2HCZX

Crystal structure of expb1 (zea m 1), a beta-expansin and group-1 pollen allergen from maize
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
241
Chain Sequence
KVPPGNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-expansin 1a
publication title Crystal structure and activities of EXPB1 (Zea m 1), a beta-expansin and group-1 pollen allergen from maize.
pubmed doi rcsb
molecule tags Allergen
total genus 44
structure length 241
sequence length 242
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01357 Pollen_allerg_1 Pollen allergen
X PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2hczX01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2hczX02
4ZM7A 3CZBA 5GLYA 2VXQA 3D30A 4FERA 2G5DA 3X2NA 3X2KA 3SUJA 3ENGA 4JJOA 4JP6A 3SULA 2KQAA 3X2PA 3SUMA 3FT1A 3X2OA 5GM9A 4FG2A 1OA9A 2PNWA 4JP7A 5H4UA 4AVRA 1L8FA 3X2HA 1BW3A 1BMWA 3FT9A 1OA7A 2GAEA 1WHOA 2HCZX 3X2IA 3X2GA 1N10A 3M3GA 2G6GA 3X2JA 4FG4A 1HD5A 3SUKA 3X2MA 1BW4A 1WHPA 2ENGA 4JCWA 1WC2A 2AE0X 4ENGA 2PJJA 4L48A 4FFTA 5GLXA 3X2LA 2PI8A 2BH0A 2JNZA 2PICA 4JS7A
chains in the Genus database with same CATH superfamily
1R7RA 3Q3GB 1I8KA 5HI5C 1P6WA 1U36A 1KY7A 4XN8A 3NN8B 3WJJA 4MJ5A 3PQYA 5KVGH 1WFOA 3B5TA 3FB5A 1KPVA 1P84J 4JY6B 1BZ9B 2J72A 1DLHB 4I4WA 4KRPC 4XBGA 4O02L 3UTSD 1WIOA 3N1MC 2C8NA 1B4JL 4BSVA 2RD0A 1PG7H 3QH3B 3S36X 1A6VH 4XB3A 4I9WD 2PW1B 2ZX7A 5EBMB 4ZMOA 5AFAA 1CD1B 5F3HA 4O9HL 4LASL 4P57A 5JW5A 1Q0YH 2YMXH 4UNUA 1YY8B 5KWYC 1U2CA 3EYUH 3ML8A 2ZUYA 3IMSA 1ZKAA 4NPYB 4PYHA 3SKOA 1DJXA 1IJ9A 1CCZA 3T6VA 4ONHA 1T03H 1PJ9A 1Z5HA 2LU4A 1EEZA 3DX7B 3FQRA 4OH2A 1Z6JT 2WD0A 4HKBB 1QYGL 2OYKA 5L2JA 3MRHB 4EI0A 3TWCL 1MCPH 1NC2A 3SE4A 2WN3A 1AGDB 3WY4A 1KSRA 4ZS7L 1RZFL 1UGNA 4FG4A 1UWEL 4AKOA 1EEQA 2O5XL 4ES9A 2CU9A 3H7BA 1MCNA 4PRDA 4UDTA 1LE5B 1Z9MA 1OSZA 1U0QA 2ZYIA 4I87A 4PBXA 1X5KA 4KUZH 1J10A 2B20A 2KPWA 4DUVA 3DX9B 3QNZA 3LRSA 4A66A 4LSPH 5SWZA 4KO6A 3GSQA 4KTDH 5I76A 1O6TA 1PIGA 4ZAKD 4BIKA 3V6FA 3PWNB 3MJ9L 1AYOA 4PRPE 4P3DB 3EOAB 4PY8J 1UXMA 3ZUNC 4KRPB 5KOVC 3WIIH 3NZ8B 5ENWB 4ZDHB 1WA2X 3ULSB 1U8KB 4JO4H 5IFHL 4EPSA 3ZTEA 2JTYA 4OD2A 4IYKA 3P4NB 2WC7A 4UUJB 4FYRA 4NAQA 2JMRA 2VISA 2XZAH 3O6ML 2QZ5A 4XP9L 2CDGA 2VRQA 5B7MA 4XVTL 3U4BH 2CXGA 4J3OD 3AXLB 4QRTA 4NKDB 5KW9L 4IOIA 3S36H 2CKBB 4AC4A 2ITFA 3MCLL 4JFSA 3V4VH 4I5BA 2Y7OA 5B1AB 1N18A 1JZ8A 4KQ3H 2YKLH 4P5TA 2HCZX 5DYOB 1DN0A 1Q94B 3WD5H 4ESKA 4XGZA 3KDPB 2R29A 1WAPA 3SDYH 5LWYH 5F7DA 2AXJA 4HJTA 5IMOA 3UBXI 2AKRB 3KPSA 1WCBA 5C1MB 1RV6X 3FFCA 2VERN 3US9A 4NFBA 3RTQA 3VXPA 3B2DC 5B1JA 4IOFC 4OLWH 3BGFC 4PAZA 4DGVH 3D0VB 1X5MA 4Q0XL 5LN4A 1A2YA 4BBWA 4GEIA 3TCTA 2IQAB 3CFJA 1CD9B 2DLEA 3V6ZB 1T7XA 1R3JB 4N5ED 1GZHA 2FIRT 2AABH 3QQ9D 4L1TA 3O3EB 3PXLA 2P5WE 4YSCA 4HIXL 4XVJH 3Q3GA 1U2HA 3HBGA 1PZBA 3N43B 4BZ2A 3RVVD 1YJDC 2HVKB 2QPFA 4WFEE 3DI3B 4JY6A 5F7LB 1DLHA 4FXTA 2CW0D 2WAQA 1A7OL 4JFVA 4X6CB 3QH3A 4B95C 2D9QB 4FG2A 2WXJA 3FAWA 3WMSA 2X4PB 2PW1A 3P3RA 5EBMA 1HOCB 3BYTA 1CD1A 4CADB 2Y6SD 5CILL 5TE7H 3C2SA 2MNWA 2IWGA 5FYLD 2CALA 4FXLA 3UH8A 4BE6A 5IJKA 3ABMB 2ENGA 1YY8A 4IBLT 4OZHA 4F57L 1URZA 1ZEAH 2QLYA 4NPYA 3S97C 5F93C 1X7TA 1XO8A 1KGWA 3V0HA 1TZGL 4B5ZA 2WQSA 2ZX9A 2F18A 3ZYJA 9PCYA 3DX7A 1EXHA 4FHBD 3RQ3A 2CMRL 4FDWA 4HKBA 3QXDB 2ZONA 3BGFB 3MRHA 5HI3C 2EVHA 3VXMA 1KCBA 1WDAA 1SY6L 2AITA 4JM2C 5IVNA 1AGDA 5T1LA 3N0AA 4Q6YA 3TVMC 5AYUL 2VW4A 3LMJL 1LE5A 1H9VA 2A7BA 2P80D 3U9PH 4KHTL 3TJHC 1ZV2A 4KVPA 4FULA 3DX9A 3K4ZA 1E32A 4PJGA 5GGTH 4EXPX 1QLRB 2WTOA 4X83A 5KYYB 2FEEL 3ISWA 3U2IA 4NQCE 4BQCA 2VXQA 3QUZB 3INUL 3PWNA 4QTIH 5LB1A 3RUGF 3BT2H 3S6CA 5T3XE 4YL9A 1F11B 1NCNA 4P3DA 4XCFH 4PG2C 3TESA 3NZ8A 4ZDHA 5I18H 3ULSA 1U8KA 1GGBL 3BAJA 1UHEA 4MS8C 4NNYB 4PJ5E 2HWZH 4U6VL 1NDGB 1OOAA 4EJ1C 2ARWA 2O5ZL 4UUJA 3P4NA 1EO7A 4UMGA 5IHUL 3BUYB 1L9PA 1DSFL 3CVIH 2OK0H 1T66C 4R5VA 1R5IB 1P1ZB 3DVNB 4N8VB 1A47A 4P2RE 1H5BC 1QSED 3AXLA 4G8IB 3ZY7A 2EVFA 4NKDA 4WI7A 1Y1VA 2XA3A 4X9FA 2PWEA 3UFIA 1NZRA 1OP4A 5HD8C 2CKBA 4G82A 1AFVL 1JI2A 3DX1A 1RUKH 5B1CA 5ID1B 1X4ZA 2E3VA 5GS2H 1C5DA 5BJTB 4Z0BL 1BQHG 2I32A 3H6AA 3K0YA 1T7YA 3HLAB 5DYOA 1Q94A 3HRPA 1GC1C 3HCVB 4G8EB 3TVMB 2EDHA 2HFTA 5AL8A 1CYWA 4S1SH 3UTTE 2E47A 1BAFL 2CO2A 1KN2L 3BAEH 2ZXWB 4N26A 3STBA 4AMKL 1LWRA 1OCWL 1NGPH 1T2QL 2X53A 3AT0A 4ENZA 1J5CA 1M57B 4AXWB 4X6DF 3WN5C 4FGMA 3S0PA 3D0VA 1T20B 3Q6GL 1NUFA 3J8F7 4R7LA 2IQAA 2FT8A 4UV4H 2H3KA 1IARB 2N7AA 3FO9B 1FVEB 4N9GB 1R3JA 1AHWC 4JPVH 5J06A 4GRWB 3DTUB 3O3EA 4XHJD 3K8LA 2DBLH 4S1QH 3I50L 2MNJB 4P59H 5HHPB 3SSGA 2HVKA 2WQRA 4N0RA 5C7ZA 4OUUB 4PRPA 2EUVA 3S4SG 1H5BB 3EBHA 5E4EC 2F54E 4LVHC 4XN1A 4XC1L 1IC4H 1RSYA 3H3BC 4X6FB 2G2NA 4L0ZA 5CU9A 4JHBA 4JREC 4X6CA 1MCKA 1SQMA 1J8HD 2BSTB 4MJIE 2X4PA 3WAJA 1U8CB 2A9ML 1HOCA 3Q5OA 2X3CA 4CADA 1KBKA 3T0ED 3DMMC 2Y36H 1DTUA 1WT5C 1UASA 2RB8A 3JWNH 2DIAA 4K3DH 2AQ1A 1IUZA 3HZVA 4DZBB 3KM2A 5FAAA 5IV2B 1G7HB 2JSFA 4EIZC 1N19A 3MFFB 3CH1B 3ZL4L 1HTYA 3QXDA 4Y4KD 3CLEH 5AVTB 5J56B 2BRRL 4Y0GA 1CE6B 3WN5B 3NIGF 3SY0B 3IR7A 2NLJB 5MEPB 1P4BL 4FF9A 4CJ0A 3FFOA 1IM9B 3WU1A 1J9CT 3X3FL 4KKZA 3UTTB 1X44A 4M7LT 2DQHL 3VD7A 1AHWB 1AD0B 2KZBA 5C92A 4YPJA 3FKUS 3GYRA 2J1WA 1QEWA 1U41A 4LSSH 5J13C 4PJBF 1E5UI 5HVWA 2YD5A 1QLRA 3AAZB 5CINL 5KYYA 2EH7L 3D0AA 2ZUSA 5DD6B 3B43A 3QUZA 4XMLL 4OM0L 1F11A 1RERA 4JKLA 4LVHB 3EGXB 2HKFL 3VYOA 2JELL 4F5CE 4JFWA 4NNYA 2B0SL 4JREB 5JUEH 1NDGA 1G7IB 3UYRH 4GA5A 4H2CA 5AW2B 3BUYA 4WEMB 3PAYA 3QEQE 1Q90A 4FN0A 4BZ1A 3ESMA 5HHVL 2P9RA 3HZ3A 3DMMB 4HC1H 2ITCB 5B38G 1R5IA 1P1ZA 3DVNA 4N8VA 5ANME 2F54B 2OZ4A 4NQEE 3WFDL 4GG8B 1HL4A 2BP0B 2GG1A 3GSNH 3QULB 1YUKB 5E5RB 2Y7MA 2JI3A 3V6OE 4MB5A 5D2LF 1Q8MA 3K46A 2PMZA 5TJWK 2EDKA 4I3RL 5ID1A 4HOXA 4DGYH 1OE2A 4DN4H 5BJTA 3LPOA 3DIFB 4XH2B 3HLAA 3HCVA 4G8EA 3TVMA 4B3EA 4XXDB 4MD5B 4YHNB 2D2CC 1A3LL 3UEQA 2Z35B 5T33H 4OLZL 3V6OC 5AW0B 2FB4L 4KROC 1NCAH 1IGCH 3BMVA 1L6PA 3KGTA 3GJEB 4AXWA 3JV5A 4KZ0A 1X9UA 1N10A 1LMKA 1YQVL 2NUTB 1TDQA 1TFPA 4OD1H 1DQLH 3FO9A 4PG2A 1FVEA 2WQWA 4N9GA 4YH6A 3ZL2A 2G75B 4ZM7A 3FYIB 3BVVA 3MJ8B 4GXVH 2VLRB 2BJML 4YXKH 3QUYC 4Y8AA 2LABA 2FCBA 3E80A 1AA6A 5HHPA 3ME0B 1WCMA 3HG1D 4OUUA 3GHEL 3X2HA 1H5BA 1N2RB 4JFHE 4X6FA 4Y9CA 1KJ3H 5GGVY 2UWEE 4HX1A 1HD5A 3K4AA 5H37H 2I7SA 3FU5A 3R4DA 4FLOA 1ID2A 1AYRA 1XVSA 3QEQB 2BSTA 3QJRB 3RURA 1U8CA 4KJPD 4C56E 3BKYL 3ELQA 3GTTA 5ANMB 4LSQL 3IPBA 4NQEB 4XNZC 1T1ZB 3LZLA 4WTZG 1R24B 3V4PL 1WBXB 4PI0A 4QRQB 1SJVA 1S6NA 2L0DA 4DZBA 3WS3B 4AZDA 3MJWA 2AEQH 4IHBA 5IV2A 1G7HA 3W5MA 3OWRA 1V3LA 2FT7A 3QEGH 3VD2A 3FCTB 3TU6A 1PX3A 2YFNA 3CH1A 4ODUB 3WO3B 2WSDA 5JPNC 4NQQA 1CE6A 3WN5A 4F2ME 3HN3A 3SY0A 1MWAL 2NLJA 1J7VR 4M6OL 4OF6A 5MEPA 4G6AD 3IJ8A 4TTGA 1YYMH 3UTTA 3QJUB 2DD8H 4IOSA 2NQDA 1AHWA 1ONQB 4PUBH 5HDWA 1E3FA 1AD0A 4IRZA 3MGAA 4JN2B 2VN4A 4TLKA 1MLBB 3LXBA 4JANB 1IZKA 1AZZC 4F1ZA 3H2WA 2Y2TA 4FG6C 3WKYA 3AAZA 1OM3L 4J7RA 2QQLL 2V7NB 4JRYD 3NAAH 3TLRA 3OZKA 1WQVT 3EGXA 1IKFL 1I75A 3VRLF 1G7IA 3MOAL 3II1A 5JO5B 4TV3A 3C6EA 3R1GL 4PR5A 4M8RA 3V95A 2NNAA 1MKFA 3DMMA 4X42A 2ITCA 2A68D 1QLEB 3LQZA 1WT5A 4YNYA 5E9NA 4XNZB 5BZXA 1UT2A 1LO3L 2F54A 5DLMH 3MREB 4GG8A 1RK0B 5LBSA 3GMNB 2ED9A 3POCA 3QULA 3VYPA 4CBPA 4YMPA 3U0WL 3OZ9H 1TZIA 4KJYB 4U31A 3MLTB 1HHJA 2UX6A 4D9RD 2F9BT 5LG6A 1AHKA 4FYTA 3U7WL 5JPNB 4PJIE 3DIFA 4XH2A 3ML1A 3CX5K 3EJYC 4YXHL 3C5SB 1W8OA 1UH3A 2PKDA 1E6OH 1XAKA 1TCMA 3WL9A 4XXDA 4MD5A 5EZOL 4YHNA 3TF4A 2Z35A 1J0ZA 2B39A 3I2CL 5CCKL 2AQQA 5CJOH 5JHLH 4OF5A 4FZ8H 3BUQA 2BNRD 5HGHB 4UTAH 2ODIA 4CUCA 2CK2A 4L3FA 3GJEA 4DETA 4OZGE 4WO4C 1QFPA 1INEH 1P7QB 4UIKH 2EXWD 1H8NA 2W95A 2NUTA 5AW5B 1OL0A 3NESA 2EDMA 5E99H 5HYJD 3ISYA 1P4UA 2V0AA 2G75A 2NZ1A 4F7EB 1JWMB 3GTPA 3JWOC 4ANVA 2EINB 3MJ8A 5H2BB 5KVGL 2C1PB 1LYQA 3BVXA 3KWUA 4FYSA 2WY3B 4R2GC 3H56A 3ME0A 3R06B 4OSUL 5IQLA 1Z9NA 3PLXB 5K5YA 1PG7L 3QQDB 1A6VL 1N2RA 2XXCB 4QXUH 3D2TA 1ILSA 3CZFB 1BWMA 4E9QA 2VSDA 4F5CA 4OGYH 3OKKB 3RY4A 5IFAH 3K71B 5T8IA 1Q0YL 1RJYB 2B4CH 2PR4H 2YMXL 3EYUL 5C0DB 3QEQA 1WA0X 4N5UA 4E41E 4N8CH 5JIKA 5KZCD 3Q48A 5L6YH 3NJMA 2HT3D 4YAQB 5ANMA 1XAUA 3CDGB 1T03L 4NQEA 1MXGA 1T1ZA 1R24A 1WBXA 3QE5A 4QRQA 3QCTL 3R7RA 4NCC2 3WS3A 1NINA 5I1GH 4N2AA 1MCPL 3L5WB 3VD1A 5BS0D 2ZXCA 3F7PC 4HW6A 4QF1B 1F6FB 4UZGA 2BP8B 3MLYL 3CZLA 1X6NA 3FCTA 5ACLA 3F3HA 5ES4B 4PB9H 3EH1A 4PJIB 4ODUA 1C7SA 4PJAE 4WO4B 3RGVD 4MB3A 4NLAA 4LEBA 5BRZE 1OEZW 4LSPL 1P69B 1ONQA 3IFNH 1UM4H 4JN2A 3ZE2B 1MLBA 1KBPA 4JANA 3QUYA 4LU5H 1OHZA 3WIIL 4DEWA 4R2GB 2X40A 4A7VA 4ZJ9A 3OAZH 4JO4L 4S11A 1OQXA 3C08H 5TE6L 4TS6A 2AVFA 2V7NA 2OQJB 5DRNB 1X6LA 5A2KH 3DUUB 5HDBB 1YQ2A 2XZAL 4NJAH 5F9WB 3MUZ1 5I1AB 3U4BL 4RGNE 3VU1A 5JO5A 4XNQB 2D0HA 2ZPKH 5C08E 3X2MA 3S36L 4TUOB 3KYNB 4GSRA 3MREA 3FOLB 4M62H 3V4VL 1RK0A 1KDIA 3GMNA 2C34A 3PJNA 4KQ3L 2YKLL 4KJYA 3WD5L 2ZICA 3MLTA 4RGNC 4WCYH 4RMUA 4E41B 4KWUA 3QORD 5E2JA 4KXAA 3SDYL 5JPNA 5LWYL 1PQFA 1N70A 2BLFA 5GZNA 4O2FB 4KI5D 3C5SA 4P3WA 3SN6N 1SF5A 4C8XA 3SO3C 4Z6AT 4JFDD 3BO8B 4ZS6D 4DGUA 4G42B 3BWUF 4OLWL 4ODWB 1DVSA 3SQOH 2UY6B 4Q97A 1YLBB 2K1MA 4A63A 5HGHA 1HN1A 3CLWA 4PJAB 4O2CB 4Q14A 1CF1A 4H8UA 5DWPA 1AGCB 2AABL 1P7QA 1DFXA 2VDOB 1J5HA 1BZ7B 3RVXD 4BUHA 1A6PA 4XVJL 3L5XH 3PL6D 2UXTA 3GXTA 2WXIA 4FTVB 4F7EA 1JWMA 2YUZA 5H2BA 2C3VB 4ADIA 1BQHB 2C1PA 3S5ZA 2ZAGA 5EBGA 5K1VA 2EEXA 4FCHA 1QTYT 3R06A 2X9ZA 4N24A 3TEXA 4BDVB 3QDJE 3QQDA 4NBYB 3WKNA 3QFDB 3UG5A 1MFDH 3CZFA 4X99B 1XSOA 4OQTH 1HXKA 4HF5H 3OKKA 4W68A 5TE7L 4V2BA 4AK2A 4S1DD 1T2XA 3BWAA 4RGNB 1N68A 3G6JE 3K71A 5C0DA 1RJYA 4LCUB 1R47A 1ZEAL 3RVTC 4BK5C 2QGBA 3ZBMA 5AVXB 1AZCA 3B1UA 2OYLA 4YAQA 3BSGA 3CDGA 4J1UB 2DLTA 3SO5A 3SO3B 1AANA 3DA0A 4P2YA 3OKOA 5FO7B 4F37F 1KWGA 3L5WA 2Z1PA 5IQOA 4QTFA 4QF1A 2HFGH 2V3FA 2VN5A 2WUBH 4YS4A 2BP8A 3ZKQD 4L8DB 4KKNA 1AKJA 3QR2A 4PJIA 4PWFA 4G8FB 5DA0B 1N67A 1JGLH 4WO4A 2ZX5A 3LCYA 2VR8A 1PSKL 4U3SB 4WWID 3S4SB 3U9PL 3B7SA 2I25N 2K7PA 4PV9B 1KCWA 1RPUA 5DJDB 1R3IH 4MA1B 2Y69B 5GGTL 3X2PA 4OZIF 2OCFD 3FB6B 1GRWA 3HFMH 3VXOB 5BXFB 5L2KD 2XN9E 3OJVC 1CJYA 3Q8EA 4QTIL 3BT2L 2DWTA 4XCFL 1VERA 4LK4A 3CX2A 4X2UA 5I18L 1HAUA 4YC2C 5J5EA 3RWHB 4KI5F 3QIWD 1FNEB 1H3XA 2HWZL 3L1GA 2AXWA 4MJ4A 1XBDA 2DQMA 2OQJA 5DRNA 3TBTB 2BVOB 5ACZB 3J2PA 3CVIL 3DUUA 2OK0L 4JHUA 2HRLA 2XFGB 3VXUB 3IJEB 2CH8A 2WB7A 3G3LA 2YSTA 3T65B 5I1AA 1Z2KA 2FQDA 3SPJA 4MB4A 4XNQA 4TUOA 3QDJB 3Q8BA 4IMLB 2EVIA 3UJTH 1UTDA 1RUKL 2FJSA 3KYNA 4JDZB 5CEZH 2WGNB 4QYOB 5EH1A 1E4KC 4E9YA 4E41A 3QYNA 1F58H 1K8IB 5JHMA 3HZMA 4ELMB 4R4FH 2X44D 3BAEL 4G7RB 4O2FA 5F88B 4XB8A 3TH4T 1DMRA 1NGPL 3SBPA 3BO8A 3NSCA 3X1FA 4AEHH 4G42A 4JG1H 4ODWA 1E2ZA 2DIJA 2UY6A 3JV6B 4OIIH 4ETYA 3H53A 4M6NH 2CBPA 2DJSA 2KDYA 4JB9H 3MUY1 2B3IA 4UV4L 1HZHH 2NZ9D 4PJAA 3IDGA 2B9BA 4O2CA 1EANA 5B38B 3U48A 4JPVL 3BKCH 2EDOA 1TJHL 2E8YA 2ZX8A 1BZ7A 3K5RA 2XTJD 4WU5B 1BQUA 1LJMA 2DBLL 4HQQH 4QRPD 3OMNB 2VJ0A 5FYJU 4B60A 4S1QL 4D0DB 1BQKA 4P59L 4GT7A 3G08B 4K2UH 3RDJA 1QACA 3BD4A 5DJZB 5CD5D 5A43C 3VG9C 2DQGH 5GISH 1XH1A 1HEZB 2C3VA 2DPKA 2GUOB 1BQHA 3IMUA 3QDAA 1SXCA 3S96B 3ZKSD 1IC4L 1B9KA 1SVCP 1E8WA 1Y5IA 3IU3B 3DUSB 4ODTH 1PYWA 4DUXA 4M9PA 3QFDA 3COOA 4XVOA 4A2EA 3QZMA 5DD1H 4X99A 5A2IH 2B77A 4F27A 1F4WH 2FIKB 3S2AA 3CVBA 2Y36L 3TV3H 4LCUA 4K3DL 3UCRA 2ZXBA 3ZMRA 3EJQA 4YDVB 5KVDL 5C08A 4EEEA 3D4GA 4RISH 4TTDD 4UI2A 4DNLA 2WXRA 3U30C 2CRIA 3AG3B 2JKIS 4LP5A 1EEYB 4J1UA 5DYFA 4N0CC 2WLNA 1AH1A 1NA8A 1PY4A 2WXPA 2VMFA 3FO1B 2AXFA 4KO7A 1ZD6A 5AYTA 3CLEL 3ARTA 3QQ3B 4JHVA 5E4AA 5EUOB 3HUJB 5K9OB 4OFDA 4MMZC 4N1CA 2L7QA 5I8KH 2CQVA 4P9HC 1KN4H 4L8DA 2FL5B 4G8FA 3IETB 4ZPVA 5AOLA 1TZAA 3S4SA 3NK3A 1CVSC 1TTBA 3K6OA 2W94A 3FHAA 1DUYB 1FUNA 4LSSL 5DJDA 5F6IC 4BQ9A 5AAPA 3MA9H 3R8BB 4YJZL 2HYMA 5IOPB 1SIWA 1M2OA 2J6EA 3VXOA 5BXFA 4N8PA 1AZNA 1Q72L 5I1LB 2HFEB 2WYTA 3ETBF 1BEXA 4FHKA 3GRGA 3NP4A 3GRWH 4P07A 3A5VA 3CV5A 4FFYA 5FGSA 3RWHA 5JUEL 1FNEA 3ELAT 4KKCC 3UYRL 3WG7B 1FH5L 3G5XB 2BVOA 5ACZA 3VXUA 3IJEA 3UO1L 4HC1L 5K33A 2NR6C 3T65A 1MCOH 2NMSA 2OBGA 1DVZA 3GSNL 4BK5A 1LEKB 3U30B 2GY7B 3VD0A 4JO1H 3QDJA 4IMLA 2BVEA 1H6UA 4D7BA 1BVNT 2F5AH 4JDZA 1R3LB 4DGYL 4JVPA 2WHVA 4DN4L 1FL6B 3CVCA 3MBXH 4QYOA 1OPOA 3WTSA 2PPEA 1BOYA 1NLDH 4MMZB 5FYKH 1E6JH 4ELMA 3HS9A 2AJYL 5ICUA 3HC0B 4DESA 5F88A 4NCC1 4NM4H 1NCAL 2ZYSA 1IGCL 1SN2A 2WJ5A 1URIA 2QPEB 5KYWB 5F9JB 2I9TB 3O9WC 1KTJA 1N59B 2B59B 3QUGA 2ZCKH 1MVUB 1YC8A 5IVZB 4QRBA 1VACB 4OD1L 1DQLL 1BZQK 5EU7E 3REWB 5B38A 3HPLA 4YDZA 1T89C 4GXVL 3U82B 4YXKL 2NYYD 1KENH 1JVOA 5ICZB 2BX5A 3KJ6H 1KZQA 3BZFB 1HL5A 2WTPA 2IWKA 3G08A 3H0TA 5DJZA 5D1ZB 5CLTA 2NPLX 1RJLB 1GSMA 2GUOA 2PETA 3ARDD 4B0MB 2J8UE 5EU7C 3BRFA 3HG4A 1FGVH 5TDNB 3NCXA 3S96A 1KJ3L 4NO2B 3IF1B 1OWRM 1M4KA 3K2UH 3IU3A 3DUSA 3RAJH 1W6LA 3DI2B 4B3VA 2P5ED 1U8OB 2K8MA 3WEBA 2NY0D 4XZUB 4DOHE 2YAMA 4TULH 1E4KA 2EACA 2FIKA 3BAWA 4XCCH 2VPXA 3VVVA 5IB1B 4GO8A 2O5YH 2G5BA 3VXSE 3UADA 4RRPM 3ETBJ 2ED7A 4YDVA 1G7JB 3MRDB 4HSAC 1JGUH 2AEQL 2APTA 4PJ8D 4GG6B 1EGJA 4PJEE 4R4ND 4LCYB 3QEGL 3BMWA 4UBDD 3MJ6A 5CM1A 1FSKC 4QHPA 1NGZB 2F74A 2FUQA 3FO1A 4M02A 2C1OB 4N2KA 5L4JA 2ZWZA 4HCRH 3QQ3A 3O9WB 5EUOA 5EU4B 3CXHJ 2YWZA 3BDBA 4FFZH 4NO0D 5EO0B 2V3DA 2FL5A 1FNGB 1YYML 3FRPG 3N91A 1ZIBA 2DD8L 3SGDI 4PUBL 2V6HA 3BIKB 3CBJB 3UEZA 4NUMA 4EDXB 3B3BA 4RH4A 1WZLA 2XBTA 1DUYA 4YSAA 3S7GA 1OXYA 4GQQA 1GJUA 4MQXC 2AS5M 2ZUTA 3GS4A 1D6VH 4WTXA 5TF1H 3LXUX 4NZFA 5I1LA 2HFEA 2DKMA 3H9YA 3NAAL 3NCJH 4PJFE 4TPRH 5ISZD 5T5ID 1IIIA 3CD4A 1IFHH 5CWSB 1AC0A 4WTZA 4MASA 4GINA 1YUHA 3ARVA 1ZT1B 2VLJD 4RFOH 4FL4B 5T1KD 2UXGA 5DDHB 3IXTB 1G6RH 3BVDB 1XEUA 2HSIA 3G5XA 4G59C 4AKQA 1S7TA 1DZBA 4I3GA 3MNWB 2HXAA 3D52A 4JDTL 5DWUH 3UGUA 5A40E 2J8UB 1PF3A 5DVKA 5DLML 1JZEA 4L05A 4F24A 4FA7B 3ZTJG 4ANKA 3NCYP 4JKMA 1LEKA 1CBJA 4BFKA 4JDVB 3V5HA 4FZEH 4N20A 1FSKB 3L5IA 1FL6A 2R0ZH 2F1BA 4QIRA 2AJXH 1G7QB 3VDCA 4XOEA 1EAQA 3VXSB 4MMZA 1E6OL 4FQIH 3MRJB 2KHAA 4WI9A 3PAZA 4WHYG 1BVLB 3ZHDA 4QOKB 1CLZL 2YAFA 3HC0A 4PJEB 1I3UA 1WEJH 3U4EB 5CJOL 5JHLL 2F5BH 4FZ8L 2KLSA 1VESA 1H19A 1DEDA 4UTAL 2P45B 3WENA 5KYWA 5F9JA 1E67A 4KDVA 5CIPB 4CW1B 2I9TA 4Z7UF 1N59A 5GGVL 4AYGA 2B59A 1INEL 1MVUA 1DE4B 5IVZA 2JIXB 1MPAL 3M8OH 2JKTM 5E99L 2X09A 1BMGA 1M2VB 3LVEA 4F58H 3REWA 4JJHA 2E6QA 5CFHA 1KELH 4CVUA 3FQWB 4U6TA 2MCG1 5CGYC 2FO1A 4IEFB 5CEZD 5ICZA 3N44B 1EEUA 4IJTA 3BZFA 4OJDH 5ESQB 43C9B 5I5RA 4XNUL 3CN0A 1E5VA 3X2GA 1RJLA 1ZE3H 2NR6A 4ADGA 5KSAD 5HYFA 4QXUL 5DC2A 2UV3A 2OYMA 1QNZH 5GLFA 4NO2A 4OGYL 3HNTH 3IF1A 5IFAL 4YBQC 1NFKA 1UHDA 3HN5A 4ZMXA 1G4RA 2B4CL 2PR4L 3HC4L 1U8OA 2VM9A 1U33A 4XZUA 5CS7A 4EO5A 5E00A 2F53E 2DI8A 4AI7A 5L6YL 3SE8H 3P69A 4PGJA 2Q76B 3UC0H 2BHZA 3A3YB 3AQDA 3KBFA 1FGNH 4FYQA 2VDPH 2QTEA 1G7JA 2PYED 5I1GL 1IBDA 3MRDA 1QSFE 3B5GA 1MUJB 4WI8A 5JA8B 4GG6A 1AG6A 1ZSHA 4LCYA 2YO3A 4GW4B 3KLHC 4R7VA 3PDOB 2VLKD 1NGZA 2W0FB 3T2PA 3GTMA 3U79A 2C1OA 1T7WA 2GSIB 5GRZA 2N7BA 2E4FA 3O9WA 5EU4A 3L3IB 1PKQE 4L4TB 3NACH 1GOFA 2O26U 4PS3A 5GRJH 4JE0A 5EO0A 2VSKB 3LKNB 4QGYA 1FNGA 3IPEA 3KW8A 5AVSB 3MROB 3BIKA 4PWEA 3IR6A 3IFNL 1UM4L 4EDXA 1T89A 4ZO7A 5TPWL 3DDFA 4QJ4B 3AS1A 4LU5L 3IGLA 5J6SA 5BUAA 1VGKB 5C07E 3DVFA 1HINL 3C08L 1A8JH 1MCLA 2GJZB 4D9QD 4UAOB 3GLZA 4NJAL 2WZPD 5C09D 3GZOA 5CWSA 2BC4B 1ZT1A 3RYMA 5AWNH 2BOLA 1N5YH 3TO4C 3WEMA 5DDHA 1SXBA 4A7SA 2FATH 2ZPKL 1VJSA 1FVDB 2NSQA 2RA1A 3SDXE 3MNWA 2J8UA 1YA5A 1I3RB 1RZQA 1ZCRA 3HC2A 5M94B 4M62L 4Z18A 1FYTE 1EQWA 3P02A 4KBPA 3OKLB 4XCYA 4O5LH 4JDVA 4PW9A 1JNJA 3CFQA 2WZAA 4WCYL 2F15A 2WXOA 3UTPE 2NXZC 3MFGB 2NY7H 4LPUA 5AZ2H 2D3NA 3B2PA 5CCGE 4HUXB 1BVOA 1OTTC 3NCYS 1G7QA 2GPZA 2KMWA 3VXSA 4LKXB 2Y3NA 4CGUB 3MRJA 4IRSC 3FSZA 1BVLA 2FQGA 4FI7A 4QOKA 2AQTA 3HZYA 5KANG 4O00A 2A69D 2DYPB 4PJEA 3SQOL 2IBZY 4IKJA 1ICTA 1INDH 2GI0A 5FDYA 4GP8B 4IKKA 4PREB 1FC2D 1PKQB 4TVPH 5CIPA 4CW1A 4X5RA 1JNNH 2OJZH 3CIQA 1DE4A 2MQ3A 3TC9A 3TGXA 3QJSB 4XODA 3L5XL 2Y1YA 1PEZA 4N2HA 1M2VA 1Y18B 3HB3D 1EHXA 3B4NA 3FQWA 1TYRA 4UQDA 3TO4B 2A6IB 3P2TA 5ESQA 43C9A 1UWGL 1XF5B 4PJFA 3MCYA 2MOVA 2FH6A 3QG6B 4D8PA 2ZG2A 1UD3A 2I69A 2ZNXA 2D3JA 4OQTL 1KACB 3P1VA 5I24A 4M48H 2VDKH 4GQRA 3I9PA 3V9CA 3WGUB 3ZYIA 1TVHB 2QADB 4UM8B 2NXZB 2YAEA 3HAEH 3WE1A 1K4DB 1AOHA 5E0FA 2W9EH 3I6KB 3IXAB 5DVPA 2IFFH 1E90A 2Q76A 2VL5B 1RL1A 2X4UB 4LOEA 4OTXH 2PYFB 1GL4B 2WO2B 4QUOA 4ZYKB 4RMBA 2ATAA 1SJEB 3QGVA 1MUJA 1NJ9B 2HFGL 2WUBL 3T4AC 4GW4A 4XMVA 5LDSA 3T2LA 3PDOA 3QUXB 1VRSA 2WNXA 5C0JB 1QQDB 2W0FA 5HYEA 4IBVA 2GSIA 4OCRH 4J12A 1JGLL 3L3IA 4L4TA 1L9NA 1KG0B 3B9EA 3MOBH 4DZ8A 3LKNA 4I0KA 1R3IL 3QIUC 5AB9A 3U4KA 1ZYRD 1XTMA 3RL2B 3X11B 3AS0A 1PYUB 1USZA 5H4YA 3MROA 1WAAA 3REVB 3ZTCC 3HFML 3IDJB 2HRPH 4EVNB 4ZT1A 1AQDB 4WUUD 1B88A 5HSFA 1SXNA 3ESOA 5D8JH 4ZMPA 4CN4A 1H6EA 1VGKA 4XP5H 2VR9A 3Q1SH 4GKNB 5FHBH 4AL8C 2DIBA 3PHQB 2GK2A 2GJZA 1HS6A 1G7MB 2EIMB 3AWEA 3TA3C 1G43A 2BC4A 2VRKA 1AI1H 4MXQC 4HGWB 4WRLA 4QLRA 2RBLA 4JUSA 4KK5C 1G94A 5EFIB 4EOWH 2IGLA 2X9XA 1FVDA 1FCGA 2A4CA 1LXMA 2YXVA 3CHQA 4X0NA 3UMNA 3UJTL 4BSJA 1BVNP 4CKQA 1I3RA 4ZNEE 5CEZL 3QDMD 4OFIA 2OMZB 4N6QA 5FOBB 3OKLA 2R29H 2W5PA 1SLVA 1Y6MR 1FP5A 3RRQA 1E8YA 3T4AB 4DAGH 2KLTA 4W9JC 1HJBC 3W11C 5BOZG 2DTMH 2J1ZA 2K3HA 4OQ1A 4R4FL 4HUXA 4P48A 4QXVA 2CRMA 1J05B 3QEHB 1II4E 3Q2CA 4LKXA 4AEHL 2J88L 5C6TH 1OANA 4HXAH 4JG1L 2BH0A 3DV4B 2DYPA 4OIIL 6FABH 5I15H 4M6NL 4ABVA 1L9TA 4JB9L 35C8H 4PREA 1HZHL 4OIAA 1PKQA 5TFSH 5GGUB 2D3LA 5DD3H 4Q56A 2FRGP 1PX8A 2QPDB 2J3SA 3BKCL 1BZEA 2NNCA 4HQQL 4LCWE 3LOWA 1HWHB 3M88A 5B21A 1Y18A 1QFWI 1HCVA 2ZWSA 4K2UL 1NOAA 2Z8SA 2BCKB 4UT6H 3TA3B 1HAWA 4JKWA 3BN9C 3OB0H 5GISL 2VMJA 4AX3A 3TO4A 1RP8A 1RUMH 2A6IA 1Y07A 4KNTA 1XGTB 4JRWA 3GMOB 2JIRA 1EFXD 3IGKA 1XF5A 4KDWA 4XX1G 4ODTL 4Y5YC 1XEDA 1L9MA 3QG6A 1DBBH 1I1FB 2CNYA 5T5MD 4X5WB 4Y9EA 5DD1L 1CFBA 4JP6A 4PVMA 4F8PA 1F4WL 3NRFA 1ZS8A 2KDGA 3PJSB 2QFRA 1GGCL 3TV3L 4B5EA 1AQKH 1TVHA 4UM8A 5GS0L 1K4DA 4RISL 3CSGA 4Y4HB 2E2HA 3I6KA 1JSYA 4PPTA 4XNYH 5JLZA 3FONB 4J27A 2X4UA 4ZYKA 3UTSE 4BA0A 3VRIB 4WSGA 1SJEA 1KCRH 4LPCA 4I9WE 5I8KL 2PCXA 2YQBA 3QUXA 1RUQH 5C0JA 1KN4L 1QQDA 4KU1A 3QZWG 3KJ4C 2J7LA 5D7JB 1KB9K 1B6DA 1KG0A 1O9VA 4AVRA 3E3QE 1E5ZA 4W6WB 4KZDH 3RL2A 3X11A 2VXQH 3REVA 3MAWA 5DD0L 3IDJA 3HE7C 4EVNA 1AQDA 2AE0X 1KBVA 1CICC 5EN3A 5EB9A 5B3JF 4YSDA 4ZXBB 3GRWL 5IP4A 2A4ZA 4GKNA 4Y5YB 5AZEH 4PYGA 4XMKH 3E3QC 4DHLA 1IBHA 2P8LB 3OL2A 4W9IC 4Q58C 2AJUH 2YOCA 1XTLA 2IDUA 4M4PA 5CN1A 2APWA 3BVUA 1G7MA 4MKMA 3T3MF 3OKYA 3V9EA 1MCOL 2CKBH 4HGWA 3BWZA 1J18A 4RNRB 5EFIA 3MRBB 4F7TA 1IRAY 1EZVY 2VDLB 4JO1L 3MV9B 1MCRA 1N6VA 2BP5M 2X6MA 3FRPB 1USQA 3BP7B 1AE6H 2F5AL 2AZUA 1WVZA 4KKRA 2OMZA 2HVJB 3KH4A 1IAMA 5FOBA 4DO4A 4P46C 5HVFB 1NLDL 1B4LA 1NH6A 1D9KD 3T4AA 1S9VB 1G0XA 3TN0D 5DS2A 5FYKL 4EZKA 3MV8E 4KRLB 2ZOKB 1A21A 1D5ZB 4I8DA 1J05A 3QEHA 3D33A 3S34H 4NM4L 5ABZA 4N25A 3ZQ9A 5GSVB 3DV4A 1PKOA 2CG9X 3HE7B 1IFRA 3GSVB 5IY5B 1EZVX 4GUPB 1CICB 43CAB 1L9SA 3PAVA 4KGJA 5GGUA 4J3OC 2ETWA 5KBNC 2F2HA 4OZFG 2NY6C 3OF6D 2PUQT 1ZVNA 1MXDA 1KENL 4PRID 3KJ6L 2O6EA 4LBAA 4LIQE 5CR8A 3IJYB 4KVNH 1PCXA 2BCKA 4KDTC 3TA3A 3BC9A 3E9UA 4KX7A 1GYVA 4OVUA 1FGVL 3EADA 2LU7A 4G70B 3P9LB 1XGTA 2IFGA 3GMOA 1B9ZA 5F3FA 3K2UL 3LRHA 3RAJL 4K0OA 2IH3B 1DCEA 5EOCJ 4LVEA 3DGDA 3B7YA 1I1FA 4X5WA 4GBXD 4TNWK 3C2AH 4K9EC 1VZGA 2GKIA 4P46B 4TULL 3LAFA 2JA5A 3TNMB 1KJ2B 4FX5A 4XCCL 3HHRB 4ICXA 4TSBH 3SUJA 1AXSB 4AJYV 2XWTB 3P3YA 3ZQXA 1JGUL 4QAWA 1TZ8A 1XCQB 4TVPD 4Y4HA 5IB4B 3HJEA 4PSPA 3FONA 4ZNEA 1AJ7H 4JFPB 1K6QH 1WYJA 3PQYD 4HFWB 3VRIA 5A3IC 2BK8A 4HCRL 5DURB 2NQCA 3NCBB 1CGXA 3MV8B 4RRPG 5EPPA 3UPRB 4FFZL 4X6DE 3DJSA 1NBZB 1ZMYA 4DERA 4DK5A 4X7FC 1P5VB 4R6UA 2XXFA 5FYLE 1OAUH 3NJIA 2I7OA 2WLMA 5D7JA 4HWEH 4C2MA 1JNLH 1PCSA 2IV2X 1MRFH 2C9QA 2NY6B 1YJDH 1UFGA 3A6BH 3QAQA 3KPPB 3BX7C 3MNMA 3B8SA 5TGBA 3PIQA 1D6VL 5TF1L 2Y6SC 3NCJL 4TPRL 5D6CB 5EBWB 1IFHL 1RMFH 5B7EA 4ZXBA 2C26A 2EC9U 4Y5YA 5JW4N 3QO0B 3S9DB 1ZLUH 4BZ1H 4RFOL 4AH2B 1NC2D 2P8LA 2J6WA 3QWQB 4JX0A 3RB5A 1RFDH 1SFOA 3AXIA 4WLCA 3A22A 1TTUA 3CZBA 4AEFA 2BCMA 5DWUL 3QUHA 3AVEA 2E2IA 2D4FA 5LG1A 4PS7A 3IDYC 1U8IB 3KDMB 4RNRA 3MRBA 4HKZB 1JXKA 3MV9A 1J0HA 2QMJA 4FZEL 4XBPB 1KPRB 3BP7A 2D0FA 5SWZD 2R0ZL 4PJHF 2HVJA 2J55A 2AJXL 4B9FA 5CSZB 5T3ZD 1S9VA 5BRPA 1CDBA 4FQIL 3E8UH 1EVUA 2ZOKA 3L95B 3NIGE 2BVTA 4HPOH 5K9JH 5J11C 3ABZA 3HBPA 3ARUA 1V5JA 1I7RA 1WEJL 3MPCA 4MX7B 2EEDA 2F5BL 2J44A 1XZ0B 2VXSH 4NI3A 2FQFA 2X9YA 5AL0A 5CF3A 2AK4B 4HMCA 2ZOWA 3JWDC 4ZMVA 3FQTB 5D1QB 4OM1H 1RURH 4PJBE 1WV7T 1Y0LB 2XQ0A 3GSVA 3HE7A 2VDNB 3M8OL 3HR5B 1CICA 4GUPA 43CAA 1K2DB 4I85A 5K39B 4F58L 1VFBB 3PPSA 5C0RH 1KELL 3TBBA 2RGSA 3R19A 2AEPH 1I1YB 1QFWH 2N56A 3L9RB 5J12C 3SCMC 4P5TD 5CBEA 2XBDA 1TUPA 1IQDA 3BPCB 3CN4A 3IJYA 2XZCH 1E4XI 2DLIA 3I9IA 3ULVH 3IWUA 2JWYA 3A4DA 3MKKA 2C4FT 3IDYB 2J5LB 3UTQB 4LT7A 3KPSD 3P9LA 3FFCD 2Z7UA 3IPFA 3HNTL 3RTQD 4KH9A 4BFEA 4NQVB 2IH3A 3JXAA 3UDWC 1NUNB 4LPTA 3ZKXC 1GC1H 5IESH 4P46A 4XPTH 5AW7B 1YHPA 3TNMA 1KJ2A 4R3SB 3SE8L 2NT1A 3IS0X 3UC0L 1MF2H 3QFGA 1THCA 1FGNL 1GY2A 3SDAC 1A1NA 1AXSA 2VDPL 2YD2A 2XWTA 2MCMA 3VFNB 4E68A 5I1DB 1XCQA 1T22B 5IB4A 1ACZA 4X7DC 2QSQA 4DO5A 2DMRA 3QNXB 4Q7DA 2Q3ZA 4MNGB 4JFPA 4HFWA 3N41F 4LRNH 2CE6A 3ZJAA 2XKSA 2X4OB 2YUWA 3L7FB 3NACL 2IF7A 5GRJL 3MV8A 1B3IA 1J8HE 1IFGA 4JG5A 3UPRA 3LKPB 1KB9J 1NBZA 1P5VA 1BYNA 4IRZH 1H3WM 4NZDA 3EBGA 4E42B 4R7XA 2BY0A 4PSRA 1O0VA 1T1WB 2OL3B 3BP4B 3OV6A 1SBBA 2KBGA 4WF7A 3HMXA 3SCMB 2WQUA 2X4SB 3B37A 3QYCA 3KPPA 1P5UC 1JNHA 4IBQA 3U7AA 4KDTA 3WXVH 5KS9E 3LIUA 4GH7B 4M8QB 1LHZA 2Q9OA 2XKNB 2DM4A 5D6CA 2PPFA 4OJAA 1MRDH 2VM4A 5EBWA 4DFHA 3MQIA 3GBLA 4CU6A 3CVHB 3QO0A 4G3YH 4Z7WE 5AWNL 3FCSB 4AH2A 3ZKXB 1QWNA 1N5YL 2H47C 2FATL 4P4KC 1X7QB 1WWBX 4DO6A 3KPRE 1UM5H 2FVNA 4Y4KC 4KKAC 2GBVA 2GJRA 2HG0A 3SDAB 5E1AB 1U8IA 3FO2B 2FDBP 4H1LG 4AQAB 2OMUB 4OY9A 4O5LL 5HI5D 5EG6C 4XBPA 1KPRA 3QFJB 5L8JB 4PVLA 4EIUA 3PY9A 2NY7L 5AZ2L 1AZVA 1UD4A 2R0LH 1GGIH 2WJ7A 3ZDXE 1PY0A 2RCSH 3GXFA 4A7GA 3ZPDA 4KRPD 3DJZA 3L95A 5BV7B 2EDJA 3DO3A 5B22A 4XX1E 3HC3H 2H4EA 2QDWA 4HHAB 4MX7A 1INDL 1XZ0A 3ZRFC 2AK4A 2MHAB 3L5HA 2CZNA 2VKWA 3RG1C 4RFEB 3FQTA 4TVPL 3FW6A 4ZOCA 4ADJA 1P5UB 5DRXB 5D1QA 1CXKA 3L08A 3ZVVA 1LP9E 2IDFA 1KCVH 1E8ZA 3SBWC 3AADB 2OJZL 1AGBB 1JNNL 1Y0LA 1NOFA 4AWJC 3HR5A 5IGXH 1K2DA 4GT0A 1MCEA 5K39A 2COVD 1VFBA 2FWSA 1SDDB 1A5FH 3HI5L 1I1YA 4M7ZB 3QXTA 4P4KB 1NIEA 3RKPA 4AUJA 1ZLVK 4QLWA 5C70A 1BQRA 3BPCA 1NDMA 4G5AA 3K5SA 3WHE1 2Z64C 5TDPA 1EZSA 4JW3A 3UTQA 2W92A 1PFCA 4BKTC 4CAGA 2BPBA 1FDOA 4NQVA 3NEOA 4M48L 2VDKL 2XNAB 4NNPH 5F89B 1JHLH 2RH0A 4X5PA 5GGQH 3VI4B 1E3ZA 1EWHA 3KPRB 2P24B 2W9EL 2HB0A 4YHLH 4R3SA 2IFFL 4OZHF 4QKTA 5EF0A 5KG9B 3CSYB 1FFQA 2Y1ZA 3R8QA 5I1JL 1RQ5A 2LLGA 2ZCLH 3ESNA 3PE9A 4IKLA 5IK3B 4PHXA 2Z8VC 5C0ND 3HG1E 3VFNA 5I1DA 2K70A 2APVA 1T22A 4KC3B 4NUPA 5GRVK 5I1KH 4FQXB 2BFVH 2YD4A 5JR1H 3QNXA 2PP8A 4JO2H 4MNGA 5F2FA 1CYGA 2EDFA 4OCRL 3ZDXB 3BLPX 5KSVB 3MTRA 2X4OA 3ZHKA 3L7FA 1X5FA 3P0VH 1ET7A 2UZYB 3TJEH 3HZKB 3LKPA 5I1CL 4BM7A 4HCIA 1V55B 3EH4B 4E42A 3MXWH 3QJHB 3V10A 1T1WA 2HRPL 2OL3A 5DHVB 2H0EA 3BP4A 4PJGF 4LLMB 3SCMA 3N40P 2OR9H 2X4SA 5JIHA 5D8JL 1LP9B 3X14B 4XP5L 3Q1SL 2BVUA 5FHBL 1FO0B 3FOMB 4M7JH 4NQSB 4AIEA 5HPOA 2XKNA 5MEOB 4P5SA 2CO3A 3OQ3B 2P48B 4K3EH 1JJUA 4XMXA 3GSUA 1F5WA 5G2NA 4IOFD 2D4DA 3M7FB 3FCSA 2R2HB 3T2OA 4KFZC 1ILUA 4EOWL 1HYRC 3CXFA 2N59A 3QZWB 2YD0A 3SDAA 5D9SB 2ZCHH 5E1AA 3FO2A 2ED8A 4AQAA 4PGBB 2OMUA 2R29L 4JRYE 2VYRE 4DAGL 4FQJH 1UCTA 5D7IB 1ZV5A 3N40F 1DJWA 4FNPA 4NX0A 5EEUA 4IS6B 1MJ7H 3V0JA 2C45A 2CHWA 4TYUA 3QUZD 4EKJA 5FXCH 1R34A 4WI4A 5C6TL 4HXAL 2QSCH 3T8XB 5JW3H 1OHQA 2OZNA 3NJLA 5H4UA 3AWGA 3ETTA 5I15L 2E7LC 3RKDC 4XPGH 35C8L 1VEOA 3S3SA 2BFGA 1AHMA 4RFEA 5TFSL 1P5UA 5DRXA 1QTSA 2HKHH 2W60A 5DD3L 5D4JA 2Z4QA 4N2EA 4D9RE 1AGBA 2EXYD 4A2MA 1KFAL 4Y7MA 2VGLM 1CVRA 2YS4A 3TBYB 1PZUB 1SDDA 2WXKA 3X2KA 4UT6L 2Z0BA 1X9QA 5KUMA 3CXDL 4ZSOE 3OSVA 3WDJA 2AJZB 1IE4A 1RUML 1E4XH 3IMRA 4P4KA 3TTSA 2BNRE 1S4IA 3QA3A 3TVMD 4CRZA 4Y4KA 3JTSA 2ZE0A 5E2WH 4NKOB 1DBBL 2X4NB 5FTLA 1NFDE 1C5CH 1YY9C 3TJHD 4AYMC 3SKNB 2PWHA 3HKZA 1EK3A 1A9VA 3FSAA 4YSOA 1OARH 2XNAA 3L45A 4Z7WA 5LGHH 1HNGA 5F89A 5HYJE 5LQBH 1AQKL 1GGTA 2PW2A 2NRDA 4N86A 3VI4A 2XC8A 4OF7A 2DWEB 3KPRA 4ZUUB 2P24A 4HG4J 3GSOB 2V5MA 4HLJA 4XNYL 4CN6A 3T1FA 3KZ8A 2Z93B 3JVGC 3CSYA 1LDSA 2FK9A 1VZIA 1TTFA 2BSBA 1E50A 4LVNB 5IK3A 4PM1A 4MS8D 1AACA 5K9QG 2NVYA 1KCRL 1QI4A 4OZFB 3W9DA 1PNDA 2GTWB 1YRKA 4Z77B 1RUQL 3F7VA 3S37H 3N55A 5DRWB 5KSVA 5T3XD 2NYAA 4HLZG 3H8NA 4XO3A 2H3XC 3S5YA 2UZYA 3SBWA 4CVXB 3HZKA 1MFCH 4APXB 1PYQA 4WGWB 4CL7A 1TWCA 4KZDL 3CQZA 2VXQL 3QJHA 3X1BA 3APDA 3P77B 5DHVA 3KGSA 2F58H 2MCPH 2WGXA 2ZAIA 1M3IA 3G6DL 4LLMA 5CNHA 4HH8A 4LSRH 1P53A 1LP9A 3OQRA 3X14A 3QQXA 2VABB 5I5IA 4APQC 1BG1A 1K3IA 1FO0A 3V5DB 3FOMA 4NQSA 3MRQB 4AQ1C 4TN9A 5MEOA 2AJUL 4BQ8A 4UNTA 4FFWD 4JRLA 1ZA3B 4XTRC 5JDSB 2HX7A 4FLQA 2N01B 4J8RB 3FTGB 4L1HA 2CKBL 2R2HA 5TDOA 1ZPLA 2HTLD 4RBPH 4J2XA 1IM9D 3G5ZB 1FL3A 1WZMA 2ID5A 3UTTD 4DF9A 3QZWA 3AXHA 1AE6L 1BZ8A 1NFDB 3CFTA 5D9SA 4IOSD 4P2QB 3OD3A 4QRRB 4CSZA 5GM9A 4UT9A 1RIUH 2WVVB 4PGBA 1SNRA 5D7IA 4PG9B 3TFBA 4WEEA 1CDHA 2E0PA 3QNYB 4IS6A 4JM2F 4ALAH 4MDJB 3MJGX 4D94A 3S34L 2Y5TB 2YRPA 4YDNA 5IBLC 3G9AB 3EH5B 2VDQB 4DQOH 5TK4A 3T8XA 3K4DA 3OR6B 5JA9A 1K5WA 1K4CA 4OV6F 1ML0A 1JZ3A 4H26B 2X89A 2VDOH 3DMMD 4WTWA 4APQB 2F54D 3DXAB 3UAFA 3JTTB 2AJ3A 4AQ1B 2Y72A 3IDNB 1GS6X 1OP3K 1A6UH 4KVNL 1Q1JH 3TBYA 2VB5A 1ZRUA 4IBYA 1I3VA 5ABDE 3RJDA 1HSAB 1JWUB 2AJZA 3WBDA 3B83A 3SE9H 2XDHA 5AW1B 3QHFH 3P0YH 3VFOB 4AAYA 3DYOA 2AQRA 4Y1SA 3GPSA 3CHSA 1UUNA 1NCCH 4MHHG 3TT3H 3MBEC 3C2AL 3SKNA 1ADQA 1LNUB 1IGJB 2XZZA 4ZG1A 5AKTA 3AY2A 3B9DA 4HJ0C 3GKWH 1K8DB 1NKOA 2W59A 4TSBL 1B3JA 5L88H 4ZUUA 2DWEA 5J3HD 3LPPA 3GSOA 3BEWB 4I2XB 1V7MH 1H8LA 1JZ4A 2Z93A 1HCYA 3HBQA 1C08B 5E6IC 1K6QL 3TT1H 3V4LA 4UOJA 3U1PA 5ADPH 4QRFA 3MRFB 1NCGA 4OZFA 5DZPA 2AMUA 1WISA 2VLRD 3NQKA 2GTWA 2E7LA 3PXJA 4M5YH 2Y3AA 3SJVB 4Z77A 1I50A 4JHZA 3Q8CA 1OAUL 5LCVA 5I0XA 5DRWA 5I0DA 4HWEL 1JNLL 1V8HA 3QEUB 2GC7C 1EPFA 1DANT 4NC0B 1E40A 4CVXA 4EQ3A 4C4UA 4GS7C 1YJDL 5ALBH 3QHZL 4APXA 4NUGH 2J6EH 3A6BL 3OAUH 1W8NA 3P77A 3F8UB 3QBTB 3QEQD 4Z76B 4XN4A 1VFAA 5DK2B 2JI1A 3QRLA 1BEYH 2X6CA 4FFYH 2H6PB 4PW3A 3WTXA 1HHHB 4XR8C 4Y88A 4NQED 1RMFL 2VABA 1FIEA 2RFXB 4FKKA 4V1DB 3V5DA 4BZ1L 3QSKB 2BWQA 3MBEB 1RFDL 1FI8C 4BGDA 1ACXA 1ZA3A 3FL7A 5JDSA 4A7UA 5I6PA 3EYVB 1U8HB 2XV3A 4AITA 3KYKH 4NP9A 4J8RA 3FTGA 4U1NB 3QK0A 5JIQA 5L2KE 4HEME 5SWQB 1IV8A 1OY3B 3Q7JA 1G8JA 3CSPA 1I9EA 3JVGA 4QHKJ 3MOQA 3OXSB 1NFDA 4Y5XC 5E6IB 2X4RB 1DSWA 4J4PC 4QRRA 4NP4H 1EXUB 3LPFA 2WVVA 4C59B 4PG9A 5IJCC 3OR7B 2IH8A 3DTXB 3E8UL 4G7YH 2EDDA 4HPOL 4K7PY 5K9JL 2FX7H 1RI8A 3QNYA 2Z3FA 5LVEA 4MDJA 3D50A 2VLMD 1DDHB 2VXSL 1PQHA 2Y5TA 3L54A 5I9QB 4WW1B 5LAPA 4PJCE 5KAQG 3BIAX 3OR6A 1RURL 4BFGA 4ACTA 2R69A 5AZUA 5KTEH 2KL6A 4H26A 1M6OB 1G0YR 2ADJB 5EIVA 2IADB 5C9KA 4APQA 4K71C 5C0RL 4HUNB 4NWTH 2OYPA 3LZQA 1RZJC 2YXMA 1HXYB 3DXAA 2AEPL 1QFWL 1Z9SB 2VJ8A 3JTTA 4AQ1A 3IDNA 5JMOC 1Q0EA 5T3XL 2X1PA 5HJDA 5ECGA 4K7PX 4RIRB 2XZCL 3FT2B 2ILLA 1TYJA 4PGDB 5EMYA 4EI6B 4OFYA 5FM5M 1HSAA 1JWUA 3TCLB 3W2DH 5GZND 1IC7H 4HULB 3P3TA 2GY5A 3VFOA 1TWFA 4PJ7E 4Y5XB 4CBZA 3NJVA 3L6FB 3B7UX 1GC1L 4JUTA 4ORZC 3EH2A 1IGJA 2XTJE 5DYGA 2LFEA 4QRPE 1RD6A 4KMTH 1MF2L 1HILB 1K8DA 1NAKH 1I7TB 2Y2YA 4NRYA 1UD2A 4FG6D 1EGJH 1I7UB 4BFOA 1P7QD 3MNVB 5IMKB 2VERA 3BEWA 4I2XA 1QWHA 3CFDB 3UJJH 5I66B 3MXVH 1C08A 2OTWB 4ZO8A 3MRFA 3DTDA 5I6KA 1IJNA 1NTDA 2YD1A 2MTAA 2OMXB 2Q7YB 3QUMB 3SJVA 5J4MA 4FRWA 3RWGB 4BFJA 1F86A 1DMSA 4M00A 4IRZL 4UYPA 2FLMA 3V4UH 2XI9A 3MRRA 4L29A 3PV7A 5DSCB 2VH5H 3QEUA 4K71B 1T5XB 2WV3A 1HI6B 4U6HB 4M56A 3UAEA 1IO4C 5F1KC 15C8H 1J8SA 3EFDH 3KLSA 4XPFH 2CJ3A 4PJCB 2A38A 5F7WC 4I0PC 3I84A 1SLXA 1BM7A 2X1OA 4MCNA 4ISVA 4Z76A 3C09C 4FTDA 1BW8A 1UKTA 4RFNB 3EJYD 4DKEH 2H6PA 1HHHA 4MRCA 1YCSA 2RFXA 3D4YA 3QISA 1HFUA 4LCIH 4AUYA 5E1QA 3O2WL 4V1DA 1A6ZB 3FUHA 5FM8A 1RJZB 4XBEH 1JYVA 4K7PH 3MBEA 3Q43A 2G60H 1JZDC 4QJ3B 3DSNB 1UM5L 4RESB 5LBSL 2ZUWA 1U8HA 3EYVA 1T4WA 3GMMB 3KS0J 4U1NA 4WO4D 3LKOB 5B1BB 5SWQA 1FFTB 2AZAA 4EQ2A 4PLJC 3OXSA 5E6IA 4QMEA 2HFFB 2X4RA 1DO5A 4XBMA 1EXUA 4FFTA 2R0LL 2L7JA 2AW2A 1GGIL 1A1OB 4P9HH 1TOXA 2NSMA 2RCSL 4PWHA 4OIBA 3ZE0E 2DRUA 1LK2B 1RJCA 5E8NB 3OR7A 4G6KH 2C3WA 3DTXA 3GFUA 4XNUH 2V17L 3EJJX 4R2GD 4KK6D 4ELKB 1BV8A 4KX8A 4LPVA 3HC3L 1HX0A 2CA3A 3VDBA 1DDHA 3LZFH 1BBDH 3WI9A 5FM4A 5FC9A 4WW1A 4GAJH 3F65A 2E7ZA 4I0PB 2JLPA 3U4AA 4M1DH 5KYNA 3IR5A 3ILDA 1GHFH 3C09B 4ONFH 3BUTA 3TIEB 5IGXL 1M6OA 3F7LA 4YK4B 1NWOA 3FRUB 2ADJA 1TITA 4KRMB 2IADA 1L5GB 1A5FL 1T83C 3AB0C 1HE8A 2EIDA 1HXYA 2OR8A 3X3GH 1PZAA 1D5IH 1Z9SA 2NY2C 4FS0A 3O6LH 3GEWB 5E6SB 4FERA 1JAEA 1VF5C 4KK9C 4UTBA 4LKCB 5DXWA 4ZOEA 1JPTH 4MQ7B 5KSBB 4RIRA 3QRGL 3VGHA 3K91A 1AO7B 4E41D 3FT2A 4IGBB 1NCWL 4PGDA 4EI6A 4LQ1A 3TCLA 4U0QB 3RFZC 4KVCH 2WLZA 4ZMLA 5D1XC 1MHPH 2J1KA 4NNPL 3OHXC 1JHLL 4OLEA 4Y5XA 3HU2A 3L6FA 3UAAA 2YPVH 4J4PA 5GGQL 1T0OA 2O6PA 4YHLL 4AGQA 3O41B 4GRMB 3QAZC 4NENA 2HLAB 1HILA 1I7TA 4OUOA 2C9UA 1JF5A 2ZCLL 1MY7A 7FABH 1I7UA 1V3KA 2CO4A 3MNVA 5IMKA 3MLWH 1OK8A 4LXFA 3CFDA 5I1KL 5JR1L 1DVTA 2BFVL 2IG2H 2NXYC 5I66A 1YEDB 4JO2L 3IK2A 2OTWA 2Q3AA 3WDIA 1T4KB 1CGSH 1X5IA 3QS2A 4FTVD 2EE3A 4H0GA 3P0VL 2G9KA 2OMXA 3NQIA 2Q7YA 1TTGA 3TJEL 4PJIF 3VFGH 3QUMA 4G43A 4JDEA 3RWGA 3NJKA 5DSCA 2VCOA 3ARDC 3MXWL 5CEXB 4U6HA 1T5XA 2BVPB 1HI6A 2HJFB 5GSRB 2ZWNA 3QRFM 4X4KA 1K5NB 5AVYB 2NY2B 1G9MC 4CSSA 3WY3A 1TMOA 2OR9L 4PJCA 1IL1B 1F3JB 5I23A 4RGND 1UXSB 1E5AA 2NY0C 3TV8A 1FZOB 1P4LB 4N2GA 1MJ8H 4M7JL 4QRUA 4OZGF 3EYQC 3RFZB 1YECH 3VTMA 5D1XB 1XSJA 2X5PA 4K3EL 2HLEB 3VNZA 2XG4B 3OHXB 4PJ8C 1A6ZA 1I8MA 1RJZA 4YE4H 3V55A 4U7MA 4PHZA 5HDBF 1AXIB 3MLPA 4R26L 3C87A 5DMIH 4DKTA 5MHSD 4IBWA 1DVYA 2P52A 4AYSA 3MNZB 2ZUQC 3DSNA 3H2QA 2OW7A 3LHAA 3QAZB 1FG2B 3GMMA 5IQMA 2ZCHL 2CUMA 3LKOA 5JORB 2YRBA 2Q3XA 5ADOH 4WJ5B 5HVHC 4OKVB 1PGRB 3MLSH 5ISZE 4FQJL 2EECA 5CJXC 2NXYB 3GJFA 3GTKA 1Z0MA 1F4HA 2X7LA 3FU7B 4E9SA 3FQYA 2HFFA 4H25B 1XH2A 1E28B 1MJ7L 1R1CA 2VLJE 1PBYA 1A1OA 2OMYA 4G80A 2J2ZA 3CZGA 4MNQB 2E7MA 1LK2A 5E8NA 3SGKC 4QIWA 1YNND 1DFBH 4ELKA 5JW3L 1PLAA 5A16B 3LDBC 3VA2C 4PB0H 3ECWA 4XPGL 5CIPH 3VXUD 2CGYA 4R97C 4P9MH 2D8KA 3KLDA 4LAQH 5E9DE 4I0PA 4PJDE 1SUJA 2HKHL 3SDDB 1IKNC 3RVTD 4PJAF 2ZWYA 2L7EA 3ARYA 4XAWH 4W9ZA 3TIEA 2AC0A 1SHMA 3QDJD 3FRUA 3VFMB 1JK9B 1L5GA 1MVFA 2XQYA 4P0DA 3LJ3A 1FCCA 1XF1A 2CPUA 1FG9C 4JZJB 5EIIG 1KF9B 2DMGA 4WI6A 5I71C 1N4XH 3DBXB 4L2LA 1ROCA 2V45A 4LKCA 2FO4B 1I8AA 5KSBA 2ZUQB 1AO7A 1GY1A 4IGBA 4E9WA 3FZUD 5E2WL 3RGHA 4RGMC 5AB2A 1C5CL 3NG5A 3PPEA 2F1EA 4KO9A 5HVHB 5BVPH 4WGKA 4YL4A 1EJ8A 2CO1A 2JJSC 1OARL 3DROB 5LGHL 5LQBL 1ED3B 2ENQA 4HAGA 2IWFA 2CAKA 4Z78B 1BF8A 1IBFA 1XGZA 4P4RB 1U3ZA 3O41A 4GRMA 4PCKA 2HLAA 5FUCE 5G4NA 3T0XA 1MLCA 1MOEA 3LDBB 3CZEA 4WSKA 3NJHA 1TWHA 1YN7B 1SHSA 2ZX6A 4DWHA 1YEDA 4H8HA 4R97B 3S37L 1T4KA 2X2YA 3FFDB 5DFVC 2EUWA 3S3JA 5C2UB 4GAYB 3JSSA 5FUCC 1MFCL 2GJ6E 4FJYA 3X2IA 5JOFB 5CEXA 2BVPA 1T83A 2HJFA 5GSRA 1T5WB 1TJMA 2F58L 4XNDA 2PYEE 3NTCL 2XWDA 2MCPL 1K5NA 2CLZA 3SZKC 1ZLSH 5BO1H 1ACCA 4I1RA 5E9DB 2FJGA 1IL1A 1F3JA 2EYTB 4LSRL 1UXSA 2VLKE 2YAPA 1FZOA 1O9WA 1OVZA 1WZ1H 1P4LA 3F05A 3IGAB 4KH2A 1QUPA 3VXNB 1F8TH 4TSCH 4RCAA 1OGSA 4RGMB 5JW4M 4FA8A 4KDLA 3RFZA 4LRIA 4CMMB 1XGUB 4Y16B 5D1XA 3GF8A 2LQRA 1YNTB 4YVUA 2XG4A 2EO1A 3OHXA 3VI3B 4MZRA 2TRYA 4OKDA 1DQMH 1NAMB 2NW3B 2VKXA 3QXVA 3MNZA 3K74B 2PN5A 1FG2A 4KJWC 1RLBA 4LLWB 5FWRA 4N4YB 3MGTB 5JORA 3VMOA 3E38A 5J8OA 4WJ5A 1RIUL 2P43B 3EZJB 4OKVA 5E5UB 5DUBA 1FWXA 2XIDA 1HNFA 3FU7A 3Q01A 3Q9PA 3R0NA 5HHNB 4H25A 5DEFB 2YEVB 3G6JF 1E28A 3RJOA 4ALAL 4ZZKA 3FSOA 3VGBA 4ZI8A 3GDBA 4ELMF 1QO3B 2BSEA 3BPNC 1ZXKA 2ZD0A 4N87A 4BHUA 1UZ8B 5A16A 4JGJA 4JAMB 1WWCA 1D7FA 1YMHB 1P4IH 3RWEB 1KFGA 2RJMA 3LB6D 3U2SB 2VDOL 2CGRH 3S3CB 2PXYC 4V33A 5LNEA 2ZWKA 3MX0B 5IW1B 3FCGA 1PD0A 5C0BE 2WTRB 5KVMC 3T8VA 1A7QH 2WLKA 2GJ6B 2J8OA 1MAKA 4ETQB 1A6UL 3C9NB 3NIDB 3VFMA 3QPKA 1JK9A 4N0CD 1EHNA 2HP4A 4OFQA 2EADA 2XIIA 4JZJA 1U4EA 2UVFA 1Q0XL 5CLWA 3T6ZA 1ZWIB 1Q9KB 4L37B 4F15B 5HJGA 3DBXA 3SE9L 1IW7D 1MFUA 5F71A 3RX7A 2FO4A 3QHFL 3P0YL 4KOCA 3TH2T 5AKVA 2JJUA 1NEUA 2Y5QA 4TQHA 4HEPA 2NY4C 3DYMA 4LNRB 1NCCL 3TT3L 4QCIB 4TOYH 2JIQA 3W0WE 4K5OA 3W81A 5CZXC 3DROA 5CJXA 2HX8A 3P2BA 5FO9B 4NT6A 3B7RL 3JUYA 5L88L 1QSZA 4Z78A 4P4RA 4XX5A 3VTAA 1V7ML 3FSVA 5DD5H 2MTPA 3U83A 3TT1L 1ZS2A 5ADPL 3BPNB 4AZUA 5ISZA 4UQ2A 4KKCD 3CBRA 1MWOA 3D4CA 1H8OA 1KLUB 3HB3C 4M5YL 1YN7A 3TFKD 5E03A 3LZNA 3WNKA 4FXGC 4BWWA 5EUOF 2PXYB 3QXAB 3FFDA 1FLTX 4UQCA 5D1ZD 2NR6D 1DQQB 3W57A 5IVOA 2F0CA 5GLYA 1IKNA 1MCIA 1OZUA 3D4ZA 4ZS7H 3PWUB 5ALBL 4NUGL 2J6EL 2DB8A 4OLYH 3OAUL 3DIDA 4FP8L 3ABGA 2DBJA 3F6LA 3VB9A 4AMXA 5JOFA 3JYBA 4AGLA 5D7SH 4JVWA 3EO0B 5DQDH 3VD4A 4E9RA 1BEYL 4FFYL 5E9DA 2EYTA 3I6LD 2WN2A 3V0AC 1OIOA 2XXMB 3A21A 3EYFB 5C0BB 4CVWA 2FEJA 3IGAA 1EZLA 5KJRH 3VXNA 2NY4B 1MN4A 4F93B 2ZP8A 1UZGA 5LAXB 4EN3C 4CMMA 1XGUA 5FTNA 4L0YA 4UQAA 4FQ2H 5IHLB 2JJSA 1YNTA 1E9QB 3VI3A 3KYKL 3EJZC 4GAFB 3O9WD 1MH5B 2EYRB 4GAAA 4PP2B 1NAMA 4YFLF 1FAKT 2NW3A 2JFCA 1BYOA 2KKQA 4HJSA 5MP6H 2OP4H 3MJ9A 4OLUL 4LLWA 3A67H 1MCBA 3MGTA 3W0WB 4NP4L 3DRTB 3ESPA 4XWOD 4DVBB 5ERWA 4JGNA 2X4QB 4JEGB 4NO3B 3SPHA 1DEEB 4G7YL 4L3CB 4FXGB 1WJ3A 5HHNA 4JGMA 5DEFA 2K6WA 2I26N 4V2CB 4HJGA 3RX9A 1ECZA 4YDJB 3ZTNH 1QO3A 4Y19B 2JLLA 3KPLB 1G9HA 4ZOBA 3UROR 1UZ8A 4JAMA 3QDME 1YMHA 4NXKA 5KTEL 4DK6A 3D6GA 3RWEA 2AFNA 4Z7NE 5I19H 3U2SA 5E8DL 2XVKA 5INCB 4AL8H 4A2HA 3MX0A 1PQZB 4RAHA 4AGNA 3LPWA 2CK0H 4NWTL 5IW1A 2WTRA 3F62A 2OI9C 5B3JE 4HISA 4EN3B 2GJ6A 4ETQA 3C9NA 4U4IA 1I3GH 1Z3RA 3I9AA 3LPGA 4P5KB 1XWVA 1GAFH 3GXUB 2D73A 1M71B 4MJ2A 4OGQC 5BQDA 4AE1A 1NIFA 4PS4H 5B1KA 1ZWIA 2X42A 3W2DL 5LN8A 1Q9KA 4L37A 1ZGLB 1IC7L 2IWEA 2FUTA 2VLKA 3VXSD 2VN7A 4HMDA 4HU2A 2YGVA 3ZMNA 1U6AH 3CPLA 4QOKD 2X41A 4LNRA 4QCIA 4O51B 4Z7VE 1JYNA 1WSST 3IN2A 2EAEA 3NCCB 4KMTL 3PHOB 2X87A 1NAKL 5FO9A 1EGJL 1GW6A 3BH9B 4NEHB 2JIXD 3UJJL 3MXVL 4N22A 2CM5A 4JQXC 4GG6F 5ITBH 4HVBA 1MCWM 1NPJA 1Y1WA 1KLUA 4C54A 2P46B 5KBMA 4PBDA 4HCFA 5E8PA 3V4UL 2PXYA 4ABQA 1GIGH 3QXAA 4NHCL 5EZPA 5I1HH 1DQQA 2VH5L 2MOQA 5F9AC 2FX8H 2OA9A 15C8L 1NCHA 2Q1EA 2OI9B 3EFDL 2FLRT 3PWUA 4XPFL 3OZLA 1L0YA 3LMJH 2KQMA 3VD3A 2IDSA 3A4EA 3EO0A 3H9SB 4ENEC 1K72A 4DKEL 4IW4C 1SY6A 3FB7B 1KB5H 1QHQA 3V7AG 5C0BA 3EYFA 4LCIL 5AQ0A 1DDTA 1NKGA 2I27N 4K7PL 4FQPA 1WD9A 2W07B 4WFHD 2G60L 1KIPB 3RUGB 4N2DA 2ZYHA 3T8MA 3FUJA 1E9QA 4DZ8B 4KITB 3TH3T 1DJGA 1JPSH 1MH5A 2EYRA 2VDLH 4L4TD 4PP2A 5FKAB 4WDIB 5FCUH 3KLQA 3O2DA 1WWWX 3GINA 3AREC 2J8UF 3X13A 1WK0A 4KOBA 4Q9CA 3W0WA 3C6LC 3DRTA 4DVBA 1OT2A 2VMCA 4P9HL 2IPUG 4JJ5B 1OF0A 4NYLA 5CGYD 2A6DB 2D0GA 4FNLH 4G6KL 1HE7A 4NO3A 1DEEA 2BINA 3PJLA 1KYOK 3HG3A 4FXGA 4KPHH 4L3CA 4Z0BH 1RZKC 1MHHA 2M2DA 3P9WB 3LZFL 2XWEA 1BBDL 5I82A 4YDJA 4Y19A 1AMYA 1LWJA 3ARZA 3MRMB 1NC4B 4GAJL 4PJEF 5IB3A 3KPLA 5BZWB 4YBQD 5E1HB 5CD3B 1J48A 4I3SL 4M1DL 4PGZA 1O7DC 3LS4H 3CN1A 1GHFL 1P6AB 4ONFL 4CKVX 3QJVB 4MCMA 3UZQA 2V5SA 4FMKA 2B14A 5INCA 1JXJA 4HWNA 4URTB 3K81A 3X2OA 1PQZA 5D72H 3ZTJH 2WBXA 3WEOA 3QWZA 3X3GL 1D5IL 3O6LL 3JTBA 1SMYD 4EN3A 4YFEA 2OXHA 4DSYA 5FTJA 1JPTL 4JVUA 3KLHD 4I1PA 1S9WB 3PP3K 4P5KA 4GUOA 1M71A 2ZOTA 1Y4ZA 3JWNG 2Y07H 2ZSVB 5TQ2H 1PTZA 3N44F 3ZSTA 2H0JA 1ZGLA 4KVCL 3EIFA 2B1AH 3ATEA 4B7IA 1MHPL 3AREB 4PJFF 1P84K 5FHAH 1UJ3C 4ILDA 2YPVL 1KJ2H 2DYPD 3C6LB 2QVTA 4O51A 3KM1A 2H6OA 5TE4H 1YDPB 4IHOB 3WUWG 2FBRA 4IMKA 2JKWA 4XOCA 3VFVB 4PRIE 1RHFA 2ORBH 2VE6B 1BHGA 4YQXH 4NSKB 1AXTH 7FABL 3KW7A 3MLWL 1U42A 1MZZA 1WC2A 4TVUA 1IM3B 2D7NA 4LEOB 5T5FH 3UTZB 5F7FA 1CGSL 1U2YA 2BNQE 3P4OB 5EIIB 3B2UC 1FV1B 2F6AA 2EDXA 2W65A 5EU3B 3RWIA 3GUTB 5EA0H 4ZW7A 3TO4D 2DEYX 3FS9A 3VFGL 4J3OH 3C5JB 5SX5K 1F2XK 3HMXH 1ETA1 2ZTBA 4LO9A 3QXUA 4WWPA 3X3FH 3K7UA 5E2UH 1KXTB 4ZFOB 3QDMA 1XSKA 2QADD 3PRZA 3PQYE 2NXZD 1MJ8L 3H9SA 1OTTD 1BAWA 3FN0H 5FKPB 1YECL 2DQCH 1MWAB 3FB7A 3O3DB 4X9BA 4LIQH 1OAXL 4GMSH 5BRQA 3U9UA 2UY7B 4K9EH 2PTVA 3IE4A 4YE4L 4PN6A 4KZEL 3Q8AA 5DMIL 4FFVD 5JYMA 2W07A 3RUGA 1KIPA 3K2IA 3QUXD 3ZQWA 2NNRA 4MBRA 1R4XA 3VE0B 2B0SH 4KXBA 4A7TA 3UBXG 3VMPA 2EXSA 4WDIA 5FKAA 5ADOL 3ZT6A 3MLSL 4U1GC 5GRUH 4GUCA 1SOSA 1G84A 1OGPA 3BXNB 3BDYH 4Z7VA 3K6FA 5HJ3B 5JQHC 1QFUH 4JQXA 3G5YB 3M45A 3QPQD 1UURA 3CSTA 1A4CA 2P3YA 4JJ5A 1NEZG 2Y1VA 4JFEB 3KYOB 4YHOH 2A6DA 3SQBB 3DECA 1TTRA 3T04D 4TQEH 1M6UA 2L8AA 4XZ4A 1DFBL 4ABWA 4UT7H 3HPJB 1KC5H 1TENA 1EFXA 2WXQA 5AOIA 1OTUD 4EIGB 1H3GA 3MRMA 2BNQB 1NC4A 4P9ML 4E0RB 5BZWA 4LAQL 1A3LH 2A73A 3HA0A 1SMAA 5CD3A 2XWXA 2YGOA 4L8SB 5FYLH 3V0DA 2OFQA 3QI9C 2FB4H 4Z7IA 4F2EA 2Z4TA 5T3ZE 3D3VB 1GCFA 2XCMC 3CPUA 4GRLC 3UG4A 4FEMA 3ZXAC 4LSVH 1KWKA 3O6FC 1N4XL 3RTLA 3BZEB 1WFIA 2WXMA 1D5XB 4ODHH 3KAAA 1ASPA 4PLKC 2ZSVA 1O6SB 2WOBA 3UCQA 2LLNA 4K5NA 3ZDWA 5BVPL 3AREA 4U1GB 3WUZA 3EJPA 1QBAA 2ZUXA 4TUKH 5ICYA 1X5JA 3L2NA 3PV6B 1T0NB 2BZ7A 2VDMB 4NC1C 3C6LA 5JHDB 3A23A 1SRDA 4RV0A 3C8DA 1HIMH 1AR1C 1PZDA 1ZA6B 2GBTA 1YDPA 2BS8A 2IOOA 2DMKA 2Z7WA 4IHOA 5E51A 3VFVA 3OKNB 2VE6A 2YAOA 3SDXF 1KYDA 3H4HA 1OP5H 1TG8A 4MAYC 2KQAA 2FWLB 3OC8A 4LBEB 3WDHA 2DS4A 5E7BA 1IM3A 3JWDH 4UB0H 2EE9A 4LEOA 4ES8A 4U6XB 3QQNA 4R7NA 3FFCE 3UTZA 1O7VA 1Q38A 1XF4B 3KEDA 4NB7A 3VFTA 3TA3D 2P47B 5EIIA 3GUTA 1OB1B 5EU3A 3QI9B 2DQEL 3ASNB 1FA4A 4QKXB 1T21B 1JPGB 3C5JA 4KK5D 1VC3B 3M1BB 4RMQA 2VRAA 4U1LB 2H32H 2LV4A 1CI5A 4GRLB 1XCTB 2DF3A 2QKIB 4ZMYA 1JYXA 1ZLSL 5BO1L 4HKJB 3O6FB 5B1JC 5TF0A 5CN3A 1TMQA 2OXGB 3OGOE 1I1AC 3RLSA 2IBGA 1KXTA 4ZFOA 3PHAA 4HWZB 1WZ1L 1R9FA 1O9ZA 4RVBA 4AQEB 4OI8A 2X6BA 1F8TL 3ECQA 4TSCL 1G8KA 3FUFA 3P11H 4Y4HD 5FKPA 1EX0A 3UP6A 1MWAA 2XUWA 3B9AA 3O3DA 2P8PB 4YHYC 2K4WA 2P26A 2IMNA 3TJPA 1UJ3A 3O8XC 2WBJC 4GW1B 1DQML 4ZD3H 4O4YH 3D39B 1AR1B 2H1LM 4FNRA 2DN7A 2OSXA 3VE0A 4C83B 5D7JD 5IOKA 5JPMC 4GOSA 4MAYB 4XP4H 3SBRA 3BAYA 3LNFA 4BCZA 4CNIB 3LQMA 1SVBA 2KERA 3BXNA 1QUNB 4LEXH 5HJ3A 4A7QA 2Z91B 1N7MH 3G5YA 4M3HA 3AMLA 4NHUB 3BN9D 1RZGB 2WK2A 5KN5B 4TRPL 4JFEA 3SQBA 1G7PB 3KYOA 4NUJB 3WAKA 5GS0H 4HCGA 1HEHC 1JG9A 4ZXBD 3HRZB 3ZW3A 3WTVA 4X5QA 3HPJA 1L3WA 1W8EA 3EJRA 1TLMA 4YXHH 3VG0H 3F7YB 5KEZA 2NY5C 1P4IL 1XIWC 3CAFA 2FGWH 5F0MB 3Q05A 2BNQA 4XCEA 4E0RA 2CGRL 1C8QA 1I1AB 1TVDA 2H5UA 4FD0A 2PP9A 4L8SA 4JE4B 1BQSA 1GTNA 2YUJA 4J2QA 5I16B 2J57A 1A7QL 1JXGA 4NM8L 2MMXA 5F7NC 2DI7A 2WNWA 3D3VA 3MV9D 4DP7X 1KCUH 3VGDA 4YHYB 2EEFA 4GY4A 4Y2DC 4M3JA 3O8XB 5CN2A 2WBJB 4H2AA 5DEZA 1JWSB 3WLBB 1CDCA 4NFCA 3QVAA 3BZEA 3KE0A 1D5XA 2XU9A 5CCHE 1AC6A 1IAIL 2EVGA 5JPMB 2YR3A 1O6SA 5CLXA 5MI0C 4FG0A 4TOYL 3V9FA 3KPTA 5F21B 4GEJA 4W4NA 4KO8A 5J57B 2WIMA 3N1GC 4OSUH 4Q8BA 5TK2A 5DJAB 3PV6A 3SYAA 1EXGA 1T0NA 5AW9B 2BERA 5JHDA 3NSFA 3HE7D 1ZA6A 3NZHH 1CICD 1W2KT 3OM3B 3OKNA 1DQJB 1UA3A 4KHXL 4X9HA 5D4QA 5DD5L 4UQIM 4ZTPH 2NY1C 1WFJA 4K23H 3W56A 3V7AE 4LBEA 3OLEA 1CDUA 3IJSB 4NFDA 1F1DA 3PWLB 1HKLH 1XIWB 4U6XA 2B3RA 4IRJC 3QCTH 3SUMA 1XF4A 4G7QB 3KCWA 1GS7A 4UM9B 1OB1A 3PWPE 4LEEA 3UBHA 3QI9A 5IJBC 3MLYH 1QD0A 1JPGA 1T21A 4W6XB 2LTQC 3M1BA 1OGAB 1YN6B 2DH3A 5DHVH 4OLYL 1EO5A 4YEEA 3FBKA 2A1WH 4GRLA 4NQTA 4UV7H 5D7SL 1XCTA 4AUUA 4Y2DB 1WPCA 5DQDL 1TKWB 4JS7A 4HKJA 1KV3A 3O6FA 4P46D 1TZHB 3CU1A 2X28A 1FRGH 3L5JA 4HWZA 3HHMA 5DVLA 4EZJA 3DO4A 4AQEA 5KJRL 2E6PA 1WCQA 1S7QB 3DK2A 5AW8B 1GCYA 3FCUB 4ZUTB 5MI0B 3STLB 5I6NA 4OCWH 4YGAB 3NIFE 1S5HB 4PFEA 4U05A 4FQ2L 2P8PA 1S9KC 5C0NC 5I0WA 1QSVA 5TE6H 3RPIB 5FFLA 3QWOB 5DURD 4X6CE 3TTYA 2V3EA 4GW1A 4DP9X 2C4XA 2OLDA 3CN2A 3FU8A 3MV8D 5LXVA 5MP6L 2G4EA 2OP4L 4AE0A 4ZMTA 4C83A 1KTCA 2OTUB 1QP1A 4YZFE 1UWXH 2NY1B 3A67L 3J7HA 4MAYA 2BOCB 2G2PA 3RU8L 1OT4A 2NY6D 5D96C 4AQOA 4CNIA 1W72B 2X70B 4Z3JA 5CJ5A 3RVWD 5AVRB 1QUNA 4IRJB 3Q9QA 1Q4NX 2Z91A 2OJEB 1UA7A 1BYPA 3ZUCA 1UWFA 1F3RB 4NHUA 3TM7B 1RZGA 4E9XA 5KN5A 4W1TA 1HH6B 1G7PA 4NUJA 3EYSH 3ZTNL 2LTQB 4L9LC 3HRZA 5CJQH 4AIZB 3DNKA 1WFTA 3SKMB 2CA4A 3BSZA 5TD4A 3MUUA 4DP2X 1IBGH 3ECBA 3NFNB 2DQTH 2FBJH 3CMOL 3F7YA 5AAWA 4XE5B 5G5DB 3V52H 3ASWA 5AAMC 5I19L 1NBVL 2D7MA 1I1AA 2JKJA 4AL8L 3PWPB 3JWNC 3DX2A 3N3EA 2CK0L 5FW7A 4LCVA 1RK7A 4HS6B 5EOQH 5A1AA 1LO5A 5I16A 4G8GB 1L7TH 4X8CA 1E65A 1JYWA 1TQCC 1NFIB 2NY3B 1I3GL 3TP4A 4RX4A 1GAFL 2B08A 5A3ID 1U92B 3A4AA 3LQAC 4PS4L 3ECVA 1UACH 3O8XA 5KVEE 2WBJA 3UZEA 2RR3A 3CWGA 1JWSA 3WLBA 3PCYA 3NN8A 1EAPB 2CCVA 4OJEH 1AD9B 2CHNA 1IU1A 3PDGA 1U6AL 1BD2B 2WP3O 3QUZC 1BZ9A 3VFPB 5JPMA 2CD0A 3APFA 3FTVA 4MLSA 3NIFB 2ODHA 5D96B 4NO5B 2W0LA 2AK4D 5DJAA 3AC0A 5CZRA 2QV4A 3S35X 3EJCA 5D1QD 1JK8B 3E1ZA 1WGVA 3R0MA 1TNMA 2XETA 4MD4B 5E8EB 4F3FB 4KZCA 1DQJA 2Y5EA 1TZOA 2FHCA 3LIZH 1FFOB 3HVDA 4OZFH 4L9LB 3S3DB 1A02N 2EXYC 1WP6A 4OI9A 4U2YA 4NPKA 5ITBL 2G3NA 4HZLB 1LL1A 1F45A 3IDMB 3IJSA 5IHWA 4Y1AB 2VM3A 3ULUE