2HCFA

Crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from chlorobium tepidum tls at 1.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
228
structure length
225
Chain Sequence
SRTLVLFDIDGTLLKVESMNRRVLADALIEVYGTEGSTDFSGKMDGAIIYEVLSNVGLERAEIADKFDKAKETYIALFRERARREDITLLEGVRELLDALSSRSDVLLGLLTGNFEASGRHKLKLPGIDHYFPFGAFADDALDRNELPHIALERARRMTGANYSPSQIVIIGDTEHDIRCARELDARSIAVATGNFTMEELARHKPGTLFKNFAETDEVLASILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hydrolase haloacid dehalogenase-like family (np_662590.1) from Chlorobium tepidum TLS at 1.80 A resolution
rcsb
source organism Chlorobaculum tepidum
molecule tags Hydrolase
molecule keywords Hydrolase, haloacid dehalogenase-like family
total genus 84
structure length 225
sequence length 228
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hcfA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hcfA01
3L1UA 5AVTA 4FE3A 2MSNA 2RAVA 3QNMA 5AM4A 1Z4NA 3B8EA 1VJ5A 5AI6A 3D6JA 2PQ0A 3AR9A 4NWIA 2HDOA 2EAUA 3ESQA 1L7OA 4DFDA 1WVIA 3A1EA 3L8EA 1Z4LA 1QQ6A 3EF0A 3SLRA 2AH5A 1RLOA 2CFTA 1ZD2P 2R8XA 3AR4A 3MMZA 4G9BA 2YMMA 3FM9A 2AMYA 1N8NA 4HGPA 5AIAA 5ALMA 1Q92A 2FUEA 4KYTA 4BNDA 3OCXA 1Z5UA 3SKXA 3WK7A 1RMTA 3ZU6A 5ALWA 3N28A 2OYCA 4NV0A 2HF2A 4UAVA 5AK6A 4EEKA 4NAVA 1SWWA 3FGOA 3WK6A 2B82A 3OPXA 3NANA 3IJ5A 5ALEA 3W5DA 1ZD5A 2YBDA 1U2TA 1RPZA 1YJ5A 1AQ6A 4QJBA 2NYVA 3L7YA 2G09A 2VKQA 3NALA 5AVXA 2I6XA 3L8FA 2ZXEA 5AVRA 2I34A 1JUDA 1NRWA 4HAIA 1Z4JA 5AVSA 1L7MA 4OFZA 1T5TA 3ZVLA 5ALLA 2G08A 2WF7A 2B30A 1LVHA 1S2OA 3WKCA 1RRCA 3PGVA 1Z4IA 3NRJA 4XE5A 2X4DA 2YN4A 1YS9A 3DAOA 1ZS9A 4L57A 4NABA 1TE2A 4ZEXA 4DWOA 1RDFA 3B9BA 4UU1A 3FVVA 3FPSA 3RFUA 1RMQA 4I9GA 5AW1A 1X42A 2B8EA 1L6RA 2JAUA 1PW5A 2FDRA 4EENA 1Z88A 2FPUA 2FEAA 1S8OA 4OHFA 1Z5GA 2BY4A 4BX2A 5AVZA 2ODAA 1L7NA 3R4CA 1ZRNA 5JJBA 2CN1A 1MH9A 4OD0A 2BDEA 4IFTA 4MUMA 4UMVA 3WKAA 4EZEA 3CZ4A 3QUQA 1J97A 5E0OA 3U13A 3EWIA 3NAMA 4YH1A 3MPOA 1NNLA 4BEVA 2W11A 5ALYA 4YCNA 1TJ4A 3WK5A 1CR6A 5AK4A 2Q4TA 5AVWA 2HCFA 2ZBDA 3PGLA 5ALZA 3ET4A 5AKYA 3QUBA 3M9LA 1RQLA 3BA6A 2C8KA 3L0BA 1RLMA 4BNDB 2FI1A 2YMPA 2DQSA 1RQNA 2ZOSA 4UARA 1Z4PX 3N8GA 3SMVA 1ZD3A 2C4NA 2WF6A 3ZX4A 2WM8A 3U7GA 4I9FA 1U7OA 2QYHA 1QYIA 2HO4A 3KBBA 3WKEA 3DNPA 3IRUA 5AI9A 4E88A 5AK3A 4CNQA 1NF2A 3AR2A 4Y2RA 4BKMA 2B1RA 3ZVNA 2YMQA 3U19A 3P96A 1RC8A 1U02A 2RBKA 4UMDA 1Z4OA 4ZEWA 2B1QA 2CFRA 3EF1A 4C4TA 4H1WA 5AKLA 1TJ3A 5AKEA 2P69A 1VFPA 4O8CA 5AM0A 3R09A 4UMFA 4AS2A 2YJ6A 3U26A 5AVYA 4Y2TA 2FUCA 2I55A 4GIBA 4BX0A 3CNHA 4HGNA 3GYGA 3ED5A 3IB6A 4KX5A 1O08A 3SKYA 2AUTA 4F72A 3QU9A 3L8GA 5AVUA 4YIKA 2B0CA 2G0AA 2YJ5A 2JAWA 3BWVA 5AK5A 4Y2UA 2GMWA 5ALHA 1Q91A 2HSZA 3QU5A 3VAYA 2IOFK 3SF0A 4J03A 5AW4A 3MC1A 3F9RA 2NO4A 3W5BA 2WF5A 3NASA 3W5AA 5ALFA 4AP9A 5AW0A 5ALXA 3QU7A 2PKEA 5AKGA 4YCMA 1RKVA 5AM3A 5ALGA 2R8EA 2WF8A 1L8LA 2GFHA 4FYPA 3ZX5A 4UW9A 2OA0A 3U7EB 4BYGA 4HGRA 3NUQA 4OCZA 4PNHA 3WGUA 1YDFA 3A1DA 3I6BA 1Z4KA 2R8ZA 5IT0A 4Y2JA 1QQ7A 5AESA 2MU2A 5ALIA 1SU4A 3E84A 5T41A 4QQFA 3ZTWA 3ZUPA 1RKUA 5FP0A 2RARA 5AW5A 5ALRA 2JAOA 4C4RA 2PR7A 3PCTA 2G1AA 2BDUA 4EX7A 1T5SA 3L0CA 3KD3A 1RKQA 5IS2A 5AI4A 1WPGA 2OM6A 5AHXA 2FPRA 3M1YA 2WFAA 1Z4MA 5ALPA 4IG4A 3ZTYA 2W43A 1YV9A 3OCYA 2WHEA 3ZWDA 4UATA 5AKHA 3UMBA 3K1ZA 1EK2A 4Y2PA 2MU1A 2O9JA 2IA5A 2G80A 3E8MA 3I76A 1F5SA 4DCCA 3UMCA 3WKDA 4XQ0A 2Q5EA 3R9KA 2FPWA 5AKKA 2FPXA 3B9RA 4UM5A 3AR7A 1TA0A 1QH9A 2C8LA 4HYTA 2OBBA 2FPSA 2YY6A 5ALDA 1ZJJA 5AI5A 2HOQA 2YFYA 3QGMA 2I54A 2D2VA 3WK9A 3QXGA 2W4MA 3ONNA 3ZVMA 1T9ZA 4KN8A 5AI0A 1RLTA 1XPJA 1SWVA 1TJ5A 3FPBA 3OCUA 1VJRA 3AR8A 2HF7A 1LTQA 1ZOLA 2P11A 4Y2SA 4CF4A 4BX3A 5A3SA 1XP5A 4G63A 2I7DA 1Z4QA 3S6JA 4C4SA 1KYTA 2GO7A 2NO5A 4JB3A 2ZBEA 3U7FB 3ESRA 1N9KA 5IT4A 2YMLA 3ET5A 1K1EA 2ZG6A 1O03A 5AKIA 3OCVA 4KX3A 5AW8A 2P9JA 4YCLA 5AW6A 3N5KA 5ALOA 2QLTA 2ZBGA 2CFSA 4NFLA 2EATA 2HEGA 1U7PA 1CQZA 3QU2A 4EX6A 4KNWA 4RETA 2WF9A 3MN1A 3OTQA 4KNVA 3ZI4A 4Y2VA 3I28A 3AR5A 3A3YA 4GXTA 2P27A 1L8OA 1WZCA 3QLEA 3UM9A 5AW3A 3L5KA 2IYEA 2C9MA 5AM5A 3WK8A 5AW2A 3N07A 3L0YA 2YJ4A 4L6CA 5AVQA 1U2SA 4Y2YA 2HX1A 1XVIA 1Y8AA 3AR3A 4HGOA 3WK4A 3KC2A 1ZD4A 3ZW7A 4CF3A 5ALSA 3A1CA 3QYPA 3WGVA 3KOOA 3L8HA 4UM7A 3QX7A 3AR6A 4EELA 4UMEA 5ALVA 4DW8A 5ALTA 1WR8A 4BEWA 5AKXA 5AW7A 2JARA 3ZWKA 4HGQA 2G07A 5AM1A 4MWOA 4F71A 4UASA 1YMQA 3DV9A 3WKBA 5AKJA 3UMGA 2GHQA 4L6AA 3QUTA 3L1VA 4CE6A 2C88A 2ZBFA 2HI0A 3TLMA 4AS3A 4YIHA 2O2XA 5ALKA 3KDPA 4XPZA 2IOFA 3KZXA 2G06A 2YJ3A 3I1YA 1YNSA 2HHLA 5AKZA 1ZRMA 4B6JA 4XOUA 2IOHA 1FEZA 3NIWA 4J2TA 2I33A 5ALUA 2EARA 3FZQA 1L7PA 3QU4A 1RMYA 4JDPA 2RB5A 1QQ5A 5A3QA 5ALJA 3OCWA 5AIBA 5AM2A 4UU0A 3RF6A 2AGVA 4Y2XA 4YGYA 5AW9A 5ALNA 2B8JA 2Q4RA 3N1UA 1IWOA 5AVVA 1EK1A 3J7TA 4Y3UA 3E58A 3DDHA 3U7HB 3SD7A 5ALQA 3SHQA 2JGAA 4ZEVA 3OCZA 4UAUA 2GHTA 3E81A 4FFDA 4Y2QA 3HLTA 3PDWA 3QUCA 5AI8A 5AICA 3W5CA 1J8DA 4CF5A 2R8YA 4BBJA 5A3RA 3EPRA 4RESA 3HYCA
chains in the Genus database with same CATH superfamily
5T7BA 4CKZA 4Q9JA 2XNCA 2J46A 3QNMA 5EPUA 4CETA 2K89A 2PUTA 1KFJB 1VPEA 3CUEF 3L1KA 3FA2A 4D4LA 5FO1A 4PX9A 3JQ9A 3ROFA 3GFBA 3KSMA 2EWWA 2OZLB 3IDFA 1Y98A 1TAUA 2B94A 2PO7A 3PHLA 3AEUA 3HBNA 1X1TA 1COOA 4AJ2A 2HQSA 3HZHA 1KK3A 1C7IA 1ZJ6A 3HJNA 4KN5A 4G9BA 3TW0A 2K2WA 4DOMA 2DFKB 2MYTA 2I4OA 1VLQA 4B9LA 2P0AA 1G21B 1JKMA 4CQJA 3LT4A 4IEIA 2G7MC 4L2IA 3V7WA 1MQSA 3KKNA 3OZCA 4XVUA 3FOFC 4K28A 1H42A 3PF8A 5B3JC 1VYVA 4OLFA 4ASUA 1VFNA 2ALZA 1EBUA 1PR4A 1Z38A 3IDOA 2V6BA 1UCFA 3P71T 4JFRA 5JWRA 2H18A 3ETRA 3T5AA 3L18A 2VAPA 4WESB 3EBPA 3HI4A 3DVRX 2V4QA 1P7PA 1ZK0A 4Q1DA 5IAEA 3ECCA 5DGIA 2QXTA 2Q3FA 2YX1A 1VL5A 4RY2A 2EZZA 3I4FA 4M8LA 3V1LA 2JG3A 1F12A 1XD8A 2V9CA 4YRRA 4ALLA 3WL8A 2IBSA 4TS1A 4HQKA 2FMIA 3RYHA 3TVDA 1W0KA 2BMVA 3AEXA 4JBXA 2RAUA 3RU3A 2R8KA 4L95C 1NVEA 1CFZA 2JGEA 4IQWA 1P8AA 2P2DA 2VOJA 3KAPA 4NMMA 4S1WA 1M75A 3CF4G 5AUQA 4QFCA 3MJDA 3KUUA 4ZHSA 2AK2A 4XQCA 2COEA 3IJPA 1XWIA 2ZATA 1I2AA 4JVMA 5FBLB 1VG8A 2H2GA 2QIPA 3DD5A 3ELDA 3G2MA 5EJ2A 4QATA 2FW0A 2CMFA 4QYIA 4DA4A 4O4JA 3BIJA 3TF5A 2P67A 1YZTA 2EAPA 1I9GA 1QUFA 3PA8A 3DE4X 3FZEA 4BNHA 2N47A 2P5TB 2QMUA 3KU1A 4LE0A 3MWEA 3PBKA 3EXIA 3H2GA 3OMXA 4JQZA 4RFSB 4F6LA 4ZYXA 1N7HA 3WGMA 4DV1B 2DWPA 4FZNA 1WXQA 1NYTA 3DLCA 1J9ZA 1XNHA 1ZD9A 3HEBA 1VJ1A 1UFKA 3ZVLA 5C7LO 2UVQA 2F3TA 4JLWA 3SV3A 1CLEA 1DXQA 2QZPA 2X14A 1A1VA 1OUMA 1XRNA 3AVOA 1G3UA 2FWRA 3BMQA 4J2OA 5DG8A 2CBZA 4O2AB 4QBHA 5DP2A 1YS9A 2AE2A 3R3ZA 5DLPA 1UJBA 1YE3A 2DC1A 9ICKA 2D3TA 3LUAA 5IDXA 5LLTA 1IQ0A 2HLPA 3LQ4A 4GZLA 5H4HA 3NHBA 3FGNA 1FF9A 4L51A 3H6HA 3DEEA 1VMIA 4E5UA 5KYYB 4GOLD 3G7SA 2PDAA 1X42A 2AF4C 1MDFA 2B8EA 5FWDA 5K5EA 1UAAA 2ECFA 2QB1A 1R4NA 2PFPA 1Z88A 2ZXHA 1QHHB 2IPXA 2JEYA 3JQFA 3MJVA 1N2SA 4DL7A 1SB9A 4HQOA 2ZIXB 3UYLA 1VJ0A 3Q3VA 4GHWA 1JIXA 9ICMA 1I1NA 2BY4A 3O8BA 2GN8A 1LJUA 3ZY4A 4BEJA 2EOAA 1M8PA 2AFRA 4RPJA 2BFFA 1DPGA 1II8A 1Z62A 3HJAA 3TIVA 2CN1A 2FQ1A 5LOVB 4AWBA 4HWPA 1ADYA 2W8BA 3MQ4A 3JQ9C 4M9UA 5BW8A 2VDUE 5EHNA 5BN4B 4HNTA 4G8CA 3AI3A 5K0CA 3GYBA 4G0PA 4P0PA 1QSYA 4Y18A 3ZIAA 1U7DA 3EWIA 3GJ3A 5ECGC 4V0MA 3MPOA 3E18A 1J5EB 4MA5A 1TIPA 3OSNA 1R8QA 4QYWA 1YI0A 3ND9A 2JLBA 1ZC4A 2H06A 3G7UA 3QXJA 4LZLA 4N3NA 4MEJA 4X45A 3VZDA 4LYHA 4EW3A 1PZXA 1TJ4A 2GAJA 4K0RA 3KUCA 5AUOB 2HBKA 2XGJA 4HB0A 2GSDA 1GUBA 1BPXA 1L5FA 5I4KA 1PWYE 2XECA 1GHTA 1N62A 1HYQA 5F51A 5F3XB 1PQYA 4I27A 1QHNA 2CY0A 2QSJA 2HRZA 3EXG2 5F7JA 4RQNA 1AKMA 3TFRA 3BS4A 4XUDA 4FWTA 1R9JA 2PQ6A 5ILGA 1SCUB 1KKLA 1ZKMA 4TSFD 2GH1A 4L76A 3WDLA 4JXXA 5FWAA 4UHDA 1ZN8A 3Q2OA 2AMVA 1DE0A 1PJRA 1RQNA 3THVA 3K75D 1A7JA 1YTLA 3N0RA 2C1XA 2KHZA 3OT5A 1ZD3A 5CJ7A 1BQ4A 3K7EA 1C4OA 2WF6A 5CA1F 1U2DA 1O96B 1VSTA 4XX0A 3URKA 4C0BA 2JFWA 3DJYA 2NPFA 1DGJA 1S7GA 2XYQA 4MPPA 1H3FA 3KD2A 9ICNA 1AK9A 4X61A 5G1OA 1EQUA 4GS5A 1W9MA 3PNYA 1NKEA 2RGYA 2K2QB 4UUOA 5KHAA 3T3PB 4CNQA 1Z45A 2IHJA 4BN4A 2IS2A 1V11A 3L79A 3V7LA 1UBJS 1JLSA 2VQ6A 3IG5A 1D2AA 4D4JA 1IQRA 1XNRB 4X6YA 1JLRA 1WU8A 3TG8A 1NJ1A 3JPNA 1W46A 1PQ4A 4GSLA 3WE7A 2OLJA 1DQSA 2OZKA 3HJUA 4OSEA 4ZOEA 4GT1A 3LMKA 4C20A 2WYOA 4EQ6B 1X8LA 1GCAA 3EPGA 1MR3F 1OZFA 1VHWA 2Z4SA 2FZLA 4HC4A 2YWXA 4C4TA 4M46A 2A9VA 5A4DA 1JG4A 2P68A 3OECA 4MIKA 3TXXA 3ZHCA 3GV5B 4GKJB 3JZIA 1E98A 2P7IA 1Z47A 3PVSA 4RWZA 1N3LA 3Q1KA 3T3NA 1BFKA 3P2YA 2JF0A 3PXBA 4PHGA 3ZCQA 4P3XA 4AS2A 4D3DA 1CHNA 3AV3A 1RYHA 2EBWA 3PENA 5F7OA 5K4AA 1PF7E 2IYPA 2NRTA 2ZRHA 3OURA 1INLA 1D4OA 1SUFA 2CB9A 3WGKA 1PYGA 4GGOA 1QWOA 1ZI8A 4R2XA 4E7OA 4YAWA 5ED0A 2Y66A 4RVDA 4YJGB 1O0BA 2MR5A 3GJ0A 4PAWA 3SE0A 2ZJ8A 4DC9A 4MS4B 3HWWA 4WK4B 2GBGA 2XZOA 2UDPA 1ZONA 5CLHA 3E3OA 1FVOA 1VCHA 2CLLB 2ZQYA 2ACVA 3GJZA 5B55A 2WT8A 1C4XA 1I0ZA 4FLEA 4TTQA 1MX1A 1E59A 4MYTA 3Q12A 5L1MA 3LXRA 3CCCA 3OKAA 1HG1A 2HPHA 4AUNA 1QTIA 3C98A 1I51A 1TZKA 1ZOOA 3AX6A 3O4VA 4YP3A 1SEPA 5GIPE 1TUBB 4DWVA 1IXZA 1SC1A 4WLEA 4YR3A 5ALXA 2C84A 3M9XA 1Y5NA 5DNYB 5G4KA 3JVVA 3AY3A 4RQ7A 4WZAA 3QTTA 1QANA 1O6CA 3T7TA 4YCMA 3QVLA 4PBRA 1DKQA 4F7DA 1Y34E 2BISA 4YFKA 1RRVA 2WWFA 1UEXC 2EZXA 2CC2A 3BFVA 4OBXA 2XADA 1Z08A 4A2CA 3R76A 1PEDA 4R1NA 4JLPA 4LOAA 4KRFA 4LYEA 5GZ6A 3LL4A 2EU8A 2FMHA 1JFVA 2J0UA 2QRPA 5BPHA 2EC5A 2J7PA 2PBRA 1E2UA 3INGA 3SVTA 3IA2A 3DEZA 1UPHA 1B0ZA 5BV1A 2GCNA 3IAFA 2JZBA 1J21A 1J2YA 1QTNA 1PV4A 3RF7A 4Y67A 3LUHA 3I6IA 2WJHA 5FFFA 3E84A 4HTFB 5CHEA 1USUA 6LDHA 3IQGX 1UUFA 1JHOA 2DTXA 5DVZA 2HQ1A 4I5IA 4QEZA 2R48A 4LQCA 1NJFA 1UJ6A 3IDAA 4RO0A 4REQB 4WBNF 1KRWA 1T1EA 1JPNA 2ILTA 2FN8A 2H1FA 1Y4ZA 3MCUA 1CIPA 3GV7B 2RBEA 3SBOA 5JEEA 3N2ZB 3KQSA 2XT0A 3EXHA 4KAFA 4X8OA 4A0SA 3KKKA 4IPTA 1L4HA 3IUJA 5IS2A 3IVCA 5LBUA 1E2DA 3W05A 3ESBA 2VI5A 4E07A 4JFAA 2C5LA 2R8PA 1KJZA 3C5EA 4NS4A 2AGQA 4MRAA 2O05A 4NEHB 2EZTA 4TSRA 1KXZA 2HMTA 3KLOA 5F4ZA 5ULLA 3CSDA 3ILXA 4PLYA 2ZJ6A 2WHEA 1VHDA 2RSLA 3UMFA 3OQPA 3GZJA 3KE8A 3GNTA 1FYFA 4Q24A 3HDYA 4NZ9A 4R8LA 2HSWA 3DQZA 4A8JB 3NV9A 4BLRA 4ME6A 2A3RA 3MJ4A 2WWIA 1K0UA 1RQXA 4HEA1 3QG1A 4RSMA 2DFTA 2L5YA 2E4UA 3NHWA 4CUJA 2RGNC 4MS3B 4NL4H 4PRYA 1DG3A 4A4DA 2WJGA 3ZXXA 4UC0A 2ZTUA 2QQ5A 4R0NA 1QSSA 3EQ6A 3KAKA 3P0FA 2J3KA 2QD3A 1L5ZA 4RS4A 2OT3B 3PQ3A 4CMCA 2NX2A 5CDUA 3GUUA 4D3YA 3D2LA 3NTXA 3SZRA 1LQ2A 3CVUA 3SF8B 2P9ZA 4HAYA 3AJ8A 2K6GA 2DUUA 5DO9A 1KDOA 2Q6IA 5DTJA 4P3YA 3ACBA 1ENPA 2VPIA 4WERA 2HOFA 1XS9D 2X1VA 2HY7A 2J87A 3RAGA 3B0XA 3O0TA 1T1IA 1RLTA 2PH3A 4NDNE 2DZDA 2JFVA 3AR8A 4KMSA 2Y1XA 2VHEA 2IUUA 5I7RA 1HDYA 2W7TA 4MUJA 2ZB3A 2JIPA 3UJ7A 2VF2A 2W7OA 4UVDA 5SZHB 4BC1A 3GIJA 3CMMA 1AKEA 3N58A 2C9YA 4WIAA 5SYAA 5HJ7A 1WV1A 1RAHA 3HTXA 1IM4A 4UJ3A 5CT9A 3PE6A 4DLVA 4MVJD 3MF4A 5JBQA 4V24A 2NO5A 1YASA 2HAEA 2VBFA 1SXJE 4MIOA 4PSVA 5MFPA 5J2IA 1GD1O 2W8LA 5A9SB 3GRYA 1KYZA 1LQUA 2C1ZA 1RLJA 2RMKA 2AL7A 1TM4E 5DQIA 2QLJA 4LFBB 1JG3A 1WOMA 2EZ9A 3ETEA 3OCVA 4RMIA 3U48A 1NKBA 2PMCA 2BMWA 2P9JA 4GPIB 3VZBA 2DBQA 1CEEA 1LU9A 1XTTA 2BE7A 4OO1J 2EATA 2LTAA 5G53C 4R9NA 2XAAA 5GP1A 5BWNA 3V4PB 5LQCA 3HBJA 4LY0A 5ITZA 1DV1A 3I28A 4GXTA 2OO5C 3WIBA 1U7UA 1JU3A 4FMBB 4G0ZA 2VF4X 2ESEA 5BSMA 4TL8A 1EDZA 1FXWF 3LD9A 5LDGA 3KUDA 3A4TA 1CB0A 4LTDA 4XW2A 4PX2A 1J2MA 1L3CA 1H6BA 4B79A 2X8WA 5JALA 1Z6ZA 2R6CA 4KXWA 3DDNA 4UE6A 5FL7D 3FI0A 2DTEA 2ZT5A 2RKOA 4Q45A 1LTHR 4ZO9A 3MNFA 3SYMA 5HYVA 3H0LB 2Q3BA 1IBSA 2E1FA 1JE1A 4B9AA 5MN5A 2ZIVA 2QGNA 1TYDE 1HYEA 2AUMA 3M5WA 3C1YA 2F9MA 2ZIFA 5IJXA 4JYAB 2G5CA 4AP6A 3ALRA 1ORHA 1XLTA 4YJ2B 4BO3A 4KR0A 3QVGB 3TBFA 3INTA 5KSOA 2GWHA 5J0QA 2NPOA 4WESA 1DOHA 2VUIB 5DNAA 5AFSA 1A4UA 3BMOB 3HA3A 4IYRA 5CHYA 3UXHA 3UT0A 1E1CB 4FWIB 3W2GA 4HKTA 1V5IA 1W6RA 4C0SA 3UJ9A 3CC8A 4DRYA 4MNTA 3HVIA 4R01A 1A8IA 1JXLA 3ZCUA 2RH8A 4UASA 4B46A 4LSMA 4Y2GA 4QICA 1N6PA 1ZQWA 2KNJA 1JSLA 1N25A 2W9CA 1MP0A 2AW3A 2DRIA 1HDOA 2PZBA 2DQKA 2R00A 4HDOB 1JQLB 2CDRA 4QYIB 1A7UA 2ZDHA 3VKVA 4DLKA 4U8GA 1S1CA 2VP2A 4OHOA 4JWMA 1ESZA 3F97A 3S2SA 1YFJA 4NLBA 3OSZA 5G4KB 2CL6X 3E1KA 4M0UA 2QRUA 4U6NA 3RJTA 3E61A 5K8CA 4GH5A 2XY4A 4R8VA 5AXBA 2G06A 2X8JA 3DT6A 5BOVA 3UB3A 3CLHA 4DPLA 4ZI7F 1ZUHA 1ZIYA 2D1SA 3M7DA 4MRRA 4ZXFA 4C8NA 1L1QA 3LWMA 2NOAA 1T2FA 1OA0A 1XALA 2CEKA 3PE4A 3QE4A 4BUJA 4COKA 4C76A 2CDBA 4EHDA 1U3VA 3G0DA 4H15A 2EDUA 2R62A 1F2VA 5HQTA 3GJ8A 2EG9A 5IZ4A 3KSZO 1JRLA 3DH0A 4JEMA 1E1YA 2VK2A 3OCWA 5D1NA 3A04A 5BMVF 3V2GA 4F3TA 1UC9A 2BLNA 1ZGJA 2XO7A 2AGVA 3EY9A 1BYUA 3WB2A 3A2LA 2HWWA 1B76A 1IWOA 1U31A 1M6HA 5C1BA 3RYIB 4L3OA 2Y1LA 3WRXC 2W90A 3DDHA 2YY7A 1L5MA 3D4BA 3MTDA 5C35A 2QUZA 3ECAA 4KXMA 3BD6A 5KVQA 1MJHA 4LI0A 1I6KA 1HOTA 1UXGA 2O3UA 4I6EA 3LIPA 4ED9A 2DUJA 4YT4A 1AMNA 5C53B 4KQKA 3STTA 3C41J 1T10A 3OJCA 1UBTS 5DG7A 1GNTA 2X23A 1OV4A 2P66A 1QVAA 3AKYA 3CKLA 3K2QA 5NLLA 2UYHA 3EXHB 3PFBA 4LHVA 3A6KA 1U5AA 1F3OA 4R40A 1RVDA 1WG8A 1M74A 3EZYA 4WKNA 4YV2A 1HDRA 3JWPA 2O8VA 4QWCA 1YB2A 3G7NA 2JFNA 1RJ9B 1M1NB 1XZFA 3H5NA 3UWDA 5B6PA 2GKSA 4BLTA 2B36A 1AB5A 1NYRA 4AJOA 2AXQA 2FFQA 1N78A 2XE8A 1YB7A 4ASUD 2PBFA 4RTJA 1NR7A 5AHWA 1HTBA 3L8EA 1PTKA 1OLUA 4MPDA 1M6NA 1A3CA 5A6SB 4X6LA 2BR4A 3SLRA 4MKRA 5JCPA 5HKLA 3MFQA 1CCWA 2M9MA 3F5SA 1O58A 3FYUC 4CL2A 2WPDA 1AC5A 2QY6A 3B1FA 4FQ7A 4MWCA 1T3HA 3EFOA 1H05A 2RGBA 2IEAA 4C2TA 2VP4A 5FJJA 3RKUA 2E37A 2O0LA 3EDOA 1SKYE 3J81k 3K9BA 4JUIA 4YS6A 2QX9A 5TT1A 1JN3A 1ZY2A 2QRHA 3DMYA 4CXMA 4MKGA 1TI7A 1Z5NA 3DMPA 4R8KA 1L6IA 1U94A 4R1UA 6YASA 4M1QA 3SQMA 3RUDA 3WRWA 4IC9A 4QGGA 4ELUA 5GGYA 3YASA 2FZWA 4JODA 1RYDA 5E6UB 4CJXA 5CFZA 2GBLC 4R1MA 4IYJA 3I53A 2HQBA 4LBVA 5LPNA 1MO5A 3ZDBA 1C8KA 5EMMA 4EPYA 4JOBA 4TWAA 3GLTA 5JW6A 2IYFA 2QP9X 4YR9A 3TTUA 5IVKA 3QVUA 3IMFA 4KITB 3FGOA 4DMKA 1UBRS 5KDDA 3NBAA 4X3CA 2YFKA 2KG5A 3JPWA 1JHXA 2NUPA 3VH2A 1BU8A 2BFCA 3PL1A 4QIHA 5DTQA 3ZQ6A 3U4IA 4IQUA 3RO7A 1HLFA 1VXOA 3IQIX 1FL9A 4RF3A 4KEAA 1UXJA 3NCTA 4F6CA 1W581 3QA9A 1ZD5A 3BF8A 2M6SA 4HF7A 3LY8A 2VXCA 3K5IA 3MBOA 5BSTA 4GC6A 1Z8HA 2I2DA 4X0EA 4KE8A 4JOCA 4J9MA 1CRWG 2RBGA 3C3PA 3D4LA 4LAFA 5BNFA 5TPWA 2RGAA 4BO7A 1YZLA 4MQUA 4IVPA 1ZK3A 1F06A 1Z4JA 2YC2C 4IKOA 2YHUA 3QPWA 4I55B 4JC5A 2ECPA 4L8LA 4BNWA 4E5NA 5INTA 8MHTA 5KTPA 3MRXA 3UA3A 4D8YA 3FPLA 1K92A 3L06A 3CRMA 4JC0A 3VHQA 1H9BA 5KG2A 1Q0PA 5LNK1 5F7ZA 4MVCA 2P30A 3ZQJA 5M34A 4C4YA 5CR9A 2FRVA 4J0QA 3L7JA 4RTLA 1D5CA 1G6OA 1WJGA 3DDUA 4JK1A 3O26A 4NABA 5JZSA 3PQ4A 3DL2A 2AR7A 2RJOA 3V9AA 3QKWA 2BR3A 2KSQA 4MR8A 5AW1A 1PJ3A 2EQAA 5FKJA 1C41A 3SHWA 1R15A 2BCGY 2V0CA 4IJQA 4AN4A 4EA9A 5GJBA 4N01A 1G8KA 3NBZC 3RCBA 2PLNA 1CZKA 1U1GA 2IYTA 2R6R1 3FJOA 2BUCA 3JVDA 3RGWS 2RE8A 2H2FA 1BMDA 5KT7A 2W0MA 3KSUA 1KJYA 1UBCA 1L5KA 3RUPA 4HL6A 4ZZ1A 3VYRB 5GV7A 3X43A 3FCSB 5JECA 4JYPA 4LVUA 1QFXA 2E4WA 3ZV7A 5KSYA 5HCNA 3U60B 4F92B 5C9ZA 2GM5A 2VYCA 3Q9UA 1AQJA 1NWHA 4BC0A 2L82A 3EIEA 1XRRA 4WOKA 1NVUQ 5EZQA 3LK9A 2AN5A 5HE8A 3B89A 4HATA 1UP7A 3W3AA 4C01A 3ZHXA 1EHYA 1YRAA 2LDXA 2HMAA 4IQ0A 1GUAA 4GUDA 4BHTA 4Z3DA 2O5RA 1EFPB 1N56A 3WNBA 2GTIA 3M8KA 3GLIA 3IQWA 3PQ2A 3ILYA 3Q3EA 1B6GA 2PT5A 3IRVA 4Z6FA 1K6IA 2QORA 1LPAB 1YHZA 4IICA 4Q7LA 1H9AA 1ZINA 3ADPA 3JQ6A 4I46A 4DTCA 4MDFA 4I1YA 3TPCA 3I2JA 1LD3A 1EDEA 4P5PA 4MFCA 4PXAA 4A8EA 1ESCA 1GGVA 4J3NA 2OAEA 1IRIA 4MK4A 1GFIA 1Q3HA 1E4OA 1KVTA 1SVKA 4JU8A 1E7RA 1GQQA 2ZTSA 4MUXA 4DL9A 2Y9MB 1KI3A 1ZU5A 3OO0A 3ZWWA 4TUSA 4J9NA 1Q57A 2V4MA 4N8DA 3GLIE 1RJWA 1I1HA 2C8KA 4KGDA 5ERXA 3NIBA 5FBVB 1UODA 3TDNA 3CCBA 1NYQA 4GXNA 4ER7A 4M6WA 2DQSA 4B17A 4CQNA 5JJIA 4YROA 1DEKA 2W58A 3P5BA 5G1NA 2CPRA 2IH4A 2YXBA 5EQFA 4W5WA 2XXAA 3EW7A 2D1YA 3NG1A 3TRJA 9ICHA 2HWUA 2REQA 1OA1A 3TAQA 4ZD6A 2ZVQX 1PGPA 4G81A 1XAIA 4OYHA 1QU2A 4XYLA 5IAKA 1G8JA 3EEBA 3OJSA 4M3NA 4ZOAA 1OKKD 3DOJA 2H4FA 4G4SP 1L7XA 4I2AA 2GLTA 4PPXA 3ZGYA 3KETA 3GCDA 1CR4A 2PGLA 5JTIA 1A4XA 3DGEC 4FR0A 2R86A 4K6MA 4M1MA 2VC2B 1XD2B 2OFOA 3GPBA 5D1HA 5DWDA 1R4AA 2JVIA 1M2HA 4F4YA 2NQTA 1WMSA 2OC4A 2J6TA 4TS9A 2KJ8A 2EP7A 2ZIUB 2VDRB 1GNQA 1F1BA 1OZAA 3EZNA 4MA0A 4CF6A 2HTEA 1OB5A 2WQZA 5C3UA 3LUDA 4C89A 4QDJA 4UBJA 1WXEA 5TXGA 1YI1A 3MQFA 1SBCA 2VDQB 2O8BB 2V5UA 1YKGA 4PZUA 5JANA 4DJ5X 2ZWAA 1SOVA 1BCRB 1WW3A 4EYSA 3E70C 3KQOA 3ZGXA 1DRJA 1GGEA 4DMUB 3GR6A 3E2IA 3K92A 4OGLA 2RJ3A 3PV0A 5FAXA 2VP5A 3HY6A 2E21A 2VT6A 2BT4A 1JHAA 5I9SA 1N5MA 4DABA 1PD0A 1I4TD 1QIGA 2VJAA 3BIXA 1IB6A 2EFDB 3QU9A 2J09A 3CRRA 1WKBA 4BZPA 4M9XA 1VKOA 3ZH9B 1NW7A 4C3ZA 1D4AA 1ZYQA 1FZTA 5J63A 1RRPA 2ISOA 3A3NA 3EZ9A 4QYTA 6ADHA 2QTZA 4KL8S 5DWQA 2K4HA 2IF2A 4CUKA 5BWMA 3QWAA 3FCOA 5KFCA 1ISHA 5IAOA 3E6AA 4FNOA 4DNQA 1ECWA 3JPRA 4B5LA 1ESEA 1F8XA 5E0KB 2HSZA 5FV4A 2I71A 2YL2A 1NQOA 4L2IB 2M1ZA 9LDBA 2G63A 1KSJA 5IJ0A 1JRPA 3LNTA 4K3UA 4EJMA 3PUWA 4TLMB 1EI9A 1JKIA 2V6JA 2VO1A 3W5AA 1JMKC 4XB2A 1C0LA 2C2XA 3MMSA 4ETNA 2X7XA 4R5HA 1OF1A 5F1OA 1L5HA 3KQLA 2X7HA 2NMVA 1YL7A 1RKVA 3F78A 1M1ZA 3AMZA 1OI7A 2V4ZA 3I1JA 3NCHA 4JA2A 2XB6A 4ZGBA 4M1WA 4UAWA 2VF5X 3CYFA 2W2LA 3FTPA 4EVIA 1IUKA 2QLMA 1B93A 3GZ4A 1E6LA 2I91A 3DEYX 3SX2A 5IZCC 1Y5IA 3MGHA 2PU7A 1T3QA 4H7IA 3P8ZA 4P83A 5IJWA 2OYRA 4BWMA 2FCAA 1YQTA 4Z6CA 4P4SB 2ZRBA 4EBCA 1UEJA 3BERA 1U99A 2H2IA 3A32A 3L0IB 3MGCA 5BSRA 4OK3A 1HX7A 1WEHA 1SVIA 3QF4B 1Y7IA 4C22A 4IIEA 1SU4A 2BHNA 3BFKA 1ZN9A 3K1TA 1BW9A 4TUYF 4PLVA 3RSOA 9ICGA 4F8EA 3KFXA 4MCHA 2D8CA 1IZ0A 1GV0A 2RK6A 4CG0A 5LIRA 4MEXA 1IVNA 3ORHA 5D6OA 4GVPA 4F8RA 2VXOA 3IP9A 4X6UA 3TKAA 4BKRA 4KR6A 1R5JA 3MCTA 1I30A 3G1WA 2IDZA 1TTHA 4UDYX 4JI7B 4CLRA 5H70A 4ZMSA 2BGKA 1FBNA 1TEHA 1PHPA 3LNCA 2WU4A 3M2PA 5EQTA 3RAPR 3FVTA 1NVVQ 4B76A 1M72A 1WPGA 3RARA 4UCXA 2CXTA 2PSEA 4TRMA 4BO6A 1UOQA 5HJEA 1VBFA 2BMJA 1YQDA 3A3PA 1GXSB 4QUBA 4GZ3A 4ZDIA 1BA2A 4JJ7A 1EK5A 2Z1NA 4J16C 4E5SA 5JRZA 2PFSA 1ZCBA 1ZNQO 4KGVA 1IHPA 1KEPA 1I8TA 4A92A 1C30A 1OI2A 1Y6GA 4FN5A 4CL0A 1TW3A 4BQNA 3Q7EA 4RFVA 2Y0EA 3P2EA 2AXNA 4LHYA 1EK2A 4E5KA 1QIDA 2ZIVB 4CQMD 3E8MA 1M7HA 2H4JA 3V48A 5I9IA 3OT1B 1SGGA 3GT7A 5A5VA 1FFEA 2Q5EA 4U5QA 3FGPA 2W48A 3UENA 5HM6A 4NYIR 4WLNA 2GD1O 1C50A 3SICE 2JZCA 3ICVA 1VIDA 1CUZA 2OBBA 4IIJA 4PYNA 3W1EA 5K3OA 1J39A 2WYIA 3RC3A 2V7QA 2WYHA 5IM4F 3VYUB 4EI8A 2HV9A 1SC3A 2HU5A 2W4MA 3DO5A 5IJAA 4EKIA 1H5QA 2UXDB 8ICKA 1X7GA 2H65A 4RSRA 2I8CA 5ARDA 1EX7A 2L19A 2XTMA 1IB0A 3IIKA 4GLOA 3EZ6A 4NZYA 5FCDA 3C1AA 2B34A 4YAIA 2MOKA 3CNLA 5AVOA 3CZ5A 1DC3A 2BMAA 3Q72A 1ML4A 3IUBA 3OMWA 2PI5A 4ELTA 4B3DA 1NFFA 4B09A 2GDZA 4BNIA 1C9KA 4D0SA 4M60A 3T1NA 2R8BA 3Q41A 3WLKX 4A23A 3WICA 3RRMA 1IWPB 5K6AA 3GRRA 1PNTA 5EWLB 4C29A 3GB9A 4YAEA 5F2EA 5CGZA 5DJ5A 3R8CA 3W8FA 2XHEA 3DR5A 3BA1A 4BX8A 2B35A 1ZXXA 2QVXX 3L4BA 1X6IA 2RHRA 3MRTA 5LZ9A 5LQJA 1WP9A 5F33A 2VBCA 3C43A 1PDOA 3T7DA 4R8MA 2X5NA 1DMSA 3HPQA 1W1WA 3FWKA 1QV9A 3VPFA 2ODWA 3ORRA 3AJDA 4CR8A 3D6AA 1IVSA 1U7PA 1CQZA 1EUDA 1MAAA 2WYWA 1BMTA 2JS7A 4H0FA 3EA0A 4QU5A 1XQWA 3RS2A 3E48A 2IXEA 4EFKA 4UHKA 3OTQA 1LRKA 4OPMA 3I01M 1N6NA 5LBTA 3RWBA 5D87A 1IXYA 4E94A 4IQ8A 1JAIA 3KKAC 2EJVA 4ZI7A 4PIVA 1OLUB 1V9SA 4E4TA 2AGOA 1AVTA 4EG1A 2IZ5A 5C34B 3GFTA 1FXSA 2IYEA 1YD7A 2MYNA 4DMRA 2XTZA 3JQEA 3LY5A 3MGGA 1KNQA 3GFPA 4JJ6A 5E8JA 4ZAGA 5J3JA 4FGJA 3FDFA 1W5AA 2UZ4A 4WFIA 3EB9A 4N8SA 4WOBA 1LH0A 2DKNA 2A14A 4XJTA 1UHUA 5BSGA 2XZPA 4POAA 1Q1GA 1NI4B 5EAIA 1WXXA 5J8YA 4TZ0A 2VQEB 1KEWA 5J1SB 2WABA 2FW9A 4QXQA 4ARUA 1W36B 4U2GA 1UZUA 1RQ2A 2WEKA 1JU9A 2HXSA 4H0NA 5EQDA 1YZ7A 3FUVA 4LRQA 1RACA 4IMRA 3FUUA 4JIMA 721PA 1J8YF 5J4YA 2JHDA 3RYFB 3W6NA 3HILA 2NO7A 1QRTA 5ALSA 4RDXA 3Q8LA 2ZRNA 4Y1GA 1QH1B 4UM7A 3IOMA 3QMPA 4UDNA 3UXOA 2FWMX 4QBKA 1JIUA 4EELA 2ZCJA 1CP2A 1Z33A 2Z95A 3RBXA 4HNVA 5JAIA 2FSFA 2AZXA 2F43B 4LKRA 2WJYA 2ZBVA 4C30A 3EYAA 5SZIA 8ICXA 4NPAA 1TQ4A 3ABIA 3P2OA 1TO2E 2NTYC 3CX8A 1DU4A 3LUBA 5AM1A 4KLHA 4RL6A 2BKUA 1KE2A 1SCDA 5IKMA 1V35A 3FNIA 3NONA 8ICHA 2G5GX 3RUFA 3TEMA 5DTMA 2LPMA 1DK2A 1P1HA 2LP4Y 3BJEA 1EWTA 3C3BA 4RHCA 5B7PA 1LNZA 5IJ0B 2VEDA 2ROQA 4CCAA 3FE2A 4DUGA 2J0SA 4EITA 1B1AA 1SIBE 1L8AA 4JMLA 2I1WA 4LS3A 2VWGA 3MWYW 4MGIR 1TIKA 2O2XA 4MV5A 5TPWB 4C06A 4ZIRB 3VUFA 3TLKA 4E6EA 2WUGA 3V4SA 3HNOA 4EUHA 3OBBA 1BWPA 2Q3CA 3ES9A 4LCJA 2RG1A 4L9AA 1ZRMA 3F6CA 4N76A 3HFGA 3TJRA 1KJ8A 4TWIA 2C61A 4JITA 4CODB 2C94A 2INGX 1SA0A 5U4XA 2HHXA 1GVNB 3AJ9A 3H3JA 3NDBB 5EPEA 3JWHA 3V3KA 4MVJH 3DDWA 1MDBA 4XFJA 3OLXA 4MR8B 4RXMA 2A4KA 5CMLA 3TLEA 3VR5H 3AHJA 3ZDRA 4CG3A 5EHZA 5JNWA 2VTBB 1IVYA 3DBHB 1T6NA 5CPFA 4DWJA 1ZA1A 1HDZA 4YWHA 2O8EA 4RYDA 4HTFA 3OSUA 1F2UB 2CD9A 2HA6A 2OFPA 2ZUVA 2NQ2C 2GCPA 2VJPA 1TADA 1MB9A 1A5TA 3HCEA 4WKCA 4ZEVA 5JASA 4Q05A 3QQ5A 1F44A 4HDCA 1DI0A 1PUXA 2OQVA 4FZRA 2DQNB 2IIVA 3CZCA 3P5SA 1SXDA 1DIAA 5TQ2B 1W4ZA 4F5RA 2A9FA 2I80A 3HQ4O 4L8GA 4Q6WA 5D3KA 4CV0A 8ATCA 2G1KA 3PL5A 3QSYA 2ZYRA 2FEPA 5JS2A 1ZMTA 2YQ5A 2J07A 1EK6A 4CQMB 1U1DA 1NQWA 4KLEA 4I08A 1T4CA 4IS2A 4MKXA 4HB3A 3GDXA 3UPUA 1TO6A 1Z4NA 4DCOA 3B5EA 1BVHA 3PT9A 4A2WA 5ERYA 2GK7A 5JJLA 2HDOA 3ADOA 3ESQA 4EO4A 1JP7A 1BJRE 4IKEA 1O57A 3VO9A 5K45A 4L74A 3MR2A 3P9KA 4JUBA 1OLSA 2W93A 4HH1A 3FYCA 5FUBA 2PMWB 1Y81A 5K0ZA 4GX0A 3DV2A 3F7MA 5IWCA 4LG1A 1NOMA 2KD1A 7ICSA 2RCYA 2ICAA 2XUJA 3DCIA 3MT7A 1D0VA 4DLUA 5H3HA 3WAGA 3MOGA 3DXZA 5AOVA 1EWYA 5HF5A 5CTAA 4D9IA 1GG2A 3QPBA 3BS7A 3A0HU 1DKOA 2ARKA 3JV7A 3KHKA 3QWHA 4YTEA 1N4AA 4F5WA 3MGVA 4YRSA 2ZJZA 1AMUA 2OD9A 2B2NA 3L8CA 1E1NA 1YKFA 4I50B 1SXJA 4PHEA 1ICEA 3NTUA 3PO5A 3NAGA 2PRYA 1P44A 2R1ZA 4KVFA 3HLKA 3B3FA 3O3OB 2PUCA 2REQB 2IYYA 4OLBA 1UWVA 4A0HA 1OFUX 1KQQA 1Q21A 4MAMA 2ZP1A 2FOIA 1KQOA 4PFKA 3J81A 1HE4A 3E0FA 4P4UA 5EXEA 2V55B 4MWSA 1BGWA 1D7OA 4YMSA 4ZU1X 2BPCA 3TB4A 4KYIB 3ENNA 3WL7A 4IL6U 4JBHA 4BV9A 1SVUA 1IZYA 3C6QA 4ZT4A 4V38A 4CPDA 1ORDA 1JQJC 3HP1A 1FE8A 2X2FA 4FIDA 3Q4GA 2D2XA 4N6OA 2AX4A 3JASB 4J0KA 1G8GA 3CPHA 2DEUA 1W85B 4W5HA 4QJBA 5IINA 2GJAA 4N49A 3O94A 2JFHA 5DGBA 4ZAYA 3H8JA 3ABOB 3P9NA 4M1ZA 1QHYA 1II0A 1VCNA 4OHMA 1IOVA 3HMKA 1YGYA 2UUCB 1QVRA 4J7UA 4ZVLA 4LOLA 2JKVA 1NRWA 1RS0A 3RH6A 2DBZA 1EUDB 2P2CA 4FWBA 1L7MA 4G4JA 2IS1A 4MCJA 5COQA 4CG1A 4F4IA 2QVBA 1F2DA 2PWAA 3O8CA 1M73E 3WGTA 1X7XA 2UVVA 1AKYA 2A84A 1WL8A 4UXIA 4DIDA 5IU6A 4LJRA 4OI2A 2ZWMA 5EUCA 4AJKA 5ITWA 1A7AA 1U0GA 4HWGA 4KOEC 3W04A 4C7OA 3RDPA 4ZYWA 3GQBA 5FOQA 3WXMA 4BO1A 4YV7A 3LP5A 2JLXA 1GDTA 3DXYA 2ZYTX 4L57A 4UBCA 3DOIA 4DUYB 4TT3D 2YZMA 3HX0A 3NYRA 2NTEA 1QHHA 4UU1A 2Q28A 3CLSC 4NEQA 3ZY2A 2HK9A 2ZIXA 1FX1A 4QYSA 4RPCA 4ZVTA 3ZDZB 2QN3A 2IDMA 4U7PB 3O47A 4IIHA 4MCIA 1E8DA 2HHVA 4HNSA 1L6RA 5GQSA 4XUSA 1II8B 4KDEA 4BWFB 2FDRA 3M81A 3PSHA 4FDLA 4HLUA 2VK4A 3HCDA 5EJFA 4NBTA 3WMWA 4OFXA 4AUEA 4D9EA 1HZZC 2CHEA 3FCUB 4IY1A 2BP7A 4L73A 2VJKA 3V8PA 3WNCA 1E7MA 2A2ZA 2OPBA 2OV2A 2P5YA 1M2VA 2QYSA 1HFWA 4IX9A 3QVGA 5CNIA 1QOZA 1E69A 3EQ9A 5IVIA 5SYNA 4K1XA 3ZXUB 4E5DA 5JC8A 4OD0A 1BXGA 2FCRA 3A0RB 3AFGA 1ST2A 3KSDO 3T0IA 4AQDA 4OQQA 1B42A 3WIEA 2FRDA 3V42A 2I1QA 1N33B 2GO1A 1G3QA 3UB4A 3ZE2B 2JFOA 1GRVA 5KSPA 3VMMA 2LYAA 3IDSA 1Y3IA 1F14A 1NOJA 1PO7A 5EKXA 2O7VA 3L8ZA 3C2LA 1MX9A 4X94A 1UC5B 1VIMA 1S0UA 3QEMA 5HK8A 1QNFA 4KAAA 3WLLA 4YCNA 3KEGA 4NC9A 4CIXA 4Z0PA 3AF5A 4RQ0A 1I5OA 2NVOA 2VG8A 3C24A 3T34A 3V80A 3SAFA 4F3NA 1QYXA 4RD2A 2KIWA 5B2EA 1GWNA 2WRZA 2WD8A 3DMFA 4BMXA 1PFKA 3FVRA 4UU7A 2CK3D 1Z39A 1ZH4A 3CEAA 3H7AA 1N3YA 3L4SO 4OHBA 1Z7BA 1TGVA 3TD6A 3WBFA 4UD6A 4UUQA 4D4MA 1ZQYA 3TQCA 5KHLB 1ZA2A 5H5JA 1NULA 3SLKA 1JHZA 3LQKA 2YMPA 2A0KA 1M1YE 4LJ5A 5IG2A 2OHXA 3N8GA 3PC2A 1MRZA 5DT9A 4OXYA 4RQMA 5KQGA 3AFNA 1RZTA 4MAAA 4RVHA 1ABFA 2JJ1A 5EMLA 3T5KA 3LTEA 4RWEA 1SZPA 1QLNA 5JRJA 5KOJB 2D1FA 8ICCA 1TX4B 2HO4A 3NNNA 1BEEA 3DLPX 4J7XA 4PWYA 3ROGA 3TIXB 4BB9A 1Z8FA 1KI8A 4EHJA 3RAFC 1ETUA 1O6BA 8ICWA 3F8SA 4H60A 4HR7A 2WIKA 1L4EA 1NK4A 4K7JA 3WGHA 3CMCO 5B64A 2B1RA 3ZVNA 2ZBRA 3OX2A 2HRRA 2CSXA 2YMQA 1DBVO 1X1AA 1NLYA 2FPOA 3C3JA 2O8EB 5DGCA 2NRXA 3QF4A 1G55A 5I4CA 3PXGA 4B2PA 2G0TA 4K46A 4L7QA 4RCYA 4OX9B 1YO6A 1Y1PA 2IXFA 4FCCA 3UJDA 4I5EA 2W2KA 4P32A 4UHJA 4US1R 1USVA 4NLZA 2YZKA 4EJ6A 2NVUA 3SQXA 5D5QA 1UWCA 2AI2A 1JHQA 1FYDA 3IV7A 3K6SA 4EZ9A 3GCXA 2XUKA 3EUAA 4J8PA 3DFMA 4I3HA 3ITKA 1QR6A 1TU4A 3PI6A 4Z54A 3DVAB 4G3IA 2I76A 3RJJA 1KAGA 1E3WA 4INJA 4CLRB 2JEZA 5KNCA 3IAXA 1T4CB 2DH5A 3DKRA 4DCSA 2R68A 3G1TA 2CNBA 3H83A 4L9RA 1FYXA 2Q07A 3EH2A 3N6VA 4WKOA 1S0MA 2BUAA 4MS4A 3E9YA 2EDCA 3MR3A 3VOBA 4CTKA 3VVCA 1BFUA 1V9PA 3RRGA 3IS3A 4LY9A 3DO6A 3THOA 1ZJYA 1GT6A 2D5AA 2G3YA 2PZGA 1V3TA 4JI3B 1PNRA 4YMMA 4F72A 4D96A 3KKEA 3O5AA 4NP6A 5J0SA 1OX6A 2ZCVA 1K9SA 1C30B 1YK0A 3FPEA 2I4TA 2YJ5A 5IH3A 3EGEA 1K7YA 4GI1A 1HFJA 3BJYA 3FFAA 3TQRA 4Q4JB 2FHSA 3HEAA 2GMWA 2O2GA 3P20A 4D02A 4MVXA 4JUZA 4PRLA 4CLEA 2G4CA 2FZ5A 3SG0A 3GUCA 2RGGA 1U1CA 1QLHA 3DTNA 4ACBA 2HBMA 3L6UA 3JR3A 1X8XA 3GAFA 2LKCA 5AW4A 3MC1A 4ZU6X 5AOCA 1XVAA 3R7BA 2PXXA 1V5FA 4FMCF 4PYRA 3VOAA 1Y9EA 4FI3C 3NTVA 1BXZA 2BD0A 2RGWA 4EUKA 2FMQA 2NVBA 2FSVC 3U61B 2J0UB 3GDGA 2OHOA 2DERA 4KLTA 3DVLA 4GRDA 4UUNA 1AQUA 2W6ID 2WG1A 1BCSB 3ELBA 4IH1A 1ZQNA 4KSBA 3WV4A 4JQOA 1IHYA 5CIQA 3TAHA 2VP6A 4UAYA 2IXGA 5DE3A 1V9CA 2SNIE 3BJMA 2AKAB 1N57A 2C92A 1YZFA 2ZJYA 1GLVA 5F1KA 1KZHA 2G9UA 5LDHA 3RRNA 1BVRA 2BTOA 4BFUA 1WXDA 1UFQA 2J5XA 3VPHA 3MM4A 2PKRA 3PKIA 2VPYA 3V8NA 3T79A 1JEOA 2AYXA 2ZPTX 4X91A 1GILA 1JQBA 2OXFA 4QUGA 4IUBS 4RH1A 1JAZA 8ICZA 5KAPA 4F3RA 1HT3A 2HXYA 1YZGA 3CN7A 3AEKB 3OG9A 5T41A 1ZD8A 4BVHA 2BE9A 2N1RA 1ZJMA 3N39C 4JX9A 4UPDA 3TSAA 2Z8YA 1OYWA 3KEFA 3KZKA 2YRWA 2HA0A 2CHUA 3GG2A 2JBHA 1SQGA 3A7EA 1P1KA 1BD4A 5JD4A 3WFIA 2Q7OE 3A4YA 3F73A 3M4ZA 2Q3MA 5TPZA 3PFIA 3V97A 2PUAA 4B3JA 2HLDD 1SCBA 3L0CA 4IHJA 3KD3A 2Y92A 4G5GA 2PTHA 4KWIA 1PLLA 5J0XA 4N7RA 5JI3E 3PEYA 5A02A 1JG2A 1KU0A 2XVYA 3BCUA 4I7EA 4F9TA 2Z4RA 4IV8A 1XJ5A 1XNSA 1EEXB 3BXGA 1XEAA 4R1PA 1MQ9A 1G8MA 4HI0E 2WD7A 5EYPB 3WYBA 4O25A 2W2QA 3NHZA 2IPMA 3HZOA 5SY4A 3OE1A 5K0JA 5FBQB 4DDMA 1ZM7A 3BAFA 1EWVA 4O02B 5FUQA 4PAGA 4BNGA 5LQUA 2I7VA 1CQJB 1XXHE 4X66B 5A4MS 5IC4A 1TLTA 3AP2A 3DZFA 4NU8X 1U8XX 9ICPA 4RVFA 2MU1A 4S35A 3L49A 1X92A 2HJWA 2Y9PB 1JXAA 4B9TA 5KZMB 3EFHA 3HT3A 2AWOA 3I05A 3R9KA 2FPWA 2E7ZA 1Y3HA 3LUFA 1Z82A 3DPIA 4BMSA 2R8IA 1XCLA 3QLVC 4UEJA 1PW7A 4KLUA 1IOZA 3QV2A 5FTNA 3A6EA 3SS9X 4UB3A 1WTAA 4F04A 3H4DA 1XVLA 3GEBA 5EINA 2QZZA 2IMWP 1E79D 5JD5A 1VDVA 1ACJA 1E64A 1FTSA 3U9LA 2OENG 5BN3B 1BDIA 1L6NA 1NKCA 2A58A 4BBAA 4KR2A 1N5RA 4CKWA 3WBJA 4B7AA 5E7QA 3SHFA 4IQFA 1YU9A 4F4ZA 4QGAA 3W2FA 4NE2A 1QCYA 2B21A 5CIYA 1H2XA 1C1YA 1UJ2A 3H2HA 4PHTA 4K03A 4BKOA 2QLNA 5B53A 4YMOA 3NJRA 4BO0A 1QP4A 4CU2A 2XCOA 2CXOA 4NBNA 1IOLA 1TT5A 3B5IA 5A5DA 3SS8A 3T3IA 1P6QA 2UUBB 4EBBA 4IEEA 2VYND 1OPRA 5AJHA 3ESRA 1N9KA 3A10A 4GECA 1K1QA 1C9NA 4P3NA 3I37X 3DEKA 4Y9TA 4EA7A 5IT4A 4ZU3A 2ZAGA 5B3KA 3I9FA 4OJ5A 1DJOA 5FQOA 4DLAA 5HZKA 1BX0A 1FFXA 3GV8B 1HQCA 3K9CA 4F5PA 3BCRA 4O2AA 5AO9A 5EJ8A 2FNAA 3EZFA 1QSGA 3G6KA 3N2YA 1TW2A 2KW5A 2REOA 3BWBA 4MZXA 4KLFA 1GR0A 3AO0B 2OEPA 2CZQA 1E0KA 2B8TA 1BMQA 2RGCA 5LA6A 1GKIA 2WF9A 2G7ZA 4IDHA 1YR7A 4QOSA 3FFTA 2HU8A 2O3SA 4RIHA 4DLSA 3Q7TA 3B1ZA 3IULA 4IX1A 3AR5A 3OFSA 4PU0A 4ZKDA 1D0SA 2JEIA 1ADBA 1DCFA 1G20A 1I01A 1XTBA 1C7RA 1EDDA 2CLDX 1RYYA 2DTDA 2H92A 2KQUA 2OAP1 2CFOA 2J3MA 1CQXA 5JMWA 1EXVA 1K75A 2JGMA 4YJFB 1OZHA 1T6BY 5F98A 3S2YA 3UJBA 4I50F 3IIEA 1L4UA 1YC5A 3E82A 2WTNA 3K20A 4G5QA 2CNWD 4PPQA 3N07A 1JDTA 1MA0A 1Y37A 1YZ3A 2CLSA 2AFHE 3I92A 4PWZA 4DCGA 1VKNA 2I7XA 3TLYA 2HO5A 2VDKB 4DV2B 4L4UA 4QPJC 1Q20A 1MB0A 1E1CA 1U8ZA 1KTQA 1NUTA 1STOA 1Y8AA 4YRZA 3C29A 3M3DA 5AQEA 1LJ8A 3G8AA 3C7KA 3U4GA 3HABA 1ODKA 4MFAA 4YCCA 1U3GA 1D7AA 1UQVA 1EH5A 3HCWA 4FTWA 1XSPA 5JH7A 5KYYA 3EEFA 3ENZA 4WJKB 3FDIA 2KOBA 3BFXA 4MYRA 1QGZA 2LIVA 3C3WA 5IYZF 2I66A 2JIZA 1NUSA 2QE7D 2FZKA 4Q3CA 5IHXA 1KYVA 1OTHA 1R4NB 2P9BA 3S1AA 1QONA 1WR8A 3WGGA 1JTEA 2H6EA 1IV8A 1BNCA 4BMZA 4RESA 4E2XA 4BLQA 2BFBB 1HEUA 1P0IA 2FK7A 1FS4A 4IVNA 3A9RA 4W8HA 1XMQB 4QOFA 1Y5RA 2NU7A 3OA2A 4JH0A 3ZWYA 5CA0F 2JRZA 3X1KA 2WTEA 1UZMA 4TYWA 3CO0S 4L5BA 2CB0A 1NZFA 4FT2A 1KPHA 3MS4A 4UULA 4L72A 8ICBA 2GHRA 1A8PA 2WHRA 3LC0A 2AG8A 3PHHA 2ZSKA 3ERCA 3E5RA 3D0RA 1VG9B 3ICXA 4EPXA 4GR4A 5J2CA 2VS1A 3EAGA 3CZAA 1P75A 4GUAA 5KFFA 4F2WA 2IYSA 3S3TA 2K60A 3UHOA 4U6SA 3WLQA 2OHHA 2EBUA 4D6YA 2LYBA 1E96A 3C15C 1FU4A 3UAWA 3OQVA 2AMJA 3ZWQA 1WNTA 1ZQXA 1BA3A 2EKQA 3H5IA 3LBYA 5FWYA 3UC5A 3SQOA 4AQYB 3C70A 4ECQA 4H4CA 1GAQA 2XGMA 1KJNA 3WLMA 2D6FC 1CE8B 2DVMA 3R3XA 3EGIA 1LVGA 5E2AA 3NKVA 3ZV6A 1DIHA 3CRXA 3O38A 4HN9A 2CWDA 3I6MA 5DZSA 4AZTA 1A77A 3HXMA 3D0KA 4LYAA 4DV6B 4YXWA 2PWPA 1Z06A 1E66A 1D1TA 3IPYA 4Q37A 1KS9A 4CEIB 4OQEA 2Z2JA 1I24A 5ALNA 1L7AA 2P1DA 3R6TA 3RUAA 1EM8A 3FYTA 4E1AA 4C5CA 4Z4HA 4ZVQA 2XXBA 1FA9A 1GUDA 2A35A 3IT3A 2QJFA 3NTQA 2BF7A 4XGKA 3OZGA 4DLTA 2JH9A 1OWPA 4ICAA 4JGIA 4U7CA 4YAJA 3WYAA 4HXYA 5FRDA 3EC1A 4FFDA 3SIPA 5EIFA 2GJ4A 3SIRA 4N47A 2IGTA 2IYQA 1YJAA 1U0TA 4DMLA 4I81A 2P91A 3LCRA 3ZWOA 3HW8A 1ETHA 2JFQA 2NZYA 4AYBF 1K6EA 2O2YA 3IR5A 5I9TA 1NXPA 1AHNA 4NYJR 4BBJA 2F64A 3INRA 4HB4A 4AKIA 4NJOA 1Y7TA 9ICXA 3KXDA 121PA 5JMPA 4NCNA 4M0EA 4JKYA 3RROA 5IJ9B 4RKEA 1I0LA 4IFIA 5I8PA 1V85A 5IFKA 3VR5D 2HMWA 2UYQA 2ZAOA 3V1UA 5HRUA 1DSSG 1LC3A 1THTA 1LPPA 2YICA 4C7XA 1D1PA 4ALJA 4J4HA 2W42A 1VE3A 2WWGA 1QQ6A 5BSEA 4GP7A 1H2BA 3N75A 4EFLA 2R8XA 1NLFA 1ZD2P 4C7VA 1IRXA 3EBLA 3GFSA 1ZL0A 4NIMA 3TR0A 3E9CA 3EHEA 5B2FA 5BWOA 4W9MC 3T5GA 3FM9A 2ES4A 1EFKA 4C7JA 4C8MA 2BAGA 1NOIA 1AY0A 5F78A 4DF8A 3OZVA 7ICPA 4NJ8A 2P6NA 3DGFC 4PF1A 2KSOA 1MABA 1COZA 1D4ZA 1GR1A 2IYLD 2QOEA 2Y2UA 3AP3A 1PJ2A 1S02A 3Q3GE 5FBHA 4A8TA 4HGZA 1TZJA 4O4IF 4DM7A 2QN7A 4WXHA 4HLUC 4TLBA 1T3GA 1AH2A 4U7TB 4HAVA 2CVFA 2FY8A 2QN1A 5KOJA 2QSYA 3DSRA 4HDSA 1D0IA 2AXPA 2AJCA 4GBMA 5KAMA 3WB9A 1N4DA 3UPQA 1PX0A 2FP4B 3DB1A 2ASVA 1FP4B 3QKIA 1NFQA 1KO4A 3PQFA 4D0GA 5HOEA 1P72A 2HRCA 9ICCA 4ED8A 1U0OC 3QPVA 4CLXA 3FFBA 4QOHA 1Q7GA 1V38A 3LHKA 3F4LA 5C7YA 5IPFA 3OPXA 2Z2KA 1NE2A 5FL3A 2A94A 2WSLA 3VC7A 4C0KA 1KDVA 3GUHA 4LX0A 1WUDA 3KJEA 3IUNA 4DZRA 4YDRA 1U7HA 1CUCA 2QS9A 1TAGA 2C03A 4DM4A 3TI9A 4O2LA 3KYBA 3BXHA 5ENDA 1NU6A 1VPWA 3N2GB 4AZWA 2PUGA 4KLAA 5AVXA 1K5PA 1RZRA 3NHPA 2HGSA 3D2SA 1AZSC 4QRIA 1ZW1A 2ZXEA 1WVMA 1GP2A 3PNKA 4AMGA 3WDKA 4JELA 1UKZA 1G17A 5CM8B 4BVLA 3EEYA 3LPDA 1BEUB 5E4TA 4MWGA 1TJNA 2HWKA 1PLJA 4TUQA 1XCJA 2A9KA 1DCMA 2VHXA 3AC0A 3LHFA 3N59A 4BFYA 4JU9A 3ZXSA 4CLHA 6NULA 3PDUA 1LB2B 3G2LA 2RHTA 3WL5A 4FGLA 1FC0A 4UDOA 2I62A 2PQ2A 1T9BA 1A72A 3IKMB 1PS8A 5K3AA 5CFOA 2J9RA 3R5KA 2C3MA 7ICFA 4L4XA 4KQXA 5H9WA 1KMNA 3VYSB 2GCEA 3D31A 3DNFA 1YQXA 1KMQA 2PZKA 3RS5A 5KL1B 3PQ7A 5ISMA 3V2UA 5CT8A 1PRYA 2R2GA 1NR1A 2JATA 1S2NA 3CRQA 1ZYUA 3H5LA 4FS8A 1AB6A 3CRZA 5ERGB 8ICGA 3ZWNA 1MZPA 1P1FA 1PSWA 1Z56C 2DFPA 2HRQA 5FOTA 3D6NB 3I58A 4NLGA 3NWOA 3OGUA 3RWMB 4DEZA 1GAJA 2VPTA 3JQGA 3NM6B 3T3OA 2Q0QA 4DPKA 2QL7A 2C20A 5DEOA 3ZG6A 4UAJA 4UB4A 2R2AA 1G8FA 4ZAWA 4YYEA 2PZFA 4E5MA 3FHJA 2HBRA 2QGFA 5JQGF 4EBEA 3RJMA 3IB6A 1MW9X 1SK8A 4PLWA 4RC9A 4A2PA 3RHTA 2G70A 1A71A 2QQFA 4IDCA 4P93A 5HIIA 1QU3A 4L07A 4LMRA 4Q3EA 1PGNA 5ALYA 1ACLA 5HHHA 1TAQA 1GGKA 4YALA 5J29A 2M6RA 2ZLBA 3PNOA 1JB1A 4LZWA 5BUSA 3K71B 1QDLB 4MR7A 5FOSA 5IKOA 1ULUA 3S5JA 3TLAA 3ZYCA 3LPLA 1XJCA 2D4AA 2ZYAA 1TVKB 2ZQZA 5EZYA 3M82A 5IYZA 1HC7A 1KL9A 2HXGA 4JVSB 3JYNA 2LM4A 2J6IA 2JLQA 3QITA 4JGGA 4C0HA 1ZQAA 3HWSA 3DE5X 1SUCA 1F38A 1RPAA 2P1ZA 2PD6A 2QXUA 5DHUA 4PL2A 1LA2A 1RLMA 2EANA 2RHFA 1DX4A 1W5FA 1PJTA 2QMQA 4WEQA 5BXYA 2EG5A 3M6WA 1T9AA 3NP9A 4BFVA 2VSYA 5IIKA 2QN2A 4GPTA 4JP8A 1T8SA 5LZ5A 1UBKS 5B4UA 2GA8A 3ZX4A 2VH2A 1KZ7B 4ZHQF 3OWHA 2WWXA 3G0BA 2C0QA 1GFZA 3JATA 3LLCA 4OJPA 1KFDA 1NBEA 2G76A 1MIOB 2QG4A 3MW8A 4XD7D 4YJHB 3DTVD 3R5SA 3ONVA 4QGBA 4WOJA 3PRKE 3H5RA 1YFLA 4RD3A 3EEIA 5CBKA 2AZ4A 4W5OA 2VQFB 3IP6A 3GBPA 3HC7A 4FXOA 3IIJA 2BCRA 2WQ7A 3UHAA 1NDQA 5AXDA 4G25A 2IY7A 9ICIA 1U02A 4YK7A 3THXA 4FS1A 1GCOA 4QWWA 3R5JA 1S3GA 4U2FA 2HYDA 4CM3A 1WW2A 2X2EA 3P9YA 4B82A 4QGSA 1T8TA 3EF1A 4UNPA 4FHDA 4LCBA 3WJAA 1FVHA 1V7PC 2FLWA 2YDXA 3RJIA 1WXIA 2DPLA 1WV0A 3IQDB 4R54A 2POQX 3WHLA 3TOVA 1P7DA 2R3SA 3ZE8A 2FFRA 4YRLA 3DTYA 4ESOA 1K89A 2Z6QA 1VE1A 5C4GB 3R09A 4XEUA 1MW8X 3N0XA 4ECWA 2ODBA 3DE1X 2YJ6A 1SCAA 4DCJA 5C8ZA 3OJLA 4PC7A 4EHIA 4FGZA 1XA0A 3Q7RA 1NJ2A 2PH7A 1UDWA 1X19A 2OHIA 1RHUA 4IR1A 3Q3IA 2P9FA 4J07A 1BNOA 1VJDA 2ERXA 2P35A 5F12A 5U9CA 3SKYA 2GZDA 4CKWB 1U0SY 5LP6F 2WD7B 2BDTA 2V7XA 5H59A 5IK2D 1IBRA 3A6PC 4ZOLB 1SXEA 5TE9A 1Z5PA 5JHGB 4KV7A 1WF3A 3UHJA 3SVLA 1IH8A 1CQJA 2E48A 1XC9A 2GAOA 2W9BB 3OHAA 1IM8A 1Q3KA 2N46A 2OZVA 2RHBA 3NDJA 1KF0A 1WBJB 1WS6A 1Y4DE 2ENUA 3MGIA 4XYMA 1KZ9A 4ED0A 1Q2XA 1BRMA 3DYIA 5CRXA 4BBZA 4ZOQI 3SR6A 3WG9A 3ENKA 4GC7A 5BWLA 2V7PA 1B2LA 1XAHA 2IBMA 2AOXA 1SGWA 4FOOA 1DKUA 1ULBA 5F9FA 3N2EA 1PX2A 2JCSA 1OROA 3LUCA 3IDQA 7ICJA 3F2IA 5JNTA 5KWVA 1K1SA 3B1VA 2QR5A 3FDSA 2MSWA 5JXIA 3GRAA 3HKDB 1H93A 3F9CA 4IIDA 3R9XB 3CX7A 2WF5A 3OTOB 5KTMA 4N0PA 4BRUA 3AFHA 5LMUB 3FBWA 4CEHB 4GFDA 4KDFA 1FP4A 1XF1A 3EOBI 2W3RA 4YXWD 3C5WP 2ZYSA 3I12A 4X5VA 4RZHA 5EGSA 3SN6A 1EX6A 2VCEA 1GPJA 1WCWA 1T15A 5JZ9A 1LPBB 2LBPA 2ZRDA 3KB2A 2UVWA 2HW3A 1JKJB 4ND8A 4DPMA 2GFHA 1NBAA 2IQIA 1BQEA 1T2EA 2LWIA 1SPBS 5E6SA 5FI0B 1L4KA 3DXFA 4W99A 5H16A 1VL8A 4N54A 4YPOA 5HUQA 1LLDA 1WPRA 4EAQA 5JE8A 1SKMA 4FIZA 1IBKB 3HP7A 3O2NA 3QXHA 1CY2A 3T3DA 2WAOA 1DADA 1OCEA 4TRJA 3IB3A 4Y2JA 1L1EA 1ZU4A 2ZJ4A 4FC7A 1YHNA 1QLWA 4QXPA 4YGXB 1UPCA 2EP5A 3WOVA 5KPDA 3U56A 2OAGA 4DB2A 3NORA 1Z0JA 2IX9A 3DFUA 3OCCA 3P9XA 5CRIA 4DJFC 4M49A 3IP8A 2DBVO 2E89A 3E03A 3FJ1A 3GV0A 2C98A 2F1RA 2IK8A 2W6QA 3UJAA 1HEIA 4LGVA 3ISBA 1VKRA 1NG9A 4NICA 3T3HA 5CB4A 3HN7A 4MYHA 1D1QA 3J80A 2P9QA 2K7ZA 1U8CB 3HSSA 4FGSA 4PTYA 4DLRA 2YW9A 4FINA 4J90A 2ZS7A 4UEWA 3WOHA 3S1AB 3G1UA 2C8JA 1PFVA 2FRXA 2VANA 2FK8A 1L5VA 3FG9A 1G7TA 5FWXA 4AROA 1D6NA 2BPGA 3RHFA 3WNZA 3ZTYA 4K3VA 3L0DA 3R77A 4DUPA 4IGFA 2Q46A 1YL6A 3SXJA 3S99A 1UXKA 1V41E 3HXTA 4YQEA 5LUAA 3CLSD 4Z4CA 1H2YA 1RE0A 1TB4A 4UATA 3JZMA 5JMOA 5L3SA 4AX8A 5IN5A 1DKRA 2D5LA 3ECSA 4DBVO 5CCDA 1MQ2A 1C0EA 2X1LA 2VIXA 4HEQA 2GN2A 1V2HE 4EMBA 3ANYB 3ZZ0A 1P2TA 4KLMA 2VZ0A 1Z17A 2G5TA 3MBIA 3GUZA 3OM0A 4DSNA 4NU5A 3IVMA 5JJKA 2C54A 1L8XA 3IFSA 5HMMA 5I5GA 3TLGB 3IIIA 4S1TA 4FONA 1GSHA 3OPYA 4PHCA 2E4YA 5KYXB 2FP3A 2YY6A 2WFLB 4UB5A 3GJTA 4R3WA 2F6RA 2GYYA 4RS3A 3ROZA 3W5HA 2I54A 2Z2YA 3HB7A 1W5BA 3T9AA 3V4VB 4EDHA 3HXKA 1G5PA 2C2OA 5IASA 4B3GA 4IIJF 4IRUB 5EXPA 3LIIA 3O0FA 1P1CA 4IHKA 4Q3BA 2OTCA 2ZB7A 4JV1A 1V7CA 1SKAA 2OOKA 2JLCA 2O5CA 4HXEB 2PS3A 1H0HA 1C5KA 2V7TA 3JX9A 2GESA 5JZVA 4EA6A 4HQRA 1XP5A 4FFNA 1YIDA 1VE6A 2Z08A 4UHCA 5IARA 3T9DA 5JPDA 4ENSA 3AUKA 3G6XA 2DLCX 2HBJA 3RYFA 1BN7A 4COOA 1NOKA 4RT2A 5DOVA 4C04A 4ANFA 3NC1C 2PNJA 3ZY3A 1XZMA 3T4UA 3K70B 3C6BA 1PAUA 4E2ZA 1PT6A 1X15A 4C6TA 3RIYA 1MT0A 3FKQA 4Z86A 4DDKA 4KMUA 4PX3A 3FWYA 2J0VA 4KTVE 5FWYB 4EY6A 2NUPB 3O8LA 2HEGA 1C4WA 4G0QA 4BP8A 3R5FA 3PZBA 3OU6A 1NV8A 2Q4EA 2GN0A 4KNVA 3MJFA 3IV9A 1X13A 3E1GA 4PZCA 2P8JA 4KPGA 2VRWA 1ZCJA 1JEYB 1Y5LA 1S3FA 2JGIA 2VAWA 4H59A 4G89A 3RB4A 5AW3A 2JGDA 2ZSFA 3SHOA 1RC1A 3C3DA 5J2TF 3SC2B 4CM1A 5TQ0B 1A5BB 4I2VA 4J75A 4RK5A 3GMSA 2HIMA 1WYGA 3QFTA 4QFBA 4Y1RA 4YJKA 1U9CA 2I03A 3ISDA 1FLAA 2YJ4A 3LX5A 3H11A 1YS4A 2B7BA 4TS4A 5AP9A 5HRAA 1S5LU 1R0KA 2QX4A 2C04A 3DOFA 4KXQA 3QEOA 4PSUA 1FTYA 5EIBD 4U2EA 1Z6PA 3UC9A 3W3AD 2VQSA 3IQFA 4M7RA 5EY5B 4H27A 1K88A 4N65A 3ZK9A 4Z4FA 2PYZA 3IR6A 3TOZA 1EX1A 2Z3ZA 3KYIB 1JHRA 1X1BA 4ZVRA 3N2LA 2I22A 2V03A 1BKYA 2ATCA 5IVDA 4JXKA 3A1CA 1V7ZA 1FW8A 2IXBA 5DI9A 3ZE0B 4BFZA 5B1EA 4GWKA 3UK6A 1SBZA 1T43A 1OFTA 4UAGA 2AFHB 4NFSA 1FDRA 1DTEA 5A4AA 1VHJA 3WMRA 3OD5A 2O8FB 2O8CB 1KHTA 1FNDA 3BSWA 4KTTE 1K3UB 1X2EA 5C31A 4DBLC 5JO0A 3AUSA 1VLZA 2G07A 1BOFA 1QHEA 4MGZR 3OC0A 2JJ1D 3I9LA 3UMRA 3MLAA 1VKHA 3DV9A 1SBQA 1QPGA 1X0VA 2Z6VA 1MF7A 1V16A 4IOJA 4LE1A 4QBFA 4R2MA 2JFGA 5DN6D 4H3VA 4FYIA 4TKVA 1GIAA 5KFHA 4HAUA 4I4TF 2PM8A 3E53A 2A33A 3DBVO 3WWZA 1PR9A 4KQMA 3WLOA 1JIVA 5G0TA 5THXA 1Y5MA 1FIQA 4RQ6A 1H4TA 1RIFA 1XEFA 3IUYA 3JD2A 3GLIB 3K70D 1WUJS 4E7PA 5JYDA 1IONA 1XMVA 2NZWA 3H2YA 1Z34A 4RLSA 4ECZA 4MR9B 3AILA 5F5LA 3GLKA 4JHLA 5I9BA 4O4JB 5KDLA 3X2FA 4N0DA 3RANA 2PRSA 1QIMA 3GUYA 3P9QA 1MJNA 1B15A 4FOSA 1XEWY 3C0KA 1KO5A 1XSEA 2H3EA 3B7GA 3MS2A 1SD5A 3HRKA 4OGFA 4B3SB 4C0JA 3L0ZA 1SMKA 4YRDA 3CZQA 3KHSA 1P17A 3SYTA 3EJ6A 1MIHA 3O82A 4HVTA 4FFPA 2ZRAA 3EJWA 2PUHA 3G2NA 5B1DA 4O3FA 3GFGA 1ELOA 4XVCA 3MTBA 3E58A 3PHGA 3QVSA 4XEHA 4F9FA 3RG8A 5K0TA 3WQHA 5LOVF 1HTWA 5GY7A 2B20A 3SHQA 1BCRA 5HIAA 1UXIA 3OZEA 5JYEA 1J8MF 3LDAA 4K9OA 1PL6A 1U47A 4IWYA 1QHXA 3U62A 3E81A 5C8DA 3IC5A 2J9ZB 4HQNA 4JLJA 3AEYA 3KOYA 4KFUA 4G6ZA 4BIMA 5LFAA 4QLBA 1JZSA 4RM3A 5J2FA 1S77D 1G4AE 2MSCB 4L3WA 1G291 1S0NA 4LY3A 4LGYA 4M9GA 5CW1A 2DULA 1UK8A 3WFZA 1F0YA 3AVPA 3P0JA 4GXIA 3AYXB 3G0HA 3ICQB 1GFSA 4GR9A 3D0OA 4MUYA 4BQEA 1O4VA 4LYYA 5BYAA 5KFQA 3U39A 5AM4A 5EJ7A 2YTZA 1N75A 3L43A 3TR6A 1TA9A 1Z26A 5DGTA 1OE0A 4DG9A 4WDRA 1R66A 4G67A 2VYFA 4EW1A 1PEAA 5T8KA 2PXAA 3FAKA 4I2DA 3PDCA 1KRXA 1G4UR 3LDGA 1NUAA 1FP6A 3A1EA 2I3DA 1TF7A 1Y1QA 3G23A 3LGXA 1KVUA 2VT3A 3TXAA 5EZYB 1V4BA 1POXA 4QUHA 4JB8A 5DNEA 3QE3A 4DNPA 5H2FU 5TGTA 3VBEA 1JQ5A 2N9UA 1N8NA 4YC7A 3HBAA 3E5MA 5C37A 1W5SA 4RTSA 4F4XA 2R18A 3VO2A 1CJUC 2RDJA 2CYCA 4OM7A 1T2AA 4KW7A 4GXQA 5KYUA 1NP7A 3X1WA 4J0EA 1W6UA 3MWDB 3EGXA 2HL6A 4BWVA 3AEVA 3PVCA 4R3UC 3SXUB 1RMTA 4FBGA 1FDVA 3PXUA 5BNIA 3O2SB 4FEYA 4FYXA 2X86A 2JK1A 3L84A 2P9HA 1UC4B 3GGPA 4F2RA 1YQ9A 2AQHA 3DLAA 4RTNA 5AK6A 2P5UA 4ENRA 4Q9IA 5HWSA 5BSHA 3RTCA 2RHDA 4BLOA 1Y6ZA 3PICA 4A36A 2BVNA 4M76B 4ZJPA 3SJZA 3C21A 3H19A 3NH9A 3NTLA 2GETA 3Q1LA 3WFJA 4BNNA 3WR5A 4HHEA 5A62A 1GTZA 4BASA 2AHOB 1V5WA 3N05A 2E4ZA 3LY7A 1S2MA 2X76A 3MSCA 4F4HA 1P3Y1 1VHLA 2H7VA 3T7EA 2C2RA 5HBGA 1Y8QB 3WO1A 5KREA 1KDTA 3W5DA 2I7CA 3NH6A 3B1JA 4GI3A 3SJUA 1WMBA 3PEFA 1QTRA 3FOAA 2VTVA 1IY1A 2MMCA 1FXWA 1J33A 1NATA 3CW8X 2G09A 3GPIA 3OEEA 1V11B 2Q6VA 4Q9NA 4PO3X 3A6FA 3P4XA 3LVWA 3L3BA 3B3GA 4GBED 2X0IA 2C3YA 4CMIA 5CA0B 3U16A 4BQRA 2I34A 3DPSA 1JUDA 3JD4A 2BKXA 3O7WA 1CJTC 4FOTA 4GEKA 4IXMA 4I2BA 4L75A 4LISA 4F4CA 3ZGLA 5KTNA 5DM60 5K20A 1G5QA 3IH5A 4F5NA 3SM3A 5HF8A 4Z4QA 2Q9BA 3FYUB 1MG0A 2H3ZA 1M66A 2GTHA 1HH4A 4Z0NA 3H4BA 4YWJA 5T6BA 1DT3A 1KI9A 3PGVA 2IX3A 3A9UA 1S01A 1LDGA 1SURA 1M54A 4F93B 1N9ZA 2D0DA 2EVWX 2Z04A 3I5MA 4MGYR 4GSYA 4TM7A 4DQUA 1AZLA 1XR3A 1UWLA 2TMYA 4I8IA 4ZEXA 1IZZA 2AQ8A 2Q27A 2FMFA 3JZDA 3NRZA 4IKPA 3FPSA 1G6KA 3I2KA 4WLUA 4DA7A 4EAAA 1WLSA 3T1YB 3UJ3X 3ADBA 1VRCA 1SK9A 3L6BA 1A69A 2QSUA 4DRZA 4QXAA 4FSXA 2IIQA 1FP7A 3JZAA 1G0OA 5FPTA 2PFNA 4GI2A 2X22A 2ORVA 3SIWA 1VCIA 3W2IA 3UMSA 2AN1A 4RJLA 3WWPA 4YV1A 1QRSA 4BX2A 4DMHA 1ZQLA 1NVBA 2WHXA 1K7EB 2CL7X 3SEIA 2H4ZA 4RNNA 3LVRE 4OHPA 5GWXA 3UCFA 1YZUA 4L0CA 3HKDA 4QVKA 9LDTA 1ZETA 4ER6A 2B69A 4QTXA 3OQIB 5J4VA 1I5RA 1UK9A 3VTAA 2AOWA 1OBFO 2ISCA 2WILA 5CX1A 2C07A 1GU1A 3RJ5A 4HNAB 1AN0A 2CZCA 2BGMA 1KQNA 3WYDA 5AXCA 4PGXA 3UHPA 1VIYA 1EVZA 1SRRA 1DT5A 1J6UA 3G9UA 4AMVA 1N36B 4TV8B 4G4SO 3LUJA 3WK5A 4DJEC 5KYKA 1YJCA 1BEZA 4WX2B 4NZNA 5FPYA 4E46A 1PR1A 2PU5A 2AVNA 2WSBA 2ZPUA 2CHVA 4TKUB 3ZWBA 5A3JA 1EP3B 2FGKA 4IGEA 4RM2A 4RMGA 3LHDA 3QQPA 3GHYA 3BGIA 5ITVA 1GPDG 4ZHQA 1KZ1A 1XTVA 1HBJA 8ICLA 3F98A 3MAAC 4ZT7A 3ROXA 5EIEA 1R9NA 2IH5A 3PJRA 3R9XA 1E4VA 4X1YA 1EFCA 2Y1GA 1GO2A 4LMBA 4JDUA 3OX1A 3IKVA 1FMTA 1OB2A 5JAPA 1W94A 3OZRA 4TTAA 4PNZA 2RI0A 1QYIA 1SUSA 2FQYA 3FTNA 2X13A 4QWEA 5BT8A 4QM7A 4YR2A 1TM2A 1BVSA 2LD4A 2WSSA 1I4DD 2W2LD 2VNJA 3D4IA 1KORA 1QXSA 3LT0A 1GU0A 1T6YA 1JFLA 2FUNB 1OBHA 3KTFA 3NNSA 3O84A 3AJAA 3K8QA 3H40A 4OXQA 4GOXA 4EUNA 4D4IA 5CVJA 5BRNA 3SS7X 4DVGA 1A50B 1M67A 1QS0A 1J1ZA 1VG0B 1M6VB 1EVYA 1NMSA 2OG2A 2QTCA 2ZRQA 3NOXA 1YCFA 4QNMA 3EZXA 3SK0A 1CY6A 4GLXA 1P5HA 5EESA 1H38A 4E15A 3ZJTA 4WACA 2BKAA 1H8ED 1DDIA 1R3DA 4RW0A 2M6LA 5THQA 2B9EA 1DJLA 4HEA6 3R75A 2IELA 5AKLA 1F2TB 2YH2A 5I7AA 5BR7A 4LF5B 3FUTA 3VU9B 4RQ4A 1C81A 1JSZA 1YRWA 2C2EA 3MA0A 2P69A 3IR7A 4D8WA 4BO2A 2HV8A 1UIRA 2ZRLA 4BVGA 5IZCA 1DCKA 1G42A 1CJVC 2I5PO 2TMKA 3I2GA 3KKZA 3PQCA 3BX1A 2AEJA 2FFJA 3C7TA 3A8TA 3ZK7A 5JAZA 2CV1A 2R60A 1CX9B 2LKYA 2FW8A 1ZM2A 2RGNA 1DDOA 1DJMA 2O1WA 3IUEA 5KT4A 4J1NA 3TI0A 3H9BA 4TRNA 1MTOA 4Q44A 5L7YA 4FDMA 1T91A 3MJHA 3BG5A 2QM3A 4BN0A 1ZBDA 4CIWA 3D3QA 3F46A 3GYGA 5EJ9A 2XLCA 1QAOA 2JGKA 1RAGA 2DKFA 1M2FA 2N0SA 1ORRA 3A1SA 3EY4A 1BHJA 2Q8NA 2GJKA 4GPAA 5HZMA 1ZDMA 2V6FA 3LZDA 4YRKA 3WLIA 4FCVA 1UWKA 4QBTA 3IL2A 2V7VA 2WKPA 5A6VA 1CLUA 1DLIA 1T24A 2EFEB 1L0BA 5EJ5A 1J23A 2AI1A 3VU8A 3DKPA 1PK3A 1NKTA 3EVTA 4M1KA 5KNLA 2ZETA 3CIOA 3D2BA 3HCAA 4AXXA 1OXBB 3MUOA 1THMA 2WPNA 3QY0A 4MUFA 3N8DA 1DEOA 3QU5A 5LA6F 4QZ8A 3GXOA 5KYUB 2P0EA 1FJGB 4OBWA 4PHPA 3BKWA 4Y0AA 3KJQA 1RLIA 5TMBA 3TQOA 3L7NA 3SF0A 3GNQA 1Q0SA 3LKBA 3WRYA 5BUCA 4XJVA 1NJWA 2OV4A 3VR1A 4L85A 5H82A 5EUBA 2PUWA 3A36A 7ICUA 3UGQA 1WB4A 2BELA 5J9FA 2FTKE 3RAJA 3QU7A 3SPXA 4B6EA 4DJDC 5KYXA 4GYKA 2PKEA 1SBTA 1XRMA 3FBGA 3PITA 1Z74A 3KVYA 5B58T 3RRZA 3CWCA 4DC1A 3AQEA 5KWSA 2G1UA 3SEAA 2ZYGA 2GOYA 1SZDA 5FUWA 2XE6A 2FFHA 4IJUA 3FD8A 2PKYX 1L8LA 1XE3A 4HB2A 2O07A 1CUUA 1XK7A 3GJSA 3ZX5A 4QVIA 4KR7A 2OA0A 4RTMA 1PJ8A 1GL9B 4JEIA 4WXYB 4AM8A 4GX1A 2I4NA 3HP4A 4PV