZBEA 1Z4QA 3SLRA 1Z5GA 3N07A 3UM9A 5E0OA 1XVIA 3OTQA 2YJ3A 1O08A 3SF0A 4NV0A 1Z4JA 4YH1A 1CQZA 5JJBA 3A1EA 3QXGA 4NWIA 2OA0A 5IS2A 1L7PA 3AR3A 1AQ6A 5AK3A 3OCZA 5AW8A 4OHFA 2W11A 3EPRA 2VKQA 1RMQA 2AUTA 4MWOA 4RESA 3AR8A 5AKXA 4BX3A 4YIKA 4UASA 2FDRA 4IFTA 1NNLA 4C4TA 5AW0A 2YFYA 2MU2A 2YJ5A 3R4CA 5AKZA 1VJRA 1YNSA 3ET4A 1WZCA 1ZD3A 5AM2A 4L6AA 3QU2A 4Y2JA 2HF2A 4YCMA 2HCFA 3E58A 1YV9A 3B9RA 2G0AA 5AVVA 4KX3A 3ZWKA 1L8LA 2B1QA 1U2SA 2FPXA 3U7GA 3OPXA 3L0CA 5AESA 5AVQA 4EEKA 3K1ZA 5AICA 1Z4NA 3L1UA 4EENA 2JAUA 4KNWA 2G08A 3KC2A 4HYTA 4MUMA 3KBBA 4ZEXA 4BBJA 3W5BA 5AI6A 3R09A 3SKYA 3SD7A 3GYGA 3P96A 2WF8A 3I1YA 5AKEA 1QQ6A 3IB6A 3UMBA 5IT4A 2WFAA 4EX6A 3E81A 3J7TA 4Y2SA 2FPRA 2YN4A 2OBBA 4XPZA 4Y2UA 1RKQA 5ALFA 1FEZA 2GMWA 5A3QA 1CR6A 2BY4A 1Z4LA 1RLTA 1KYTA 1TJ4A 1Z4PX 3FZQA 1Z4OA 4UM7A 2Q4RA 5ALVA 4DFDA 2IOHA 1VFPA 3A1CA 1YMQA 5ALQA 2Q5EA 3NASA 2Q4TA 2P9JA 3CNHA 4F72A 5ALYA 5AVYA 5AHXA 4L57A 4NFLA 4HAIA 1Q91A 3U7HB 1ZRMA 2IOFK 3L5KA 4PNHA 3L8FA 1VJ5A 2C8KA 4UU1A 5AVUA 1L7MA 2HF7A 4DWOA 3WKCA 1SWWA 3L0BA 3FM9A 3ED5A 5T41A 1RRCA 2MU1A 3U7FB 3L8GA 5ALIA 5AW9A 5AW1A 3ZX5A 5AW2A 5AVZA 4Y2VA 1J8DA 5AK5A 3SKXA 2C88A 1MH9A 3U7EB 2AH5A 3ZWDA 3N1UA 2CFRA 2DQSA 1RC8A 3I6BA 1ZJJA 5AI0A 1U02A 1L6RA 3QX7A 4O8CA 4JB3A 4EX7A 2WHEA 1X42A 2WF6A 5AM5A 3NIWA 2GHTA 4OD0A 3NAMA 1TE2A 1T5TA 4BYGA 4ZEVA 2IA5A 3CZ4A 3NRJA 4JDPA 2JAWA 3QUBA 4KNVA 2HSZA 1TA0A 2YY6A 1IWOA 5ALKA 2CFTA 3W5DA 3ZUPA 1K1EA 5ALRA 1SWVA 2G1AA 3DAOA 5FP0A 4C4SA 3ZTYA 3E8MA 2B8JA 2D2VA 3MMZA 5AW5A 2C4NA 2W4MA 4CF4A 3FGOA 4XE5A 5AI4A 2RBKA 3QUTA 1RQNA 1N9KA 2CFSA 1T9ZA 4DW8A 3ZX4A 2B8EA 5ALOA 1F5SA 5ALDA 1L7OA 3QLEA 4J2TA 3IJ5A 2RB5A 5ALGA 1WPGA 2P11A 5ALPA 2GO7A 3QU5A 3UMCA 3N28A 4CE6A 5A3RA 4AS2A 5AK4A 2G06A 2R8XA 4Y2RA 1T5SA 3ZW7A 5AVXA 5AW3A 1ZOLA 2WF7A 1XPJA 2IYEA 3M9LA 1ZD5A 3PGVA 2YMQA 4BNDA 4Y2YA 3WGVA 4Y2XA 3R9KA 2GHQA 2OYCA 2IOFA 1O03A 2C8LA 2X4DA 5ALJA 3I28A 3AR7A 5IT0A 2YBDA 2AMYA 2FUCA 1SU4A 2R8YA 3VAYA 1TJ3A 3W5CA 3FPBA 4FFDA 2I33A 4FYPA 2ZXEA 4NABA 1Z4IA 2FPWA 5ALWA 5AKLA 4F71A 2WM8A 4HGQA 4XOUA 3AR4A 1S8OA 1U2TA 2I7DA 1EK2A 1S2OA 4BX0A 2O2XA 5AW6A 5AI8A 2YMMA 2B0CA 4CF3A 3WKEA 5AKHA 3U19A 4CF5A 3DDHA 5ALSA 2I54A 4QJBA 3WK5A 3UMGA 3L7YA 3QYPA 3ZVNA 1NF2A 5ALUA 2I55A 2ODAA 4Y2PA 2FUEA 3NUQA 1RPZA 3QU9A 4I9FA 3NALA 4KN8A 4DCCA 2R8ZA 2EAUA 3HYCA 3PDWA 2WF9A 4KX5A 3AR2A 4UMFA 2NO5A 5ALMA 4XQ0A 2G09A 1RLOA 2P27A 3ZVMA 3WKAA 2HOQA 2YJ4A 3QGMA 1J97A 3MPOA 2WF5A 3FPSA 3EF1A 3ZU6A 3U26A 1Q92A 1WVIA 1RKVA 2MSNA 2ZOSA 5AIBA 1YDFA 2JARA 2BDUA 3NANA 4H1WA 3FVVA 4E88A 4Y2QA 4AP9A 2B30A 2B1RA 2AGVA 3RF6A 5AI5A 4UMVA 4UARA 3WK4A 3I76A 2YMLA 2RARA 2NO4A 1N8NA 3B9BA 1RMTA 1TJ5A 3ET5A 3AR6A 2ZBGA 2ZBFA 4UM5A 3OCYA 4Y3UA 1Z4KA 2FEAA 1JUDA 1Z5UA 4J03A 5ALEA 4GIBA 3QNMA 1QQ5A 2HO4A 2YJ6A 4OFZA 4HGOA 5ALHA 5AW4A 2QYHA 3BA6A 3OCVA 3AR9A 3ESRA 2PR7A 1RMYA 1RLMA 3IRUA 2B82A 3WK9A 3SMVA 3D6JA 2PKEA 2QLTA 4UU0A 2FPUA 2FPSA 2HX1A 4HGPA 3SHQA 4BX2A 4RETA 4EZEA 2G80A 3WK7A 2GFHA 5ALTA 3W5AA 1RKUA 4B6JA 4CNQA 3A3YA 5AKGA 4BNDB 3OCWA 1ZRNA 1U7PA 3TLMA 1WR8A 2HEGA 3L1VA 3HLTA 4G9BA 3MC1A 3DV9A 5AKKA 3QUCA 4EELA 4L6CA 5AI9A 1NRWA 2R8EA 2W43A 3U13A 2O9JA 5AW7A 3WGUA 3L8EA 1QH9A 4UW9A 4QQFA 3PGLA 5AVSA 4YGYA 2OM6A 1ZS9A 1PW5A 3KD3A 5ALXA 3S6JA 5AVWA 3KOOA 3WK6A 3L0YA 4AS3A 1LVHA 1ZD4A 3WKBA 3N5KA 2C9MA 4G63A 3EWIA 5AKYA 3L8HA 3ESQA 5AKIA 3WKDA 2JGAA 4OCZA 4UAVA 3AR5A 3OCUA 4NAVA 1L8OA 3B8EA 3F9RA 1EK1A 3RFUA 2HI0A 1YJ5A 4UMEA 2I34A 3A1DA 4Y2TA 4GXTA 3KDPA 4YCLA 2I6XA 5AVTA 2ZG6A 1YS9A 2HHLA 2BDEA 2CN1A 3BWVA 4HGRA 4ZEWA
chains in the Genus database with same CATH superfamily
1PSWA 4KKXB 3M1YA 1WULS 1Q0PA 3QMWA 4LYEA 1N2OA 1U9CA 2IXGA 4PL2A 4MHSA 8MHTA 1E9VA 2GA8A 5LKAA 1R9MA 4HQKA 1B8OA 1W94A 2OVBA 1T3LA 4KQEA 5ENDA 2AQ0A 4JT9A 4TV9A 4WX2B 5T7BA 5JCJD 3BXPA 3H75A 4KAFA 1A2QA 4MKRA 1NULA 1J2JA 4IAOA 1RIFA 1F12A 4AWXA 4IL6U 5IS2A 2HLPA 1KSGA 2ZJ4A 1K92A 3V1TC 3LBAA 2V9ZA 1C3JA 1WSBA 1ZONA 1Z8NA 1PO7A 3BF7A 4Q8FA 4Z49A 4IFTA 3DZGA 1VBMA 3IAEA 3WNCA 1QGAA 2W6ID 3PX0A 2QAJA 3A6EA 2AS0A 4XPIA 1J20A 5BSWA 3TADC 3PICA 2JHFA 4LPKA 1T91A 3ZV3A 1ADYA 2Q4DA 3T5GA 3EXIB 5BRAA 3C7AA 1N8TA 5BQ3A 4AQ7A 1G19A 2GK3A 1EP2B 1SELA 1G9XA 4P93A 3D8TA 1XFAA 3ZK7A 1KYTA 4YAUA 2F43A 2YWFA 4TL7A 4BNUA 4PHPA 1VPDA 3ADDA 2KVCA 1JEJA 2VDJA 2WFMA 1MAWA 4POOA 1FDWA 2JEYA 4AMBA 3SC2A 3LHFA 4LDPA 3B78A 4MWSA 3V2GA 3GNTA 1NQ5A 1P29A 4O02B 2BYTA 2ZITA 5D1NA 3BA1A 1OWLA 1A0PA 5IBRA 2BH2A 5MGBA 4UULA 4UB8U 3HBNA 1UQTA 3C3YA 4HWKA 2ZRFA 2FR8C 1IXSB 4EWLA 1J1IA 3PC4A 1YF3A 3BBLA 4BP3A 2GM3A 4BYGA 1OZGA 3EPKA 4C8OA 1SEPA 3D0KA 3HUDA 4GI3A 2OCEA 1A9PA 2FN4A 1S4QA 1B42A 2CHFA 4HFJA 5IT9A 2UZ1A 2WQZA 3N87A 2C82A 4D3ZA 4WUTA 2HQ1A 2TMGA 2D00A 1O95C 4PPXA 4J2TA 4WD3A 2P75A 4OX9Y 2A9PA 2NZWA 4NJ8A 2Q1WA 4R6XA 1Y3IA 3IHTA 2R8XA 5GY7A 5DN6A 4DLAA 2HZBA 3UOAB 4D9MA 4GOKA 2A19A 4UJ3A 2B8WA 1G8YA 2Q3JA 3BGVA 2BM9A 5CPFA 2J1LA 4V0LA 4UXHA 3KJEA 1KTQA 1N6HA 3L1JA 1R0BA 2O05A 1SVLA 1TT5A 2BBTA 1NU8A 5TQ0B 2EKBA 1YZVA 1H8HA 1WB4A 1OILA 2PSHA 2BVNA 5DIZA 3G17A 3HJRA 2WF9A 4MUJA 4LKRA 1D2AA 1R1DA 1CC1S 2I9PA 1C4KA 5C8YB 4AWBA 3HT3A 1PL8A 5AJUA 3MT7A 3IRVA 3GAAA 4LHXA 1R8JA 1QHXA 3WDLA 3LHKA 2W03A 4BPRA 4GIBA 3UAOA 5KNCA 5FPQA 1CRQA 3VR6H 3IQDB 1L4NA 5FTMA 3UXHA 4TT3A 4BX2A 1ZQJA 3TZEA 3ZY5A 3TSWA 3IT3A 4G8JA 3PUKA 3GJ4A 4MRSA 1S10A 3V8NA 2XDAA 1WX1A 3QLVA 4NE2A 4LNUA 2DHEA 1CKEA 2R44A 4FYHA 4PE5B 5IPFA 4Y0NA 1Q7EA 3CLKA 2GBLA 1G7SA 4U6SA 3QXHA 3V4LA 4KLOA 4K4GA 2RC6A 4GR4A 5CDFE 4XAQA 4FBTA 1U2RA 3GP3A 3EXFA 4RTRA 5G2OA 2KVSA 2H65A 4MKZA 3RFUA 2RJ3A 4QVIA 2IDZA 3BWVA 1PJLA 3BKWA 1L5QA 3I04A 3TAPA 4BEJA 5LZ8A 3PPIA 4CKCA 3ZKAA 1BS9A 3IUYA 1AZWA 3BXHA 4FE7A 4EKDA 2PQ6A 2H17A 3CJTA 2PMDA 2E5LB 1E9DA 3B7WA 2JVKA 2JIMA 3KKLA 3BN3A 3OQHA 5HQJA 4B3JA 3ENKA 4RDHA 3IAS1 4NFSA 1NXTA 4B45A 3IKTA 1O94C 2QNIA 2PFNA 3TQTA 4DUPA 3K0AB 3TO5A 4GE3A 2D8CA 5AVOA 4CLOA 2Y2UA 4XB6B 2CNWD 4YR3A 2VDRB 4YR9A 3IMFA 6YASA 2WJ6A 2LDBA 3LL4A 1DAPA 4WZAB 3GMDA 4NZZA 5DT2A 5EJ6A 1AGNA 2P5SA 1XZNA 2C20A 4DV2B 5CR9A 2GBGA 4UBLA 2E82A 4F6CA 2FPGB 4Y2JA 3TRHA 3RSLA 4PSVA 3VZRA 1JEYB 1J70A 2F3SA 3K1ZA 4FU0A 2WBLC 1AXEA 4CG0A 1JFVA 2MSDB 4HYYA 1HV8A 4MUMA 4W8GA 2D0IA 4BO1A 2ZQ5A 2ZU6A 3SR6A 2HVIA 4EFNA 1YFZA 2Y68A 5J2TB 1Y3FE 2J41A 2SKCA 4JN6B 2Q50A 2XYQA 1Q57A 4P0TA 2FG7C 2X1MA 1D0VA 2JKZA 4TV9B 1BNCA 5LP6A 2GXUA 4WWHA 3IDZA 3DMNA 4UBJA 3VU0A 2A2ZA 1CIPA 4ALKA 3U4MA 1XQYA 2AIRA 3BHIA 2PEZA 1V37A 2UDPA 1FFWA 4AMGA 1ECPA 5L8VA 4RF4A 4YB8A 3GRVA 4LI3X 3SKXA 1UFKA 1G8AA 1UWCA 3ZZ1A 3C0KA 4JEHA 3Q88A 3X1YA 3EQ8A 4M9HA 4TSFD 5I4CA 4EL5A 3JX9A 3L0PA 2C04A 3NW9A 3VR5D 3QUBA 2QVCA 3D8HA 4QPNA 2PUHA 4DIEA 1E3QA 3V4OA 4S1TA 4HDQB 4XE5A 5BMOA 2UUOA 2ZT6A 1EFAA 4O2BF 3WTCA 1Z19A 1N6KA 1UC5B 2KPOA 1Y42X 3LP5A 3FNFA 2DBVO 1C4OA 1BNOA 2RHFA 8ABPA 4B76A 3OIDA 1P1CA 3L1IA 2QMEA 3CV3A 3VH3A 3U4HA 3NUZA 5AK4A 5EKDA 2D2EA 2XI4A 3L0SA 4I6GA 4E21A 4WCFA 5IT0A 2F43B 4Y2HA 4FFDA 4R1QA 5TMEA 2MIIA 2H3QA 1S2OA 4N6GA 5CNJA 1T4MA 2X5NA 4OFWA 4KQFA 1TEZA 1T1SA 1AF7A 4G1CA 1ST2A 3LCJA 1GZDA 2ZWIA 2ONZA 1ULZA 5TT0A 1H2RS 4FX2A 1URPA 3DWIA 2ZK7A 4DIOA 4YP9A 3BPSA 3CKKA 2HA6A 1OC4A 4D2IA 4UMVA 2C42A 3LU1A 3H0RB 8ADHA 1GDDA 1A97A 4X60A 3COSA 2I7VA 1VJTA 2GCIA 1CZOA 3FW1A 4FKBA 5IIJA 5B4TA 2YXLA 2YHIA 1W1WA 5SZHB 1H0RA 3WK7A 1UDRA 1Z3IX 2H5JA 3BK7A 5IDQA 5T6BA 4G5XA 4LBYA 1Z5NA 1QBGA 3VHXA 3RRNA 4B82A 2LPEA 2OVFA 5KVVA 4OMFG 1E5LA 3WY9A 2H06A 5JNRA 4PPQA 1TT5B 4J0IA 3OPYA 3U7IA 1XRPA 4U0KA 2FWPA 3LZDA 3C8ZA 1YZ7A 5EMHA 1IVYA 3RRXA 3L8HA 1XEWY 5D86A 3FF1A 2HHJA 2OB2A 4RMHA 3C3MA 2LKYA 3VKFA 1U8UA 3CUYA 2OG1A 2C5LA 4NX2A 2XUJA 3RHSA 2XZDA 1BWSA 3TD6A 5AM1A 1Y98A 2RAUA 3RJGA 1MNAA 3UWKA 4O1MA 1RPAA 5E9JA 1S3FA 3QU7A 5B6PA 4B80A 5KFSA 1QWOA 5JRTA 1Y8AA 2JH7A 2XV1A 5C5IA 1OLSA 1A95A 5DMHA 1N3BA 3KUXA 1E64A 3T4XA 4DQRA 4PAMA 3SFTA 4JUIA 4ENTA 2DTXA 5KO2A 4LNUB 3E2IA 5DCYA 2DCUA 5AJZA 1AIPA 4H60A 1GTJ1 1PJZA 4IL5A 4QXAA 3BERA 2FZEA 2YASA 2WZQA 1TIKA 3PL5A 3D2LA 1O1YA 3I62A 3D3EA 2W2PA 2YQEA 5JSKA 3EXFB 1ECFA 2R79A 3KFUF 5DM0A 2I8LA 4IILA 3VR4A 1A9YA 3PU6A 5KOHA 5K6RA 4TPKA 1MD9A 2F9LA 5JO0A 4ECTA 3JY6A 1W93A 3W5BA 3H4BA 4DMMA 1YWGO 3V6KA 3OG9A 3LF2A 4CKCB 1FL9A 5JQGF 3E3LA 2O48X 3A9SA 1RYDA 1HSZA 3V1NA 1RKQA 4MEBA 2MUTA 3KQNA 3RSFA 2XIJA 3AKCA 4IS3A 3VH2A 1W25A 1JDSA 5K3DA 2YYAA 9ICVA 5IDVA 3HYRA 4MWDA 4MGKR 3H8SA 4QVGA 3RU7A 3ZCQA 1B6GA 4CI0B 3D0QA 1FTSA 1XTSA 4CLOB 4CTNA 4B8YA 1YQ9A 5K7SA 2B4QA 4HZGA 4TQSA 2WKQA 3QKUA 3GY0A 3CJQA 5ERYA 1HMYA 1PNOA 3BD6A 5A62A 3GIMA 4IG9A 3UWSA 4JS0A 3E0FA 3KQPA 1IZ7A 1SKBA 2HWWA 1GWNA 2H63A 1XLTC 4JVNA 4Y6PA 3KQUA 2KSOB 1GFIA 2C31A 1TFRA 4TLLB 1Q0UA 2R8GA 3FMIA 4MJXA 4CPDA 3D6FA 5AR1A 4TT3D 1JT2A 3FCAA 5L40A 5I01A 1WS6A 4EBFA 3KE9A 4EL0A 2CVFA 4V3BA 1T1JA 1U4NA 1CTQA 3DMYA 2ZJ3A 3ZLBA 2RB4A 1YKFA 2YBDA 4ZDJA 3LQ4A 2IWHA 5AKLA 4HCJA 3KKOA 1Z1BA 4Y0AA 4G5YA 4DA7A 3AWDA 3VVCA 2A3VA 3BEOA 4V1CI 4DFKA 1VB3A 3EC1A 4ER5A 4ED2A 2OV8A 1IN1A 3E35A 1NOMA 1O77A 1VHWA 2Q6LA 2EKPA 4YRQA 3WLKX 3HJCA 3EC2A 3TBHA 1EWVA 3TFQA 3FAZA 3BULA 3RRYA 4L6IA 3JQ8B 4KK4A 4S3MA 5K6AC 2IP4A 2IELA 5BQ5A 4PFQA 2W2XA 2HW8A 3PXCX 3GQBA 1RJEA 1GU1A 4LIPD 4M0UA 4BJ5A 3PA6A 1IHPA 2Z8XA 4QDUA 3JQGA 1A2KC 3K8ZA 2QORA 1EQAA 4Q05A 3OZXA 4EY8A 3EBLA 2BDTA 4Q4JA 1V43A 5JQWA 3RVDA 1ZESA 2JI4A 2QE7A 1QO0D 4ZICA 3QYFA 1RYHA 3OMWA 1NC1A 3BIXA 1DOQA 5ARDA 1PGPA 1KSJA 4GLOA 2GN8A 4GPIB 3E22A 1X1RA 4BC0A 3BTUA 3KETA 1I3LA 1TTHA 3FCOA 5SYAA 2DLCX 3I05A 4EHFA 3OIVA 1L1EA 4OUDB 4MW1A 2PKWA 3ZJVA 4YUWA 3Q3HA 3TDMA 3MAJA 1I6WA 3T1NA 3SYRA 3F5SA 4E1BA 2Y1CA 1DAGA 5BQFA 4QZHA 4QG3A 3ZTWA 3TADA 3HB7A 1O58A 4ZCLA 3GRRA 4O9MA 1L5OA 3W8FA 4BJQA 4M55A 3ZDRA 3QW2A 1MZVA 3SVZA 4FCCA 4RTJA 4PY2A 1VPVA 2AJLI 4I55F 3HU5A 3ZH2A 1ESCA 1XTIA 2GOLA 1E2JA 3PV0A 3RB6A 5KSPA 2QD1A 1Z0IA 4K8RB 5AW8A 2HSWA 3EZLA 5DBBA 2EQYA 1CV2A 1X2EA 2UVUA 4DEVA 2PKCA 4RQ5A 3AERA 4MRVA 3G9UA 4D81A 3BK2A 1S77D 2H4ZA 4IWXA 4FLMA 5BUCA 2FR8A 1Q21A 1H2YA 1RKXA 3AVPA 1IG6A 1VYVA 2XTJA 1QCDA 2F90A 5F78A 4RCVA 1WCLA 4C2BA 2RIRA 4NG5A 1Z9BA 5DT9A 1KJJA 4RF2A 3WGQA 4AJLA 4PG7A 5E0KB 1DKUA 1POXA 4R5MA 3MCUA 5KG4A 1O95A 1XG5A 2EZTA 1Z4OA 1Z13A 4UM7A 4DFDA 1MB9A 3T3FA 4KOAA 1M7GA 1RXWA 1A0OA 1GPKA 2CMHA 3NNSA 5D00A 2XBLA 5BMVF 4MB0A 4CKXA 4LVUA 4PGQA 2AI2A 5EFOA 1H65A 2QQEA 2BPFA 2V6FA 5LSAA 1HBJA 2MU1A 2PL1A 1DIHA 2BDPA 3R3UA 4UFNA 3CF2A 4EO7A 1DELA 3MDCA 5DEIA 3W1WA 4ALMA 4NHOA 2DFKB 3I6YA 4P34A 5E1OA 5THQA 4RY8A 3KV1A 2ZJ5A 1OFUA 4LDNA 4P4TA 3S3TA 4RXMA 5CVVA 1ZQDA 2D2VA 3N8KA 5KL1B 3THXB 4C0KA 1JA1A 3C1AA 2TS1A 3V9AA 2HNBA 1SCUA 4A4DA 1ZM2A 1OYOA 4GX1A 3GVCA 5CJJA 5KHLB 4NIMA 5IJAA 1Z8DA 1QOPB 1L5LA 4G4SP 4BIMA 2LCQA 1SV4A 5F7ZA 4Q7MB 3IXMA 5B1EA 2ZTEA 3N2IA 3KAKA 1BMQA 3ACCA 4YPFA 2AX4A 1A9TA 1UXOA 3N7UA 4MUHA 1PW7A 3M6MD 1SVMA 2AZMA 5DE3A 3L40A 2QZ9A 2B0CA 2A86A 4JVOA 4CF7A 2F3PA 3O47A 4Z54A 5DWDA 3GLGA 4II3A 4L8WB 4GI5A 3PGA1 4LJ8A 4IUBS 5FNVA 1LKZA 1PSZA 3EW7A 1H2BA 4HAYA 1TQ4A 3OIFA 4DG8A 3D5QA 1SC3A 1A98A 4B09A 1KE2A 1IZ9A 2O1XA 5F52A 4URVR 3H9CA 5TQ2A 3JU3A 3MTAA 4AL4A 4ZGWA 2ZYSA 2A9OA 2VFAA 3NHJA 4P7FA 2PGNA 1YFLA 4LCBA 4CZ2A 2X76A 1OVMA 3DJYA 3SBEA 2KSQA 3NLLA 2KZZA 5LJLA 2B37A 9ICMA 2NAPA 3K9WA 1WBBA 2X4IA 1DZ3A 3UXNA 1U1EA 3PPYA 2OCYC 4CRWB 2N3ZA 2A5YB 4I2HA 1O8BA 4MS4A 4EELA 1VLHA 3WGIA 1HNZB 2XAUA 3FMVA 3RCBA 3PMLA 4CIXA 4LRWA 1Q0HA 1JVSA 1O94A 4YP0A 4MPRA 4I2VA 4E0DA 1N5XA 1ZJNA 3VZSA 4L76A 4DHEA 1JFSA 1S8AA 2OFXA 1L8XA 1ZQ1C 1F06A 2J08A 3B8EA 2JFHA 4HWTA 5EJMA 1AQLA 3KB1A 4JLPA 4DLEA 8ICBA 2ADFA 3H2GA 4ER3A 1Z22A 3E23A 1GTG1 3QEAZ 4C8LA 3HWWA 9ICOA 4QFBA 4F4IA 2H18A 4BRUA 2H59A 1L0BA 4V0SA 3I3SR 3ICQB 4MKIA 1Y48E 4YCCA 4MUIA 1Q2UA 1VL1A 1NF3A 4EUFA 2ZBDA 1V11B 2WM2A 4DLNA 2XQKA 1IG3A 5AM3A 1ZH4A 3JQGB 3FVRA 4Q4JB 1WZNA 1JHDA 3IQZA 5F4BA 2P9BA 5UKDA 2C7OA 4RNMA 5FXMA 5IUKC 4FJ2A 4OKNA 5J0UA 3OCCA 3RREA 1BHO1 4NE9A 4NENA 1B0ZA 1DPGA 3VYVA 3MF4A 1Q7CA 5C18A 3O2SB 1WETA 1Y6QA 2XWPA 1PLKA 5ADVA 5DRTA 4HJXA 1P7CA 1MT3A 1DB3A 1IXYA 1WE2A 4GQAA 4IIYA 2W7TA 3SD7A 4R2MA 4JI3B 1X8XA 3PJRA 4M88A 2Y9UA 4JASB 2JATA 1VLLA 3H8MA 2P4SA 1WV1A 3T41A 1DX4A 2G9VA 4DMUB 3WL7A 2Z58A 4RX1A 5HFJA 2B6GA 5KTQA 4TMXA 4R3NA 2FSVC 5B7PA 3WDSA 4DWOA 1Q7RA 2CKMA 3G8CA 3T9CA 3D0OA 3IVAA 2UKDA 3L8GA 1FJXA 1VKRA 5HKOA 4ASUA 1VI5A 3SZRA 3L92A 2I2WA 2EBWA 5ED4A 1UJ2A 5J2EA 2OFWA 5H70A 3TAXA 5DKFA 1FP4A 4M21A 3LLCA 3AERB 1Y6GA 3GZFA 2RLTA 2DF8A 2C78A 1H0HA 2RAFA 4IZ6A 2YN0A 3PR3A 1ZJZA 3Q8SB 1N3LA 4CKYA 2P2GA 2ZIGA 4IDBA 4K9LA 3V4RA 3EPGA 1Z68A 4ECVA 4OKSA 2HR1A 1XL0A 1LF5A 3NIBA 1C0KA 2OV2A 4M8LA 4LZZA 2E4UA 2W7PA 2IOFA 1FFXA 5CBPB 2VHTA 2WPNA 5A0VA 3WGGA 4PZOA 4HRAA 4CMBA 5ALWA 4XOUA 4L27A 1CIJA 1DMRA 4C04A 1YDMA 4N65A 3PDCA 2C1XA 2D7DA 4NHEA 1XELA 1Y7TA 1Z7YA 2RI1A 3OBIA 3S44A 3UJAA 2COEA 1I1HA 3P9QA 1JLLA 1BQ3A 2ZUEA 3TQOA 2WF5A 3HDGA 4QFMA 4QTYA 4FW8A 1F6DA 4WXEA 1V16A 4F2RA 1IQ0A 3HILA 4ESHA 4FYXA 3H04A 1O8CA 2YMLA 1SV0C 2YQZA 1JALA 2BQRA 1XWFA 3LDAA 5J4KA 1ONPA 1QKKA 4JZKA 3RFTA 3MABA 4YAEA 4DV4B 4FWBA 4C7MA 3C4JA 1A76A 2HU2A 1OPRA 3RBVA 1XWWA 4U2DA 1IIBA 4M8NE 5AKGA 1PG0A 4QC2A 4NICA 3PR1A 3JD2A 5H5JA 2NUTB 1SQ0A 2CVHA 4DCTA 4N1AA 1ZBQA 3CW8X 4O5CA 1UK8A 2JJ8A 1CJSA 5CR0A 4XQCA 4NE7A 4QTUB 4R8UA 3UAWA 1ZD4A 2WMYA 2EG5A 3A9TA 1IY1A 2FLKA 2BH9A 4GX5A 5FNVB 1BJKA 1XZGA 2WUDA 3ZE2B 4FSHA 1CUFA 1GCGA 3QKIA 1CDOA 2FSSA 3B51X 2G88A 3KZXA 3E5HA 1LTHR 3OPMA 4EI9A 2BFEA 1HG0A 5DX0A 1XYGA 2XQJA 4KVZA 1E92A 1EDEA 5JI2E 3QZ7A 4JJEA 5TQ2B 4YC7A 1TUGA 4N0MA 1C3EA 1E0AA 3CLTC 4OB6A 1JXMA 3OZGA 3BRSA 1X1DA 4IG4A 1OU0A 2GAOA 5IARA 4N0DA 2Q3DA 1PUXA 2WB1C 1B43A 4UTRA 4MCJA 1NN3A 3BB1A 3G23A 3LXRA 5JSUA 4MS4B 1W30A 3AUKA 2PGOA 3RHFA 4K3UA 3UAZA 4LXGA 4JLWA 2AUTA 3GOHA 1VYTA 2CB9A 1USUA 2HNKA 1Y8CA 3OWOA 5EMJA 4HNQA 3ZQ6A 4URUR 4RQ7A 2A1AA 2FX5A 1U6KA 1KFTA 1Z4NA 2NMVA 2YX1A 4RLFA 4UB1A 2C2XA 3OKPA 2DETA 4KHPB 1MO3A 4KDEA 4CTKA 5AD1A 2PT5A 1QMGA 3LLMA 3PSAA 2WG0A 4YN4A 1XLTA 1Z0SA 4LOHA 4PSKA 1L5WA 1NJYA 5I9LA 3WC4A 2AOTA 2XHEA 4INJA 2KICA 3D7KA 3N7AA 5DNEA 1H1TA 4M4SA 4DB4A 5KX5A 4ZT5A 3JYQA 3K5WA 5SZJA 2ZANA 4DR6B 4KDCA 5KYNA 3AIMA 3EJ6A 2XMCA 4UBKA 3OC6A 2IHNA 3L0BA 2FAXA 4PLHA 4AYXA 3UAYA 4CKEA 5L1KA 4FOOA 1ECBA 5T3YA 3TXXA 4CQNA 1AX9A 4GUDA 3D9QX 4J0FA 4NENB 1U02A 4C22A 2PKXA 1HFJA 3G2LA 3QTBA 5CM2Z 3DT8A 5L3SB 1W4ZA 4BOYA 1OXTA 1G3MA 5K2OA 1OYWA 4UXIA 4TVKA 3RR2A 5J0WA 4LF6B 1GU7A 3DULA 1G5TA 1KW4A 5AI4A 1V45E 4P4OA 4IWYA 4DW8A 1RYBA 1UFRA 5A7FA 4F5NA 2MTBA 4Y1FA 5K6AA 2M6RA 5CB0A 3KJXA 2X0IA 2CHVA 5JASA 4MW9A 3INTA 4K81B 3Q2OA 3T5BA 4M0PA 3IO5A 5A5VA 4FFNA 1D7AA 5FOWA 4Y2XA 4BNHA 2WAOA 1E5XA 3QEOA 1PT6A 1XYVA 3ZXYA 3DMPA 4YPOA 4YQFA 5AQEA 3RS3A 2ZYGA 2OWDA 1X92A 5C4MA 5C35A 3TWOA 3IVCA 5AOCA 2PBFA 1D07A 5SZIA 2QLBA 1VG0B 1DEXA 1QZ3A 4NMMA 3LP8A 3N6VA 3KYBA 3ZCUA 3E5NA 2QEQA 3LW8A 2WTFA 1UEIA 4ALJA 5ENZA 1FP4B 4TV9F 5TARA 3ZW8A 4ER7A 4NVRA 1G42A 5BN4B 4DMHA 3V97A 3AWIA 1YQXA 1CJTC 3WWPA 3DXFA 5A7GA 2J0UA 4F2SA 4RTKA 4B9LA 2E85A 5EE1A 2ILVA 4EUHA 1SKSA 1PFQA 3JYLA 2DUMA 2VBIA 2GYVA 1RKUA 2DHCA 1FNBA 3CE9A 4X1YA 3QKTA 4YLGA 3NBQA 2Y1KA 5C7YA 4S2UA 4NLCA 1QIFA 3BWXA 4JT8A 2D3TA 1NNSA 4R51A 1D03A 2FQQA 4QRHA 121PA 2C84A 4S04A 1DMSA 4HDSB 4BLRA 4UHEA 3I9LA 3WIBA 2AKYA 3NBUA 4X64B 4B2LA 2X0FA 3F97A 3GIKA 4RPYA 1NV9A 4D9KA 4RD0A 3G1TA 4CIVA 1X7DA 3U37A 4JL5A 3TQHA 3O90A 5AXBA 7ICLA 3LQFA 5ER9A 1MJFA 3NHFA 4G4GA 4BU1A 2G9QA 1KXJA 1B8NA 2AFIA 3O4RA 1Y1QA 2CZCA 3PIIA 3AF0A 2EFHB 1ORWA 1JHAA 3O4HA 3JYHA 2E3TA 4KIGA 1A6SA 1E8MA 5C81A 3ZIUA 5KFVA 4MYTA 1Q0RA 3A31A 2VUTA 1SM4A 4BEVA 4GGOA 2ECQA 3SZLA 4O5KA 5ESRA 3TUJC 3N59A 5LQUA 5GGXA 2PGDA 2W2NA 3EEIA 1VCHA 3WQQA 2R7AA 4B2IA 3EH1A 3ZQJA 4R8UB 2FDRA 5EWLA 3TVYA 5J43A 2JDID 3KZOA 4G1EB 4Y9DA 1AUOA 2I87A 3PUJA 5FTJA 4YACA 5F3DA 4N5LA 2WWHA 3EBOA 1KHHA 5A6SA 5E9WA 4LHYA 2C4KA 1C1YA 3DLCA 4YJHB 1KN5A 3U2QA 2BFEB 2ZUDA 5LQCA 2I71A 2ZB8A 3KLMX 1XHEA 3TRFA 3ZR4B 1PDOA 2Q2OA 1TMKA 3V7LA 5TDHA 4HVTA 2BGLA 3RLIA 3CO5A 5D49A 5BUSA 3O1IC 2LNDA 4E5SA 3RVRA 3LFUA 4EGSA 4GI2A 4FNOA 1QO7A 4RHTA 4CLHA 1HQDA 2IUTA 1V96A 2V0GA 3RVBA 4CU2A 3ER9A 3U3JA 1FIQA 3OLXA 1N0UA 5DK4A 1MH9A 2O4UX 1X87A 3BVPA 1A77A 5FPTA 4YA6A 4B34A 5EJ5A 3M9NB 3ZDAA 2GKGA 4KG7A 5JROA 4XVUA 2NVWA 3RC3A 1LB2B 1DKPA 3WYGA 3ZQ4A 2FLWA 1G8FA 3TVDA 1QSLA 4NDAA 2H07A 2J3HA 5BYKA 2H1LA 4E5UA 1R0LA 1KKXA 2BR5A 4NEGA 3CKMA 3FSRA 4A8HA 1XFDA 4UAGA 1RR6A 2F6RA 1ACJA 3D1JA 5JSZA 7ICIA 4ZT7A 4ZAYA 4CE6A 3E15A 1XUOA 2HJSA 1TZ2A 4X1OA 5EXEA 2XUKA 4OG2A 4RQ8A 5DXJA 1PBTA 3PQCA 1R0WA 2ZYAA 2VZ9A 2AOTB 5KWSA 1SZDA 4REQA 4TS4A 3W5CA 3OLCX 4LE2A 2X0DA 1MIOA 5EHIA 1T0BA 3OESA 2QN9A 4QM6A 3K2IA 4YP3A 1QHEA 2FFRA 4HRVA 4RTLA 1F9EA 5ALSA 3WX0A 3LDHA 5ERXA 1SBHA 1V3TA 2YXPX 1T4GA 3DXZA 2W6JD 2PS0A 2NU9A 4MV7A 3L6UA 2QTGA 2W4QA 2DWCA 4ZYWA 1QGED 3GJRA 1S9HA 2CNDA 4UKDA 2QBYA 1ZETA 4HG2A 4DXDA 3RSQA 3MOGA 2G5TA 2JFWA 4LECA 3W9UA 1JHPA 3MHTA 1ZQ1A 4HBZA 1W0CA 4MVJA 2JHAA 1SU8A 4OLAA 1DEAA 5E95A 4FYJA 2AQIA 1UXJA 3FF4A 3FKSA 4HN2A 4Q4LA 4A1OA 2OHVA 5A4JA 1QS0B 5LIRA 3IBCA 1PNVA 2E5SA 1ULSA 1FZQA 3OQOA 4TXMA 1AVTA 3HB5X 2ZSIA 4UOEA 4EA7A 1Q46A 4K9DA 1OROA 2KG5A 2IUEA 1QV7A 1MDBA 2XX3A 4IUYA 4CG1A 3MFHA 2J3KA 3GFPA 3OM1A 1ZN8A 2D5IA 4RHCA 4FZNA 2VUHB 4LHSA 5HR5A 4JYAB 5ARBA 1TVMA 5FWYB 1WR8A 3SENA 3E53A 4GC6A 4B3XA 1IYZA 4AAYA 2Q8QA 1F4VA 1LVHA 4N01A 3HJHA 1TM4E 1E0KA 1VSBA 4JC5A 1KYIA 1UHUA 5EYPA 4KGVA 4AMVA 3OO1A 1CT9A 2O7SA 3PW0A 3KIPA 4UAWA 1JLMA 2Y9PB 2H6EA 2FF7A 5JSHA 1TK0A 1UBHS 2C54A 3H5VA 1SIWA 1FC0A 1G59A 1QCZA 4DQPA 1EE2A 1TNDA 1U6JA 4LJ7A 5LP6F 4RZSA 3BH7A 1CJVC 4GXQA 3ZCVA 4UTZA 2X7XA 3GLIB 1NMXA 4L22A 3V7WA 1SXJE 4WK2B 1P8JA 1YU9A 4DR2B 2OT3B 4B3BA 2XNDA 3NKVA 2W8BB 4G07A 4XFDA 1TQHA 3T61A 4NK4A 1NY6A 2X1HA 3BL6A 3LBFA 1JI0A 3N7TA 1TDJA 7ICEA 4X1YB 1T7PA 1H93A 3EWAA 3RH6A 3NHRA 4RVFA 4QYXA 5KNBA 4DDVA 1S1MA 3PF8A 2FSVA 2PA3A 2P3OA 5DG9A 1NW3A 3P0IA 1MXFA 2G3YA 5EE3A 2RIPA 5DEOA 3A0HU 1Z5WA 3BGOS 2RHBA 1BC5A 4NNOA 1AO0A 2EWWA 1CRZA 1M6WA 3P2IA 3R5SA 3T0GA 1ZI8A 3O84A 4WK0B 2EWMA 5BOSA 1CIVA 3EE6A 4XH9B 3NTLA 4HYTA 1CF2O 4IY1A 2NQ2C 4XWGA 5EMKA 4QOJA 4QQKA 2BFCA 4AULA 4JBXA 3Q2IA 2OBBA 4F3NA 3GFKB 3AHJA 3WYAA 4P4GA 1U1GA 3NHZA 2AFIB 4GBMA 5LB4A 1TCUA 3OLVA 3I45A 1NYTA 4FONA 1RVV1 4NK5A 3WSTA 4F72A 2Y27A 2Z5GA 2ZB3A 1NXPA 2GCEA 3F4LA 2VHJA 2Z2JA 4BNZA 2PUWA 1I2AA 4IOKA 1X86B 5ARCA 3GEPA 2ASJA 3FIUA 2IYWA 1ZAKA 5A5DA 4XVRA 1R4ZA 4QZAA 3NRZA 4YVFA 2PMKA 2EP7A 1YUNA 3CEAA 3MGGA 3KWFA 2V7GA 5EWLB 4E5NA 5ALKA 4XUSA 2OHGA 5D6NA 2AEFA 3C5CA 3V32A 4LF8B 3DBVO 2ZRPA 4J9OA 4HAOA 4PYQA 1M75A 1GJRA 3HG7A 3SJ7A 3BFXA 3DKPA 3RASA 4YMLA 2IEBA 1SV0A 3UMCA 2Q4OA 4UNIA 5JYBA 3HNRA 3QOWA 4I1IA 1UWVA 3TGWA 4FZRA 4N7JA 3UK2A 1P0IA 5D7NA 2D62A 8ICIA 1AS2A 4XDGA 3GZ4A 1F5NA 4C0HA 2LP4Y 3RWOA 4LC1A 5J2DA 2NNWB 4L08A 5CRXA 2FPWA 1T24A 1TZCA 3KHGA 3UNXA 1RS0A 1W96A 4Y2PA 2QF7A 2XVTA 3OZRA 1Y1LA 4J0GA 4PLGA 4RIGA 2W2QA 3A14A 4DBZA 3OLYA 4BFLA 4AY6A 3DOHA 3FHJA 1WW3A 1ZW1A 3N0WA 5DTRA 3O3NB 1RKVA 4BDPA 1ZUHA 2FCAA 1NR1A 4BE9A 3H84A 3NBMA 1Y8QA 5L3QA 2PX6A 2WHPB 1E9CA 2QMYA 2EFDB 7ICVA 3WDKA 4ZAFA 1NKCA 3OHPA 1DOZA 1MQAA 2ZB4A 3HFJA 3PK0A 1CK4A 2HX1A 4E5VA 1JR3A 2GA9A 5CA0A 9ICCA 5J8YC 2O7RA 4XD7A 1G17A 5KFCA 4N3CA 4REQB 3R7SA 1OD6A 4WASA 3COVA 3EVAA 3D3WA 1BMTA 1KEPA 4K9RA 1MIOB 1NBWB 1SUCA 2B35A 1ABBA 3LUAA 1ICIA 1JS1X 1TOAA 3GFTA 3KOOA 3FSJX 2XXJA 3FFTA 4K5QA 2LBOA 3F78A 3VSAA 4AW9A 2OKCA 2J48A 1N48A 4GZLA 3SJCA 4A2CA 3EVZA 4I2NA 3OVMA 2J6IA 2QBYB 3Q87B 3R9IA 5CEEA 1Z45A 2ZIWA 4XEUA 5GOTA 4M0LA 5IC6A 1Z6YA 2F59A 2WKSA 1O96A 4P38A 3WLSA 1XMPA 4BUCA 4D44A 2YRWA 1BXGA 3R3ZA 3DEZA 5EXDA 2GASA 5LFAA 2KMDA 3AVTA 3C1ZA 3GJYA 1I94B 4M0CA 3CFYA 1ZJMA 2XA2A 3WLAA 4QODA 1Y4UA 3EUAA 1FSFA 4I1OA 2QJWA 1G5RA 2B7BA 4L5IA 4Y1EA 5HJEA 1GTZA 3JZFA 1YHNA 1ISSA 2IS2A 5FUXA 2QR2A 1V7CA 2L69A 3F3MA 1CWUA 3INYA 1E5QA 1G4AE 4KN9S 3WNDA 2EANA 1ZGJA 1LGYA 2E1PA 2ES4A 3LY8A 3VM6A 4ZJYA 2RKWA 5AKXA 2EIHA 4XPIB 5DM70 4EMUA 4HTAA 2BKLA 4MDHA 4YVZA 3OZAA 1U3WA 1ZQYA 4X1IA 3ELBA 2ZI5A 5EYPB 3AV0B 2O2HA 1Y7HA 1VE1A 5F1OA 2JRLA 5FYQA 4B8ZA 3TX6A 4WERA 2CEAA 3RUPA 5JS1A 1KRHA 4EK9A 1NK6A 1C9EA 1D2MA 2XB2A 5U1PA 2IYOA 1D6SA 2R65A 3AJDA 3HCWA 4H6XA 4BO9A 3T5DA 1GRNA 3N3BC 2CNBA 5ALFA 4TYQA 4DUZB 2BJHA 3SC2B 3LX8A 4GLLA 1LV8A 5IDWA 1VLVA 1Q14A 5IAGA 3ADOA 2QTTA 3JPQA 2FR0A 4G5FA 2F77X 5KFGA 2AOWA 2HJGA 1UDXA 1WWKA 2VJMA 3DAPA 1EDDA 4EHKA 3L6DA 1D9FA 4MCAA 1Y8ZA 1JEQA 4X62B 1JLHA 3WLFA 1OH7A 4MV5A 2VAPA 2ACVA 1JX6A 1W48A 5FI1B 1Y5NA 1ZJJA 4EJ2A 2CL7X 4QUDA 5DBAA 4EX7A 4FMPA 3ZY3A 3ERCA 4MVJD 3N75A 2UZ1B 1KBUA 5SYMA 1N62A 3WNBA 1NXVA 3A6GA 1X19A 3ILYA 5G1OA 1CD5A 4CYMA 1X6VA 2G77B 5BOSB 3L84A 4DA8A 4EEZA 4RLHA 3VKGA 3R5HA 4B3MB 1T0PA 1YB6A 1MZPA 1VBFA 2BFCB 2BZFA 3ABIA 1EHCA 5JXHA 1V8DA 4KLHA 3VOAA 4BCCA 2X5JO 3BK1A 1NUSA 1S8OA 2XY6A 2ECPA 3BYZA 5IANA 4P2GA 2FN9A 2ZR8A 2TSYB 2JJYA 4LAFA 4ROTA 4R8KA 4R9VA 4WZBA 3H1TA 1KY5A 3AKZA 4MA0A 2BTOA 3HWX1 1TLTA 5GP1A 3HXLA 1CU1A 1X38A 1GDHA 3DWGA 5EJ9A 2OMEA 4TTPA 2DULA 4CM1A 1IATA 1CRLA 1L7RA 3WJAA 1AGPA 1QRAA 3UMJA 2XB9A 3O4GA 2ETVA 1EGVB 2PGLA 2NO4A 1ZQZA 5J0YA 1FMCA 4KRFA 2VPIA 3KELA 1Z4KA 3EDOA 2GVNA 3BRCA 2J4CA 3O3OB 2A3NA 2B82A 4UBMA 2C3UA 3SZ3A 1KDHA 3OOSA 1QH8A 2IXAA 2OFOA 3CRMA 4GXRA 5K2MA 2G5IB 5EIFA 3IHQB 1XX6A 2GFHA 3PQEA 4OIFA 3GCZA 3FNBA 4NU8X 3AIOA 3D7MA 2H51A 1G8MA 3PUHA 2GZSA 3Q9NA 1W88A 2XT0A 4WA8A 3EJWA 2QD5A 2ZJYA 2PBRA 3WGJA 1JPJA 2BGWA 3S8EA 5HFNA 3EIOA 3AT1A 4J1SA 4GL2A 1DUIA 4BO8A 2CMDA 3D4BA 4JFRA 5EVCA 4CKZA 3TOSA 1DQYA 4UBNA 1JQAA 1H4SA 3EWNA 5DN6D 3RODA 3LE8A 2DWPA 5FF9A 1ZMBA 2O0HA 3E7XA 3I8XA 1P5HA 2OPHA 1Z0ZA 1Y8QB 4J6FA 3G2JA 4W4TA 2AI3A 2JBAA 5EIEA 3RQIA 4WNIA 3C1UA 1V2GA 1QVAA 1SO8A 1H8HD 4C87A 3ZD9A 4F60A 5BWBA 1T9CA 3F2IA 4TN5A 5CGZA 4OO1J 4BNGA 4J0KA 4RJKA 4JK3A 4C6HA 4P32A 4DCJA 3P97A 2BP7A 4D8UA 3GFOA 1H23A 3DKRA 3K31A 3U4AA 2P9QA 4CW7A 1VM6A 1GR0A 5CA0B 2JEJA 3R6WA 1K3UB 1AKWA 4HNSA 4QXPA 3LQQA 1SUEA 2PT9A 3F71A 3D3WB 1Q15A 5U9CA 2HDNB 4L4XA 1VFNA 1KE1A 1KQFA 2QLJA 2OC9A 1L5MA 5KNCD 2NPOA 3QOFA 3CWCA 3KT8A 1T6ZA 3VCBA 3RUIA 1US8A 4WIAA 4WEQA 1NKTA 5KVSA 4MZXA 2ZIWB 5FBWB 1K8ZB 2PLAA 4BBJA 1NGSA 1O96B 3PW7A 3II6X 2NVUA 4D41A 2D5BA 1BXGB 1TZBA 1HDGO 1H5NA 5LP6B 4LY0A 4YLEA 1BX3A 3O93A 1PVDA 1VLBA 4BMCA 5KYWA 2C2YA 3GT0A 3ONVA 4OLBA 3I64A 3MTQA 3TINA 1WNFA 5FNVF 3VHRA 3JASA 4V0ME 4QFCA 721PA 1UFQA 2IHZA 4YBRA 3DOOA 1NUHA 3OEHA 1P2FA 4GXIA 4QZ8A 2ST1A 4MA5A 5AW1A 1YOBA 1MA3A 4MOWA 5KJEA 2YWGA 1SQFA 1KAHA 4OI4A 3LQKA 1Y1PA 4TQRA 3E9CA 3IAHA 4RZ2A 1T9GR 4J4BA 4XSVA 1N33B 1Z0AA 4O63O 4N3BA 3BMOA 3HRIA 4X1IB 4C4SA 3UCXA 4UTPA 2WJGA 2P2DA 4MS3A 3REFA 2J3DA 2R8HA 7MDHA 4A5SA 4WCFB 1B16A 1YZGA 2JG3A 2BEKA 4MW7A 3MCVA 3RAJA 4JBGA 1UBJS 3L4JA 1BVSA 4LTMA 5DP1A 3R74A 3PZBA 3DZFA 1TVAA 4RYDA 4ZVKA 1U7HA 3SU8A 2FA9A 2J6SA 2VJMB 5JS8A 1SVUA 4Z0TA 2OP0A 4H16A 1ISGA 1KI4A 4XWYA 2X2PA 1JEQB 1PVPA 5CH8A 1QVVA 4J0HA 2L42A 3PUZA 3Q4GA 4RUAA 3N53A 3F1LA 5ICEA 2X40A 4CN8A 4GP6A 4Q4HA 2YICA 1R9JA 4PFKA 2B1RA 3K5PA 2ZWOA 1JFRA 3U81A 2WJZB 4LXQA 2FEXA 3OIWA 4YJ2A 4OA8A 4PWZA 3T6KA 4BAUA 5ALEA 3U3KA 4LG1A 4CR8A 3I8SA 3GUUA 1JG6A 4X84A 2YHIB 2OB1A 5EWEA 3C3XA 1VSTA 4LSWA 2Q1TA 3QVSA 1B6RA 3RIEA 1Q6ZA 1KEZA 3DDZX 4K88A 2B5VA 1BA3A 4MA4A 3VHXB 4M8SA 1OBFO 3VQTA 1UKVY 3OPYB 4LF7B 3P2JA 3GIIA 3FUXA 3C3KA 1E1DA 2YWRA 1JPNA 1J5EB 4WA7A 2WYOA 4XSHA 1R8QA 3AFMA 2X86A 2IW3A 4F86A 2M9MA 2Y71A 3EMKA 2Y1LA 3D2CA 4X3OA 3KSRA 3UJCA 3EQ7A 3B3GA 4KQHA 3VTAA 5KFRA 4WZBB 2OHHA 5DGHA 5BYBA 1AMOA 3PB3A 3HCOA 4ZTUB 3U49A 1N7JA 3NRBA 2WWVD 3DVSX 4KQ9A 3OJFA 4GU5A 1POWA 3F8WA 3CKLA 1OXXK 2EKDA 4EAQA 4XKJA 1DCFA 3JVVA 4OL9A 1ZM9A 2XOEA 5IM4F 1YS6A 2KS6A 3ETRA 2JJMA 2QMOA 1OLSB 3PITA 1U7DA 3PNPA 4EHLA 2X41A 4Q4AA 1EBUA 2IHUA 4QXOA 2QRQA 5HUQA 3W7AA 2JGLA 4I2GA 3SYKA 4RK5A 1QH8B 1P6XA 3ZIDA 4EDHA 4E5YA 1OREA 4IEIA 1USVA 1I1OA 1GLGA 4HLNA 1DP4A 1I1QB 3PWSA 2VHWA 3LVQE 1JMVA 2IDMA 3QFCA 5BWLA 3TIVA 4D5GA 3P9SA 1TEHA 3SDSA 3LA6A 3KFVA 1UR5A 1Z26A 4KN5A 1U94A 4PPGA 5KOHB 3OWXA 1GR1A 3DV2A 1PQPA 4CUZA 2XUOA 2H3VA 2GCGA 4PHEA 4DMLA 1L8LA 3EODA 5C4IA 3DJFA 3DM5A 4LYHA 2QTFA 2OHFA 3CO0S 2A1JA 3M5WA 1CZNA 1XVUA 2MUTB 4RBNA 1GPYA 4EYQA 2ARKA 2VHEA 4D3XA 4IINA 3R0QA 2G7ZA 1F1BA 1XTVA 1AQUA 2COKA 1SCBA 2JGDA 1DFHA 1ECWA 2JBAB 3ULKA 1CR6A 3UJBA 1VCIA 3ZHXA 1EEHA 1I8TA 3U4DA 4RIEA 4JCCA 5K0BA 4DABA 1DO8A 2WUVA 1DKOA 2ORIA 3AINA 1UADA 1EDBA 5BSUA 1TK9A 2DWOA 2BP7B 1C41A 1ITZA 2D74A 2G70A 2DWQA 2FZLA 2ZYIA 4ECSA 4Y2VA 3FG9A 3UUWA 1OBCA 3QG5A 4J3JA 4RPCA 5B3AA 3Q8PB 5KFQA 2W90A 5LQNA 1XE3A 3L7DA 3RC8A 3CZ4A 1HK7A 3HPQA 4PYLA 4YG2A 2ZVQX 2YXNA 1UT5A 4PO9A 1H4TA 3FH0A 3PRKE 4B6SA 3M2PA 2HXSA 4O8ZA 1M5TA 1TT7A 4CQLA 4UB2A 3RHTA 5JT1A 6PFKA 5JW6A 2F44A 1XXLA 1HEYA 3IDQA 1KEJA 2EVWX 3IURA 5I7WA 2VIXA 2R1VA 2ID9A 5L4NA 4RU9A 3PGVA 2VJDA 3G1UA 5DB6A 1GSIA 4W99A 4OAQA 3H8JA 4UEJA 3VR2A 4BDTA 5KYWB 3A3OA 1JXEA 2JLRA 3FPBA 4H7IA 1ZKDA 3JWHA 3OE7A 3VR4D 3OJSA 1WMDA 2O7VA 2UUCB 4R2JA 1J00A 3JASB 1XA4A 3MK31 2ACEA 2Y8EA 3I2HA 5FADA 3TR0A 3L1KA 1WKCA 4IOMA 4LHZA 1K0FA 3UMGA 5J8YA 5HQTA 4EO9A 1ZITA 2YOFA 4XR9A 4MRPA 3HEBA 1QK4A 1TJYA 2FXVA 2QRZA 4TYYA 2J9ZB 1NNI1 3HY6A 4NS1A 2AC4A 3CLUD 8ICLA 3T8YA 3GQBB 4NPCA 3HFGA 5JANA 4UBCA 1EPUA 2JVIA 5JG7A 4OX9B 3C3EA 3BGWA 4FQ7A 3OM0A 4V39A 4JSYA 4KIJA 3GG9A 5LMZA 5CYPA 5TF0A 4JQSA 4F9FA 3VJMA 1LNQA 4MS3B 1FFGA 2NVBA 2I1WA 4MMZB 4MW0A 1T94A 3W8EA 1OWPA 1IBRA 4HZUA 3BGDA 2NO7A 5L7YA 2CJYA 1RM0A 4F0JA 1RE1A 3KZIU 1FTQA 3NBYC 3G9QA 1NSTA 4EPYA 3E22B 1NSYA 4TQUS 4RTMA 3A05A 3MFIA 3D0RA 1TW2A 4D46A 3NX4A 4L15A 4IQGA 5U4XA 2VF7A 2OYRA 2ZI7A 1YRWA 3RE1A 4XWAA 4NCHA 1Y1SA 3EPIA 1KAOA 2AR0A 4B5KA 5D5QA 1OLXA 3LXXA 2JA1A 4PG5A 4UAVA 5FUBA 3K09C 5DLPA 1XMJA 5J2AA 2AHRA 4LYFA 5DYGA 3KX2A 2W42A 1Z0KA 4TUQA 3ONWA 3NHLA 2P9TA 3VNQA 1R5BA 4DKJA 3CURA 3TAUA 1IU9A 5KX5F 4KFSA 2ZI3A 3D6AA 2J07A 3EF0A 3A26A 1HOXA 4YJ2B 2O2CA 4ICIA 1W5FA 1QQ7A 4DCUA 2WILA 2OOKA 1KPIA 1GZSA 2B3DA 4BP9A 3WBKA 2ZRJA 5LMNB 1C3OA 1P7YA 2X9LA 2V58A 1IIRA 4JQZA 3FLBA 4A2PA 1GG5A 2NO6A 4ILEA 4BWYA 1P2TA 1H2EA 2JB9A 2C2HA 2QV0A 1XTPA 2PMBA 4ANFA 3DZHA 4B3DA 4NV0A 2FOXA 2VP3A 1LSOA 3CRRA 4GYYA 1ZKMA 4KLUA 1V7PC 1E2QA 5EP2A 5DLGA 1SG9A 4F3YA 1AQ6A 1RAEA 4UUNA 1FDUA 5TIIA 3QXXA 4A6DA 2QVLA 2XITA 1I2BA 4YRPA 3FZYA 4DSOA 2GLUA 1NQTA 1V8FA 3WLMA 5I7RA 1GT91 4AY3A 4LZAA 2Z8YM 3GFGA 1NK0A 1N2BA 1TTPB 3AYXB 5CHGA 2R6HA 2QE7D 5FDFA 4LOLA 2F1RA 4O0IA 3N8NA 2XZOA 1I33A 2Q1SA 1C0EA 2CVOA 4L0DA 5EE5B 3BMNA 3IIJA 2PH7A 3K70C 2RK4A 2DBZA 3SXPA 2DR0A 4DREA 2W04A 1MQ8B 2MCFA 4PO1A 1QHGA 3T12A 3ADBA 4Q4AB 4R2HA 4XIJA 2PLRA 2PEYA 4UJ5A 1HE2A 3VPDA 4G5RA 5HZHA 3TCNA 2A9FA 2I76A 4ZVOA 2VK4A 3BJZA 3KCQA 1CETA 4HI0E 1VBKA 2GJSA 3LKZA 2WJVA 1J8DA 1T5LA 1P7DA 1OW5A 1BZYA 3IUJA 4EUSA 4QPZA 5LDGA 3T35A 3PXGA 2BN4A 5FPPA 1L9XA 1L7XA 3WWOA 4LJSA 4Q6BA 5A1JA 3THYA 1SCUB 1JKJA 4HRYA 3T4PA 3CLHA 4RY9A 2O06A 1W49A 4EY7A 1XTJA 2A5FA 3DC7A 2YIMA 2A1JB 4I8XA 1FVXA 5E4FA 4BKOA 4DYVA 3MR3A 1QDUA 1QHNA 2P3LA 2HWYA 2JGDB 4DL2A 3I9V1 1Z37A 3GFSA 4ZP1A 2OK8A 1TCBA 2C8LA 2ZT8A 2VQSA 4WTOA 1Z83A 4J3NA 3GLGB 2XNJA 1K88A 3T38A 5EWGA 2AF3C 3OMLA 5DHFA 4F5DA 3I5XA 2WA2A 3KHHA 1NJXA 1BYIA 3GJSA 4JCOA 1K8QA 1LPBB 4L5JA 3HDJA 3O2QB 2I5HA 3VU8A 1ODCA 2HJRA 1LFAA 3BL8A 3CRQA 3OEYA 1O95D 4F1WA 2DC1A 2WHXA 2VWGA 3TQ1A 2HIAA 1ED1A 2IF2A 4IKEA 5CP8A 5FPHA 5J4YA 1NW6A 3FNIA 1CUBA 4P8RA 1E2NA 1M67A 5HF8A 3TXYA 1EFDN 2IEZA 2WNHA 2ZJBA 3L41A 1LNSA 2JHCA 5IIKA 1XPRA 1T6NA 2VVTA 4IBOA 1LPOA 4CQLB 2EZUA 3WMXA 5HF9A 4UB6U 2CEKA 2W2MA 3C5EA 5FTLA 2DE0X 2RDMA 2IXDA 4FHGA 3FDXA 2R1VB 4W5WA 4GMGA 3GJTA 1QFZA 1XWLA 5JD3A 4RVOA 3DLPX 3BZBA 1TO2E 4RS4A 2B2NA 4EP1A 2QY9A 4HQLA 4HDKA 4NONA 4P31A 5BQOA 4I2CA 4ZCRA 3FMOB 4DV5B 1LPMA 4GWKA 4E5DA 1DKRA 3T94A 1NVFA 2NLOA 4CF6A 1C30A 1L5SA 2Y6UA 1RTKA 4KLTA 5DNUA 3ISDA 1S3SA 3SE0A 4ZEWA 1XO0A 4FE3A 4KYIB 4F9EA 3N7RC 2QTCA 3QBTA 1X9IA 1QVRA 3BILA 5DLQC 1QZZA 2OENG 5AKJA 4B6PA 3AOGA 4AO6A 1XZJA 4A23A 4U6NA 4ACAA 4OGKA 4UNNA 1JTFA 3I9NA 2BMAA 2XYHA 4TQAA 1KQ3A 2HNAA 5AM0A 4O59O 1UBFA 2R5WA 4G0ZA 3V7FA 2ODQA 3OFNA 4DIUA 3LGAA 2X14A 4HZUB 2A67A 3DFZA 2WJYA 3G5AA 5GTDA 1QYIA 2GJKA 4HNUA 1WWVA 1XDGA 3F2VA 3CVJA 1H9CA 1YBMA 5K3SA 4EVSA 3UPUA 1CQZA 4DDUA 5JI3E 4HL6A 3U0BA 2HAEA 1J0AA 2XUQA 5DH9A 1P0FA 3KJHA 3L8ZA 5AHWA 3AILA 4DG5A 1RBZA 3NH9A 5BSVA 4INOA 4RSRA 1V9PA 5HIIA 2NZJA 2H9AA 4DAOA 5AW0A 2BSQA 1OLXB 1FFVA 3MUEA 2RGYA 3LM8A 4DIMA 4YMTA 3SZ2A 3A2LA 3DDUA 3PSFA 4FQ8A 2HJVA 2PAAA 3EAFA 2DY0A 2YQ4A 4KLFA 5JR3A 4ABYA 1GAEO 3HNPA 4X93A 1ANKA 4MCHA 4HWPA 1WY7A 3K35A 1GSHA 3GMTA 4A8TA 3HBAA 1AQIA 1AUVA 4PZDA 4YYZA 1O94D 4B87A 1CJMA 3X1MA 3KVOA 4ARSA 3VBEA 1XMIA 2ZSAA 1GQSA 2DY1A 4XUEA 4QT0A 2XCOA 4OI0A 2FW7A 3AUAA 4LJ6A 1L7AA 1P73A 4YCSA 4OMCA 3TLGA 3KVYA 3TAQA 5GVRA 3QE0A 4C4AA 2FPPA 2YWBA 3A58B 4F85A 4MVJF 3GD5A 4P92A 3HB9A 1GRCA 3MWDA 2IMWP 1HQYE 4BRSA 1KZHA 1M8FA 4D0LB 2QE6A 1SKWA 2B34A 4L5BA 1V1JA 1T15A 1TIBA 1QH0A 3X2FA 2Q0SA 5LQJA 5CD9A 4MMYB 3LKDA 7ICRA 1OT5A 1I9GA 1TI7A 1FFXB 5JADA 3C5HA 1CS0A 3BMNB 5J4LA 3EEBA 4B83A 4DXAA 1N36B 3S40A 3ZWXA 3TRDA 3PHCA 4BYMA 2P0AA 3BSWA 3MCZA 3RUAA 1KZYC 3VKHA 1SXQA 1Z4IA 3MTGA 5JSYA 1L5GB 1KVQA 1PFUA 1RFLA 4YFVA 2C99A 1EI9A 1JLLB 2W9XA 1U8FO 1D0SA 4D1YA 1MJGM 1E5DA 4NJMA 2GEVA 2FB9A 4AZ0A 3AU8A 1V16B 3H86A 5DG8A 3IQGX 2J31A 1NBHA 3S99A 4MUEA 2ZTHA 4KO1S 3AKDA 1GA6A 2H5LA 1GRVA 4E46A 1MGOA 2H57A 1JKJB 4QGHA 1Q0LA 1Y7IA 2HBKA 1JDBC 1PS9A 9ICXA 4C78A 2H3FA 1T1EA 5KYUA 4OFZA 4EOGA 4RPGA 4K86A 3C7TA 3HDVA 4EJ6A 3H1AA 1DIRA 4ASUD 3FTPA 3S2UA 4AYBC 2ANCA 2FPSA 1Y4AE 2JS7A 3GCXA 4G36A 2NU7A 4OJ6A 2RGNC 3HM9A 2KWIA 1F0YA 2OLEA 1ZRNA 2WHRA 5JALA 1FU7A 4WVLA 4Q1AA 1AQNA 5ESDA 2R84A 1X7YA 1HWYA 5FTKA 1KBQA 4NESA 2ZUBA 1CUXA 9ICEA 4JC8A 1OC2A 2YXEA 2CCGA 3ADKA 3L0YA 1DG1G 4Z4QA 4A0HA 3GQVA 3WOVA 1L5VA 4WACA 4Y1GA 1I36A 3UWPA 5FI5A 4C5AA 3B7PA 3ANSA 3Q5GA 2CVQA 4NRDA 1CZKA 4KR2A 4YONB 4INPA 5IK2A 5GIPE 1WUYA 4GR5A 4MTLA 1I5EA 3GUZA 2C7VA 5IN5A 4YIHA 1J25A 1FUKA 4Q7QA 5C8ZA 3QWIA 2C7RA 4ZJPA 4BKQA 3KKAC 4P83A 3PSPA 1HRDA 4NP6A 3R7FA 3JQBC 3HKDA 4CEHA 2D3WA 3ETLA 4M1TA 1XYYA 3OTQA 4JBLA 4QRIA 1PZHA 2A5DA 3WBJA 3O2NA 4MYDA 3W90A 1TX4B 1KP3A 3O8NA 3FMPB 4C8NA 5EL0A 4ZT2A 1CNMA 2RP5A 5F77A 4HDKB 3VVBA 2QT9A 4BWGA 4NF2A 3MDAA 1M2KA 1RCFA 3WB1A 4JD5A 2OYYA 4QUJA 2Y67A 3D4PA 3DAGA 3UB3A 4CL2A 4H7JA 4EG3A 3B70A 5D3MA 1Z0DA 4MP6A 5AVQA 3QJGA 1C30B 3W6OA 2VBCA 2IZ7A 4DPLA 2PWBA 3FPJA 2NV3A 2XF8A 2C95A 3B3FA 1RAHA 5DDYA 1MKYA 3ZE9A 4FDLA 4DMFA 3DE3X 5KX5B 1PS0A 4H3KB 2NSYA 1Z0FA 2ZTMA 5JVDA 3LWLA 1KY2A 4PZAA 5F64A 3A1CA 1D2CA 3H65A 2YB1A 2D4AA 3NHBA 4FCVA 3CNHA 4CKEB 5B7QA 2HMUA 4MHVA 2AV6A 2Z6AA 5FWXA 3MBOA 2EAMA 1D5WA 5K0ZA 3MJFA 1K6EA 2V6IA 3BREA 4IXNA 7ADHA 3CZPA 1KY4A 1PN3A 1IDOA 1V8ZA 1LEHA 1WXGA 2OYSA 4GFJA 2C9YA 1IHXA 3KWMA 3WA6A 2Z1DA 4HNRA 3MCTA 1SBIA 1E6UA 5K4LA 4KNVA 1KOJA 2CFTA 2P2CA 3DGEC 1KFDA 5D3KA 2XE4A 5L9XA 1DIBA 3CNLA 1X66A 1PWEA 1T26A 4C6SA 1P3Y1 5CA0F 2PG3A 3QVVA 3FAKA 2WVAA 4ALNA 3IJ5A 4KPFC 1KOLA 4B6GA 1WSDA 4NOKA 4L02A 2Q45A 3IFSA 1D4AA 5CDFA 7AT1A 5LQRA 4DCPA 2WB1F 1UQVA 4M1KA 1WW8A 1VL8A 2GHQA 1X1AA 3STWA 3ZNNA 3WSVA 2HUNA 2CHUA 5F3XB 4QT4A 3OFVA 1RI1A 4GI7A 1FJGB 3E3AA 2IV3A 5JTTA 3MAAC 5FR2A 3ZBPA 3ZZTA 3TLGB 3RRJA 3G5TA 4PXAA 2GEDA 1G6Q1 1DOHA 3P0JA 1VG8A 4KN8A 2FPPB 4UM9B 2EG9A 4TOIA 3BIWA 4WXHA 2AQ4A 2I6FA 3MWDB 2WAXA 1QM5A 2QRVA 3ISTA 1T5IA 1EWYA 1JROA 4L0CA 1E32A 2J0UB 3K09A 3KL2A 4D9IA 4RE5A 1KDVA 4UPEA 4OFBA 2VK2A 1VG9B 2NT4A 3ZS9A 3GB9A 2CXPA 2GJAA 3OTGA 2JAXA 1N2XA 3LLUA 3ZE6A 5ED0A 2NSJA 2WWFA 4J9SA 3MM4A 1M2FA 2IYNA 1JHVA 3HRDD 4KLIA 2BCSA 4AX8A 3A4MA 2W2KA 3G0BA 2BQUA 5EIHA 5B1SA 2O0KA 2QROA 2YYSA 3ZV7A 2E1EA 1U9YA 2NUAA 1EH5A 3LY5A 1HE1C 3KQQA 2ZE8A 3BWDD 5K3FA 5A4DA 4HRXA 1XD8A 4BNKA 2P9YA 1KH1A 1EXVA 3M6UA 1UKEA 4NARA 2DH5A 3JS5A 3D81A 2NIPA 3UKOA 2C9MA 4M1YA 4OAPA 5AKIA 3W06A 3QE4A 3UJ9A 4QDOA 2ORWA 4D9JA 1DEHA 2AN9A 3KQOA 4URFA 1TUEA 3OM8A 2I03A 2V1UA 2RGRA 2O2ZA 1DRKA 3EPJA 1N2EA 1GQ2A 1LPPA 4IQWA 4IMPA 5E4TA 1HE4A 1XP5A 3MWYW 6ABPA 4HP8A 1T6BY 5KYUB 1LB1B 3RU2A 2WLTA 3DMGA 1EA7A 1V85A 3M9WA 2YMPA 1SIBE 4MYCA 3EA5A 1D8LA 5EKUA 3LUHA 4WGFA 3ELYA 1N9GA 5F12A 1RAIA 2NU7B 5FUWA 2ODPA 3SDBA 3IE2A 2EQ5A 2O52A 3FWKA 3BX1A 4UM9D 2H4WA 1HZJA 3PDIA 5J1TB 4ZT4A 2EBUA 4NWIA 3MGCA 5C9ZA 2OHJA 3H2SA 2Q2WA 1VSVA 3OHAA 1NW5A 1CZRA 4HAUA 1VJRA 1YNSA 2EYQA 5J2IA 4FM9A 4S1OA 5A6SB 1G21E 3EPHA 3WDMA 4AKIA 3NWOA 3R3SA 5JAQA 2OPBA 4R8RA 4UU8A 5TPWA 4U2GA 2JK1A 3LGSA 1L4EA 4G0UA 1PR2A 2Q28A 2B25A 5EJIA 3I1YA 4TVSA 3KJZA 3HB0A 3F7TA 1ZG3A 3DKVA 2R00C 2JFPA 4EJMA 3L4EA 5BVGA 2I1LA 3FXAA 5TY0A 4DJAA 1Q7TA 4HYKA 2B5WA 4P4SA 5HZGA 4LSMA 4EYHB 1IY2A 5K20A 5JARA 3CR7A 4WL0A 4CQJA 3L5KA 3TZHA 4RDIA 3OZWA 2DB3A 2K8AA 4BFZA 5JZBA 4ZQGA 4B6EA 5TLSA 5CFRA 4M76B 1XMXA 5KYVA 4Z9XA 1HFWA 3VZDA 4JLUA 1E18A 4CEJA 2CFRA 1M73E 3RS2A 1M1UA 4R16A 3AVWA 1QOZA 3CG0A 3NIWA 4G01B 4LPSA 4I5DA 1Y5RA 1YS4A 4X3PA 1NIPA 2VG8A 1LBIA 3UXMA 1BDBA 1GG9A 2CJWA 4GPD1 5B6IA 4ECRA 4PQEA 5EQJB 4BO3A 4BKPA 5JSZB 1MB2A 5D3MB 2W2LA 4IXMA 2A1TS 1F5SA 1O6FA 4LEIA 4JOBA 3NJ8A 3NNDA 3QLEA 4NEHB 1RU3A 1VPWA 4FDMA 4QHTA 5BY2A 3HYNA 3DLAA 4KQ6A 3ORFA 3WMGA 2ACWA 2F2TA 5JVDB 1OFIA 4GC9A 3Q0EA 5BURA 4MB2A 2NU9B 1Z2CA 4XSGA 1JLKA 5LZ7A 5BWMA 3G2IA 3D4IA 4WLFA 2RHDA 3I2GA 5J5VA 1VCNA 4CTJA 3P20A 3WB2A 3FPCA 1ETUA 2A33A 3ZU6A 3ZHSA 1VL2A 4RCYA 1IM2A 5B2FA 4C5BA 4DS3A 3PZPA 3LHSA 1IOLA 4WW0A 1FIUA 4QREA 5TF4A 1UJ4A 5JUMA 2QB5A 2Q3BA 4BBZA 3DL2A 4C4PA 2HMVA 2AG5A 4HO1X 1W4CA 2FPUA 1CUJA 4Z1MA 1ZXLA 2AN5A 3FOFC 3M4NA 2H29A 3MA0A 1AMUA 4CNQA 2BHRA 3USES 4B4DA 5HS6A 2F76X 4U7DA 1ZM7A 3TIGA 4UAZA 1MENA 3OJWA 1U3CA 4WLOA 1M66A 1RM4A 3JYOA 2CBGA 2VDKB 3IT0A 1OXBB 3H87A 1VDZA 4JP2A 2X5KO 1N2GA 3LQ1A 3WKBA 1G6OA 2WWXA 4YY3B 4Z6DA 4PVDA 4R5HA 1FF9A 2LZ0A 1UZLA 3EEFA 3IAM1 4GXTA 3VGJA 2QL6A 2IYPA 4LOJA 1DLJA 3ANTA 1HO3A 2DFDA 3RYHA 4LJKA 4LI0A 5F2OA 2QRVB 2ZJ1A 2FZWA 1SVNA 4MVYA 4Q7KA 2NRXA 4I29A 1SA0A 4ZVLA 5HDQA 1ADFA 4QA9A 3KU1A 1JG2A 4P4NA 5FI3A 4J0DA 1NZPA 1QTQA 1CEEA 2QL9A 3WV4A 4Y2GA 2HA7A 3LVRE 3SFZA 2OAP1 1QPBA 1N2IA 3QW4B 4F3OA 3TBKA 1W5EA 2F9MA 3ESAA 3BCSA 3N8GA 3HW8A 3RAGA 5K09A 2G4LA 4WNAA 3SLGA 3ENQA 3T5LA 2W2KB 2JH1A 3BE5A 3LFHA 1XRMA 1SCAA 1G3UA 2Q1YA 4GC7A 4G81A 4KE7A 3DV0A 3MJHA 4B7AA 3LK9A 3P9NA 1GNVA 2X8JA 4EF5A 2I9KA 3FKSD 4EBEA 3PNMA 4DAEA 4RJJA 2ZM6B 4F12A 1P2SA 1FQWA 4PO3X 3ODGA 5T14A 2VF8A 2J0EA 1OBVA 4QTZA 5JBIA 3NBKA 1V5WA 1YL6A 5GQSA 2P7IA 2RGWA 3SR0A 2ZKIA 3QY0A 3HY3A 1LUAA 3SQIA 4IXWA 2X0RA 1GUBA 3KKZA 3SZGA 5JC1A 3SY8A 3DBLA 2P78A 5TQJA 1L7DA 3B52X 3I92A 5DVZA 2WABA 2KJQA 4OXRA 5JFTA 1MXHA 4DARA 3S7TA 1QB7A 2H2IA 1XZ8A 1MPXA 2CFCA 2CK3A 3E4CA 1ID1A 4AZ3A 3Q3CA 1SOVA 1MO2A 2J6CA 1KEKA 3KVNA 4IUCS 4HS4A 4F4WA 1BEZA 2COUA 3AB7A 3BCHA 1TFUA 3IV7A 1N9GB 2Q5HA 3T7AA 4GNKA 3EG9A 3PDIB 1N78A 1F8UA 4OJLA 2ZDGA 5AK5A 2H3HA 3K96A 1I4TD 3SHWA 4XCXA 3TLJA 3EFBA 5EG5A 4YJ2F 4FS1A 2FLPA 4JBYA 4OSPA 2IVFA 3BSSA 4ZOQI 3RR8A 2AF4C 4NMLA 1TW3A 3P8ZA 3JALA 4I28A 4J1TC 2GD0A 4DN6A 5AHOA 1D7OA 9ICIA 4IGEA 1ULAA 3V5NA 2XNDD 3LT5A 2XCPA 3FVQA 2I99A 1E7WA 2JLSA 1N2ZA 3ZCRA 5TPWB 3JYNA 5EXXA 4WN9A 3PDJA 1W0JA 1HI9A 2MR6A 3U1TA 2HV9A 3UCEA 5KNBD 2KBEA 1NLUA 2IHMA 1NFRA 3G2NA 3USZA 3B6IA 4FSXA 1XPJA 3N0TA 4IXDA 5ECDA 1J2YA 1XQXA 4LE1A 1Y5IA 5BVGB 4FGSA 1ZNWA 1CZLA 4EJFA 1HFEL 5EAIA 3T3GA 4INZA 3NJ4A 3S70A 2JAPA 4MS1A 4M7RA 4E70A 2JNWA 3KB8A 2RGNA 4H6WA 5HRUA 4K2AA 1I2CA 3HZOA 4JOQA 1NLZA 2H3IA 3CH7A 3MRSA 1BMFA 2GDJA 3GUVA 4CEJB 2AQHA 4XM1A 5KSOA 5L3QB 1JHUA 1TZMA 3FVVA 1BOFA 1P61B 1OLOA 3U4GA 4Y6OA 5JHHB 2HMYB 2CJWB 1N6PA 1DWUA 4QASA 1CB7A 3WO0A 3ZE8A 3QMVA 2N0SA 4D4IA 4E15A 5KU7A 1DT5A 4X0EA 4DY6A 3ND6A 4F5OA 3V2HA 1VRWA 7ICQA 2ZRKA 5KYGA 3LY9A 4RSHA 3BGIA 1XNSA 3NVDA 4XW2A 3KKAA 4JC0A 1DBRA 1Y6ZA 3EGWA 4DLWA 4I2EA 3RUFA 3JQBA 3JAMA 2XYGA 5KTPA 2ASLA 4Q3AA 2Q7XA 3EQ6A 4KLQA 1XVVA 2CLFB 3PHJA 2B4YA 3NNNA 3ILVA 4BLTA 1PVOA 1RLJA 3FLMA 2Y0SC 1D0IA 1ZJ5A 3HZRA 4TWAA 2FG6C 3HLKA 9ICFA 1UBCA 4PAWA 1TEXA 4G1VA 3ADCA 4CN9A 1DAEA 2JCVA 3B1ZA 1XU9A 3U39A 2X8LA 4UMDA 3NRCA 1ZHOA 2C7GA 4K46A 1SXGA 5KTRA 4PYKA 3PCTA 1Z33A 3TB6A 1WUDA 1X94A 1VMDA 4IDCA 5FBVB 4AUEA 7ICHA 2J3JA 3EEQA 4S0ZA 4IDEA 4S1WA 1WEKA 3C85A 1N5MA 3QI2A 3GWGA 3V2UA 4PXYA 4XQ8A 1Q19A 2LGJA 1L8AA 3FPGA 4BE4A 2ODBA 1BWPA 3CZAA 4GG1A 3V8MA 3OT5A 2E55A 1LRLA 4DADA 2F3RA 4A6XA 4KX3A 5EVJA 1ZOIA 1JR3D 4ZI2A 2QP3A 3RYHB 4A91A 5BV0A 3CLTD 4XD7D 4FX5A 2NVOA 4RWEA 2YFQA 3C6XA 1FX1A 1AJEA 4G3IA 4IPTA 1DHTA 1UQRA 4G89A 4K26A 4M1MA 3U44A 3S8YA 4L0QA 3QFRA 4CLDA 3AP2A 4KQ2A 1SVWA 4L4YA 4GLBA 2Q5EA 2P4HX 3C3DA 2Q4BA 1KVSA 1YK0A 1PRYA 1VI2A 1BPEA 5DYTA 4WNAB 1GGFA 4W7IA 4UQOA 1EZZA 2RJNA 4JI0B 3UBTA 1FMLA 1ODTC 3UMRA 3U7FB 2X2EA 4O0LA 4CBVA 1I51A 2O5EA 3DV0B 3JCZA 4L8FA 3O8BA 1ODFA 1YZHA 3NEYA 3Q11A 2X8JB 5F9FA 1D8TA 1Q3HA 4DE5A 4QOIA 4QTTB 3UGJA 3TW6A 3MJRA 4TRMA 2RGXA 1V1RA 4HC4A 5K3CA 2LE0A 3JATA 3K4PA 2W4MA 3JAKA 3DQZA 3QUTA 5MFZA 2JGIA 4IDQA 4DC9A 1CJBA 5KT3A 6GPBA 2RGUA 4Z1MD 1WZUA 1OWOA 3RSOA 3VPFA 3DBLB 1QVWA 1AXRA 1RWWA 3A1TA 4CCHA 3I32A 2PGXA 3KQLA 2EH9A 3QEKA 1HNXB 2Z6UA 3SX0A 3UPTA 2OLKA 2PNFA 1MAAA 3AW8A 1IK4A 2VNHA 4AZ3B 2HN9A 3ZKWA 3R9XA 1OWMA 3QRWA 4MLPA 3IOBA 4QU9A 2ZI9A 4NU5A 3TQSA 1OXVA 1TVCA 4OEHA 5HW0A 2OCPA 1G5PA 5CDTA 2QSUA 2R4QA 3NVKI 5EESA 2YJ4A 5H59A 4L4RA 3WHLA 2FQYA 3I5AA 1Z5ZA 2GOYA 4OHVA 4X66B 3JALB 2OUIA 1YBHA 5DYWA 5EGSA 5AI5A 2RFLA 3I83A 1ZUWA 1N57A 3LC0A 3JRWA 1DFGA 3F2DA 2V0NA 1B23P 4B17A 2EP8A 3G6YA 5AW4A 4WN9B 2XMZA 3EQ2A 3S5UA 2ZBPA 2CC2A 2ZCJA 3OD5A 1KA9H 4FB5A 4BN4A 5FOTA 3VC2A 3FX2A 1MC8A 5C8DA 1W88B 5BNTA 3C3AA 2P2ZA 5KDDA 3TDKA 3AXTA 4PF1A 1B00A 2Z57A 3MJDA 4KEAA 5ICFA 1JI7A 5I51A 1FDRA 5HZMA 5LBTA 1P2DA 2OILA 3SVLA 3W6UA 2PA0A 1SXJC 3TMAA 3ZU3A 1YKSA 4A15A 3DZDA 4QQNA 3KT3A 4MKGA 4Q1CA 5HE8A 2VWHA 1EXNA 1KTVA 5KBYA 3AI3A 3Q0IA 1VMKA 5EEGA 3VH4A 1QUFA 1PKXA 5D87A 2IITA 3G8DA 5DB7A 3USCS 3GA7A 1U0EA 2AMVA 1UZMA 2NU8A 1SC1A 4XTRA 4US2R 2K5UA 5L1LA 3ZHOA 5IVPA 2CK3D 3LBNA 4ZVQA 4ELUA 2ZIVA 2ID8A 3W5HA 5CLQA 4TT8A 3DYBA 4G2TA 3JPNA 1Q3TA 5KT6A 2R00A 1XC7A 2OEHA 1SPXA 3MJEA 1C9JA 4NCKA 4CV3A 3JPSA 2GRUA 4R1LA 4D9NA 7MHTA 4OTZA 3ZW9A 1OX6A 3DEIA 4UNQA 1QCYA 3PJFA 1H4VB 1OVGA 2FMQA 3EPRA 1Y4DE 5FTNA 3ZWNA 1RACA 1US8B 5BN3A 2H0QA 1AUXA 1QR2A 1K7SN 4GBED 4BJ1A 4UASA 2A0FA 1RZTA 3HR7A 4PR0A 1GPJA 1LK0A 2VYQA 4KWTA 4D0RA 1R0KA 2LBPA 5B58T 1RABA 4M7OA 2NVUB 2M98A 8ICEA 2OXOA 2BFOA 3W9BA 4PICA 1TD9A 3V9PA 5E3JA 3NXKA 4FEAA 3CNEA 5JFOA 1QCKA 1LTKA 1X7XA 3STYA 5KUTA 3QE9Y 3HDHA 2H31A 2YCLA 5JIBA 1I24A 4HPXB 4ME6A 1E9AA 5HHIA 3BE4A 2IA6A 1L1QA 5EI5A 2WIKA 4F6LA 1T36A 3DE2X 4JMLA 1U7XA 4X20A 4KMRA 2IKSA 1YZFA 3NWPA 3HP7A 4IDHA 4A03A 2PX3A 4XGQA 1H8EA 1O6ZA 1A9SA 3SYZA 5AVZA 5KC8A 1U3UA 3PUYA 1OFGA 1TPZA 1JQDA 2KK0A 3BMOB 2G83A 2UUAB 4DJEC 1PNRA 5I8ZA 4KRYA 1DC3A 3AHFA 2FVXA 3O3MB 4PCVA 1WU8A 4I27A 3O8RA 3OPNA 1KXZA 4Q34A 1FFEA 4EEXA 3AKEA 3E1SA 1J5PA 1PJ2A 4OQDA 3PO5A 1T9ZA 4BV3A 4LRXA 5IZ4A 3KSBC 1C50A 3UH1A 1YZQA 2HCRA 4PYRA 1ORVA 1S0MA 3Q1LA 1XMVA 4LRQA 3BQMB 4NG4A 4XCQA 2I3DA 3KALA 4JJ7A 2W71A 3U44B 3LXMA 1R15A 3U1BA 2VDLB 1TTQB 2XD9A 4I1SA 1FP7A 5THXA 1SXDA 1XCOA 4LMRA 3U40A 4F4UA 4P5DA 4TKUA 2DT5A 1YA8A 1JXAA 1EVIA 9ICTA 3KSMA 1QG6A 5TT1A 4Q4HB 3SQMA 2F62A 2GRAA 1S89A 3B3AA 4J6EA 4DUGA 4KHZA 2G09A 2ZWPA 1T1GA 2ZRIA 2XGOA 4JP5A 2MWMA 4H7KA 3O0DA 2I3BA 1MDFA 5K5EA 3DDSA 3B9BA 5H68A 3ET5A 3H2YA 5ESXA 3JATB 3K75D 3JAKB 1YIAA 3OEHD 5I3CA 3I5MA 1ZXXA 1ZICA 2HWKA 3BD9A 3BUSA 3W9YA 5JAUA 1ZQFA 3T1OA 4KLNA 3F96A 5HBRA 5D7BA 3TLMA 3W3AA 4YHBA 2PGIA 5CLGA 4EMBA 1Y5LA 2DLNA 1V6CA 1OA1A 1V71A 4KNYA 4RQMA 4Q9NA 4I8IA 5EFZA 3ZKWB 3R9XB 4NL9C 1IM5A 1XRLA 3S6JA 5KAFU 1OBHA 4B8WA