2HCZX

Crystal structure of expb1 (zea m 1), a beta-expansin and group-1 pollen allergen from maize
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
241
Chain Sequence
KVPPGNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and activities of EXPB1 (Zea m 1), a beta-expansin and group-1 pollen allergen from maize.
pubmed doi rcsb
molecule tags Allergen
molecule keywords Beta-expansin 1a
total genus 44
structure length 241
sequence length 242
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01357 Pollen_allerg_1 Pollen allergen
X PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2hczX01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2hczX02
2G6GA 2KQAA 3SUKA 1BW4A 1OA9A 2PJJA 3M3GA 2G5DA 1BMWA 2ENGA 3X2KA 3ENGA 3X2PA 3FT9A 1L8FA 1HD5A 4FG2A 2PICA 5GM9A 1WHPA 2BH0A 3SUMA 4AVRA 3SULA 3D30A 4FERA 2GAEA 5GLXA 1WHOA 4JP7A 4FFTA 1BW3A 2VXQA 2JNZA 1WC2A 3SUJA 2AE0X 4JP6A 4JJOA 2HCZX 2PI8A 3X2MA 3FT1A 3X2IA 3X2HA 3X2GA 3X2OA 4JS7A 4ENGA 3X2LA 1N10A 2PNWA 3X2JA 5GLYA 1OA7A 3CZBA 4JCWA 4L48A 3X2NA 4ZM7A 4FG4A 5H4UA
chains in the Genus database with same CATH superfamily
2IMNA 2ZJSL 2VM3A 1G8JA 2G5UA 3V5KA 5LAXB 4QF1B 4QRUB 5HP5A 3EF7A 4AI7A 2GTWB 3V6FB 5IW3A 5JMRA 5IWLA 1OW0A 3N44B 4ANKA 1JHTB 1EEQA 1LP9E 2WXKA 5FTKA 4I0PC 4HS6B 4HZAA 3HS9A 2FX7L 2VN4A 4K8RC 4ZOAA 5GS2H 1RZKH 3CFMA 5EF1A 4URTB 2VDKB 1DFXA 3G6JB 3RA7H 1LWRA 4WI8A 2CDFA 4A6YL 1EEZB 3EO9H 1W72B 4NKIH 3U6RA 2YK1L 1CQKA 5DEGA 2P49B 2W5PA 1TWCA 4XNQB 4ZBJA 1EZUA 4KVNL 3O2DL 4ONHB 1KYOK 4UILH 1GZPB 3H3KA 1BZEA 5D2LA 3QDME 1IGIH 1EO7A 4E41B 1MEXL 4LCUA 2OK0L 4UQBA 2K8QA 3U36A 4DEWA 1N26A 4JFOB 4KKNA 3DBSA 4CMHB 5CEZD 2VLMD 3DK0A 2PUQT 2VDPL 2WBWB 3CBRA 4LCWD 4XXWA 3KGSA 4PLOB 4X98B 4ELDA 4WEBH 3WKPA 4XXWC 1C5CL 1IQDA 2QQKH 3DX7B 5FR3A 5B6CA 5I28A 4FQHA 4KO6A 4PP2B 2Q9OA 3AREA 1T83A 1OANA 2YAOA 3KLAA 5KYWA 4XP5H 4Q6IC 5D55A 4N0YH 2EAEA 2JJVA 3BD4A 3RFRA 1ACYH 2Z91B 3O45B 4YC2B 5F9DC 5HHQB 3ZKMC 4ELMF 1UASA 3CFDA 3BXNA 4GOSA 4RAVB 1K9TA 1ZVHA 4RZCB 3BOVA 5ES4B 4NRZB 2H8PB 4R9HA 1U91B 1T6VN 4Z9KB 3SJVE 4X4YB 4R4NC 3C08H 5KBKA 4NQXA 5ECGA 4OZFG 1NBVL 3FCGA 4K3JL 4YK4B 3ZE2B 3SULA 2J1KA 4YSOA 4HZ1A 2GT9B 1TQSA 2XQBL 3QXAA 5D96C 2Y6TE 1RK0A 2BY0A 3PREA 5DSCA 1U95B 3RGVD 1OALA 1FG9C 1Z5YD 3ML8A 4PLJC 1JUFA 3UOAB 4Z76A 2AJSL 4TQHA 5BRPA 3FO9B 4BA0A 1T0NB 2PPEA 1HWHB 7FABL 5IMMA 1N5AA 2EYTA 3OD3A 3VH8A 2MHAA 4HS3A 5C1BA 1KN4H 1YY9D 3LH8A 4GRWH 2ZJSH 3CIAA 3QEQD 3L9BA 3RWHA 3LXUX 4FHBD 1CDUA 3BGMB 3H6AA 2OJEB 3QIBD 1E32A 1U2CA 1Q0XH 3V0FA 1FZOA 2GAEA 2C3GA 4MZ3A 4YE4H 4O02A 5C0FA 4ANVA 2B59B 2B0SH 4FDWA 2IV2X 4JL2A 4AKPA 1CF1A 2J72A 1RZJH 2H0EA 1I9RH 4YHKL 2JJTA 5FGRA 3L9EA 3H0TA 2ARJA 4LHJB 3C8HA 3VFRB 2VB5A 4M7KH 1CXLA 1DVFC 4U1HB 1MCFA 6FABL 4AGQA 1KV3A 3HG5A 3I9GL 4K3GA 1Q9KA 1FL6B 4P57B 4ACTA 1Y18A 4XAWH 3BVDB 4HIJB 4B9YA 2OR9H 4FQPA 3VD5A 4RDQF 3VNZA 2Y5TA 4DFIA 3LN4A 3GRWH 4PJ5A 4PR5A 2LU4A 4WWNA 1CGWA 4ATWA 3CVIL 4IBSA 5TTRA 3OTTA 1QHOA 4DERA 1Z9LA 4CMHC 2BRQA 2ZCZA 4MXQD 4N0UB 3BAWA 2K9FB 3BZ5A 4PGJA 1A6ZA 5SWZD 3U0PA 4RMBA 4P4RA 2QADD 1FNEA 2WVVB 4CAGA 2CMRH 2JIMA 2JCCF 5I8OL 5IR1B 5C07E 1OD9A 3IGFA 5A6IA 2FWOB 2HMIC 5HHPA 1D5XA 2A6JB 2BNRA 4LHUD 3V6ZB 3IMBA 1CD1B 4UV4H 3ZSTA 4YDLC 1WTGT 5KJ4A 3VDBA 2UZXB 4R0LC 3CQPA 2P26A 1KTLB 3BPNB 1AANA 3DXAE 4LASH 5FO8B 1IEHA 1QLEH 5FUCE 3OKDA 2XXMB 3WFZA 3RLSA 1CDBA 1OTSD 5JHLA 2B5IC 3CHRA 3V5KB 3QG7H 4HC1A 1UOKA 5DO2C 4XPHH 5IB1B 3CFTA 4KRPD 4EVNA 4LE8A 3PXHA 4OD1H 4JY6A 3BP7B 2Z9TA 3H8NA 3IWVA 3KL5A 2DQJL 3QDGB 3QO0B 4L4VD 1A9VA 3T4AA 2MQCA 3C6LC 2A9ML 1CFSB 1SN2A 2VDMH 2XIIA 3HC0B 4GKNB 2PABA 4I1NB 4KTEL 4YK4C 3X12A 1D6VH 4FMVA 4L9DA 1E61A 3WSQH 2B2XL 3F6IA 4PGCB 4ZTOL 4HMCA 4Z7VA 3C6SB 4G1MA 2HCZX 1YQVH 3IMVA 5IGXL 2Z92B 5MP6H 4AM0Q 1JZEA 3G5XA 1RKRA 5BRZE 3OAYK 2M8XA 3BPCB 3GK8H 15C8H 3KWVA 4AZDA 1YY8A 3VE0A 3KPNB 1G7QA 2CK0H 3I6KA 4KY1H 4FQ1H 1UXSA 4JDVA 3DOSA 4XPTL 1XL6A 1PEWA 2WV3A 5TQ2H 3VXTB 5I2IA 2ARWA 4UT7L 1MI5D 4ERSL 1BZ8A 4BK5A 4AUYA 2XTJE 1UXSB 1H8OA 5ADOL 5ICYB 2RA1A 1ZWIA 5C0RH 2P5EA 2WOYA 4XO5A 5J9PA 4UNVA 5MERB 3M7FB 1EFXA 1NGYB 4KOBA 5CCKH 2J73A 2X6CA 1Q90A 2VLJE 2ZP0T 5DHXB 1HXYB 2V9RA 1I9RL 1UUNA 4YHKH 3CV5A 5JORB 2DQIL 2LHAA 3WEBA 2C9XA 4KDVA 1KB9J 3RVXD 3UTQA 3P3RA 2CDFB 5F9JA 5KVEE 4NLAA 4B3VA 3IKCA 1E9QA 1XMEB 4FF9A 2X0UA 1D6EA 4UQCA 5AVZB 3HS8A 2PCFA 1Z0NA 2EE0A 1S7QA 2F19H 4IMLB 2L7UA 4J3OG 2JJWA 4BKLA 4AIZB 3OR7A 4Y4HB 4F2MB 1CBVL 3I75A 4OKDA 4MHHI 4M1GL 2ZXGA 4J39A 2HUEA 4UNIA 5DT1L 2A9BA 2WD0A 2Y6SC 4WFHD 5DJCA 3VMOA 7FABH 4LHQB 4KNUA 1FORH 5JO5A 1S7RA 3S8FB 2HJLA 3MUGA 1ZHNA 3P54A 5L7XH 4BV1A 3L95A 4M29A 1MF2L 4PUBL 3SDAC 1W72H 3BN9D 1AGFB 5SWZB 4FCAA 4ZODA 3E80A 5BXFB 3T2QA 2XXFA 1ECZA 3GSWA 4OZHE 1HHGA 2HX7A 3LNGA 5TF1L 2DTMH 4R4FH 4QO1B 3MXVH 2BVTA 1ZT4A 3LKNA 2WO4A 3QA3B 2NW2B 3QXDA 4IRSA 3MRGA 2LVCA 1P4BH 2WZ0A 4XR8C 5B38A 4GXUM 2BW5A 3FCTA 1MJUH 3OLGA 4MCZA 2K7QA 3I6LE 3ATFA 1S7SB 1S9XA 2WIMA 1SHSA 3BPNC 1I1RA 1AZUA 5BJTB 2OTWB 2YWYA 2AXFB 4YBLB 2JIQA 1NAMB 2PYEB 5AAPA 1V7MH 4P2RD 3WL9A 3MNDA 1ZE3C 1FNGB 2H47C 2QPSA 4OZ4A 2IV9A 2NY5C 1ZS8B 1YCSA 2OXHB 3AS1A 5E6ID 3PV7A 5GGRY 3X13B 5JDSB 3RI5F 4W9IC 4MJ5B 2F8OA 3DK2A 1LO0L 2FWSA 1J0IA 5L4JA 3UBHA 5IVNA 3FT2A 5GRWA 1BIIB 2GJ6E 2VDNL 1ZVSA 4U6HB 5FOBB 4MAYA 5LCVA 3GHPA 1N3NB 3CSYA 1LEIB 1ZHKB 1U21A 3S6CA 2LE9A 2WGXA 3BSZL 3EH1A 5DC9B 3OX8A 4X83A 2Q8AH 5C0AB 3O6KH 3UIYA 4WI2A 1U8NB 2VNCA 1YUHA 1NC2D 1MEXH 4UT6A 1EWHA 2IFFL 2QGDA 3PDGA 3BRDA 2DMKA 5DK2A 1QSFD 4PJ7B 3WIIL 4OI9A 1Y5IA 1NGXB 1Q1JL 1GPOL 4QEGA 4ZQKB 3PWNB 1IQDB 1NEZG 2HTKD 4LLDA 2DQ6A 4XE0A 3MRHA 4I18B 3FU6A 3DROA 1RUPH 5DURB 3ROOA 4ZUUB 1LYQA 1I8LC 3LRMA 1U3HB 3TT3H 3BHBA 4GNKB 3BJLA 4PY8J 1PTZA 1H15B 2P80A 2WVTA 4X7EC 3TH4T 3PGCB 3HLAA 2CLZA 4LU5L 1NEUA 2X4UB 3N43F 5IFHL 4PJFF 5D7JD 1UZ6F 1EDHA 2C9VA 3DYOA 3LKQA 5EEUA 5CNHA 1ZHLB 1TZHB 4R3SB 1XAUA 4YHPB 5DUPH 3NSFA 3VVVA 5DEGB 3MV8D 3TM6A 4LLUA 2ORBL 2PR4L 3EJYD 3L3GB 5JW4N 2XU9A 4X0KA 4RAHA 2VDNH 3BVNA 4WDIB 1UHDA 5F6IC 4FABH 3E2HC 4YUEH 2O6CA 4CRZA 1JS4A 4FD0A 1CFSA 3HC0A 4GKNA 5K1NA 3ULVE 3CFQA 4FX5A 2K1MA 3EYSH 4XNBA 3RJQB 1YYLL 1T6BX 2B16A 2MRYA 2VAAB 3RU8H 4M8QB 2FR4B 1A6PA 2E7MA 4IRJC 2YPVL 2YKLL 4LGRB 4WGKA 3MLZH 5FUZH 4JZNA 4A7GF 3FQ1A 3EJPA 5ILTH 2JJUA 1JNLH 3IN0A 5FGCE 2ZX6A 5J0BA 3IJYB 2XDHA 5IW1A 5EU6A 2ENSA 4G8FA 2E0PA 3EH3B 1ZT7A 4Q97A 3CDZA 5L88L 2K0RA 4AZUA 4ZS6D 3RWFB 3W0WB 1A5FL 1TWGA 2YEZB 1XSIA 4H8WL 4KRPC 3ZO0A 5TJWK 1OGAA 1PG7X 5KSBE 4GBXD 1T22B 3TBWA 5E1IA 2B20A 3CQFA 1CXFA 2FD6L 2F53A 5J4MA 1A9BB 5LXGL 1JGLL 4QOKB 4HX1B 2HX8A 4CC4C 3HBPA 4FA7B 3WTYA 5FOBA 3VFNA 2YN3A 5C0JB 5AKVA 5JXAH 1A3RL 1KIQB 3FHEA 2KT6A 3V4PA 4RFEB 2QKIB 1N5AB 2EYTB 3A23A 2E3VA 2Y25A 4LLYB 5ESAA 2AGJL 2ORBH 3QZBA 1WBYA 4XX1E 2P24A 5INDA 1P7QB 2GJPA 3SQOH 5EIIA 2XN9E 2B08A 2VR4A 4HYTB 2FHFA 2DOCA 4P5TC 1MPAH 3PP4L 3HUJB 5D7JC 4MLSA 2P5WD 3BGAA 1A5FH 1T04B 3PP3H 2Q87A 2EDTA 1L7IH 5T33L 4XMLH 3DMMD 5ELIA 4LSRL 2JLLA 4Y8AA 3RPBA 3VXPA 4APQB 1JNLL 1INDL 5IB3B 1L0QA 1MCRA 2XHNA 1OL0A 1N4XL 2YXFA 3ULUL 3K8LA 1Y0LB 2FSDA 4LSPH 5TDPB 1OSZA 5FLVA 2CDGB 5C0CB 4LKXA 5CLXA 3CD4A 1Y18B 4HETA 1KIPB 1EMTH 4JPKL 1TQBC 2EIBA 4GAJH 1H5BB 3QVAA 4HPYL 1SMYD 3ESVF 4GAFB 5SWSB 1VKXA 1U8PB 4EVNB 4ZUWB 5ITBL 3V4UL 5KVGE 1HQ4B 1G7HA 5IT2H 4PYHA 1PZBA 1AKJD 1WZLA 1L9QA 1AHWB 3L7EA 5I0WA 3BUQA 3UGEA 3VRIB 4A2FA 1WISA 1X6NA 5I16A 1KLGA 2X6BA 2NY1D 3BO8B 4NENA 3SYCA 4D0BB 1LD9B 2ZSVB 3ZSSA 5F9AC 2ZWNA 1NAKL 2VABB 5EBLA 2VZOA 2IXQB 3BP4A 3GBDA 2DWTA 2X4NB 1JNJA 3KBFA 2PICA 2D4DA 1TIUA 2J88H 1NCTA 4PRPA 3U1SL 5DMGC 3KWUA 4EBQL 2WUBL 3SBWA 2DIAA 1RQ5A 3DHJA 1MCBA 4UQ2A 4FLSA 2VMDA 4RCAA 2FL5B 4LF3B 4Z95L 1V7ML 3BE1H 3IVKA 4Q7DA 2Y0SA 2EIEA 1I4FA 5AG9A 4MB3A 5EO1B 1OTUD 3IPEA 4JDVB 1U8HA 1A8ZA 2D9QB 1THAA 1FVCB 2HFEA 2JJTC 3ABKB 4MMXB 5GSVB 1PQHA 3L4YA 4JG0H 3LPGA 4OLEA 3N9GH 3GZPA 3ZR5A 4HIXH 3VI4F 3QP3A 4ZMQA 1EU1A 1UA6H 4G8EB 2JB5L 4HU8A 5JLZB 2A9AA 5D9SA 3NFPB 3MRHB 3VSUA 1DZBA 4M1GH 3LKOA 4GRWB 4OIIH 3MTRA 2PJHB 1T1XA 5JLZA 2L3BA 1UWGL 3MA9L 3T71A 3BZ4A 1BREA 2G5BB 4M8VA 3WJJA 1C5DA 2VDLH 3SE8H 4K7FA 4XP9H 5KVDE 2EIDA 5JMOC 2OI9C 1M6OA 1UWEL 1BF5A 5IEHA 1TQVA 5KJRL 1XDTT 2JA7A 2LW3A 1ACCA 2BXZA 4GW5B 3MN8A 2QV2A 4XNMA 1DFBL 4AAYA 4OD1L 3O4LA 4PJ6A 1KG0A 2PF6A 4UIKH 3F7PC 1RPKA 4J8RA 4IBWA 3WTUA 1QO3B 4M1CC 3BFWA 4AW4A 2IWFA 4ZFQA 5J13B 5FPIA 5GSRB 3U46B 3U0WH 1IT9L 5SV4A 3AY2A 5E99L 5DVNA 1LTXA 1XR9A 1IEBA 3ILPB 1ZC1A 1AGEB 2YBRB 4ZUUA 5KSUA 5FM8A 3RUGA 5CP3A 4CGTA 4ZT1A 1H5BC 4JQXC 1L5GB 2ZCKL 4G6KH 2FATL 2FQEA 5B39G 2O5XH 2WSPA 1YNKL 2AXWA 3LRHA 5AUMB 3DV6B 5DD0H 5AD0B 3UZEC 1DJHA 2UX7A 1VA9A 4HEPA 5C0GA 3T4AC 2NR6A 1E40A 4HKJA 2C3VB 2XQYA 3TN0A 3W11C 3WEOA 5J12B 3F04A 4MD0A 3NABL 4Z7WA 2H1PH 2FO4B 4JFUA 1VZHA 4DSYA 1AXTH 3NSJA 4PSPA 5LN8A 4YHIB 2FEEI 2B2XH 3FTUA 3L1OH 2A6HD 1LEIA 4XO3A 5JHDD 4N2KA 3EDDA 1CE1L 3NZ8A 3ZTEA 4ZX4A 4I8DA 4ZFZA 4AVKA 4EZKA 3INOA 2HN7A 3O9WB 4XWGH 1ZVSB 1T89C 4KRNA 5EU5A 4JVWA 4DWHA 3O41A 5I1AB 5JOFA 3CVHL 3CXFA 2P8PB 3Q3GB 3SD5A 3K5RA 3WIHA 2WN3A 3WFDL 2OMYA 3FH7A 4KI5C 1E4XL 2ZKYA 4JPIA 1L9MA 2JV6A 1FVDB 1N8OE 4HH8A 4MNHB 3ULVC 4N8VA 4Z3TA 2UY6B 2NVYA 5CSGA 3LIZA 3CFEA 1NCNA 1C1EH 3N55A 4HCRH 4TQEL 4XE5B 1E8ZA 4Y1AD 4YNYA 3MLTA 4M3HA 5F21B 4GQRA 3RWEB 1U8JB 1MUJA 5ITBH 4IMKA 1BF8A 1O6SB 3BMVA 5IMLB 1CS6A 1IQWH 2NQDA 1SJEB 5FYJU 3QDMA 2CHWA 5D2LE 2E9IA 2X4UA 1FG2B 3G6JA 1ZSHA 4BCXA 1IW7D 2XZQH 3O3UN 1N6QL 4K7FB 4Y5VA 4TLUA 1Z9OA 5F9OH 2NUTA 2VQ1B 4BZ1A 2AEWA 1RH8A 4HEPG 2MH4A 3LRKA 2YD7A 1XBRA 2NX5A 1KUMA 1TYJA 3I9AA 2OCJA 3EBGA 3QJOA 4QY8B 2OMUB 3MLSL 4GP4B 4F2FA 3FU7A 2ZXCA 5HI4D 1U33A 4FOMA 4PJEF 5FWQA 3SBPA 3Q1EA 4YDVB 5HVHC 4YE4L 1WIUA 4Z6AT 2H4EA 4UT9L 1KXTB 3RKDC 3GMNA 2SEBB 3GD1C 5T1MA 4F80A 3ARUA 1TMOA 5EV7A 3QZWA 3BP5B 4G7VL 3BQVA 5AENA 4XVJL 5A2BA 4TXVB 1EJ8A 3ARBB 1GYUA 4UYPA 4YSSA 3SIKA 3HNVH 3B2XA 2CBMA 4XCEB 1BZ7B 3WHE0 5JW4M 2LU7A 4P05A 1J0YA 2NCMA 1MCIA 5CFAA 2X9ZA 3GQFA 2BXYA 4HP5A 2YOCA 3JQOB 4UDTA 2PW1B 1WA1X 5BZWB 3BRGC 5CJOL 3VXOB 1TZIB 1VEMA 3PJSB 3F01A 2Y06H 4WRLA 5EF2A 1DN0A 3VFVB 3V4VL 1P6FA 4OFKA 3OGOE 1MCCA 2Y7SA 4N20A 1M57B 2IGFL 4XMKH 4Z7UE 3QUYD 4IOSA 2MCPL 5JIMA 4X80H 3ULUD 1J5HA 4C4KT 3QI9A 3O6KL 4QDGA 5KSBB 4KJPD 5F0LB 1UD8A 4JHAH 3RNQB 1SLXA 1DE4B 2G5BA 3FCBA 2AK4E 5T1KB 4BSJA 3D1MC 1PCXA 3TIDB 1NMAH 1NSNH 1RFDH 2G2NA 3E8VA 1UENA 3PWLA 4HUVA 4JG5A 2A2QT 1M3JA 1A4JA 4I0KA 2WMPA 5D6CA 1M7IB 3NCYS 1ES0A 2G75A 2CJUH 3JV4A 3QJFB 3II1A 3VGHA 3VTMA 3KPSE 4DUVA 5AKSA 1ICTA 3BVXA 3FAXA 3CHPA 3KCPB 3QNYA 4XB8A 3VFRA 4X98A 2GI0A 5DFVD 5D1QA 2UV3A 2R7ZA 2C9SA 3Q1SL 4P2RE 2BSRA 2KPNA 1JBJA 5IBLD 2EDHA 3CC1A 3H9SD 3WXWH 4Q9BA 2NT1A 3L1EA 2XY1A 3HEIB 3MBEB 1IGCH 3T2OA 3BESR 1F02I 4QXTA 2EJ1A 2ATAA 1N2RA 4A2DA 4LPCA 3X17A 2BZ7A 2GHZA 4BK4A 4ENED 1A6WH 5FDYA 1MCQA 3EG9B 2NY2D 3RVTC 5L8KB 4FQQB 2CKBH 5C08B 3GXMA 3UTPD 4LLAA 4HJGB 2EH8H 3Q2NA 1AR2A 1Y6KR 2E59A 2M1KA 3BO8A 4O5LH 3TCTA 5EO9B 1RZIA 1UT9A 4PR5B 3DRTA 1IL1B 1FN4A 1BSIA 2FK9A 1GZHC 2GSIA 2H7WA 3FCTB 3BDBA 3LEVH 4BQ8A 1YA5A 4QTHA 3C9NB 4N0YL 2OL3A 1E5YA 3MRKA 5FKPA 3D2UB 3ULSB 2GIXA 5JA8B 1TITA 2WLZA 1U8MB 4YLBA 4O00A 4KGJA 1IQWL 5D1ZA 1O6VA 2Z31D 4XCEA 3S97C 1OD7A 5L8LB 3ARBC 1NC2B 3L5IA 1AQKH 3FAWA 2ZUTA 4BH7B 1YEDA 2R2HB 1A47A 3AWFA 2ZWLT 4X5WB 1KSRA 2HTLD 4I5BB 2VXQL 3NJFA 1JI2A 5SV3A 5EBGA 3FN3A 3MCYA 2F1AA 3SKUD 4I5BA 2PPFA 3OKYA 5EDXA 4BIKA 1INEH 4WHDA 4FFWD 2ATPB 4EJ1C 3ARGB 3B2VL 3OKLB 3A67H 2WNXA 3OAYH 4XNXL 4OZIF 2VN7A 5KVMC 1SBSH 2OP4L 3PWPB 5BS0A 5EU3A 3WFBH 1A7QH 2KZBA 1LO5B 2R15A 3ZE0E 4X9BA 3ESPA 3ULVH 5AZ2H 5DYFA 4A39A 2UYLA 1CLCA 5EA0H 3PE9A 3D05A 1D5ZB 4LF3A 1KLUA 4PJBB 1OAKL 3HCVA 1J88A 3D39D 3MFGB 4IYKA 1E28A 4MNQE 5D6DA 2EUVA 2C3XA 2OSWA 4EDWH 3NCCB 4IKKA 3FO1A 4FTVE 4XCYB 5BVJA 4HCFA 4HMEA 3CUPB 2ILLA 1GSKA 3ARDB 2IH9A 3EFOB 4LP4A 4U6TA 2CKNA 3GRWL 1DQKA 9CGTA 2LOEA 3ARBD 3CN1A 3ERXA 3MSPA 3S4SB 3CGTA 4H1LB 1FDOA 4XVTH 4DKFH 2JKWA 2R4RH 1N64H 2K8MA 4AJ0A 3LH9A 4EXPX 2W9DL 3QFDB 2BIIA 2C4XA 2X4OB 3OAUH 3LEXB 1FRGH 3C75A 1A1OB 1LILA 3D87B 2Q2LA 3FXIC 3HFMH 2KBGA 3KE0A 5D96B 3WCYA 4ADGA 3IGKA 5C71A 2BZCA 5CJXC 3P30H 4G7QB 1J8HE 2XWTB 3IU3B 1OGAD 3N6YA 4MAUH 2Q8BH 4D8PA 3VD0A 5GGVH 3RPIB 3OPUA 4JZJC 3BKJL 2QFRA 2SODB 5C7XL 3W37A 3QDJB 1OCWL 4KKCD 1BJ8A 1A4AA 1MY7A 3Q6GH 4KQ3L 3CXHK 3PPEA 3A6BL 1CIUA 5HHMB 1BIIA 2WQAA 2WBJA 4ODSH 3X14B 3GMOB 5IVXA 1J8HA 1P2CA 3FUHA 3VG0L 1X7TA 1TQWA 1DTUA 4Y5XA 1HXKA 3H9HA 4Z7WB 3AM8A 2QSQA 5KANG 1HYSD 1M2OA 2UZIL 1TR7A 5D7HA 2F15A 1MFEH 2OBGA 2ERJB 4I18C 3QYNA 1Z5LA 1DBBH 6CGTA 5GZOD 1PYWA 1QSEB 1R33A 3SCMB 3GC3A 2FGWL 3TA3D 1UB6B 1QA9A 3TA3C 3HFML 4K3JH 3QR2A 4MA1C 5DD3H 4P4KB 4YPGA 1P7QD 1LP9A 3O4OB 2BJML 4PI0A 1VDGA 3C08L 1MCPH 2G3ZA 3I9GH 2KERA 2W38A 4JY5L 1QBML 4NQCD 1OOAA 4Q9QH 4F37F 2GSMB 5TGBA 1G7MA 1X7QA 3QJRB 2EDNA 2XQBH 4BELD 4QRPA 1CMOA 2VXUH 3WY2A 3CBJB 2V2WA 4NQED 4HJTA 4OI7A 1XSKA 1OLZA 4JE4B 5E5MB 3U4KA 5BQ7A 3AS0A 1ZXKA 2JMRA 3ARGD 4ZPTA 1FDLL 3FFCA 4OD2A 1L7TH 2ARJB 5BZZA 3NFNB 4HWEH 2R23B 4KODA 4TN9A 4X42A 1NAKH 5F88B 4GKLA 1XCXA 3A4AA 5DRWA 1NBZB 4X6EB 4OKVA 5AW6B 1G9ML 4J3OH 4JUTA 1KYOJ 1D5BA 1QI4A 1CXKA 4TUUA 4RMTA 3JWDC 4UF7C 1NCDH 1RIHL 2G60L 4F58L 4F3FB 1H3TA 1G43A 4HWBL 1ZJAA 1MCDA 4HJ0C 4J23A 2XKSA 5FUCC 4GI8A 2EDRA 1LEGB 3NRQA 4MD5A 2VLRB 4D8OA 1BQRA 4QJ3B 3CLWA 3V0EA 4Z7NF 1D9KB 1HS6A 4XAWL 3FH8A 1PQZA 4AQAA 5C0EB 2HP4A 1R9FA 1HOCB 3K7UA 5GGUB 2N7BA 3AUWB 1U4FA 3P11L 3QQ3A 5B4MD 3ROOB 1TQUA 1NGPH 3EO0B 4LLMA 4EIUA 3Q01A 2NR6C 3INUH 3LKQB 4K8RD 2BHYA 4JO1L 3VXQA 4J1UB 1BMZA 2GC7C 3MV7D 2JVUA 3S35H 3CVBA 1J05B 4OZFB 3GMRB 4WVRA 2P9RA 2O6PA 3LD8B 4AOFA 2OYMA 2IDCA 5C0AE 4ATTA 5IFAL 1KXTA 4HCRA 2VZ1A 4NJ9H 3UO1H 4OM0H 4O02L 3BAEL 3QWRD 2V7NA 1ORQB 3U2SB 4KKLD 3KJ4C 2YRBA 2EEBA 1P9MC 3DUSA 4ZOEA 5ACMA 2OAAA 5TE6L 2XTJC 2FR4A 5D70H 3RIAF 1CL7H 3CFNA 1KCSL 5GGTA 2ENPA 4PJ9D 3T2LA 4ZMPA 4KVPA 1NLBL 3TP4A 4K94C 1WFMA 4FNLL 3TA3B 1MCJA 5EB9A 3WNMA 5IJKA 1MJ8H 4LAQL 4XN8A 1FVCA 2HFEB 1G7IA 4MMXA 1CTOA 4LCWA 4Q4EA 4Z7WF 2HT4D 4CVWA 3HHRB 5AVVB 1N68A 2R39A 2MQGA 4N5ED 3O4LD 5DYOB 1MIEH 3QEQE 1GC1C 3OHXC 4G7SB 1AY1L 1JHLH 2ZG1A 1A6UH 4P3DA 4X6CF 4XBPA 3IB4A 3ARED 4G8EA 3ILQD 2ROXA 4DVRL 1CD8A 2VJ0A 1NGPL 5ID1A 1TO5A 2NXZB 4UNUA 2WOBA 3K8KA 1IC4H 2WXMA 3GSNA 1C7SA 3TV8A 3QZMA 3NJNA 1T5XA 1YNTF 3N50A 4E9SA 1GYAA 4DVBA 3SBWC 1ZMYA 4NQDB 5BS0B 4PBXA 3WHE1 4LK4A 4UTBA 1R4XA 4IRJD 2DJSA 1BVOA 4EOWL 5B3JF 4B9ZA 3VGDA 1LGVA 3M17B 1WA2X 4G71B 2X0WA 1A6ZB 3NJLA 4L3CA 4OJFL 4XI5C 4G9DB 1CFNB 5DRZA 1O7DE 5DJCB 5KUMA 2I27N 1HNFA 4J3TA 1V54B 1F2QA 4LARH 4NEHB 4QYOB 1BD2E 1LNUA 1COBA 1RIVH 2J1ZA 2Z31B 4Y19B 5DZPA 1CR5A 3TV3H 3V0JA 3KJ6L 3WD5L 3R4DA 1YPZA 2YUXA 3QAZC 4NO0B 1CDIA 2YPLA 3KW7A 3Q9PA 2NY5H 5T5FA 5CZVL 4YDIH 3OKDB 5FO2A 1RD6A 5DS8B 3ULSA 3I75B 1QFWL 5IMOA 4OGQC 3RDTC 3VFTB 1MXDA 1IFHL 1OAZL 2BOCB 4O2FB 2FH6A 2VMEA 1MKFA 4UYQA 1XCWA 2EDBA 2H2SC 5T8IA 5I8KH 3FSAA 5GS0C 1KQFA 3WL9B 1MDTA 3U4EA 3BYTA 4B95C 2OMTB 4PRBB 1MCSA 4UAOB 4HKZB 2DJ4A 4FQJH 2ICES 3B2PA 3MLYL 4K9EL 5CD5C 2GUYA 5IVXE 3UZQB 5DQDL 3JTTB 2OMBA 3L9RB 3V0WH 1WS8A 1E6OH 3QRBA 2WLJA 3HCVB 1KQGA 4OTXL 3HZKA 3NDZE 4ZFOL 5HYJD 2XXCB 2M26A 4KZ0A 4JFDB 1JGEB 3LZQA 4M6OH 4QHMA 2VISA 2DMGA 3A3YB 1IGYB 4DUXA 1NCCH 3AG4B 4URKA 1MFCL 4EN3D 2H26B 1RUAH 1I1FB 1T1ZA 2VLRD 5GRZA 2XWCA 4N87A 5FO7A 3RGHA 2YSSA 1FGNH 3L3KA 3PQYD 4AG4H 3EADA 3RL2B 4OZGE 3DUHA 4PG2C 2XBDA 2DKUA 3HN8A 3SE4C 4XP6L 2NDFA 3GS7A 4Y2DD 3L3KB 1PKQA 1Q0YH 5DD6A 5K9OB 1JK8B 4O02B 5C0FB 4PJ9C 3BD5A 4NNYA 5IVXF 3TO4A 1GIGL 3MXWH 3CVHA 2ROYA 1T1XB 3E1F1 3TBTA 4RGNB 1JK8A 3SDDD 1MI5E 1K2DB 1J86A 2ZOLB 2YC1A 3CX2A 3U30C 3U7WH 3BCFA 4FTVA 4P06A 5G5DA 2OSLA 1UQSB 5J89A 1TVHB 2ESVD 4YN3A 2DLFH 4N0CC 3S37X 4Z0BL 4AGMA 5T5NG 3FO1B 4JR9H 3TEUA 1JWUA 2DYRB 3VWJB 3NSCA 4YIQB 1CICD 2QV4A 5C0DA 2NYKA 3QQ9C 5INCA 3U4BL 1F4HA 5K39A 1XF5A 1NJ9A 2P46B 4XH2B 4XN1A 4HWBH 3WKNA 3PWPE 3IR7A 3QWNA 4ZK8A 1X5GA 1E4WL 5K39B 4KJWC 1WFTA 2BW4A 3U9PH 3L3GA 4OCWH 1DQLL 3IJ8A 1VEPA 5CM1A 1TVBB 3BAJA 1YNKH 3KGTA 4F91B 4ZPVB 3N91A 1MH5B 4QKTA 3Q5OA 2H0JA 5FM5M 1U3ZA 2A0LC 2CLRB 4OR1A 3OB0H 1PQZB 3VUAA 4AQAB 3IPFA 3PGDB 1GKOA 5DTFA 4GIOA 4DN4H 1IBBA 2ATKA 2W91A 1NICA 3N43B 1MHPH 1HSAB 2NNCA 1DQDH 1YY9C 1HN1A 2E9WA 1TO4A 3O3BA 5F0JB 4GSDH 1SIWA 5K59F 3LYRA 1I1AD 4BK8A 4MCNA 4G5AA 4X2UA 2CPCA 4OLXL 1PS3A 4GUCA 5BV7C 2E7CA 5KJRH 2DYPA 1SOSA 4QTFA 2F5BH 2ZX9A 4DO6A 3K80A 1WK0A 5EOCH 4NKOA 3NZ8B 4B53A 4XC3L 3H3PL 2W07A 3BT2L 3SOBL 2JIXD 3BZDA 4PGZA 2Z64C 4ZNCD 1WUZA 1AGBB 3HZKB 1TZ8A 1B0RA 4JAMA 1BQ5A 1HHIA 2WB1A 3DIVA 4WW2B 3SDYH 2EE3A 3MLXH 4ZMAT 3WAKA 5T1DL 2K78A 5CBAA 3SDDC 1W0WA 4FNPA 4LSQL 3Q5TA 1TQBB 4PGDA 3S8WA 1G84A 3WFEH 3QDJE 1ODAA 3KPRD 4X8GA 3UZEA 2BC4B 4NRXB 3TLRA 1UB5A 3VXRA 5E8DH 1QUNA 1IAMA 1B0IA 1XD1A 5I71C 3D9AH 2MKWA 32C2A 4AEIL 4JJ5B 1VPOH 4U6VH 4ZO6A 3DJTA 1SRDA 1NDGB 1YEIL 2FIKB 3MOBH 3PGFH 4KQ3H 4FP8L 3UG4A 4QCIA 5JR1L 2NY5L 5KSAC 1FE8L 2N0MA 2EVIA 3ZZQA 1S3KL 2WXRA 3HNSH 2R1YB 3MCKB 1NFIA 1SFHA 5C9JB 2AXGB 1N7MH 3EGXA 4ETQB 3DSNA 3PF2A 4WUUD 3G6AB 1JWSB 3MV01 3R0MA 5CN2A 1IB5A 4WTQA 4F8LA 5D7IE 2CMRL 3HOGA 3W81A 3K2KA 5JQIB 1X4ZA 4AEEA 3N06B 1F4YH 2NXYB 2Y9RT 4BSWA 1HQRA 2EE6A 2JXMA 1SHXA 4F33A 1GTFA 3QHFL 5JXEC 1G9HA 2EIMB 2YD9A 3KYKL 3TN0B 1T7VA 1I1YB 3JVGA 5B1AB 1HQRB 3BKYL 4QTIL 4RWYH 2OMXA 3NCXA 4EN3B 2Y7QB 3DC0A 4OZIE 4PTUA 4A7QA 4QLWA 4J2XA 3DOHA 2A68D 5F1OB 1ORQA 1KWKA 1PZ3A 1WHPA 3SUMA 1OWWA 1WYJA 3BEWB 3F7YA 3NCJL 4M62H 3ZE0F 3EOTL 1K8IA 5DMGD 5GS0H 2V3VA 2K7PA 5EOTA 4R8WL 2HTKC 1X5MA 2ZOTA 4HK0A 1BM7A 2GIMA 2I5YH 2UZXA 3TYFB 3NCMA 4ADIA 1TXKA 2A9DA 4E9WA 4YSUA 1BF2A 1EZSA 4NI3A 4YXHL 3Q2WA 2ADGB 3RWGA 2FL5A 4CBPA 1A3ZA 1FNGA 2F8IA 1AHMA 1QPPA 2DEXX 3WBDA 5I0VA 2K9UA 2BK8A 3FT9A 2NT0A 5IJDC 5T5FL 1UWYA 4NWTH 2R0ZH 5C97A 5JIQA 2E8YA 3C6SA 4FC3E 4GT0A 2VWEE 3V9EA 1ROWA 1AZBA 3L3OC 2F61A 2P3YA 1M53A 4JRXD 3LQMA 1PT0A 2A6DB 1VC3B 5F7HA 5I75C 4KU1A 1MCEA 1NEZB 3K6DA 3RWIA 3D5OF 4OLUH 1E4WH 3AACA 4YMPA 4MGXA 4IK7A 3MV8A 3GZQA 3I9IA 5GGSB 1PD6A 5HJDA 3C5ZC 2Z92A 2WBJD 4X5PA 1FBIL 3GIVB 2NX5B 2WIIB 1RZ7L 5ICZA 1IGFL 4MD4A 3GEFA 3QUXA 4Y9FA 2F54E 4C56A 1S5IH 4U6YB 1P4IH 3VW3H 4Y8DC 4PS4H 4WWID 4HFWB 3TC9A 3UCRA 3L4ZA 2HWZL 5MI0B 3ZO9A 3NJMA 3OZ9L 5C0CA 2FHCA 4JRYD 4BSVB 4QHLB 4BCYA 2P42B 1VIWA 2MNJB 43CAA 4OLZL 4DOHE 2X2JA 2XWEA 2OMZB 4BGDA 3F8UB 3IWUA 4LGPB 2BCKB 1AOHA 1KY7A 3Q44A 3D39E 3KYMB 5F9OL 3BPLC 2HPTA 4B9CA 1AGEA 4M02A 4J3WA 4R5XA 5C2UB 3FB5A 4TULL 5JDSA 2Y06L 4N2DA 3FTSA 4OSUH 5CEYA 3MRPB 4EIGB 1R5VA 1K72A 2BERA 4PJHA 4XZ4A 3MRBA 2NSMA 3IFNL 1ITCA 2WXHA 3MRPA 4N2HA 3F7KA 5DA4A 2Y3AA 3QDHA 4ZAKC 2VH5L 5G4NA 1E5VA 1L0PA 2HJLB 3F7QA 2EECA 3MUGB 4GUPB 3EYUL 4NO5B 5DJZB 5CSZA 5DQDH 4ADJA 2B1AL 3ZBMA 4WW1A 1VGKA 2OM5A 5HI4C 1DMRA 2VE6B 1NGZB 4LU5H 4X6DB 2BO0A 1AGBA 1WZAA 3O8XB 3AQYA 1RZ8A 3KYOA 4GAYB 1KWGA 2PKDA 4J12A 1GW6A 2L7JA 3IETB 1R3IL 4APXA 2L4OA 3PV6A 4U3HA 5C0CE 4R0LA 4EI5A 3KEDA 4HD9A 5FYKH 2AK1L 3GTKA 1UVQB 4FLHA 3AGVA 1TT6A 5EPMB 5IQNA 1AS6A 3S4SA 4ZSOE 1E3FA 2H9GB 1BAWA 5C70A 3D3VE 4M9OA 3ARPA 4CADA 4N5UA 1JDAA 5I9QC 5LGHH 1HSAA 4WV1B 3ZKNC 1F4WL 3FUMA 1I8UA 3QJXA 4MMYB 4NP4H 1U2YA 3PDOB 4BA8A 2GEQA 5KVEH 4HF5L 3UMTA 1GOFA 1WP6A 2AGJH 1JGVL 3RNKB 1D9KD 2FTAA 1S7VB 5I6MA 1NEZA 4D0DB 1GRWA 4X4MA 5HGDB 2HYMA 4YR6B 4HCRL 2YR3A 4YX2H 1IKOP 1ND0B 5D70L 1B9KA 2C1OB 1GVIA 2D8KA 1NFAA 2AVFA 3VG9C 1NCBH 2JCCE 3H2PA 4PD4J 4UM9D 5D2NE 1VACA 4MAZA 1AGDA 3WENA 4XCYA 3ARFC 5IEHB 4Q0XL 3EUDA 1VF5C 4UBDD 4F7PA 4YDMA 5IVXB 4YSQA 1FJ1B 2BSBA 4DP8X 2YUWA 4BFFA 3V5HA 5J6HA 3IDXL 4CDHA 5KN5A 4N2CA 4F7CA 3A0OA 1A8JH 1IZJA 4WO0A 3QQ4B 5KBMA 4NNYB 3TO4B 4PJGE 1PX4A 2HLFC 1KN2H 3CLEL 3V6OE 3RX9A 1DHKA 1GA2A 5KYWB 5DFAA 2VW6A 3ET9F 5DRNB 3K4AA 4JRYB 2WYIA 5G5DB 1MNUH 3UJIH 4DETA 3RIKA 2Y7OA 4I18A 2ZYIA 2F7QA 3T5WA 2WPGA 5HHQA 3SY0B 4WGVB 4M8QA 2XVGA 2X4OA 1R1CA 1URLA 1NLDH 4KDLA 5EZLB 1JD7A 4P07A 4MNQB 2VRKA 4JY6B 1FO0H 4W9DC 1H3GA 1WFIA 4BZYA 5DHYB 4D9RD 3ABMB 1TQTA 2VLKE 1A7OH 3Q6FB 2DWSA 4GB9A 5IP4A 3TCXA 1RIHH 4F58H 4JM2B 1BFOB 3BQUD 3WIAA 1A3QA 4JP6A 3NA4A 2ADIA 5LGJB 5AYTA 3K2MC 3KR3L 1P9MA 3PHQB 4HSCX 4AYFB 2KLTA 2VZTA 4MQXD 5ICUA 4L5FL 1J5OH 2OJ1A 3CMOL 4PEEA 1BFVH 4XVUC 3QNZA 3QUMH 4TVPD 1RSYA 1S5HB 1S7XB 3FO9A 1X9UA 1UA3A 3L5XH 3SGKA 3W5MA 1MI5B 3GIZH 1SQ2N 1JGIA 5E5RB 3L4WA 3VO0A 5FYJH 1TJGH 2WJ7A 1AYOA 2JI2A 5FAAA 3VA2C 4F8TA 1A66A 3TOPA 3WFHB 5ID0A 3KYNA 4DZ8A 1OAQL 2MPAL 2Q1EA 5I6XC 1QZ1A 1FH2A 3CMGA 4XP4H 5KVGH 3HPLB 1U93A 3MV9A 4YLQT 4GBXB 5I1HH 1YO4A 4MVBC 3SGJA 3V4LA 2KPWA 2J1YA 2A6KB 4HPHA 4K5MA 2OMNA 4R26L 1VHPA 2EDJA 2WKGA 3EDFA 3DETC 4ERSH 1YYMH 4OF8A 2ZSWB 4IBZA 5E23A 3E1ZA 2I60L 5IB3A 1DQJB 2PP9A 3F12B 2ZNWA 4KY1L 3B2DC 5DI8B 2IBGA 3H0TB 3PUUA 4P3CH 4F37K 2ZXBA 3DV4B 4ZS7L 5C0NC 2H6UA 5L2JA 4MJIA 4ETQA 4L3FA 4HDIB 2FLBT 1VGEL 3DRTB 1NDTA 4QYOA 3RVUD 4MSWB 5J11C 2J12B 3RZCA 1RU9H 4Y4HA 4EIBA 2J21A 1ZEAL 4L0PB 4F2MA 3X2PA 1SJHB 2EEFA 3P4OA 1S3RA 3D85B 1INQB 2VPZA 1WZ1L 2LV4A 4IRSD 1E9PA 1I8IA 5F96H 4J3BA 4APQD 1ZT1A 2F53E 4P2YA 4X5XA 1K8DB 4XMPH 2N4IA 2YD5A 4DZBB 1ZK5A 4ZFGL 1Z5LB 2EUXA 3KLHC 4NQVA 5I24A 4ZUTB 3HN5A 3IJEB 1JZ8A 3WNLA 3QS3A 4Z7NE 4JFPB 1VSCA 4KFMA 3ULUC 1KZYA 5D93C 2DD8L 4ELKB 4G70B 4NZJA 2I24N 2WWKO 1LP9F 1WBXB 4LCCA 2DIJA 1L9OA 2DLTA 4M6NL 5D5MA 1QR1A 1AKJB 3ZQWA 1S78C 1W0YT 1YEEL 1A6AA 2AP2A 4G8GB 2ATPA 5D72L 4A1RA 3OJDB 1XEUA 5EU4B 1ZA6A 1BCIA 2QPEB 4HAKA 1SN0A 4AC2A 4FMFA 3OJDA 3HE6D 1E18A 2YPVH 3GXPA 4G1MB 4DN3L 1TFHA 2FO4A 3GTTA 2JK5B 2DICA 4PW3A 2JKXA 1IAKB 4JKKA 5EHFA 4JO5A 1WGVA 5E7BA 1NC2A 3CFCH 3LN5A 4MJ4A 1XH1A 3TCLB 3NFNA 3DIFB 2B63A 3DBXB 2NY7H 3B5HA 4YBQC 3S98A 5GS1A 4RMWA 4ONHA 3KHOA 2QQLL 4KI5F 4Y2LA 4IEFB 4CL7A 1YYLH 3LPOA 4PG2A 3HG1E 2VXVL 2FB4H 4UMGA 3FUIA 1J1OL 4Y5YC 3RIFF 3ZX1A 5LCVH 1SGKA 1U8CA 4JY4B 2H1LM 1CVSC 2AW2A 3OHXA 3ZYIA 3LPPA 3DARA 5EO1A 1CFVH 4BZ2L 1JHTA 4HF5H 1YSOA 2RQ8A 4LVNC 2WLMA 2KZKA 4MQ7B 3LQAH 2BS71 5E6YA 2Z0BA 3T0BA 3CFBB 3D4GA 4FQCL 5L4IA 4XO4A 2BSEA 5GZNA 4UT9H 3JXAA 1N2RB 1W72A 3QUZC 2IH3B 2ZNXA 4X6FB 4Q9CA 3GTJA 2JI1A 3D0LA 4LSPL 4KO5A 4JKLA 3STBA 1U0QA 3QIUC 2DWDB 4G3YH 5LJYH 4OT1L 4WCYH 2ZCLH 5A2CA 4JFEA 4N9GA 2GJ6B 5I66A 1EZVX 3V0IA 1SF3A 1GMIA 5DZNA 5ABAA 3AUVA 4PS7A 4PJAB 5C0BA 4F15B 3OSVA 5LDUA 2PPDA 5CGYD 2FJSA 3ARRA 4OUOA 3VAEA 2N0KA 1ETZA 5A2LH 5TD4A 4HU2A 4TVPL 3WE6B 1KT2B 1CTNA 3U79A 3QNXA 3D39B 2RH0A 4FG6C 1VGKB 3QIWD 4PJEA 3RKPA 2EH7H 4R7DA 1S9VA 4X4XB 4NT6B 3NOIA 1LO4L 1TNMA 3B2VH 4KX8A 2WYZA 2XIDA 3IAQA 1JZ4A 1ASPA 2XNAB 3BZFA 2H26A 4JFPA 5DHVA 4IKNA 5HJ3A 4XOEA 1AFVL 2BS8A 2XX1A 1EXUB 5DUPL 1CZ4A 3W9EA 4YSPA 2FB4L 1FZOB 1L6ZA 2AQ3A 3QH3B 2YARA 2OMVB 3KBHE 3KPQB 5DJ0A 2XFXA 2ZWSA 4GG6B 2X7LA 5E95B 3T8VA 4H88H 4P9ML 4Z3FA 4Z78A 1NFDF 1PBYA 4JGMA 5IBLC 2E75C 4GP8B 3T08A 1G1KA 1AD0A 1D7CA 2ADJB 2UY6A 5TGBB 1DLFL 1NMAL 1CLYL 1DSWA 1NSNL 1RFDL 5D7LD 5JHDE 3T2PA 4RGMC 1VENA 1IM9D 5C08E 1NWPA 1X9LA 2RFXB 1HHIB 3K0WA 4AE0A 4R2GD 2EYRB 1A9BA 1XF3A 2OTPA 5DFWH 2P24B 4TVSa 3KS0H 1UB6A 3EGDA 1CL7I 3L4UA 3L6FA 4MMZA 2O26U 3K91A 1PX8A 2YRZA 4CKVX 1X5JA 3V4PB 5EU7C 3BDYL 4B9FA 4E5XB 3GWJA 1GS8A 1HXMB 5MENA 5HGAA 1FORL 4M1CD 4DNLA 2VT0A 3D4ZA 4GRMA 4HUMB 4CMMA 3BSZH 3L3IA 2VDKH 1WSST 2BVOA 2XN1A 2SEBA 3NACL 2VIRA 2HFFA 5AYQA 1QI5A 3N40P 2NPLX 5FS5A 2VL5B 2LVEA 1Y0LA 3KDMB 2H3XC 5TDPA 5AOJA 4KK5C 3LNDA 4N2BA 4QGTA 5E2WH 2CH8A 1KN4L 5JHBA 1Z3GH 1H6UA 5E08L 3GYRA 4KROC 4MS8C 1MJ7L 5D4IA 2ITDB 4MHHG 4B41A 5I1LA 5CAYB 4J4PA 3L5WA 1X5AA 2ZPKL 1F42A 2GK0A 4PTTA 4DEPC 5M95B 1MAML 4QRSA 3BKML 4UIKL 3LN9A 4LPXA 3N85L 2ZWZA 1NM9A 2P48B 2G2RA 1B4JL 4Q2ZA 4GKZA 4X8JA 1J05A 5DJDA 1DSYA 3QIUB 2JIOA 1BVLB 2C1PB 4UU9B 4NO3A 3FB7B 5ADOH 4XH2A 1YVLA 5HHNA 5CILL 4Y5VB 2OXGA 3QIUA 3NJJA 3UP1A 5JW4R 1TDQA 3NPSB 3N40F 1CGXA 3K74B 1NINA 3JUZA 3OKNA 15C8L 3VRLE 3B9VA 4PLNC 4NZRL 5EEZA 1HIMH 2HPOA 1LK2B 1JE6A 4HJSA 3D09A 1CGYA 1A21A 4PJ9A 5D2NB 2OX5B 1N6QH 2MQ3A 1I75A 2JK5A 5D4QA 1O9VA 1V10A 2Q20A 2X42A 3FZUC 1G7IB 5GLYA 4PJAF 1D7BA 3RWCA 1IBZA 1UACH 2LTQC 5I1HL 3W9EB 4L48A 4JM4H 2AJVH 4L3AA 3QUXD 1C5CH 2J2ZA 5LWYH 3QI9C 5H35A 1KTRL 1Y07A 1SXBA 3UP6A 3BUYA 3ILEA 2QTVA 4ZFFB 1UM5L 2Q7AA 2Y1AA 1R0AH 3KCPA 3QNYB 4PUBH 2GKIA 1QAWA 2A5UA 2NXYC 1E4XH 4YXKL 2DQJH 1AIZA 3Q2VA 1YN6A 3EFDL 3TX4A 4RGMB 1WQVT 2Y7LA 1KIUA 3IMWA 2YAEA 4KPHL 3HS0A 3JT2A 4U4IA 3IE9A 4X9IA 5DC4B 2VLME 3QWQB 4HWBA 4R2GB 4EN3C 3GSVA 2FJHB 4XVSH 1MJUL 3K72A 3KXFD 2XX0A 5CJBA 3KWXA 2FJGB 4HGWA 1YQ2A 2FQGA 4LBEA 4UINL 3CE1A 4Y7MA 5IJCC 4Z7UF 2ZXAA 2H5UA 3QFJD 4X6FA 2CRZA 4YZWA 1VCBC 3RKDD 3MA7A 3ENEA 5A40E 1FE8H 1KF9B 2DEWX 4NQDA 1YEGL 5IESH 1R27A 1JFQH 5J06A 3EO1A 2IBBA 4NKDA 1UHEA 5JTWA 3ZDXB 3T4YB 3UYOD 4NDMB 4XMTA 2ZUQB 2YMOA 2YRLA 4JO4L 1DVXA 4ZTOH 1TZGL 5H4ZA 3TJEL 4HGMA 2WINB 3IMRA 3FN0L 3G9VA 4HFUH 1A6VL 1AQDA 2EYSB 2HKAA 1ZGLP 3BISA 4YFDB 4OLVH 2DAVA 3LQAL 3MRNA 3O4LB 4LBAA 4PJEB 3FQUB 5E6RB 1R19A 2VZSA 3MBEA 4N8PA 4X7CC 5DEFA 4FERA 3UL4A 1IM3D 3Q8EA 4NQCA 4JKNA 2D2CC 2QSCL 3P0VL 1MAKA 1ZTXE 2GJJA 3LNEA 2K4AA 4OGXH 2APWA 1IX2A 2FUQA 2APFA 3RDTD 4FFVC 2Z93B 2D7PA 3E6HB 5JW3L 2FNBA 1NBYB 3R06B 1T3FA 2F8VA 1N5YH 2PCFB 4Y5VC 1HZLA 5GS3A 4FYQA 2BHFA 2GABA 2VGLM 4GMTH 1HTYA 3X2KA 1Q1PA 2WLYA 3NCBB 2BP0B 4IOIB 1YLEA 2D7TH 2ZYSA 2NVXA 3UROR 2W81C 4NN7B 3NUKA 5IOPA 1YEFL 2BM3A 3TVMA 1PG7L 2A83A 2B77A 4FEIA 5FV1L 4U1IA 4QHMB 5EN3A 4PJ5E 5IESL 5EPPA 5I8EA 3D2UD 5A16A 4BFIB 3AC0A 5I74B 3W82A 1WZMA 5IGXH 3ZKXC 1MCOH 2Z7ZA 4HJJL 4FNSA 1X4XA 4JFHE 5DZOA 3UIZA 2B1OA 2YXWA 3I02B 3QSKB 2V9QA 5BVJB 4LNRB 3NZHH 1LDPL 5D7IB 1DSFL 3T2NH 3MFFA 4NN6B 3F05A 3AS3A 1JPTH 1OOWA 3MGOB 1JGUH 3BPLB 4NQQA 5K1JA 1WH0A 2DLFL 4NFBA 3RL1A 4I3RH 2UXVA 1B4RA 3TO4D 3IJHA 3DRQB 1NGXA 1AQ8A 4TF4A 4JPQA 5DK0A 5EA0L 4HEMA 1NUGA 3KNBB 1AC0A 1KELH 1Q38A 4OZHB 12E8L 3H56A 4EBQH 5F1KC 3SDXA 1O7VA 2EEAA 3PNRB 5G2NA 3DX7A 3DROB 5LBVA 5SWZE 3V10A 5FB8B 1FP5A 3QG6B 2ZT9C 3L3HB 3CQQA 1DQMH 3QIBC 1XGYL 3GF8A 1ZRUA 2H2PD 3HB3B 1TOXA 5MHSE 5AAMA 2H6PA 4PJAA 5C0BB 4BZ1L 4AT6A 3ZU8A 3BKCL 5EZOH 2GG1A 4WDIA 3S36X 2IANB 4MNGA 3Q2LA 3QQ4A 5D2LB 2VDLL 2CO4A 3SE8L 4BH8B 1RIUH 3ARDD 3WI9A 4XRCA 5J7CC 3VFUB 1FL3B 3P4NA 4NO5A 4XNZB 5DJZA 2VM4A 5LWYL 1WICA 3G5ZB 1RERA 4K71B 4Z7VF 2ZKXA 2YD2A 1EV2E 5DS1A 3SPVA 4ZXBA 5FCSH 3TJPA 2GJRA 4DKAA 3EJRA 4YFLF 1IC5H 3MRRA 2X4QA 3MROA 4KMQA 3T3MF 1YHPA 3LQZB 3WXVL 3EF4A 3FUKA 1RLBA 4V1DE 1A6WL 1NCUA 4B60A 2QVFB 1CGVA 2RCSH 3GMQB 2F6AA 3FPYA 3NCWA 3IS0X 4POZD 1I9EA 4ZMWA 5GZOC 1L3WA 3GMLB 1VERA 3MV9D 3FB6B 2X44D 4OM1L 4L0ZA 3ZKMD 4CJ1A 3HAEH 3B4NA 4WV1A 3CHOA 3RTLA 4KY2A 2XFXB 1EVTC 3BMWA 1DP0A 1A7BA 2CUMA 3DHPA 1XZWA 3H42L 3M46A 5E9DE 4E41E 4QJ5B 1BMWA 3GT6A 3EDJA 4AZ8A 2ZOWA 3CFJA 3NJHA 3QFJB 1M9WA 5LQBL 4ZXBC 1UEYA 3C5SB 1ID2A 1E50A 3T4AB 4GW4A 1QP1A 4S0HA 4DKEL 5AW0B 3HI5L 4MJID 1E5AA 4OJEH 4HS8L 1I8LA 3T6VA 1QSED 4KK9C 1ODUA 4R83A 4XP5L 1RJZA 2EKSB 1XO8A 2J56A 1EXGA 1E5BA 3AAZB 1UHVA 1JZ7A 3BAKA 4RBPH 4D9LL 1UOWA 1BAFL 2NY4C 4QOKE 1FNAA 1YMMD 2MCPH 4PRIA 3WMSA 1U8LB 4K5OA 4C83A 3VD9A 4MX7A 1LQBC 2F7RA 2Z8VC 4G80B 3PWLB 4U7SA 3WMQA 3M1BA 1HL4A 4Y9BA 3E9TA 1CLOH 4G6MH 1ZV5A 4G59C 4PG9B 4QHUA 1JCKA 2Q3XA 1K6QL 1ZJBA 3P69A 5MENE 3AU1B 3B5TA 4BFBD 4GKOA 1S5IL 2VSDA 3QEUA 1G87A 3WLWD 4LLMB 4KRMB 2IOMA 3ISYA 2ITEA 4QTIH 1ZANL 4CSZA 1Y6MR 2UY7A 3HI1B 5CWSB 1JN6B 4RRPA 2YO3A 1FBIH 4G3YL 2FJHA 1QD0A 1B2YA 1RXLA 1DLFH 2OR8A 3HNVL 5E2TL 3ZTDC 3DA0A 5F70A 4UDUA 4OZHF 2ESVE 5I5RA 4X6CE 1G1CA 1HH6A 3HE6A 1H6FA 2EUZA 1G6RA 4HJIA 2UXTA 3VMPA 1W6LA 2I9LB 3OPZL 1S7WB 4PVBA 5HDBF 2X5PA 1BBDL 1HILB 2VKXA 4P2OD 4X9FA 4FFZH 1VJSA 1A02N 1OHQA 5LG6A 2GK0B 4P99A 3B9KD 1IEAA 3BH9A 2AQRA 4IU2A 4RMRA 3V52H 4CN4A 1H5BA 4JQXA 3EYQD 1E4JA 2OSXA 4NAJA 3NIDE 3FYIB 1LEKA 5ITFA 4JFWA 5AYUL 5FUOL 2XTJD 4I0PB 4M8RA 4LXFA 5I75B 1JIBA 3H2WA 1JNNH 2ICEB 5FGSA 2C34A 4NPJA 4X7SH 3F5WA 2CW0D 5IB1A 1TU2B 1GGCL 3MV9B 3U2IA 3BDYH 4GG8B 2J6EA 4G5ZL 4KTGA 1CYWA 3GPSA 4RISH 5KVFL 2ODHA 1TQCB 4H4NA 1U4EA 1BWMA 4PWGA 1UZ8A 2F54D 5CR8A 2NYZA 2YAMA 1G4MA 4JMXA 1WVZA 4D0BA 3X13A 4JRXA 1DJSA 3K2IA 4I0CC 5FKAA 3HVDA 3VXSA 3FRPB 1QEXA 4IM8A 1A1MA 1RMFH 3HUJE 4JFEE 4F92B 2AJYH 4U3CA 3B1TA 5GGQL 1DO6A 2VITA 1O6TA 5GXBB 2C5DC 1WBYB 3WJJC 3IFLH 4MJIB 5B8CC 4P5MA 3OF6A 5C08A 5F0PB 4OV5B 2PR4H 4PGCA 1DJXA 2BY1A 2C1OA 1OGTB 3REVA 1FDIA 3MJ9L 5T1LD 4S1DC 3ZE0B 1R75A 2GJ6D 5KBDA 4BFNA 2WWOA 5EBMA 1G6VK 2J71A 1WG3A 3PL6B 4TL5A 2GSGB 4PPTA 4R5VA 4ZFOB 3WV0A 2R0KL 3U0TB 1WBZA 1ZA3B 2XPYA 3QIWA 3WE1A 3FUEA 4Y19A 2I9TA 5I6KA 3VSQA 1EXHA 1HT6A 1TMQA 3QQ7A 4IQHA 4Z0XA 2NW2A 4WU7A 3T6XA 1UZ6E 2VMCA 2JQZA 4JHBA 4BEIA 2NUPA 2Z65C 3OKKA 1CG9A 3HUJF 3ZYZA 4C56B 3BFOA 2K70A 2Z8SA 5T5NF 5BXFA 2V6HA 4M6MH 3LEYL 3FCUB 3K6OA 3VI4E 3QDJD 5FC9A 1SFDA 4KITB 5B8CA 4IMLA 1P0SE 1R3HB 3GXFA 4PJEE 2A73B 1MG2C 1Q72L 4JN2A 2H1PL 4UDUB 4HKJB 5HVWA 1OEZW 4JN1H 1HHHA 1RCYA 2B9BA 1IGFH 4CVXA 3D25A 4TSBH 3WN6A 4YSEA 4JPVL 2JKTM 4G9DA 4M48L 4WI5A 4BDVB 5FHAH 2DD8H 2KDGA 1IVLA 3SE4A 3EXJA 4EDXB 1S46A 5AW9B 3EG9A 4IRZL 3C2AL 1JHKH 2PN5A 2AFNA 1U91A 2OV0A 3RBGA 1TJHH 2KC0A 2V17L 3SCMA 3MBWB 1MFBH 3B7RL 3GMOA 2HRPH 3QUYB 3VYOA 3MLRL 1JK9B 1KNOA 4GSDL 4GRWE 3CZFB 1IJ9A 5MEND 1XGQB 5T3XE 4PMFA 2GTZA 4TRPL 4X5LA 1CT8B 2ENQA 4KH9A 3OKOB 1PZ5A 4K15A 3V0HA 1S7TB 2BVQA 5KG9B 4CADB 5I8CA 5SX4I 4OLVL 1WJ3A 3MODH 4DP4X 3JWNG 1BXAA 1N19A 4ZUSA 1EEYA 1UD3A 3O4LE 5KS9E 1DVFB 1BVNT 2EVFA 4NQEA 3HU1A 4U2YA 1QPXA 1H3XA 2DJUA 2EC9U 5BZDA 2UWEE 1EJFA 1OW0C 3CVHB 4O4YH 5CUSH 1DQLH 3WEXA 4X6BA 3EZJB 2WCGA 4CUCA 3TIWA 1ANUA 4WUUA 4PJ7F 3QHTC 3ELAT 5FX3A 3KZ8A 4KXBA 2HLAA 1VACB 2YJQA 1ZYRD 1KJVA 1ZSDB 3MV8B 1PF3A 5SX5H 1KENL 2H0FA 5DSCB 3QIUD 3SKJH 4JFZL 3ARFD 1ITBB 1WEJH 2DI7A 5CIPA 4FJZA 4UQAA 3BC9A 1QVOA 2A6IA 4NOBA 4N6QA 2X6UA 3T65B 3CC5B 4AGOA 4Q56A 1QZNA 4ZMXA 1KBKA 1P7KA 3ULVL 5CR1A 3CG8A 3L7FB 4J8RB 3Q8BA 1U8LA 2YAHA 1AZZC 3BYYA 3TEZA 3NP4A 3STLB 3N2JA 1K2DA 5IR1A 1ZT1B 3HMXH 2E27H 3PGCA 4Y9CA 2VLRE 1FGNL 1IAOA 3ABZA 4AG4L 5IQOA 3K3QA 1EFQA 2FEDD 5DMIL 3ZQ9A 5HDWA 1I1CA 5EBWB 4TNEA 5LG1A 2XA8H 3QCUL 3TBTB 2G0LA 2FNWA 1ETB1 4NBZB 4ZI8A 1M2VB 1S9KC 5JNYB 1GGBH 2EIZA 3VD2A 1VKXB 3GPEA 1WHOA 5J3HC 3L1GA 3VB9A 4IBYA 5GGRA 2EXWC 1KBGL 4FQ1L 3C60B 3X11B 2AERT 3L1FA 4EZMA 5F89A 2J3SA 2B1HH 2NZ9C 4HXAH 3RE0A 1TLKA 5T1LB 4F1ZA 4F5CE 5T5ID 1HI6A 1MNUL 4IMKC 4Z77A 3MRJB 4WW1B 4XBGA 1CE6B 5GIRB 2DMCA 3CFJB 3GMPA 3QFJA 5E94B 3KXFB 2R4SL 3UZVB 5DWPA 3E6FA 3RA7L 3AXLA 3TXAA 3L4VA 2PYEE 3TH3T 4DJMA 5J6GB 2ZUYA 3GMMA 1XWVA 1JNNL 1ESOA 1QUNB 2BNUA 1Q8MA 2X7LB 3GJEB 4C56D 1JD9A 1CIDA 3RB5A 4DOHB 1AG6A 2P4AB 2CHNA 4H25A 1Q0EA 4OUUA 5INDB 3VH8B 2PETA 1RY7B 3IJSB 3N42B 2JA5A 4P23A 1ZE3H 5C0CD 3LS4H 4PWIA 2KHAA 5AW3B 1VADB 4XVUD 4OIFA 4NOHA 3LMJL 4P4KD 3NDYE 5J11B 1AQMA 3BWZA 2VDKL 32C2B 4A2GA 2QT6A 3DKHA 1V05A 3ECQA 3KVDD 3QJVB 3D08A 1FZMB 1UKSA 5CJXA 5DMYA 1IRAY 5BOZG 3WHXA 5F7FA 4B9IA 3ASOB 1RUKH 2HJFA 3BFQG 2YGPA 3DX4A 2GY5A 3FS9A 4QRTB 1RVFL 1KB5L 2CHXA 2ZXEB 1DQJA 4ZW5A 3KPPA 3I50L 4GQ9H 4LCIH 1YAIA 4Z7VB 5GRJH 5C0ND 4C4BA 2WLIB 2FLRT 2YGNA 1P1VA 5DRZB 3C5ZD 4FG4A 3QI9B 3RTQB 1X5YA 3T3MB 1ZK9A 5DJ2A 2ZXDA 3M17A 4HK3N 1OF2B 5I1JH 4PJ5D 3OZ9H 1EUUA 4HHAB 5HJGA 3DETD 4APQA 5T3ZH 1N59A 2QJDA 4XMKL 4TYUA 2YD0A 4MDJB 2YPLD 4PY7B 4XPBH 5CMAB 2X6AA 5PCYA 4GG6E 4A37A 4PQXA 1CFBA 4KVCL 3IFNH 1SBBA 4ZSOB 1M1XA 4JHAL 4POYA 3E0GA 5F9WB 3GTVA 4HLZG 1ADWA 4L29A 1SOKA 4CRPA 4PJCB 4GS7C 4PSRA 1NQBA 2D9CA 2ZIDA 3SPHA 1FAIH 2YSTA 4JQVA 4NO3B 1TTUA 4LPWA 1HINH 5ACZB 4HC1L 4K8RL 3VACA 4AYSA 5SWQA 3O6MH 1L0XA 3MLWH 4LEOB 5DD1H 3TTSA 4ONGL 4TVPH 4FAAB 3JWOH 3JWNH 3L5JA 3OKLA 3C60C 4GEJA 2AK4B 5E8OA 1EQWA 2R92A 1RZFH 4LOUC 4D7PA 3VDCA 3KGUA 2D3LA 1HZHH 3AJ7A 3GTNA 3BZ4B 4L4VA 3N44F 5BMFH 3QDGA 2D2OA 4OCLC 3SUKA 4JVUA 2PO6A 2ENGA 3LIZH 4GY4A 3RFZB 4DP0X 3U82B 3P3SA 1NUNB 5DJAA 2IFFH 4EN3A 1U92B 3G04B 1G5AA 4FYRA 4XCCL 3Q43A 4AIXA 1TU2A 5DRXB 3WN5A 1H3WM 2GTWA 5F7AA 1DBAL 5E6SB 5IVOA 3S5ZA 3V6FA 5F93C 4N2GA 1ZOXA 4O2CB 1IBDA 1Z9PA 3ZR6A 1IGTB 4GSRA 3D6GA 3ARZA 3X1BA 3FRUA 2NTFB 1KCBA 4ISVB 1A9EA 2H32A 4N2IA 2YFOA 1I31A 3NIFB 1CC3A 4JGJA 5A43C 2BVOB 4TLTA 3MACH 4HWZB 1SMDA 4I7ZC 5T3XD 2VPYA 1F6AB 4HUXA 3RX8A 3FRPG 4AV5A 5GISH 1NGWA 4RX4A 1BLIA 4N2NA 1LE9A 5E2JA 1HNYA 5EWIH 3T0EE 1O6SA 5IMLA 3UG3A 1F0LA 2QVTA 4YHYC 1Z9NA 3PWUB 3S3BB 3FKUS 3ZDYF 4CGUB 3ML9A 5K9JH 4DMRA 4K9JA 1CICA 2CR0A 4K23L 4PJHB 3ZE1E 4MQXC 4GKZB 5DJDB 1N7ML 5DWUL 4OFYA 2IEPA 3TGXA 1TFPA 3CVHH 2RTTA 2F7IA 2BPBA 2HH0H 1A7NH 3GSOA 4WHTA 3CXHJ 1F58H 2YWZA 4PP1D 3QWOA 4RA0C 1CURA 1WWWX 4OLZH 4V2CB 2EDXA 4YHMH 2CCLA 5DHDA 1YC7A 4NT6A 1CG9B 2NMSA 2WQVA 4PJBF 1ZT4B 1C5BH 3LKNB 3QA3A 4ZFZB 1FVEA 4YHZL 2YPLB 4L1HA 5TE4H 2FX9L 3ZDZE 4NFCA 3WNKA 3PHOA 1QABA 4ZO7A 3AY4A 2JKNA 3EO9L 5BW7A 3MXVL 5T5MD 3A6CL 4MYPA 3SPGA 3LQAC 4B27A 1Z7JA 1P4LA 2R9HD 2FWLB 2R69H 4MAYC 4PRAA 5FTJA 3VVWA 3TJHD 1WT5A 3CHXA 3RPIA 1RZ7H 4UM8A 1UM6L 3ZL4H 3W5NA 2JELL 3GB7A 4MYWB 5DD5H 3OG6B 2ICWJ 3GI8L 2MHAB 4HS3B 1RHHB 2QBWA 4H5SA 4MJ6A 5F96L 4WHYH 4HAFA 3KAAA 3VXNB 1IV8A 1S2EA 2EIZB 4PIRF 5KZCB 4FLRA 1CFTB 4HQQH 4CS0A 4XOAA 2AK4D 4RBPK 1FYHB 1VADA 2JIXA 3RAJH 3J07A 2JB6A 3KH3A 1P1ZA 5C0RL 1EO5A 4WU5B 5E70A 4JE0A 2DL2A 4WFGE 4OLWL 3D8MA 3H6JA 3QXTA 3FDWA 2BHZA 1MWAL 2ENJA 3GKWL 3UTSE 3VFNB 2EIKB 3VFSA 4YPJA 4DN4L 3B83A 3GSQB 5DWUH 5ALCH 1TTRA 1LMKA 3KPRA 2Y36H 3W3BA 3UAEA 2UXFA 4OB5H 3IXTA 3GLZA 2MOQA 4K4KA 4QRBA 4IJTA 4K5LA 5AB2A 4G6FD 2J44A 1CFQA 3EOTH 3ZKQD 3SKOA 3KL0A 4ZNEE 2ZX7A 2F5BL 4G8FB 2QFPA 3EHBD 5AW4B 3JV4B 2XWDA 2WLNA 2L0DA 4W9GC 3U4AA 5IJBC 3NPSC 4DH2A 4FA8A 2Y24A 5CLYA 2R1WA 5KYYA 4OW6A 1R34A 1DUYA 1EA9C 3QDAA 3UC0H 5D8JL 3F3HA 3OAZH 1D6VL 1KBGH 3DX9B 5E5UB 1SEQH 4LKXB 4UOQA 4U1SA 3FQXB 2D7QA 3QO1A 4OCRH 4LEBA 3VMNA 2JXMB 4WW2F 4IIQC 2IADA 2CKBL 2NY2C 3RVTD 3BLKA 5IHBA 1HL9A 2CQVA 2DM3A 5SX5K 2PWDA 2KQAA 1G9MC 2WUBH 4FP8H 3EOBA 3MUZ1 4XAKE 5FWRA 3KGRA 5I73B 1IO4C 5FEBA 1GIGH 2DEYX 3MXWL 3CN4A 1LD9A 2BP3A 5HHNB 3ZGIA 2P43B 1YC8A 35C8H 4PLKD 5M7QA 3SKNB 3OQ3B 3VXOA 1U9KA 2V2TB 2E74C 2Z1PA 1Z5HA 3X3FH 3U4BH 5EOTB 1AYRA 5FO9A 4NENB 4FEMA 1LEGA 5H4YA 5ADPH 2IJ0C 2UZYA 1EZVY 4PJ8D 5DGRA 1KYUA 1SY6L 3U9PL 4MMXC 2VLKA 2BNRB 5AVWB 3UEZA 1CLZL 2B8OT 3PFQA 4G9FA 3VD1A 3O11A 3WS3A 3GLEA 3G5XB 4GT7A 3ZKND 3VD4A 3I02A 5FTLA 1V3JA 2BNRE 3MMEB 1W2KT 4YWGH 1DQVA 3NH7L 3C5JA 1WGOA 3MNZB 2ZYRA 4W9HC 1K4CA 4QR7A 4X5WA 1DQQA 3FRUB 2F74A 4R5TA 1I53A 1MVYA 3SE3C 4KUCD 2ZWYA 1HI6B 2BSED 2C9UA 4OCMC 4LRNH 2TAAA 3DUUB 1B0GA 4PRHA 3FFCB 2XVLA 1BQHA 1ZLDA 3P4MA 5B1JA 4QHNB 3TJHC 4GP5B 3TWCH 1PD1A 3DV4A 1L7IL 5T33H 5DZVA 2J8UE 5B22A 1MFDL 2WKLA 4MXWH 3S5LG 3DUSB 3IMUA 5FB8A 1AGCB 4YE0A 4IJ3C 1RLWA 4GW4B 3GSRA 4NQDD 3VI3E 1N4XH 3RWIB 2NLJB 4WFFD 4F7MA 2F8XC 1B4JH 4Y5YA 3H3BC 1S7QB 3LZLA 2VQUA 3QIWC 1HYSC 1NFKA 1BGXL 4NNXB 4XHQA 3UPRB 1FN4B 1L0YA 1NDGA 1XGPA 4EI6B 1NKGA 5AKTA 1PYUB 2WJ5A 1R5IA 3V7AG 4LIQE 3VX0A 4S1QL 3APFA 2BIOA 2BC4A 1OV8A 4AV4A 2JELH 1XGPB 3WGVB 3LPWA 1AJ7L 3SYPA 3AMKA 3HAEA 3SQRA 1FL5B 2YBRA 5KSUB 3MPCA 3SO3C 1HOCA 3DPBB 1EFXB 1NGYA 2VXTL 4ODHH 4PJCA 4PV9A 4XXCC 2B3IA 1D5MA 3BIKB 3C2AH 4KKLC 4PRNB 1E4HA 2AQNA 4QXTB 2CZNA 2K6ZA 3RDTA 5E9AA 3QQNA 3V6BR 4KXAA 2F7OA 1BJ1J 2F9BT 1BYOA 1U3NA 4OFDA 1ZLSH 5B8CB 3BWUF 43C9A 4ZW6A 4YAQB 3VJ6A 2IV8A 1ZHNB 3EOBB 4PW4A 2Z4QB 5B1CA 4GXVH 5IK3B 3T1FA 1IM9A 3MI6A 5H94B 2HH0L 5K5YA 1I1AB 3GI9L 2QMKA 4YHIA 4ZMTA 3HAEG 2RD0A 3B2MA 4M1DL 2BRRL 3C8KA 1AKJA 2D0GA 4G1EA 3F85A 3KLQA 3NYKA 4HG4J 5C3IA 1RUAL 4JPWL 4X7SL 4LDLB 3ZW3A 4G6FB 1NPNA 4RWHA 2NZIA 4TVUA 2YKLH 5IZ7A 1CDJA 3DJRA 4FNLH 1GYCA 1PKQE 2ZTBA 1WBXA 4NM4L 4PJIE 1MW1A 1UKQA 1ZAGA 4JDTH 1FQ9C 5E8EB 3QIBB 4JY4A 3IJHB 1R3JA 1BD2A 1OK0A 5I19L 3COOA 2VR9A 1MLBB 1BX2B 4WEEA 3N0AA 2DMHA 3O0LA 4MFHA 4JFOA 3PABB 1P4IL 5CXPA 3VW3L 3N0PB 1BD2B 3ZHKA 5IOPB 1U30A 4JZOB 3RGVC 4DVRH 5JIIA 3OZLA 2PYED 1SEQL 3OKEA 4I77H 2P44B 4JFDE 4ENGA 4AYBA 2BSSB 3G9AB 4MXQC 2OYLA 1KJVB 3CZLA 1QASA 5CZXD 4PREB 3BSGA 3EJZD 4ONOA 2RHEA 4Z7AA 5E6IB 4TUJB 1TTCA 3KPOB 4JB9H 1P6AB 5EUOE 1N9PA 4LBEB 4KK6D 4WUUB 1BZQK 2AI0L 3CDCA 5HDLA 1TF4A 3GBEA 4LRIC 5B1JC 5F1IA 5F44A 3DO7A 4NBYB 4PM1A 4OF3A 3FJTA 1RZKL 4YZFF 2R23A 1P5UC 2ID5A 2X3CA 1E67A 2JCCB 1CL7L 2Y6SD 2YIHA 4GPVA 4U7KA 4GRLD 3RY5A 5FGBA 4L4VE 4NWTL 4BKSC 2AJUH 5AALA 3GDCA 1YUHB 2F1EA 4FFVD 1JDDA 5ISZD 1DANU 3H7LA 2IQAA 3FB8B 3SHSA 1OA7A 4ZRGA 3TFBA 2YJLA 4MXVF 3EYOB 1OGPA 1CYGA 4IU3B 1M7DA 2OJZL 4ZOBA 3T6WA 4MB5A 3GXNA 5F6HJ 1HHJB 2JTYA 1FPTH 1MCWW 3KDMA 3O5AA 3OL2A 3MJ7B 3KYOB 5E2TH 4NQCB 3G5VB 4LLWA 5ICXA 1PZUB 1JPSH 2FYVA 3N1PC 1V3MA 4H7VA 4OCXL 4S1SH 5CU5A 5JOEA 3UJTH 2RACA 4Y19E 4AE1A 3TM7B 3INUL 1JJUA 4HW6A 3S88L 3EOAA 3DVGB 4PLJD 5E4EC 4GO8A 1AZVA 1NIAA 1Z32X 2FYYA 5C07B 3MZTA 3OJMB 4BDVA 2QHRH 2DV6A 1XV8A 2J4WL 2BCKA 4XWGL 3MMEA 1HSBB 3DX0A 3V4PL 5I76B 4WWKD 1I85A 1CE1H 1AI1L 4GG6A 3WIHL 2H32H 1S3SA 3FT4B 4HSQA 1DCLA 4O58H 1P4BL 2WQSA 4R4ND 4PN6A 4I2XE 5FCUH 1T7YA 5EUOA 2XCMC 1G9NH 5FYKU 2APSA 4JDEB 5B4MC 3ZE1B 1JMXA 1QSEA 1SXAA 3SPIA 4UOZA 1DDTA 2DYPB 1NCIA 1CLOL 4G6ML 3JYBA 4QHNA 1E3XA 4CNIB 3FCSA 5GRYA 4W9JC 5JOFB 1J11A 2W1NA 3NJGA 3H9HB 3X2JA 1NCAL 1CD9B 3GBMH 4G43B 5DMIH 4W1TA 2ADYA 1F18A 3KPQA 1SMAA 3DX8B 3NTCL 3TBYA 1A4JB 1JPGA 2G9HA 4GIAA 3FH5A 4RGOH 1I9IH 3B9KC 2GFBB 4LSUH 4BBWA 5FFLA 5EUKB 4F7CB 1MWOA 4AVRA 1GSMA 1KCRH 4OF0A 1YECL 1NM4A 4FXKC 4BQ9A 5IQMA 3CFIC 3LEYH 4HV8A 5E8PA 4AMKL 3O2WH 4JP7A 4L1SA 2A1WH 5HHXL 5TQ0L 2Q6WA 5HHOA 3BUIA 3OSKA 3MZGB 2XQ0A 3WHXB 3CN0A 5E6IA 3C12A 1XSJA 5CO1A 3CDGA 3CH1B 4AVIA 3BW9A 4PGEB 4Y1AA 2Y7NA 3POHA 2B4CC 2GYSA 3FN9A 3AMLA 5JORA 4AJYV 2EDWA 4GYBA 3S5YA 2Q8BL 3FB7A 5E24E 1F00I 2X12A 2ADFH 1C16A 1BMGA 2XWZA 1BYNA 3HBZA 1O75A 4UT7H 5DC0A 3MNMA 1UYWH 3UADA 2WWKT 4Y4HD 3JTBA 4D2NA 3MCLH 1QSFE 1MLCA 5J3HD 2ADIB 1M6UA 2ICEC 4KX7A 2IOIA 4HCIA 1R24A 1T7WA 2VR7A 3K6NA 2ZSVA 5J1AB 2RIKA 4UTCA 2W65B 1DBKL 2DIBA 2I07A 3LRSA 2L8AA 2DJMA 5E94A 5ABZA 4EI6A 4J7RA 2XA8L 1G9MH 1U36A 1DUYB 1RAMA 2C7UA 4LVHC 4JN1L 2BY3A 4JO8A 5EG6C 5MEQB 4ANUA 1U58A 1QFWM 4HKXA 1IGMH 4I9WE 4LHUA 2HVKB 4CBZA 1MW3A 2Z34A 5IVZB 4DHLA 1IFHH 1OAZH 1U8MA 2DI9A 2MPAH 3GJFA 2Q86A 3SKMA 3MV11 5EF0A 1JZ3A 4Z8FL 2QELA 1F8TH 1TPXC 2R29L 3IGUA 3MLVL 2X3AA 4PW9A 2R83A 4U7MA 1BOGA 3AZUA 4GEIA 1Y4ZA 3BJ91 4RX4D 3RRQA 2N7AA 2CGZA 2XJLA 5FYLD 5AVSB 1SPDA 4OCRL 1R3KB 3WY3A 3OMZA 1ADQL 4M7LL 2QZQA 1RULH 1FYTE 4Q9RH 2VPXA 4P5KB 3OF6D 3IXAA 4ZX3A 5GGTL 1OAUL 3L3DB 1A7OL 1MCNA 3IMTA 5ETUB 1ASOA 2QSCH 3GXIA 1GC1L 4U6HA 3T0VA 2GSIB 4OFYD 2DLIA 1HHKB 5JIKA 3AVEA 1F45A 3B34A 1BDYA 1QBAA 1DQTA 1FYTA 1JV2B 3OXSA 1I8KA 2FECI 4LPVA 5GQBA 3FFDA 5BUPA 4Y19D 3WS6C 1CGTA 5HTSA 2FIKA 5DQJB 4XX1G 1FFPB 4NZRH 3GJEA 2DPKA 4ZO9A 2YD8A 4I0PD 4ZW8A 1E43A 1JVOA 3TPKA 4P3DB 1I7UB 4OZIB 4NBXB 5L6YH 1U8QB 3EJYC 5CZXC 1IAIM 2X4PB 5DI8A 3VGEA 2PO6C 2NUPB 2HT2C 3OKKB 2VCOA 5A6MA 4QO1A 3I74A 5D1QB 5F7EH 5GRXG 4BKLB 1HX0A 5KYXB 4JFED 5D1ZC 2IDTA 3RAJL 2G9KA 2IANE 5LDSA 2WIIA 5HJBA 4QNPF 4DUWA 3ECUA 4GKSA 3S3DB 2VUYA 5EORL 4DGYH 4LEXH 4YAQA 5TK4A 3GS0A 3I6GA 4UANA 3H53A 1ZTXL 1O5PA 5L9DL 4I3SH 5B38G 4OJCA 5KVEL 3ZT5A 5F7KC 2P8LB 2F5AH 2X9WA 4GJTB 3T0WA 2Y2WA 1N64L 4N85A 3ROLB 3LSOA 1NZRA 3S96A 3H42H 4LKCA 3OKMB 5FYJE 3IKKA 1KCUH 3QXAB 3UBXI 3IJEA 1AO7B 1A7PL 5I23A 1S8DB 4LLQA 5IIEB 1BZDA 4B5EA 1SBSL 2OP4H 3VWKD 4OJYA 1AO7A 2AJZA 4Y89A 4YDJA 5PAZA 4YHYB 1IEBB 2APBA 4ISVA 4YVNA 3IGAB 4KX9A 2OZNA 1CGSL 2EDEA 2WY3B 5D7LA 4MASA 1ZT7B 2A3TA 1AI1H 2IWKA 2ZF8A 3QUGA 3NIGF 4FI8A 3QORC 3V0DA 2XWXA 3TVMB 3DIDA 1XZ0B 1IGCL 2A77H 1WIOA 3GXTA 4I13B 3VTTA 3S4SG 3TF7C 3QG6A 1Y7VA 1AIFB 2IPKA 3AY4C 5EU4A 5L4MA 4PB0L 2AJVL 1R6VA 3OHMB 5G4OA 3WFCH 4L37B 1AIFA 2IPKB 3UFIA 4YBLC 5HVFB 5B7MA 3ATDA 4LCUB 3RHWF 2PMZA 2XG4B 1GCYA 3D4CA 2R1XB 5HYQB 5ISZB 1CFQB 1DEEB 2DI8A 2K4WA 4OFQA 3MREA 1ZPUA 5T3XH 1RJYB 2QVKA 5LVEA 4UQEA 2GITB 1LHZA 1UD2A 3RWDB 3WN5C 1JPGB 5AB0A 3F7RA 1KJ3H 1TZHA 2P5WB 3KS0J 4M7ZC 3MFFB 4WY7H 3D30A 4B6ZA 5I15L 1PSKL 4E2OA 4CC4A 3U0PB 1IARB 4YDKL 2VLKD 4NJAL 3SD2A 4EUPG 3X2LA 2CM5A 5F71A 4ZNEA 1BEYH 1MVUA 1K5NB 1UXMA 2DQUH 4YXLL 4I3RL 1IGJB 3GEWB 5JW4Q 3GNML 4X6DE 1SDDA 3V7MA 2WXGA 4PJXE 5IQ7H 4H20L 4BUQA 3DSFH 4KUZH 1HAWA 1CXIA 4DCQA 2OSLB 5TE6H 4L18A 4PCKA 3PHQA 3EOAB 4XRCB 4D0CA 4FZ8L 2JIXB 1DBBL 3QQ8A 3TF4A 4K8RH 1BGXH 4JHVA 1S9YB 3HZYB 1MAMH 2M2DA 4PCYA 4YL4A 1DQML 4AT6B 2YUZA 2YA1A 3DO3A 3BP7A 4X4ME 4X8CA 3E6FB 3PHOB 3SODB 5B21A 5IHUL 2P28B 5IQLA 5J6SA 2WUCH 4AM0A 4BZ1H 1MVFA 2GK2A 4G43A 4YGAB 5LBSA 3RVVD 3RVWC 4V33A 4JNXA 1ZIAA 2CJUL 4ZYKA 4U49A 5LBSL 4QWWD 4FI6A 3HPLA 3RHWK 4E9TA 4EZJA 4GQPH 3UTZB 1KB3A 9PCYA 5GZOA 4KQ0A 4QRFA 3CX5K 4F1SA 1H9DA 4ZZFA 4LPYA 1DQQB 4P23B 4WWOA 3PRZA 3PHSA 3OXSB 3TTYA 3VI4B 3WIFB 3UO8B 1P7QA 3TIDA 2ZUVA 4P4KA 4YPGB 3SGDI 1KBVA 4M9PA 5F3BB 1LDPH 4B9JA 3GK8L 1PQEA 1DVTA 1XB6A 2CBOA 2IG2L 3K6FA