2HCZX

Crystal structure of expb1 (zea m 1), a beta-expansin and group-1 pollen allergen from maize
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
241
Chain Sequence
b'KVPPGNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-expansin 1a
publication title Crystal structure and activities of EXPB1 (Zea m 1), a beta-expansin and group-1 pollen allergen from maize.
pubmed doi rcsb
molecule tags Allergen
total genus 44
structure length 241
sequence length 242
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01357 Pollen_allerg_1 Pollen allergen
X PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2hczX01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2hczX02
3FT1A 2HCZX 5GLYA 3X2HA 2AE0X 3FT9A 1N10A 4FG2A 3X2MA 3M3GA 2JNZA 3X2NA 2G5DA 4FERA 1OA9A 4JP7A 4AVRA 3D30A 1HD5A 1BMWA 3X2GA 1L8FA 5GLXA 1BW4A 2ENGA 4FFTA 4ENGA 5H4UA 2GAEA 3X2LA 4ZM7A 2KQAA 1OA7A 3SUKA 3X2PA 4L48A 2PNWA 4JS7A 3SUMA 3SUJA 3X2KA 3X2JA 1WHPA 4FG4A 4JCWA 2PI8A 2VXQA 2BH0A 4JJOA 3X2IA 1WC2A 3ENGA 3X2OA 1BW3A 3CZBA 3SULA 2PICA 2G6GA 5GM9A 2PJJA 4JP6A 1WHOA
chains in the Genus database with same CATH superfamily
5F8QC 3S8FB 4XNBA 1Y1VA 1U8PB 2AXGB 3OSKA 3ROLB 4U6YB 1W72A 1CJYA 1R3HB 4PTUA 1ETZA 3TH3T 1LP9A 4RCAA 4DTGL 3DIDA 5T5FL 4OLYL 2DMHA 4WJ5B 3EIFA 3WGVB 3FBKA 3KDPB 3QEGL 1L9QA 3HMXH 3D39E 4JFSA 1DYZA 3R4DA 3GHEH 1QASA 3BP4A 4OZHA 3ZTJG 1D6EA 5F0JB 2WLLA 4L4TA 2NQCA 5ITFA 4GRLD 5MEND 3LKNB 3OZKA 4GW1B 3JWNE 5GRVL 1NGPH 5CLTA 3O8XD 2WCGA 4HUXB 1A3RH 2WLJA 3ZKMC 4FXGC 1N8ZB 2FYYA 3GI9H 4ODHH 5EU3B 3ZN6A 4EI6A 4OFVA 4JFEB 2BRQA 5FTJA 3QUYA 4GKNB 4GA6A 4HFWB 3TPUA 5L88H 1S9XB 4A6YH 3HUJE 3APMA 5DJAA 1IC5H 4FFYA 5JOFA 3GTMA 1WJ3A 2AQ3A 2PETA 3I84A 2A5UA 5FKAB 5E1AB 3LX9A 3PFUA 4JKPH 4MA8H 4DZBA 3CFDB 4G6FB 4TLUA 1KEGL 4MKTA 4NUGL 4N3TA 5TPWH 3I3EA 2F8XC 2OYKA 1E27A 3ULVH 3QQ9D 1C5DA 5E7FA 1F1GA 5GGTH 1DBML 5IG7B 5IY5B 2OL3H 1CYWA 3QW9A 3RX8A 4CL7A 1OM3L 1NCOA 1R6VA 3K7UA 1YNKH 3VYPA 1VFBA 1G9MC 6PCYA 4NN5B 2C26A 4JO3L 2VRQA 5DK3A 2F6AA 2G0LA 2I69A 1QVOB 2XQYG 4CBZA 1N0LA 1OP9A 1OB1A 3LNEA 4ZOAA 4O2FA 1D2PA 2YS4A 4GS7C 3IMTA 4L5FE 4O5LL 4UINH 3S9DB 4TNGA 4BH8B 4YWGH 2ZXGA 4PJDF 4NZ8A 1U3HB 1HYRC 3NFPA 1XXFC 5HJBA 1A2YB 3ARDD 1FNGA 3SZKC 3Q8EA 5IQ9B 3ECUA 5DD5H 1I4FA 3FUFA 1BZ9B 4K2UL 3JUYA 4PJFE 4AKOA 5MENA 3EH3B 3WUWG 3KLQA 4XXCA 2J4WH 3O8XA 1Z1WA 3BRDA 3BISA 4NCDA 3HLAB 4ZBJA 2A1WL 1N10A 2BSTA 3H2PA 3X2MA 3L54A 5TDPB 1OANA 3MOQA 5FCUH 4TNWK 2EE9A 4QRTA 3IDNB 3QEQD 1H0HA 4HWEL 3O3DA 1WZLA 1I9JL 5G5DB 4BSVA 3NIFE 1ACYH 5K93A 4KVCL 3U6XS 4MAUL 2XV2A 3H9SE 1VGKB 2LTQB 3QNYB 4K0OA 3GRWH 4OCRH 1P7BA 1OAYL 1FJ1A 2W81C 2VISB 5EO9B 5HPMA 1E5YA 4XZUA 2DDQH 1KELH 1AKJA 1URIA 5EWIL 2VLME 5HHME 4MS8D 3D2TA 3DWTA 4P2RB 4JCMA 1MVFA 3Q6FB 4IIQA 4HCRH 1YY9C 1BD2E 1FWXA 4KK6D 2AFNA 5D1XC 5IEHB 1XAKA 3MOAL 2YPLE 5MI0C 4QY8A 3SCMD 1FUNA 3VD7A 1EHAA 3QZWG 2HLFC 1CDUA 3PPEA 4QAMB 4KO9A 1QWNA 5CP7A 3B5HA 3BDXA 4N5UA 1UJ3C 3CLEH 4YLQT 4CGUB 3IGKA 4X6EB 2W1NA 4OCXH 1E6JL 3BXNA 2CR6A 4JMXA 2VLKD 3QHFH 2XUWA 3ARDA 1UZ6F 1T2QH 4JO4L 5AALA 3JT2A 3FYIB 1Q9KB 4FXGB 4HBQA 2O5NA 2GTZA 2PF6A 4WU5A 5AB1A 4QIRA 1YMMD 3HZ3A 5D93C 3WI9A 5I1CL 1UWXH 3MRBA 4CSZA 1BX2B 3UACA 4NI6A 1EBAA 1E28B 4MTMA 5CJQL 4F15B 4PJIF 5JHDD 5ENWA 1QEWB 5CBEA 2WO3B 3B2XA 3QH3B 3QQDA 3HEIB 3QORA 2FCBA 2AJUH 2W07A 4MJID 1V3LA 1G0XA 2J88L 2VERN 4S0TD 3KGTA 1PAZA 3TIEA 1WWWX 2B15A 2GT9A 5BXFA 4UMSA 3M1BB 4P4KC 1RZ8A 3T0EE 3U4BL 4LLDA 2VDNH 3GXFA 4FN0A 1KTLB 4ODSH 5LAXB 1D6VL 2QKIC 2AQTA 1DE4B 3BP5A 4G8GE 1SEQH 1YEFL 2DLFL 4KKBC 1E4XH 5HJDA 5JHAA 2OPCA 3D4CA 1NAMH 3GSNH 3SCMA 4GS7B 4D9RE 2G75A 1TYEB 3EYQC 4JDVB 1JNHA 1FA4A 3BVWA 3SE9H 3PP3K 4DN3H 3ILPA 2I9LA 4ZQTA 5DMGC 3TONA 2VC2B 4HH8A 1LVEA 4UT9L 2XZQH 4HJUA 3STZB 2Z8RA 3N5AA 4MXQD 3CD4A 3I9AA 5B7EA 3ME0B 4DEUA 2VLKA 1NC4A 1M71A 5FEBA 2CO1A 3FU0A 3WDIA 3NFNB 1RK1A 1OHZA 4AIZA 4N20A 1IBFA 2PP9A 2HVKB 4O02A 1E18A 5EG6C 3CSYB 4YE0A 1RZ7H 1WUNT 3X3GH 2Z35A 3MJ9H 3AXIA 4OLWL 1TNMA 3RURA 3K2UH 3OQ3B 4MCYB 3ZE0B 1F4HA 5JHDA 4PVLA 4UQCA 4R5TA 5AUMA 4WFFE 3MRQB 1XEDA 1KULA 4MJIA 2WIMA 4HQQL 1EEYA 3X2HA 3QUZD 5FYJL 1I50A 5C8JA 1F3RB 2MCPL 1Y7VA 3DX0A 3KM2A 4MQXD 4YO0B 3UPAA 1PTZA 2FWOB 2J57A 5L2KE 2GIXA 1EHKB 3QFDA 3KPOA 3LVTA 5MI0B 4ABQA 4CVXA 3AUWB 3Q05A 5I6XC 3PDOB 1RJLB 3UBFA 5L9DL 2ZOWA 2CO7B 2MSPA 2YZ8A 2Z7UA 5J11C 2XBTA 1AGFA 3RX5A 3RUGF 3C5SA 2YIHA 1GA2A 1HH6A 4YDIH 5K59F 1ORSB 1UJ3B 2F1BA 4QXUL 3IFOA 4GI9A 4DKFH 3TJEH 1F02I 3G5ZB 3I6KB 4JDEA 3AM8C 3MMEB 4AGPA 1UVQB 3GMOA 5D55A 4WK0B 2MIZA 1Y4ZA 2VYRE 2H0PA 2UXGA 3N0AA 2YBRA 4KNQA 5D93B 3TCLA 1QLFA 3O2DH 2IWGA 5GS2D 1R27A 4PH8A 1I85C 3TPKA 9PCYA 1WE5A 4WUKH 4D0CB 1Y0LA 2BMKA 3CFEB 2XRAL 3PAUA 4KRPD 2NXYC 5CUSH 3QWOB 1VLXA 4A68A 3CHOA 2HPOA 4BFKA 3LKPA 3Q0HA 5I30H 4FNTA 4YDMA 2BY1A 1WBYA 4P4KB 4N2DA 1NJ9A 3OJ2C 2JFCA 4PY8I 1AD9A 3QUZA 2NTFB 3APFA 3D07A 4JKKA 3VD3A 1LD9B 2QKIB 4E9WA 4LMQE 1DUZB 5D96C 3EO0B 3PWPD 3SUKA 3WFEL 5JR1H 1EJOH 4G7RB 5M95B 5KVMC 3WS6C 5EU6D 3HKZA 4AYBA 4U3SA 2G9HB 3T3PE 3HAEG 1KTDB 4RFOH 4F7PA 8FABA 4XXDB 4ONGH 2VDML 2WSPA 1LO3H 2CDGB 3OG6B 5D1QC 3UADA 2ETWA 2K8QA 2MFNA 3K2MC 2FD6H 1WT5A 5IQLA 1USZA 3FUKA 1X5MA 3F64A 2F54B 2J8HA 3LZFL 2Y07H 3VU1A 3CPUA 4AC2A 3CZJA 4HEPG 3KBHE 3UYRH 2KC0A 4R5XA 2VXVL 5ISZE 3K74B 1J9TA 5I23A 1I53A 3A5VA 3B7UX 1MFCH 5H4UA 3EFDL 4NPJA 15C8L 5EZLB 2CLRB 1HQRA 4LHQB 2W5PA 4NZRH 1K2DB 1LE9B 3F7VB 3T04D 1QFUH 5BZWA 4PGCA 4QKTA 3HE7D 3W2DH 1G6RB 5DVPA 3ECBB 3LIZA 4JO2H 2VE6B 1XL4A 2WBWB 4QEGA 5F7MC 1Q9OB 1BIIA 3RY6C 5E8DL 2X44D 3EFFA 1GYVA 1G9NC 1PLCA 1JZ8A 1OAQH 4GG6B 4JFQA 3NPSB 4JGJA 4YLCA 3KJ6H 3B8YA 4KJQD 1ZSDB 1AVAA 4TOYL 1T2JA 5I6XB 4IRZH 5I6PA 2QV2A 4LLVB 5J11B 3KWVA 4MLSA 5DYOA 3PWPA 4HIXH 3OHXA 1JN6B 1F4XH 4P2AA 3T2LA 3FB8A 1ZA6B 3HHSB 5F6IC 1P5UC 4N2OA 3GBMH 4HYTB 5HVWA 4PLOB 4UOQA 4FZ8L 4X4ME 3WS3A 1DO6A 2F5AL 1QNZH 3PWNB 3PWJB 1F4YL 1EXHA 4LPTA 2VRKA 1RJYA 4HGKC 4PG2A 1N59B 2GSIA 3EZ8A 5T3XE 1OA7A 2O5ZL 3ZSSA 4AMXA 5C70A 5CD3A 3AWEA 4P9HL 4NQSB 5AENA 3E8UL 3WFBH 5TE6H 4M5ZL 5I8EA 2NXYB 4K7FA 4RA3A 1VFMA 3QQ3A 3X11B 5EH1A 3L95B 2M1KA 3NJXA 3F5WA 3HE7A 1MFAH 4I3SL 3U36A 1ODUA 4AVRA 3FB5A 1XR8A 1L8FA 2XI9A 2E4FA 1BQSA 3OXSA 3DETC 3CU7A 1XZ0B 4HXBH 4WZ9A 1BJ8A 2V2XA 4KMTH 3TEYA 2JKTM 3S34L 4CVZB 3FTGB 4N24A 3CXDL 1T5WB 5D96B 1D2OA 4OZGE 4X7SL 2BNQE 3OR6B 2FSEB 2X4NB 4B41A 2QHRL 1AZUA 1TXKA 3Q5TA 5T1LB 4PRAB 5EEZA 4OIFA 3GIVA 4ODUB 4DN4L 5CIPB 4ZYKA 3ARVA 4JFDE 5CWSA 2B7DT 2YSSA 1XCTA 3W0WA 3CHPA 5EN2A 4JHZA 1BVNP 3ZL2A 3UZVB 1J1PH 4QRSB 1DVQA 4R9HA 2DQUL 3WELA 1TUPA 2OAAA 2BXZA 1UD3A 1B88A 4H40A 3T6QC 1UB5B 4FQIH 1DBJL 3N42F 3RKDC 1YN7B 3RX7A 2DQHH 5BS0B 4ZS6D 2RAMA 1L7TL 2B9AA 5IV2A 2BWQA 1P1ZA 1BGXL 4Z7NF 2W94A 3IDGB 3EYSL 4U1GC 1LEGB 3RY5A 1EMTL 4M1CD 4Z78B 5DQJB 1NANI 1M05B 1XCXA 1OTUC 2XZCL 3WTSA 3GPEA 5GXBB 3T77B 4YVUA 1COBA 4MAYA 3K8KA 2JI2A 3U1SL 3ZQXA 4D3CL 3ML9A 3KLHC 1WAAE 3KLAA 3FT2A 1NIBA 5DHYB 5AZEH 1MHPL 4K5MA 4U6HB 1F13A 1P5UB 32C2A 2JMRA 5D2LF 5IHUL 5HHQB 3S37L 5HGDB 3U1QA 5KVGL 3NCEB 4RRPG 3GUTA 3DGDA 4N1EA 3U0WL 5IVXB 3KAAA 2QKSA 5CXPA 5ESAB 5F8RC 3RVXD 5L8LB 3CFCL 1WVZA 5K9JL 3PHOA 5ESQA 2W65B 4W68A 3MJWA 4K3GA 4P04A 4N2IA 5FO2A 3T6ZA 4FCAA 4CN4A 1WFJA 3L4WA 3GMNA 1SVZA 2NVYA 5AAPA 4F33A 4ZMTA 1BAWA 5T33L 2EVHA 4E36A 1BW8A 4MRBA 2Q6WA 1YAIA 1MAJA 4IMLB 2FECI 1IBHA 1WHOA 5EOQH 4U1MA 1EEQA 5LHDA 5TH2B 4YS4A 4KXAA 2NOYA 3WFDH 2AXWA 1RL1A 2IPTL 2Q86B 1IC4L 1YY8B 1DQML 3BYYA 4HS8L 4Y89A 5CEXB 3MRLA 2QV4A 3KCWA 1CLYH 2CSPA 4RQQB 4UU9A 2ZKMX 4QTHA 2JJVA 1F4WL 3MCLL 1VDGA 5CSZB 2J5LC 5B22A 2ED8A 2V8MA 4YZFE 2DI8A 4NUJA 1ZT7B 5AEAA 4NO0D 3BRGC 1FBIL 2YKLL 2HB0A 3WO4C 1TPXC 4A2DA 3I9GH 4AG4L 3VFVB 2WQSA 3BAWA 5IJCC 5K9QI 4XBEL 4NQCD 4K3DL 3G6JB 3QDMA 1M3JA 3DBXA 5CS7A 5EFIA 2FQGA 2DD8L 3G6AA 2X6CA 3CUPA 1U92A 3UFIA 2B0SL 1T66C 1S78D 2JIPA 1DN0B 1GZPA 4NWTH 5F7UA 3H4HA 1T0MB 4CC4C 4ABWA 2CHXA 2WYZA 1BBJB 2ZPKL 2UZIL 2ZUUA 2IOMA 2VABA 3L48A 3NGBB 4QF1A 4U2ZA 4WUUB 3D25A 5DO2D 4CADA 4R97C 4J23A 1J1OH 4OVVA 1U36A 2Z8VC 3NN8A 2P5WB 3MLTB 2H8PB 2JKXA 2NNAA 2YPVA 4M8UA 3UJJL 4XPTL 2LLLA 4B96A 5BZDB 1NCAL 1REIA 3Q8CA 4OLXL 5H37H 1MEXL 5GJTH 3ZPDA 4B3EA 4QD2E 2BDNL 2PTVA 4WO0A 1OPGL 3ARBC 2XA8H 4MZIA 4M1DH 3L1EA 4PWJA 3V8CA 5CZXD 1CFVH 4P3CL 3D0VB 3K80A 1BZEA 5F6HI 3VM7A 1DJSA 3K2IA 2LFEA 3T65B 3BLPX 1IGJA 2MCAA 5BVJA 4WEUD 3F84A 1HXYA 3OPUA 1N4XH 2F7QA 3LKQB 4R0LB 2PJJA 1IM3B 3MLRL 4EOWH 1CYXA 2NW2B 4WTQA 4NO0A 3SDXB 3DHMA 5JW4Q 2DICA 4GOSA 1S7TB 3T1FA 4K94L 3HNTH 2O61A 3QZLA 3UJTH 5LBSH 3VYOA 4M8VA 2ATKA 2XCMC 3KNBA 3MNMA 4NQCA 5F72S 3TBSB 5L4JA 4PRIB 1CL7H 4MFHA 4Q4IA 3S4SA 2XWBB 3FB7B 4PP2A 1S3SA 2IADB 5KVEE 1FYTD 2YPKB 3LQAC 2BIPA 2YMOA 4NWUH 4W6YB 3ZHKA 3GJFH 5B39G 2LE9A 3IDYC 5AVUB 4B7IA 5I1AB 3UPCA 3BSZA 4J1UB 3W11C 1LDSA 4G3YH 2KERA 5J3HC 5LO7A 5T3ZD 5I73C 1LM8V 3N9GH 4RZCA 2MHAB 5T1DL 4NNPH 3SOBL 1I7ZA 3KBPA 2VDQH 1YLBB 4GBXD 1SFOA 3FCSB 2WMPB 1X4ZA 4DIXA 1GGCL 4S1DD 3CK0H 4JFFD 2J5LB 4YSEA 3MLXH 2QL1A 4H0HB 1MDTA 2P26A 3Q1SL 4OF3A 3FSOA 3GHPA 2DQJH 3MROB 2YGOA 4K73A 3WO4B 5FFGA 3HG3A 3U9PH 2XG4B 1K83A 1ANUA 5JZ7D 2OR9L 2KZWA 3LRLA 4U6XB 2ZONA 2NY6B 1JYVA 3D3VE 3R1GL 1URLA 1VJSA 1EDHA 1N2RA 2F68X 4Q9RH 3O11A 4FJZA 3MBXL 3V0WH 2DQTL 4PLKC 5HY9B 4LSPL 4OZFB 4IDJL 1ZCRA 1UXWA 1KLFA 3WNNA 5J5EA 4DUWA 2B1OA 2I85A 3CH1A 2MKWA 3SN6N 1UWEL 4PRNB 2G5BA 5GZOC 3NAAL 3IFPA 4R97B 2GFBA 1ZRUA 3T08A 2CU9A 3WUZA 3MV8B 2YFOA 2R0LL 4P59H 2ZSWA 4OM0H 4RV0A 1X5XA 2WQ8A 3FQNB 4YGVB 1M6OB 4Z0BH 4L9LC 3MLSH 1ZT4A 1XF1A 5I0XA 2D03H 4DK6A 9CGTA 3ZL4L 3MV7B 4OJYA 3ARBB 2EEXA 1K6QL 3TVMC 3WN5C 4HZLA 1I8IB 4N8CH 4TF4A 1FDLH 4UOW1 1G1OA 2NY5H 2IMMA 4GBXA 1FO0A 3GEWB 4JDZA 3ZT6A 3ZYZA 2X7LB 5C08A 5HDLA 2IG2H 3V5HA 2JWYA 4JFED 3EH1A 2KLTA 4BV1A 5KYUB 1QACA 2HRHA 2A4CA 2AXHA 1JAEA 3MNZA 3PL6D 4AW7A 5GRVK 3HI1B 3O6KH 4P2OA 4UQIM 4Q2ZB 5AAWC 1BSIA 4N28A 1LJMA 3DROB 2WC7A 2OULB 4G6FD 2EILB 2AHIA 2BP8A 4AT6B 3U7YH 2XZAL 4XN8A 2VDRL 3JWNH 3HPLA 4ZFOB 1WC2A 1Q1JH 3VXOA 4JN2B 1E6OH 3MGTB 4JG0H 5DMJB 5BJTA 4TUKL 3ZHNA 1WIOA 5DQDH 4KXCA 1S6NA 3VSQA 2Q87A 4NGHH 3IDYB 3EAKA 1C08A 4M1GH 4OJFH 5INDA 1AQDA 1JPSH 3CIAA 2Z9TA 3F65A 1I31A 1I9RL 3B3IB 1KUMA 4Y4HA 1ZS2A 5HHVH 2YD2A 4JPWH 5I73B 4BHUI 4LL9A 1R3HA 4XCFH 5IB3B 3WIHL 2R9HC 4MJ2A 2C9UA 3NESA 3EJYD 1VF5C 1KCLA 3DI3B 3FQXA 4KV5E 1SXCA 4LL1A 3O6FA 4ZUSB 4AQOA 4Y8AA 4BK8A 4G2AA 1MCOL 1IEBB 4PW4A 1ZTXL 4MRCA 1PVHA 1UFUA 2AEQH 5C9JB 3KWXA 2FYVA 1U58B 5CJOH 2VLLA 3KWUA 5JW4R 4JFEA 2MNJB 4DHLA 1KN2L 1KGWA 2YD0A 4GKNA 3RPIA 4L5FH 1QSED 3HZMA 1UXSB 1SJXA 2EIZB 4F8LA 5JXED 3MUY1 3PL6A 4N2EA 4UT6H 4NZTL 5DC0A 4OD1L 2F19H 1A4JB 1ZLVH 2J8UE 4ZDHA 3Q9QA 4W4OC 4XAKD 3VW3H 4C55A 1XCWA 2YOCA 3Q8AA 4FFZL 4WGVB 3CHRA 4GEIA 4DP2X 5BV7H 3QEQE 4PS4H 2HT4D 2WUBL 2X87A 1OXYA 3E0GA 5JO5B 2PO6A 4KPHH 4N87A 4OD3H 3CC5B 1ECYA 4IOSA 4APXB 3B83A 1MI5B 1Q0XH 3QRBA 1NFDE 2QZQA 3EYVB 4KHXH 1UGKA 5E6RB 4LEXL 2YUVA 1VC3B 1JVKA 3KPRB 1QVOA 2Y06L 3V4PA 4PJAB 5LXVA 3IETB 5F9OH 4NM8H 1GVIA 2IQ9H 3WN5B 2RD0A 2H6PB 5KSBB 4BH8A 4I88A 4HJJL 3VGBA 3H42L 4IBUA 4JO1H 3K71A 3FO0H 2R69H 4NQTA 4PJGE 2B4CL 4AONB 4G6ML 4YN3A 5IQ9A 3T2NH 4BA0A 3ATDA 2F0CA 1FG9C 4H8UA 1RJZA 3OMZA 3C6SA 3GHBH 1NH6A 2BOCB 1BJ1H 1J8SA 2X4SA 3M7FB 4NUQA 5FA3A 5GGSB 5HDBE 3RG1C 3VFPB 3MA9L 5AYUH 1IVLA 3FPYA 4HD5A 4X7CC 4J7RA 3SE6A 1JHKH 4P0DA 1JRHI 3T3PF 5E6IC 2ZCKL 1M6UA 2P7TB 2C9VA 2OV0A 4WJKB 2YGQA 4XH2B 1X5IA 3D50A 3VFMB 2CE6A 3FQRB 2WBJC 1QSEA 2V0AA 5FOBB 5JXEA 3KPPB 4HWUA 4P9MH 4FFVC 4IOIA 3MTRA 3FNKA 3ETBJ 1NCDH 2WOYA 4KDVA 1F8TL 1E5UI 3CPLB 3DX8B 4J39A 2G3XA 3ARSA 1UCBL 2YEQA 1EO8L 2WZ5A 1BECA 3CSPA 1YNLH 3BDYH 3Q6FA 1W72L 2FH8A 1EX0A 4LP8A 1B0GB 1TEFA 3UBXG 3VSUA 1RVFH 4ORGB 4JS7A 4LCUA 3R7RA 5I28A 2ZXAA 1CR9L 2R0WH 5JUEH 4C54A 3GBNL 3QCUH 1GTNA 1CD1B 3CVHB 1KJMA 5DRZB 5HJGA 1WDAA 1KT2B 4X6EA 1FNHA 4B0MB 2Z1KA 2XWEA 1OWRM 2GG1A 1QG3A 4YE4H 3OLGA 3SQOH 2R92A 1FRGH 3ELAT 3OKLA 1Q9KA 2D73A 2JI3A 4XTRC 3HBPA 3CZUB 3QXTA 2NNFA 3V6OE 3UTQA 4FFYL 5FC9A 4FNUA 4TNWF 5T1MB 2E2IA 3FC8A 4CA4A 4F9PC 2WINA 3PLXB 1IARB 4F80A 3QH3A 2W60B 2K45A 3VFRB 1QLEL 2OCJA 4URKA 43C9B 1FVEA 1SLXA 2XN1A 2VSKB 1EZVX 1MJ8H 2DI7A 4RA0C 2Y24A 2VDLL 1L5GA 2N7BA 2Q8BL 2YAQA 3IDIB 2BP5M 2H3NB 3M1BA 3MRRB 3KJ4C 3QXVA 4ENZA 1YY9D 4GSRA 2DBLL 2BFVH 2P24A 4LU5H 5GGQL 3EFOB 3FRPA 5LAXA 4LXFA 1I8MB 1S5IH 3TV8A 1M9WA 3X1BA 3OQRA 4TM9A 1T2XA 2D3NA 4G9FE 4JGUA 2DWXA 5HI3C 3TBTB 1DANT 3JVGC 2ZCLL 4H1LG 1FVDB 5IROC 1FZMA 3SKJL 4JDVA 1FLRH 5IFAL 1MIEH 2R83A 3WNJA 4Z1PA 4UBDC 3TA3C 4YDKL 2E27H 4Y1SA 5C2BL 5K39B 4WI5A 3ZHDA 1MHEB 3WV0A 3IFLH 3HZKA 2OLDA 4YX2H 2JTDA 4HDIB 4OZGF 3SGJC 3QDJB 5B3NA 2CO4A 2FQDA 4PWIA 1DFXA 2B77A 5BO1H 1AA6A 1HHJA 3VTTA 3GS7A 3IN0A 2J3SA 3QG6A 1NOLA 3BKJH 4B97A 1KG0A 1W16A 2ZX9A 5D7LE 2HVKA 1WTLA 2X0WA 3CSYA 4RMBA 4JX0A 2YR3A 4PJ9C 4Y9BA 5C18A 2WBJB 3N44F 3WKQA 5IJBC 1SPDA 1F41A 3MV9A 4MCYA 3U4KA 2DTMH 5I1IL 1C12B 3A0OA 3IPFA 3WE1A 2J56A 5D9SA 2BVOA 3IMUA 2VL5A 2V9UA 4C4UA 1A1NB 1K8IA 2E7HA 4BWWA 5BMFL 4UIKH 5GJSL 1GC1C 4LSVL 3GGWB 5AW0B 2QPFA 5F7EH 1J5OH 5IMOA 1HL9A 5DSCB 2FWSA 3DHPA 1BJ1J 1GGBH 1OTSC 4YO0A 4MDJA 4XVUC 3S5LB 3HC3H 3X1EA 2R1YB 2L7QA 3UZQB 1OGPA 2GJZB 4QMEA 2WKOF 4DCQA 1QTSA 1RJLA 1UB6A 3EYQD 2DQDL 4TULH 4A6YB 4AYEC 5A6IA 1WICA 2IEPA 1JDCA 2HTLC 2I24N 4OCYL 3VFUA 3UO8B 1IGCH 3EUUA 4J3OD 4BELD 5C0DB 1S9YB 25C8H 2AAAA 3ABKB 1X5YA 3DDGA 1CLZL 1ZE3C 5LKNA 1KFAH 4OCNC 1SBSH 4C8XA 4HUKB 5KSVB 4N9OB 2F54D 4PJCE 1IAIM 1ZY9A 4XMLL 1RZFL 5C0GB 2MQ0A 2VR4A 1Q9WB 4Z3HA 1INEL 1MNUL 2D7TH 3C6LC 3F83A 3IXAA 5FDWB 1ADWA 4OQTH 5E8EB 3ZDYF 2OL3B 4LO9A 4WO4C 4XMPH 5MERB 4OZIB 3QIBB 4RISH 1UT2A 2WN3A 4Y0GA 1KJVB 1RK0B 4KTEL 1YG9A 4D0CA 2ZYRA 4TRPL 3SKNB 4L05A 1AG0A 1HE8A 1AIFB 1PG7X 5DRWB 3QWOA 3REWA 4AM0Q 4G80A 3BUTA 1FZKA 2I27N 4KH2A 1KBWA 2YUZA 3MLUH 3BZEA 1HX0A 4XNZB 2A68D 1JNLL 3QEUB 2ZD0A 3D7PA 2XHNA 1TTAA 3X1FA 3K8MA 3TF7C 1RIUH 2M2DA 2XWTB 3DECA 3SKOB 3TM6A 2H1PH 1UM5H 2R0KH 1T0NB 4TNVK 4JG1H 1JZ3A 2NTFA 4HCGA 5BUGA 5FXCH 1DUZA 5JXAH 4DVBB 3E1F1 3J8F7 3DYOA 1DQJB 5IGXL 1P4BL 3BJ91 2IBGA 4M62L 3CZKA 1QI5A 4ZTPH 3CU1A 1A4KA 5E4EC 4Z7WF 1KCSH 1NINA 4XX5A 2MRYA 4U3CA 4Z7UF 4P2OC 1TLMA 4HLZG 2CDGA 1MRDH 1TCRB 1S4IA 1TJHL 2IQAA 5C0CB 5IQ7L 1QHPA 5KN5B 2VMDA 3N6YA 1XGYH 4RNRB 2F54A 3I6SA 2XN9D 1UQSA 4O02L 1XMEB 2NY1C 4OV6F 3RRQA 2N0MA 2MQCA 4KHTH 4WAFA 1PLGH 5EZLA 2CLRA 2BS9A 4NNYB 1QPXA 4PJ9B 3RQ3A 5I1HH 2KPWA 4OUUA 5J6SA 1JWSB 1LE9A 4Y4HC 2J1XA 2YD4A 3JVFC 3SE8H 1AANA 4M43H 1K3ZA 3QPKA 1G6RA 2FL5B 3VI4E 4FQCH 2WXFA 3TNMA 5HXMA 3LNFA 4LLUB 4NYLB 2J20A 2FB4H 4OUOA 2R4SL 4DZ8B 2IDSA 5KANI 1OF0A 1E5BA 4NBXB 4JDTH 5T3XH 1CBVH 2CCVA 3H56A 4KTYA 4X9HA 1MZYA 4ZW5A 5F9JB 5KTEL 5BZXA 1S9WB 4FNQA 3OAWA 1LMIA 4FG4A 4GG6A 5FO8B 3WJJC 2X4TA 5EV7A 1I1FB 2PN5A 4WTZA 2J71A 3OKDB 4X8JB 3VACA 1OOWA 4XI5D 1CF8H 4JKLA 2NCEA 4FI7A 4LLVA 3VRIA 4ALAH 2HFFB 3NCWA 5T1LD 2EEAA 4IS6B 4CC1A 5DJ6A 1M7UA 3WFCL 2FX7H 2VR5A 5F21B 2C1PB 2WQWA 4G70B 4PWEA 4LEBA 5DVKA 4KI5D 4PV1C 5DJYB 1GCYA 2VM4A 3FTVA 1ZLEA 3C6LB 4NQDB 1YC8A 2VQTA 2WXGA 4DP5X 4L37B 4WO4B 2FO4B 2XN9A 5D1ZC 3TBWB 4Z8FL 4PGEB 1NM9A 2KMWA 5FW6A 3PHAA 3U25A 4Q6KA 4N85A 4XPAL 2AK4E 1NAMB 2JELH 4P4RA 2IOIA 1PBYA 2OSWA 1CTNA 1JERA 1PFCA 2X4RB 1T5XB 2MTAA 4JZOA 4MXVF 4H4NA 1IEHA 1RY7B 2EYRB 3NEOA 2ICES 4XAWH 4MDIB 1KB5H 1Z5HA 2BY0A 1NC2B 3MYJB 4XB3A 1JGIA 1AH1A 3BHBA 3IAPA 1A4AA 2P44B 4JM2B 3US9A 4XCNA 2QZ5A 3PLYA 3DI2B 4G7YL 1KC5H 1FZOB 3UXFA 3S2AA 1WZ1H 3QXUA 3S5ZA 2NYZA 4UUJB 2COQA 4BKLA 1GRWA 1NEUA 4H0LC 3ML8A 1O7DE 5EU4A 3KLKA 4NLHA 3TCXA 5E4EB 5E4OA 2ZP8A 1G7PB 4ZUVA 5DWPA 2F58H 3NG5A 2QEJA 3MRJA 3S3PA 1EJ8A 5CIPA 4A7QA 2JJTA 4I0PC 2VDOB 4NKQB 1CN4A 4GUPA 4WNQA 5DRXA 4I1NB 2ATAA 5T5ID 1EXUA 5KJRL 1YMHA 2WD0A 1A8JH 4HCIA 4M61B 3UZVA 4GW4B 4PJXB 4NOFA 2D7MA 1HHIA 5C07B 5ALCH 2PCPB 1WFOA 5JW4M 4MLIA 2H1XA 4I48B 3SIKA 1JTOA 4PG9B 1RPKA 3COOA 3L3GB 3LIZL 3SDYH 3DV4B 1FH5L 1SYSA 5KVDL 3ERXA 3IDGA 4TN9A 4WNSA 1D7CA 2ZYSA 1AHMA 4PJDB 1Z9PA 4Z78A 4AENB 2WVVA 1M05A 4IEFB 4PB9H 1A22B 3AWGA 2XFXB 2H0EA 2XYBA 1HIML 4M6AA 5F7WC 1OALA 3UYPB 4R7DA 1N67A 4PRPB 5EBMB 2XSKA 4HT1H 4XWGH 1NMCC 4M6ML 1IBGH 2P42B 2R56H 3DV6B 4QCIA 1B6UA 4BZ2H 4YUEL 3HFMH 1DVXA 2A83A 5KVFH 5HD8C 3P77B 3FAWA 2YAFA 2A4ZA 3F6LA 1YEWA 1RUPL 5HGDA 1BZOA 1SLWA 5LG6A 1JGUH 2BY2A 2WXJA 3IT8D 2BOLA 3RX9A 1JVLA 4PR5A 1VADB 3VI3F 2X1WL 3NFSH 3FB6B 4DK3A 3RFZC 2YMTA 2W65A 4WUUD 2HH0L 4BINA 3VVWA 3PGDB 3PNWA 5D1ZB 3VXSA 3AACA 3BUIA 4A39A 2P5WD 3V4VH 1SYVA 4TUOA 1PPYA 5HHXL 3LH2L 4ORZC 4QT5B 3UZEC 3DX6A 4F7MB 2HTKD 1SN5A 4R90H 2DS4A 3GSRA 3ATAA 4X6CF 4BHUA 4P57A 3M88A 2VLJA 5D5ME 3N0PB 4PVMA 4PY7A 2QVIA 3H0GA 3GI8L 1MPAL 1RUKH 3NJJA 1SHMA 4M56A 1U6AH 4M3JA 3LNHA 1XIWD 3DUUA 1ONQB 4S1QL 1INQA 3QVAA 4AYFA 4Q97A 4Y88A 3JTBA 1NBVH 3TN0B 4XP4H 2JKIS 4ISVB 1ZT7A 2CMRL 2X4UB 3MXVL 1CE6A 1RK7A 1P7QB 1T7WA 2CALA 3EW3B 5LNDA 1XDTT 3KPMA 2X12A 1IILE 1HHGA 1YECH 2VZSA 3QWQB 3U0PB 3HFFA 4JKMA 2DQMA 1OAZH 4PJIB 4BFOA 4KUZL 3G6JA 4NSKA 1A14L 1GIGH 4IBSA 5DMKB 4PRID 3D09A 4YDLC 4N5ED 4GI6A 4KK9C 1CXKA 5E95B 3S98A 4OF6A 5CKAA 4W81A 1DZ0A 1ZEAL 3IDJB 4YHOL 2EH8H 1F2XK 2CJSA 2EE6A 2W8CA 3NSCA 5GRUL 2QSVA 1T0MA 1BA9A 4EN3C 3THMH 3NA9H 4JP6A 3ARXA 5A6MA 4YHYC 4LP4A 4MZ3A 4NO2B 2HCZX 4ONFL 2F7PA 2C34A 2F74B 2ARJB 4GSDH 1FYTE 1MWAA 4NX0A 3L3JB 4UOW0 4FKKA 4KI1A 1S7VB 4F5CA 3O6MH 2VAAB 1HD5A 4PGDB 4IBTA 2HKFH 1PX4A 5E1IA 1JPTH 1SHXA 3U79A 2ZNXA 1B0RB 3PIQB 5KVEH 3RWCA 1OWWA 2Z7ZA 3FQUA 4IRSB 3W5NA 3V9EA 2P8LB 3C6EA 4LEOB 5F9WC 2IBZY 1AGCB 4U1NB 3SYCA 3DTUB 1B4JL 2VR6A 4LDLB 3T65A 4R7NB 1YZZA 1MREL 1JXGA 2YRZA 4CW1A 4IW4C 1RAMA 1XIWA 3FFDB 1V7NH 3OWEA 2WZ6A 4P5TA 1DBAH 4L0YA 2GIMA 1NMCB 3BWAB 4GAJH 4GXVH 4R0LA 2EVJA 4TUJB 2F1EA 1JG9A 1CC3A 5FB8B 1H6UA 1HXMB 2NY6D 1JGEB 4MA3B 2X4QB 5C0AE 3DVNB 3GSXA 3DO3A 2V5YA 3GUFA 4PJGF 1P6AB 4FXLA 4AK2A 1QBLH 3CFMA 3DMMB 4M6OH 4G6KH 1G7HB 2XWBA 1Z5LA 2R4RL 2MJWA 3FB7A 4ES9A 3RFZB 3EG9A 1KJ2A 4E9RA 1C1EH 3VB9A 1UOVA 4NB7A 1TG8A 4X6DE 1XR9A 3LRKA 2B39A 2MPAH 2GY7B 5E8OB 3CVDA 5E70A 1IL1A 2AERT 5KUMA 5HJ3A 1E4XI 4N8VA 1LMKA 1JWUA 3MR9B 1GGTA 5F93C 4EIBA 1HQ4B 1TQTA 2BRRH 1W0VB 5IIEB 3SDDA 3QULA 4KO6A 3RUGB 4BCXA 1F6LL 2B3IA 2OMXB 4PWKA 1TEGA 4U0RB 5GHWH 2YAOA 4HAFA 2Z93B 1A5FL 1QTPA 1CK0L 3BAEL 3DXAB 4X2UA 2I5YL 3EYUL 4MMYA 4GT0A 4RH4A 5D70H 2QMKA 1R4XA 2O6DA 4OTXL 5I1GL 1FGVH 2PKDA 4I0CC 4KNSA 4U6XA 1IBYA 1B9ZA 4B9ZA 3WTTA 3AMKA 3BVXA 5I74B 1CCZA 3TNNB 2XVKA 4ELMB 5I1EL 4OJEH 2B8OT 4R84A 5DEGB 3RA7L 2CJUH 1P6FA 3JV6B 4FZEL 1QA9B 3T3MF 1I8KB 3X3FL 4YHYB 2AJXL 3MJGX 4PRNA 3RWFB 2YPVL 1Z32X 1OP3K 3W11D 5JPNC 3BZFA 4GRMB 4L3AA 3ETTA 3I75B 5JNYB 3NABL 2E4TA 1YSOA 5IHHA 1KEML 1P9MC 2WWMC 3SD2A 4GRWF 3GZPA 2I07B 3L3OC 3RTLA 4JHAL 1OAJA 4ZOEA 2AEWA 2UWEA 2HFGL 2VLRA 5EC1B 5F9WB 1LO4L 4NRXB 1YUHB 1NGQH 3DVFA 4NKMB 5K5YA 2NLJA 2UZYA 4M7LH 5H4YA 2E76C 7FABL 5DMYA 3ZLQC 3HCVA 2JIXD 2D0HA 3TBYA 5I0YA 5EO0A 1HL5A 3GKWH 2P45B 5KYUA 1AI1L 4HS3B 4IKJA 4JFYB 2FLBT 3H85A 5DUPH 1AFVH 2AGJL 1OM9A 3FO2A 1CZ8H 5ADOL 5GRJH 5KUKA 4IKIA 1EDYA 5CGMA 2DKUA 3D8MA 1IEAB 1WS8A 1EVUA 5ICXA 4PS8A 4CVWA 3UX9B 3QJUB 4Q2ZA 1DHKA 3DROA 2NZIA 2D0GA 4R8WH 3TIDA 2FJFA 2H6OA 3HC2A 4J3UA 3VSTA 2F8VA 5GLFA 3AT8A 3LHPL 2BIHA 4AQAB 5FUZL 4FYQA 1O6SB 3MGTA 2PCXA 5GZOD 3PDGA 4KKLC 5DT1H 3PF2A 3WN6A 1TETL 2ZG3A 3L7FB 3SE3C 3UIZA 1C9SA 2WUCH 4AUUA 3BSZL 4JZJC 1TT6A 1HWWA 1KENH 4DNLA 4HG4K 5D2NE 5IQMA 3ATEA 3KPRD 4P2RE 1D7DA 2Q7AA 3DX2A 3OHMB 5IB4B 2DH3A 5DVMA 1N7MH 2XQBL 3B56A 4H0GA 1PT1A 1RZGA 4H8WH 3HZYB 3EO9L 4FQ2H 3L4YA 1B0WA 3FUEA 5E2WH 1MW1A 4DGIH 5EIIB 3MBED 4PJHA 4I9WE 3ZY7A 5IHWA 1SDAB 5DZJA 1I7RB 4PGBB 3IDMB 4AVJA 5CSBA 3TL5A 1FC1A 4ZUSA 5F96L 2ZG1A 2JJTC 4HPOL 3PFQA 1CFMA 5GGRB 5CILH 5C09A 3ARGB 5C86A 1INDL 2X6BA 5LVEA 3DJTA 1FHGA 4S1SL 2XOTA 1U58A 2IANE 2JIXA 4JFWA 2Z92B 2YD6A 4WLCA 2BNRE 2ZAHA 2YLKA 5PCYA 2BIQA 1VZHA 4EBQH 7PAZA 1N3NB 1MCHA 1FGNH 3V0HA 1U8LB 2EECA 4NT6A 3WKMH 1G7IB 4LDEB 5FUCC 4YIQA 3PGCB 4FMKA 4NXSA 1KGJA 4K23L 2EIEA 5DS8A 2C7UA 2WNWA 4MXWL 5JO5A 3OV6A 3CC5A 4APXA 4QIWA 3QIUA 3ULUL 4AGLA 4XNYL 5JPNB 1H8SA 5B8CC 2R23B 2KT6A 1II4E 1TJMA 5T3ZL 2R9HD 2V7HB 1FPTH 3SDCC 3WJLC 3IETA 5H2BB 1Z5YD 1U8MA 4OI7A 1BZQK 3GT6A 2PYED 3EH2A 1FO0L 3KCPB 4OJAA 2IH1A 2WLNA 3MLYL 3RBSA 2XG5B 4QRPA 4WFGE 2UY7A 4HKZA 1DEEB 3MBEA 3LZNA 1VENA 2BJML 4PRHB 4D9LL 1WV7T 3GJFB 3O4LB 4JUSA 4LDOB 1TZGL 1OGSA 1YUKB 3VMPA 4NHCH 5AVYB 3OZLA 2J6EA 1KIUA 2D0FA 1N12A 2AEOA 3KDMB 3TTSA 2EUWA 1WC7B 4KUCD 3K6SA 3FQ4A 1ILUA 4DMRA 4IKNA 4XH2A 4JJOA 5HDOA 3N42B 2EE2A 4UV7L 1JK8A 3VFMA 5C0FB 3FQRA 4WKZA 1MRFH 2QPEB 1UHDA 1QKZH 2BVEA 2VDQB 3NP3A 4Y1AB 1MG2C 1PZ5A 1SN0A 3F62A 2ADYA 3VDAA 4RX4D 1R3IH 3GWJA 3ZE0E 5LUMA 1CFNA 1U3YA 3E6FA 1YEEH 2WO2B 1TTGA 4H5SA 5AD0A 4WI9A 3QAQA 3CPLA 1XVSA 4JZJB 5I1LB 4Y5XA 3RVVC 3KS0H 2IJ0C 3F7KA 4ZAKD 4HJEA 1GHFH 1SM3H 5EUOE 4W6XB 2YGPA 5FS5A 4B9PA 2D9QB 3N85H 2ZCZA 2NSXA 4LCWA 3ZZLA 5I8CB 3WTUA 3I6LE 2EDHA 4MJ6B 3GTJA 2Y9RT 4OLVH 3K4ZA 4NQVB 1DN2A 4I1PA 4LASL 5D1XE 3DGGB 2WB1A 2I60L 2X5PA 3VVVA 2OTUA 5D2LB 1W15A 3L9YA 4HISA 1CI3M 1RZQA 3UTTD 4R7XA 3ZO9A 1AE6L 1N6UA 3Q6GL 3TYGH 3HAEH 5EZIH 1KT2A 2PYEA 3B2UC 3KPSD 5KW9L 2JNZA 4AYID 1XF2A 4GUCA 1CFBA 1NMBH 1UM4L 3FCGA 3RL2B 2N56A 2QVTA 4A63A 2Q76B 3WD5L 5DJXA 3QCVH 1BMGA 3L6FA 4YFLF 2V17H 1QZ1A 4U1KB 3VQMA 1TZIA 3MLZH 3PP4H 1A6VH 1ADQH 1OIOA 1YHPA 4FFVD 1SN2A 5B1JC 4OGAC 1JMXA 4KZ0A 3J07A 2G2RB 4ZW7A 43C9A 5E5UB 4B9YA 5KYXB 3S36X 2A9NL 4JP7A 2CBQA 5IB5B 5DTFB 2HFEB 3MRRA 1UH4A 4GKZB 4RGOH 3KH4A 4AYSA 3OKEB 2JQMA 4LSTL 1IFHL 1MIMH 1V3MA 1L4IA 4JHBA 5DZPA 1A6ZB 3V4PL 4E41A 1NLDL 3VQ1C 5IMMA 3PAYA 2CKBB 3GMLB 3QI9C 4ZAKA 4P5TC 5DMIH 3SDCB 1N5AA 4LLQB 3II3A 1THCA 1HSAA 4LPUA 1MCNA 3D39B 5IWLC 5J1TC 2YUXA 3SBQA 3T71A 3D87B 5JA8B 3TFKC 5FM5M 3TWCL 5KS9E 1JGDA 5ADPL 2XWJB 3MX0B 4FHBD 3ULVD 3UTTA 3NJIA 4MHHG 3MRPA 1MHEA 1U2CA 3AREC 3KPSA 1MQKL 4GQZA 2V3EA 4X7FC 4OLYH 4GIAA 4XTRD 5M94B 5D7JC 5LGHH 3QIBD 4Z0XB 2DBJA 3QEGH 4UQAA 3FHAA 2CGZA 4OGZA 1AXSB 1EXGA 2E7CA 5FK9B 5GQBA 4U4IA 4ZW8A 4UILH 4F2FA 1VEMA 3WLWD 4HWZA 2EDEA 2R15A 4XZ4A 1BVLB 5C1MB 4E9YA 3BPOC 3ZU8A 2VMEA 4PLNC 1CXHA 1PQEA 2DRUA 4C57C 1C12A 4ZTEA 1KIQA 3HMXA 2Z8SA 1F56A 1ZWIB 3X2QB 1AHWA 1CGXA 1Q94A 2EYSA 3DSNA 5B7FA 4Z7VE 2DYSB 2K9FB 3A6BL 4WSJA 2FE0A 1NKOA 1G0YR 3HBQA 5JQHC 4GAYB 3RE0A 2AMGA 1MLCA 5AB2A 2EIBA 5JPMC 1U8HA 4X80L 5HI3D 3W39B 4ANXA 1AQHA 5IROD 2OXHB 4UCFA 1AS8A 3QIWC 5DHVH 1ZXKA 4A6YA 4BQ8A 3IDXH 3C87A 5INCB 2P80D 4UBDD 3CZFA 5FA4A 4RMQA 1FZJA 5C0DA 1S9YA 4IIZA 5C0CD 1HKLL 4TSBH 2J72A 2ZKWA 4KAQH 3C2AH 5FGBA 1Q9WA 2FTAA 3MACH 4O2EA 3S5LG 3KEHA 1UADC 4U1SB 5GGTA 5HI4D 4CMMB 5FFLA 1JL8A 5E8EA 2OL3A 5D7SH 3BGFC 4IU2A 4OZIA 3NZSA 3QIBA 4PJ9D 2E7ZA 4Y2LA 1KDJA 4ANKA 4JQVA 2BW5A 2JIMA 5DZ9A 2DQCL 1RK0A 2KZBA 4YXHH 4MVBC 2R1XA 5IMLB 1BAFH 2QTEA 1AIFA 1TZOA 5DRWA 4OBRA 2NT0A 4GSQA 3LRSB 5HHMB 1IM9A 1HI6B 2WPGA 3NIGE 4QR7A 3CX5J 1H3PL 1U8OB 2YO3A 1EU1A 2RACA 4NO5A 3S3SA 4C56A 1XGTB 3IVKA 4YHZH 2XWTA 4RDBA 4R2GB 5CR8A 3SKOA 1BD2B 1L7IH 1DSWA 3R8QA 3SBPA 3ZUCA 4HWEH 5FX3A 4Z76A 5GSVB 5BQ7B 3VTAA 4XBPB 3IF1B 4Z7QF 4C4KO 1OAYH 1KXHA 4Y19A 5EORH 2NXZC 4PLJD 4C59B 2A99A 1ZHKB 5EF1A 2VH5H 3RPKA 1HOEA 1N26A 1KV3A 3TJHC 1PLAA 4PREB 4JAMB 1QUPA 3GLAA 2P80A 3GZOA 1EBPA 1T20A 1PY9A 3AQZA 4N9GB 3GRWA 4U49A 1YVLA 4NQDD 3C6LD 4Q6YA 4YHIA 3AREB 3ECWA 4QHMB 3C08L 3GS4A 2DWEA 5D1QE 4DKEH 3Q43A 5IVZB 4RNRA 1B9KA 4HJTA 4I3GA 2PCFB 2QSQA 1BV8A 2UV3A 1KQFA 2FGWH 2QADD 4HCRA 3GTPA 4YXKL 3IGFA 1QP1A 2GYSA 2C1OB 1EPFA 4YDZA 3OR7B 3BPOB 3DHUA 1BZ7A 3LZRA 1F18A 1RULL 3C09B 1JWSA 2QQLH 1GY1A 3D5OF 1IQWL 3O6LH 4W9JC 5IOPB 3BX7C 3STLB 5BS0E 1NC2D 4A7TA 3LXUX 1T1YB 2FL5A 2H45A 4K4KA 4N0FA 3RWDB 4BFIA 3DPBB 4PJ7F 3T0EB 3ARFC 4NYLA 5CJQH 1IAKA 4NJAL 5DJZB 2ADFL 4JM2D 5JDSB 1LP9E 4TNVF 3N3EA 3CX5K 1AR1C 2AQ2A 5A2JH 2B5IC 3ZGIA 2Y1AA 1W8NA 3WXWH 5C0NC 5CP3H 3QSKB 1JDAA 4LCVA 3OKYA 2CA3A 3L08A 3QWNA 2AANA 2H3XC 4OZHE 4RDQF 1JV5B 2DV6A 4L4TE 5E1HB 4P2QD 4OGXH 5TQ0H 1E4WL 3QIWB 2LU7A 3AZUA 3P1VA 4MQSB 5DFWH 2VXSL 4IS6A 1RD6A 3G5XA 3ECQA 1JF1B 1MHCA 1I3UA 3OAZK 5GRWA 4ZD3L 3BP6A 4QHKJ 3GMQA 3GK8L 1LGVA 4S10A 1A7RL 5HPOA 1FFOB 4IRJA 1MOEA 4L8SA 4NQDA 3CQFA 3IDUA 4RAVA 3FOMB 5IVXE 1MFEH 2A74A 3BGFB 2FZ3B 2FECL 4JFOB 5C07D 4D0DB 1SRDA 3EOBA 3WIFB 4NRZB 2YMXL 3KE0A 2YOAA 3QIUC 4G9DB 3HR5A 4P2YA 1CURA 1HZLA 3GSNA 2V3DA 1I9IH 4XCCH 2BERA 1OEZW 2TRYA 4NP4L 1RIHL 2EYRA 3HPJA 2MQGA 5MP6H 3AB0C 3WIAA 4HOWA 3FFCE 2HP4A 5FTMA 4XWOC 1A02N 3KG5A 4LKXA 5CEYA 5L2KB 1E4KA 3NDYE 2G30A 1CU4H 3CZBA 4JM2A 4PRPD 4OH2A 2X70B 2ZJSL 2OS7A 1AXTL 4AUJA 1IGYA 2EYTA 1I3RA 1FZOA 3OC8A 4G42B 2E59A 4P23C 2B63A 1IGMH 1NCCH 2C3HA 4UUJA 3RZCB 1D5BB 1WFUA 3VGFA 2YEVB 5DUMH 4YR6A 3MJ9A 4P2QA 2GUOA 2O5YH 5A43C 4PWHA 4EPSA 4ZFZA 3R0NA 2SEBB 4U3XA 4F37K 1BM3L 4N90E 4RGMC 4IDLA 1KTBA 2IFFH 2ZWYA 2EVGA 2R59A 1Z9SB 1F3DJ 3NZHL 4EIUA 1E60A 4NHUA 4W9KC 4JFXB 1NLBL 1CD0A 2FK9A 1NDMB 1W91A 2VW6A 3B2VH 1EK3A 1SVBA 8CGTA 3MRMB 4ZQKB 4PJXA 4LLYB 3QHZL 1L6XA 5EBGA 4ODVL 3X13B 4XPBH 3OKMB 1CGUA 3DARA 3OPZH 5SX5H 2WN2A 4WUUE 3CFJA 3DRQA 3GKZA 3ORJA 5BW7C 5FOJA 1G6RL 1WEJL 5DFVC 5KYWA 3L3GA 4X7EC 1DR9A 4LARL 2BSBA 2P5WE 4KZEL 3QCTL 3VD1A 3H55A 3ARFB 1U21A 2OI9B 2P46B 3RGBA 1AY1L 3WEXB 5IR1B 1BFOB 2DYPB 3FN0H 1E9PA 1AR1B 3D1MC 2Y36H 1ZOXA 2B5IB 4BQBA 5L7XL 4IBWA 5F88A 3UYPA 3BE1H 2PR4L 1ZV2A 1YAZA 1YRKA 3AXLA 1I1AB 2XWRA 4JPKH 3TN0D 2WQAA 3QHTC 2VB5A 1P7QD 4M6NH 3HNSL 1PQZB 3O2DA 3NH7L 4PRDB 1NPJA 3T3PB 4TLSA 5GS0C 3OMAB 4X8GA 4B9CA 1X5JA 4ZZKA 5DZNA 3EHBC 3BFQG 3U0TB 5BRQA 4HAKA 2Y7NA 4HSCX 3FFOA 2FLMA 1JXDA 3I02B 2X28A 4XO3A 5F1IB 2R1WB 1HT6A 2A6DA 4J28A 3IKCB 4JRYA 2V4LA 4JM4H 1YEJL 3LZLA 3FB6A 2EKJA 3ECVA 5KYYB 4KZDH 1QO3A 2A9CA 3D2UA 1ZHLA 1EERB 4N0YH 4OIIL 2E0PA 4W9DC 1VIWA 2VDMH 2PW1A 1TJXA 3EBAA 5FTKA 1QSVA 1WLHA 2AQ1A 3BQVA 3HE6B 3FU7A 4BRVA 3F7QA 2NUPA 5E5MB 3MCG1 2FQFA 3HS0A 4JW3A 4IRSD 1JTPA 4FS0A 2DQGL 4WFHD 2CUAA 3RB5A 5J8OA 15C8H 3OWRA 3MUGB 3QZBA 3VH8B 3DO7B 1FNSH 1YEDA 1QCSA 3INUH 4JFVA 2F53B 3V5DB 1SY6L 1T4KA 3FUNA 3SO3B 1KBKA 1HJCA 1VPOL 5DD3L 1TDQA 4F7CA 4DP6X 1OGYA 3EJZC 3VFTB 2VJ8A 2Y6TE 3J2PA 5EZOL 3TN0A 4HSQA 3NT0A 1I3VA 3G7TA 4J3XA 2X2JA 1YJDC 5AOMA 4BM7A 5JYMA 1IKNC 5E5RB 3V52L 3WEMA 2CPCA 5KYNA 4OSUL 3I2CL 1T03H 1JK9B 3DMMD 1CE1L 3IR6A 3ZE1F 1NBZB 4U6TA 1RFDL 2B1HL 1E5CA 2UYLB 4FD0A 3V6ZA 1R9TA 4M00A 2KPNA 5HHPA 1NMAL 5ICZB 3KYNA 4AIXA 2CKNA 2E9GA 5GGUA 4J6IA 4PUBH 1AHWC 4I77H 3CFBB 4AXWB 1PZAA 1K4CA 2H0JA 1IGIL 1VFAB 2P43B 5A1AA 1D5ZB 2UXTA 1JI2A 4X8XA 2D4DA 1OCWL 4NKDB 4A7UA 3TT3L 3L3JA 4JY4B 3W9EA 2Z8WC 1S7VA 4OD2B 1AYRA 2Y5QA 3MV8E 4PGDA 4MJJA 3BKYL 5TQ2H 3U7WH 4BCYA 1QSFA 1RUAH 4HK0B 4KY1L 2HG5B 1N6QL 1B0RA 1VACB 2JCWA 4WK4B 2WK2A 5EDSA 5EIVA 3P4OB 3MV7E 4IRSA 1WWAX 2OFQA 4JFHD 1AGDB 2GSGB 4Q52A 3ABMB 2FJHB 5I6NA 3BCFA 4J3SA 3DXAD 4PTTB 1XAUA 4OM1H 4YGAB 5C0JB 4OZGB 1AGBA 3FFDA 4BFNA 4O4YH 4YSSA 5DHMC 5LQBL 1EJFA 5FYLE 4A37A 3K1DA 3CVIL 1NIDA 1NPNA 3C5ZA 4TUJA 1MF2H 4N2NA 3M17A 1FYHB 2ZP9A 5F3FA 1HXMA 3OVUB 4AJYV 4LNVA 4GKSB 1KYOJ 3N44B 2CG9X 4JRXD 4Q14A 4WV1C 4KROB 3L5XL 2OK0H 3HZVA 3CXDH 5DURB 2WXIA 1NCWL 4FABH 3P4LA 2EDTA 2BM3A 1L0PA 1QI3A 1RIVH 3SYAA 1K4DB 4G7VH 5GS1C 7CGTA 2QDVA 2Q2EB 5K33A 3D18A 1OCZB 1U8JB 1DEDA 2C9PA 1IC0A 2FEDC 2AZAA 5EBWA 1K72A 5K1VA 1GW0A 4HUUA 5DQ9B 2APTA 5ESVB 1E50A 3BO8B 3BRFA 3MR9A 5I0ZA 4HKBB 3VG0L 2ROXA 3LKRB 2ADGA 4JY5L 3D4ZA 3WG7B 1WZAA 3GB7A 3S0PA 4NENB 1KY6A 2XKSA 3WDJA 3N55A 4AEHL 2WVUA 3JWOC 4K8RC 3UTPE 5J89A 5FIEA 4L1SA 2FBRA 2NYYC 2L7JA 1HHHB 2BVQA 5HYSB 1Q9LB 5ICYA 5IEKB 3ZDYB 3VCLB 2BSCA 2J44A 4WGKA 4NZUL 5FV2A 3VO0A 1TQUA 4LOUC 5D7KD 1U3NA 1P4IL 1U3JA 4A2EA 2JCCA 4K5PA 5JW5A 1QW8A 3IS1X 1Q0EA 3OJDA 3DTXA 4QKXB 1NAKH 1N64L 1ZGLA 1WCBA 5B1CA 4JRXA 4ELMA 1YEHL 5KBDA 4OT1H 3GJEB 2YK1L 4Y2DA 2XY1A 4NKIL 3Q01A 3L5IA 1QA9A 4XO5A 5ERWB 2KDYA 1UA6H 5BRZE 4O2CB 2GIYA 1I8KA 3JV5A 3OBAA 1O75A 4PP1C 1FE8H 3S37H 1CDCA 1MWAL 4RMWA 3RWFA 1DVUA 1TTFA 2BY3A 4NKOA 3II1A 5AOLA 3U0WH 1OSPH 5KVDE 3I75A 1RZKC 4LESA 4N6QA 4WW2F 3E7JA 3WXVH 3ZTEA 1MI5E 1XZWA 4AITA 3BH4A 1KCWA 5I19L 1RQ5A 4ZODA 3MO1B 2I07A 2YKKA 4F8PA 4Z7WB 4LSDA 1XH1A 4PJAE 2H7WA 1MHHA 4Z7UB 1P84K 1JPFB 4NRXA 3TLRA 5KSBE 1U93A 1MQ8A 2X3CA 4I3RL 4JY6B 3ARGD 1PY0A 1O7SA 4LMQI 5DD0H 1EEZB 5GLXA 1JRHL 2IPTH 1YPZF 3TZVC 2ALWA 3U46B 5F0PB 4O9HL 1HZHH 3K3QA 4LSQH 4WEBH 1XSOA 1M53A 1EEUA 3C60A 2ZKXA 5I76B 2W9EL 2ITCB 5ALBL 2FEJA 1ZV5A 1F4WH 3K5SA 3MCLH 4ZS7L 3T8XA 3TO2A 5BOJA 1IZJA 4WV1B 1DUYA 1GPOL 3DC0A 5FYKL 3WNIA 4X9IA 1JHLL 3JZ7A 1YN6A 4BZ1A 3D34A 2YKLH 1KJ2L 1T1ZB 3RL1A 4YNYA 1SUHA 3KXFA 4YHMH 5GS1B 3TT1L 2VJXA 3AS1A 1O6SA 5TGBB 5DYGA 2LVCA 3VX1A 3QNFA 1T89C 2ZXEB 1CPUA 4GKLA 4IGBB 3SJVA 4Z18A 5TDOA 3DDFA 4UZSA 4ZM7A 4J8RA 3WJMA 1E4KC 1E40A 4KQ4H 3TH4T 4LCCA 2G0KA 3F8UB 5E4AA 3UAJD 2Y7OA 3JTSB 1MG3C 3A21A 2DM2A 3O3UN 4YH6A 1AMYA 3HZYA 4XBMA 4R96A 1PX8A 1CFSA 5AWNL 5DXWA 4Y4KA 4DAGH 4H1LH 3IPBA 1JF6A 3QQXA 1LO2H 4PRHD 3DUSB 4L29A 5AOJA 1X4YA 4PGBA 1NCAH 3O0RL 3O4LD 4HWBL 4LVEA 4X4ZA 1MEXH 5GISL 2GK2A 3TTYA 5B1AB 2UZXA 1OPGH 2QSCL 5GGRA 4C83A 3WKYA 3ARGA 2OX5B 1BOGA 1MCCA 1OQOA 2ZICA 4HIJB 4P3CH 1G9MH 3MU3A 4J4PD 3BOVA 4GW5A 1HOCB 1UACH 2Y7QB 4IHOA 4YPGA 1QYGH 3W0WE 5J6GB 2OMZA 5LXGH 1PZ3A 3M8OH 4D0BB 4Y1AD 2EIMB 4APQC 1DVFC 4AI7A 2O93L 5F7HA 5EIIG 5D7IA 5FCSH 1PNCA 1OT2A 1UT1A 2CO6B 3LN4A 3QO1B 1NGYB 4HJGA 4BYHA 2WBXA 5AYQA 5CFAA 5GGVL 5SWSE 4QRAA 3V4LA 3EH4B 3FO1A 2QGDA 1H15A 1UURA 2D3LA 4FDWA 1T0OA 5AG8A 2GEQA 3FHQA 3FO9B 1CXFA 2WZPA 5C7XL 2GVYA 2PYFB 1SMDA 2ODHA 2W0PA 3IK2A 2AC0A 1BPLB 2R23A 3DX9A 4HJ0C 1QRNB 5H37G 3CGTA 2IAMC 5ITBH 2C4FU 4XP5L 4AL8C 5H35A 1AXIB 2YAMA 4HUVA 3UAJA 3IU4L 1EZLA 3A47A 5E99L 2QSTA 2WV3A 1JGLL 3M6DA 5KSAC 1CBJA 5EMYA 3A6OA 3CBKB 3PE9A 4H2AA 5LBSA 5C6PB 5CJXC 1HH9B 1S7WB 1EHNA 3QWRD 1DEEA 1MJJA 2HLAB 4JFUA 5I18L 3GJFA 3O4LA 5T1DH 4I85A 3SOBH 3GLDA 3DJRA 1FVCA 1A6PA 2PPFA 3GZKA 3K5RA 4P5KB 1F42A 3QDJE 2BP3A 5IHLB 3ALWA 3D3VB 4AQ1B 4IQHA 4XPGL 1GGCH 4KKCD 1YQ2A 4J4PA 3CSGA 1UUNA 4WDIA 4AVIA 3CV5A 3GLEA 1FCGA 2OMTB 3CX2A 4H8WC 4NBYB 3AT9A 4ETQA 4QOKD 1F6FB 1UZGA 1AQMA 4M7JH 1FL6A 3RNQA 4Y1AA 4R3SB 3ULAB 2E74C 5GRZA 4BGLA 2BW4A 3HB3C 4KX8A 2OR9H 4WWKA 4PV8A 3Q5YA 3EDFA 3TEUA 1ZT1B 3MODL 3R1GH 2DOCA 4M7KL 4DGYL 1A9EA 4J5VA 1DL7L 3FULA 5EDXA 3PWUB 3HC0B 4ZFGH 2CGRL 3GYRA 3ZYIA 2GITA 1FFNA 1KNOB 1P6WA 3FUIA 5ANMB 3LTVA 3MBWB 3D39D 2E47A 3BMVA 3HU3A 1G5GA 2E46A 4H26B 3WLBA 4RFEA 3T0DA 1LP9F 4HAGA 5DYIA 1RKRA 2G60L 2R0LH 2HN7A 2D7PA 2G4GA 1JXKA 5DJ2B 5FO7B 2ICEC 4Z3EA 3WIIL 2ODIA 2FIKA 2ENGA 1LEKA 1U8QB 2WQXA 4AC4A 4HLZH 3VI3B 2GJJA 3QWRA 3LKOB 2HT3C 4MD4A 3MFGB 3SB3A 5CCHE 2OMWB 2E7BA 1S46A 3QYCA 1MXGA 2FUQA 1R1CA 2W0KA 1JS4A 5B7MA 4U1KA 2W9LA 1TQSA 5L8KB 3MLVL 4APQB 5F7AA 1DVFB 2M83A 1F3JB 5HP5A 1ZS8B 4EZJA 2G2RA 4L8BB 4PW3A 4QOKA 3LNGA 3N04A 1UXMA 4X4YA 1DSYA 1DFBH 2A73B 4XOEA 3EOTH 1NCIA 5HDRA 1GOHA 3MCKB 5L2JB 2K1MA 2IGTA 5DTFA 3JWDL 3SUJA 4MD0A 2FT6A 2OMUA 3HRZC 5HHNB 3FUMA 3H0TB 4KFMA 4AIEA 2V2WB 3TASA 3QUMH 3FH5A 2I9TB 2E5EA 2XZAH 3HJEA 1E3ZA 3F3HA 4HV8B 2VDRH 4M48L 3GMMA 3CDGB 1TTCA 1B4LA 2IAMB 4MMXA 4PAZA 4Z5RA 2MQ3A 3UBGA 3KGSA 3QDGE 4YBLC 3NVQA 2VRAA 1UUSA 12E8H 1WQVT 4UYPA 3NIDF 3WENA 4JB9L 1SOKA 3T0AA 4AEEA 4GB9A 5EO1B 2X2YA 4W70A 3T4YB 3PABB 1MAMH 1S7UB 5LGJA 5EA0L 4YQXL 3MX0A 2ZKYA 5ILTH 4G11A 4Q0XL 1F86A 1X5HA 2J6EL 3MJ7B 3WHXB 5K69A 3WIHH 3LEXB 4U1HB 2IDTA 1WD9A 5HBBA 1OAKL 3P4MA 3O3EA 5C0CE 2NDFA 3HG1B 1MVUA 1EO7A 4BFBD 1RV6X 3HUJA 2VXQH 3L5WA 1GR7A 3SE4A 2RQ8A 2JB5H 2J8UB 2NR6C 2YRPA 3H9SD 4IOFC 1QQDA 4KFZC 4OGAD 5DVOA 3FZUC 3QQ4B 4OF7A 5EOTB 5HGHA 5HYJB 4NIKB 5HHMD 1T6WA 2VLMD 4UQ2A 1J0YA 2ZSVB 1O5PA 2HVBA 1ZHBB 5B1BB 1ZWIA 1J86A 2DQEL 2VXUH 3HB3B 4POYA 2EINB 5IBLD 3VD0A 1I1YA 4G6JL 4R2GD 1BD2D 5I1DB 4NZTH 4HC1A 4OD1H 4KWUA 4NLAA 2VXTH 2I32A 1A6WH 2CDFA 3QB7C 1DLFL 4CS0A 4NP9A 4UZGA 4N22A 3U7AA 3N43F 4FFZH 4FXKC 4K3HA 4JKNA 4WGWB 1ZLSL 2Y1VA 4DP0X 5IW1B 3RU8H 1T6VN 5I8KL 3TFKD 1EAJA 4FQ1H 1Y1WA 2EXWC 5INCA 5J6HB 3RTQB 4F27A 2CQVA 4K9JA 4PJGB 3TO4C 2ICEB 3F58H 3ARED 1T83C 4LRIC 5FM8A 3BD5A 5CCJA 4PJFA 2VDKL 2Y06H 1HHKA 3ZQ9A 5HDBB 4OY9A 4XMKH 1ORQB 1D5XB 4LCIL 3VJ6A 4Y2DC 4JKWA 3VQLA 1Q0YL 2CD0A 4HW6A 3K6OA 3OKOB 3H42H 1SJVA 3PPSA 4ZNCD 1M4KA 4ZO7A 3FT4B 3F00A 3A67H 2FJGA 1NCTA 2VW4A 3H9SA 2ADIA 2OW6A 1DVTA 3L3KB 3PJNA 4QJ4B 1PL3A 2XU9A 4YHKH 5F97E 1TWHA 4RMVA 3MA9H 4ADJA 2ICWB 2Y6SD 3T0ED 5C2UB 2XJKA 4Y2OB 3ULUE 1EAPA 5ACZA 5CBAB 2P9RA 4FTDA 2EEFA 3ZKXC 4FQLH 5L0QC 2R69A 4OKVB 3HRZB 3QJTB 3P3YA 4G8GD 1Z0MA 1BD2A 1RUQL 1SNRA 4ODTH 2YPLA 1U8IB 4YXLL 4D9RD 1J7VR 2EP6A 3JXAA 1A47A 4F7TA 2EEBA 3NCXA 3ASOB 4HF5H 4NN6C 2DKMA 2WNGA 4LQFL 4YBLB 5JQIB 1ZHKA 2LLNA 4PV9B 1F8TH 3L3HB 3MKGA 1SJHB 4FA6A 4JAMA 4ETYA 1BZ8A 1C5BH 3MRGB 2WLYA 2X89D 5D4HA 3ASWA 5H94A 4FG6C 4XNUL 1KXTB 4N9GA 1T1XA 1WTGT 3GD1C 4G1MB 4DFHA 3ABZA 4JN1H 5BNXD 2ITDA 2W9DL 4Y16B 4L4VA 1QUNB 1G9NH 3BAKA 3MGOA 2AV1A 4KVPA 3ZO0A 3M7OA 3FRUB 3LB6D 3KYMB 1IJ9A 4KQ0A 2BNUB 3QJZA 3NK4A 1GAFL 3PJSB 3OR7A 2GJ6B 3G5YB 5HHOB 2BSEA 5IJVB 3LXBA 4WFFD 5EOCH 3FH7A 3HMXL 4F8QA 3GHEL 2H4EA 2DB8A 1PY4A 1BW4A 4AM0B 1XGQB 4JZNA 4F8OA 4HPYH 4FG0A 3I6GB 1V8HA 3HAEB 1NGPL 1LL1A 3DPBA 3R06A 1A3RL 5L2KD 3POHA 1EZUA 1ASOA 4G8FB 3B9KA 4WENB 5J1SC 2CBOA 3GI9L 4ODHL 4PJDE 3RGVA 1OCRB 4ODWB 3IN2A 3M07A 4G8GA 3H3BC 5EC2B 5L88L 4G9FB 2PTTA 4FXKB 3RZCD 4A6YL 4LLMA 3IRPX 1OARH 3K8LA 2G5DA 5I2IA 4X9FA 2KZKA 2VDLH 3H6JA 1L3WA 4JKPL 4MA8L 4TQIA 2OP4H 3TU6A 4WK2B 1JPEA 2C9SA 5LN4A 2PPDA 1NOAA 4DGVL 1I8LA 4M29A 5TPWL 3TO4B 1SOXA 3FQWB 5DK2B 3ULVL 2X89A 1OLLA 1IGTA 3FT3B 5GGTL 1NIFA 2HX7A 2DY2A 3IJ8A 2OL3L 2BVUA 3DIFB 1WH0A 2ZCLH 3B37A 1PX3A 2K7QA 4AGMA 1K5NA 2K0RA 3QBTB 1FNEB 1G87A 1YNKL 5D7LB 1XL6A 3FOMA 1KN4H 4JRFA 1R47A 3MRNA 4YDKH 1QLRB 4KTDH 4DPBX 1IAOA 3WIFA 3BH8B 2WCPA 3V0VA 5LDUA 4UINL 1DBBH 5LGKA 2EEDA 2GCYA 2HXAA 5GZND 1ZA3B 1A0QL 3I50L 3U1PA 3ARFD 1U91A 3RDTC 5DRNA 4JRWA 1VESA 5DD5L 3HHRB 4F7EB 1AR1D 4MJ4A 5L0QB 4B6ZA 4LBEA 3ALXA 3P40A 4JL1A 5K1JA 1I1AD 2Y5TA 2Z31C 3AU1B 5EBLA 5L2KA 2VGLM 3UDWC 1G6VK 3AAZA 3UERA 2X70A 3L2LA 1DJYA 3NRPA 5FCUL 4ZUUB 4G42A 3SPIA 4RAUA 4LIQE 4NN6B 5AZ2H 1MJUH 3V4UH 1DQQA 5BMFH 1UZ6E 3OKKB 1L0XA 3RZCA 1D5BA 3X14A 1R0AH 1ACYL 1ET5A 4JLRA 4L1DA 1NWPA 4OFKA 4UM8A 4OCRL 4U1JB 3GRWL 3HVNA 2SEBA 1ZSHA 2DDQL 1KELL 5F9AC 4WKXA 3FF8A 1Z9SA 4PJIE 2A77H 1S7QA 4X8CA 5SWZE 1CXIA 4HH9B 4B9IA 4HCRL 5GIRB 1UOKA 1NDMA 1C16B 4MD5B 3TBVA 3MJ8A 4C58B 3LPFA 3HE6D 3MRMA 4ZQKA 1D9KC 2O5XH 4PJBA 4ZMYA 5DLMH 1CLZH 3JV4A 4LLYA 4Y8DC 3X13A 1G43A 5AVWB 2EDKA 4FFWC 4L3CB 5C0EB 3X2PA 3TWYA 2NCMA 4YHPA 1KGXA 4OCXL 1R5WA 4YHNB 1DJXA 1MFBH 5GZNA 3QHFL 4W4NA 2DLTA 3IJ9A 3STBA 2F7IA 2DQFB 2F53D 3WEXA 5IR1A 3ROOA 4NPYA 1BFOA 5CCGE 2M8XA 1A66A 2Y1YA 1E2ZA 2WAHA 4N0UA 4HIIA 4FTVE 5IMKA 3UAAA 1I1AA 2JLLA 3LN9A 2WLIB 1F58H 1K8DB 1GTFA 5IVNA 1YEGL 2C8NA 1UT9A 1NBYB 4ACTA 2AJUL 2LU5A 4HHAA 4XVSL 4F37F 3ATFA 1NDGB 4XHJD 3DURB 3MRIA 3VDBA 2NY7H 3I9IA 4G1EA 3FQTB 1DJWA 1A7QL 3QNZB 2YQGA 5T3XD 2VDNL 4IBQA 4QPEA 5IGXH 4JFPA 2BHYA 5ISZA 5LCVA 4ODSL 2XXMB 4GAAA 3GXTA 1SEQL 4NZJA 1E4XL 3BMWA 3HE6A 3GSNL 4P3DB 3T5WA 2RHEA 1CFQB 1FFPB 1BXVA 1UEYA 4FLRA 3UABA 2IOOA 2ZCHL 3QS3A 3SE9L 5E5MA 3OXRB 5E2UH 4DN3L 3VI4B 4HOMA 2HWZH 2WSKA 3DVGA 1XB6A 4OAWB 3VFWB 3NDZE 4L18A 4WHTB 5T5MD 5KSUB 2ICWI 2K4AA 2XZQL 4U1LB 3SYOA 2P1YA 4X5LA 1F5WA 4LKCB 5CO1A 4EDWH 2CLZB 5JIHA 5I6KA 5E03A 5K59E 4XXWA 4HUCA 3GSUA 4ZPVA 2BNQD 1MH5A 3AMLA 4EEEA 1KTCA 3VXTA 3GSQB 1RZ7L 2A9BA 5GS0D 4CSPA 4HS6B 3X3GL 5DDHB 3MJ9L 1KIRB 2QQKH 3K46A 3K2UL 3QZOA 2VN3A 3EZJB 1MFDL 2R4SH 3DXAE 2FH6A 2A6HD 4KDIA 3UH8A 1T22B 2F9BT 4QRBA 4JFDD 4KROD 4QXTA 1LO0H 5DURD 4AZUA 3VH8G 4X4MA 2CJTA 1WA2X 4FLOA 3P02A 4UDUB 2IFGA 3C75A 3GM8A 3F04A 4Z7IA 3IE9A 3JTTA 4TSCL 2VMFA 2WP3O 5IKCB 3NCJH 4X42A 4PJEA 2V2TA 2XKNB 1A3LH 3LKSB 3MRFA 4XNAA 1NUDA 3MV9E 2H3KA 3C9NB 4AXWA 5DJZA 1RUMH 1T3FA 5FYLH 3GTTA 5HTSA 1D9KB 3OAUL 5FHAH 3WFCH 4E68A 1SDDA 1QNIA 2AK4B 3D33A 1KPRB 5EU5B 1E9QB 1PSKH 2JE8A 5A6LA 3T9WA 2TSAA 4JY4A 4YDIL 3OTTA 3TJEL 4O51B 2CAKA 3FCTB 2HG5A 1NEZA 1KPUB 4QGYA 3IAGC 4Z9KB 1BVKA 3MN8A 4XN5A 2BSRB 3P4OA 3REVA 4LE8A 1A7PH 4M5YH 4XPAH 5BUPA 3Q06A 5D8JH 4MQ7A 2NAPA 1UH2A 3LQAH 1GOGA 1WAPA 3GXDA 5B38G 1QWUA 2D31B 3O2DL 4BFRA 4AJWA 4H2CA 4EUPA 2BNQA 5CINL 4WUKL 2OTPA 5E00A 1CICA 3H7BB 2SODB 3K81A 2MPVA 4QWWC 5CUSL 1UD4A 2JXMB 1NDTA 5E94B 4YAQA 4CDGC 5CEZE 1IAMA 1L9OA 2R2BB 2VZUA 4G7YH 3N40P 1NEPA 1AIZA 3MDJA 4I18B 4JFDA 4XMTA 4L3EB 5I30L 2X2IA 1KB5A 2BCKA 1JD7A 5IW3A 1HSBB 4WI4A 3NJGA 4TXVB 1OSZA 2XIBA 3APCA 4U2YA 4MDRA 2HT2D 5E8PA 3V5KB 2Y69B 4KDTA 1WBZB 3LHAA 3TH2T 1N0XL 1U2YA 3TC9A 1QBML 5JR1L 1EJOL 2XX0A 4Y5YA 1M1XA 1J0JA 4WW2A 1R75A 2XV0A 4RFOL 4IM8A 2J12B 3DX7B 2WTRA 3OD3A 4ONGL 4R7LA 4K55A 2ZX7A 2GI7A 4QJ3B 4CMHC 1IKFH 4KMLB 4J3TA 4TV3A 1YQVH 2FD6L 1ML0A 5D6CA 3PXHA 3ZIYA 1RXLA 4LNRB 2Y07L 3IRZA 2H2PD 3FQ1A 3CFKB 3UYRL 1NZRA 5IB1B 4FQPA 1SVCP 4UIMA 5HGAB 1XBRA 2RGSA 5IW6B 5C0BB 1MFCL 3LIZH 3BH9A 2YEZB 1BFSA 3NZUA 3BVNA 3O9WC 1FH5H 1WAAA 5HYSA 5KVDH 1Q9LA 3OB0K 2ZOLB 1KCUH 4NZRL 2FJUB 3BQUB 4MCZA 1JYWA 1GGIH 2I25N 3SDAA 5B39B 1NCHA 1QFUL 4WW1A 4HXAH 3CLFH 2C3XA 3H2QA 2D8KA 2X9YA 5KG9A 3G5WA 3KZ8A 5IJKA 1TZHA 5J9PB 4LCYB 4NM4H 2EKSA 4JPIA 4QHKI 1IFRA 4JK0D 5JA9A 3RKPA 4FULA 5AQ0A 4PCSA 4YUEH 3MREA 1S9VB 1OAQL 4P9HC 2G5UA 3KJ6L 4IGBD 2BS71 4LSRH 5F3BB 4FF9A 2UVFA 4O2CA 1KBPA 3PV6A 4IRZL 1RUPH 3QJHB 3B1TA 3B9KC 2NQ3A 3JSSA 4HIXL 4QRFA 4ZXBB 1Q8MA 4J2XA 1F4XL 4N25A 4Z7QB 4BZ2A 4JANA 2Y1ZA 2XNAA 1DQIA 3BEWB 4KTGA 2A6KA 3GBML 4K5OA 2MOQA 4CILA 3MO1A 3QAZC 3IJEB 1QNZL 3R0MA 5D6DA 4XNDA 4PMEA 4Q7DA 3EYFB 2GK0B 1J1XH 1KIPA 4XBGB 3NQKA 5C9KA 3TEZA 4PHXA 4HGWB 4BK5C 4DESA 1OD7A 4TVPE 4AW4A 2V6HA 2Y5EA 5AAMC 1XD0A 2EVIA 2VDMB 3GMPB 4LOUD 3V4VA 2XDHA 4PRHE 3F7YA 4BD4A 2BC4B 5TE6L 2RQEA 3BZ5A 2R51A 2HLEB 3HI5H 2C4FT 4P5MB 5I76A 2C5DC 1R7RA 3SBWC 2DEXX 4XNQB 4Z3IA 4XOCA 2Q8AL 3QG7H 4EF3A 3QUXC 4FYRA 1MCLA 4TTDC 4E42B 5MEQB 1FL3B 4HXBL 3T2OA 5CHNB 4KMTL 4PJ7B 1I9EA 3LEVH 2X4PB 4Z7NE 3KM1A 4KJYB 3DRTB 1OF2A 2O5JD 3L2NA 4IGBA 5IF0B 2DL2A 2YD7A 3KPLA 1V3JA 2JJSA 3TXAA 1CF1A 1K9TA 2R2HB 4ZPTB 4LLWB 4CMHB 2IPUK 2BP0A 5HDQH 4HCFA 2H26A 2QGBA 3RY4A 3FT0A 3A24A 4MKMA 3QO0A 1XB8A 2HJFA 4ZUWB 2KI6A 3DUSA 2VZVA 4IMKC 5C0RL 1J1PL 1XO8A 3V2AR 1I7TA 1ASQA 4XMWA 3O9WB 4FP8L 4POUB 5DJ8A 4XC3L 4FQIL 1A7OH 2DQHL 4L3FA 5F7BA 3BW9A 3D3VD 4HIJA 4W9LC 5JDJA 1NGXB 1ZIBA 2E8YA 3ABLB 4ZFFA 2WOBA 1B4JH 1R5IA 1S8DB 5CFHA 4U3HA 3LPPA 4NCC2 4QHNB 4S2SB 3VXQA 2AV7B 4PRBA 3ZTNH 4IU3A 3IFNH 3CLWA 5FUCE 2CJ3A 5BW7A 3RJQB 4WSGA 2PP7A 3FO9A 2ZE0A 1A6TB 1SGKA 4G8IB 2DI9A 2OQJA 4X5XB 1P7KA 2R29H 2EZ0C 2FBJH 3ULUF 1JTTA 3QRGL 4RIRB 1W2KT 3QAZB 2ATPA 3BZ4A 5AL0A 1MCJA 3RVUD 1NCBH 3VWKD 3C2SA 1BEYL 1IQDA 4WFEE 1HH9A 3BKML 2F7OA 4ONOA 4HIEA 3QUHA 1T04A 2YUJA 1ASPA 3EGXA 2YUWA 5LBGA 4P46D 1ZJBA 2EH7H 3VG9C 2E9BA 1TJIH 1BQHB 1XX9C 1PKQE 2G3NA 4HJSA 3WFDL 5JW3H 4Y4FD 3D3VA 2QR0A 2EXTA 1BOYA 4APQD 2E7LC 1AQKH 4ATTA 1FV1B 4N0CC 4ACPA 4BZ1L 3BCDA 1IJNA 2OMTA 1CK0H 3VXSE 2J55A 4BSWB 2EDJA 2XQYA 2OMVA 1UD2A 4RBPH 4K3EH 1M2VA 1TU2A 4NRYB 2VUMA 3K0WA 4HOZA 1HEJC 2CDEB 2VLJE 1ILSA 2WIIB 4P5SA 4ANVA 3I9GL 3T4AA 4J6RH 1WFIA 2IPKB 3EJTA 2FR4A 1RJCA 3V6FB 3ZHFA 2WJ7A 1MUJA 3QJSB 4FZEH 3SQBA 1GZQB 1PZCA 4MS6A 1KJ3L 1L6PA 3MBWA 3WUWA 3CN4A 1I75A 1KXVA 2NUTB 2Q3AA 4FQXB 5KBNC 3X3FH 4EQ3A 2ICCA 4XO8A 3LH9A 2K3HA 2IWFA 3EOAB 3PAZA 3Q48A 2AJSH 5DJ2A 5IBTL 3U2IA 3VWKA 4ZW3A 2YARA 1A7BA 1U8QA 3MUHL 3A4EA 1J1OL 5A2LH 5CCKH 4K94C 3IJSB 4GRLA 4R6UA 3RAJL 5ID1A 1OKEA 1MLBA 4P46A 1NTDA 5C1BA 4BQ6A 1LO4H 3AY4C 1BLIA 2N0KA 5GJTL 1WCMA 2IALA 3GBLA 1SZNA 2XA8L 4M1DL 3AS3A 3L1GA 2VDPL 3N1PC 5HSFA 1DDHB 1OV8A 4Y4FA 4I7ZC 1CFVL 3K1KC 2IXQA 5GS3A 4AQ8A 1RLWA 2AK1H 3MCYA 3UBXB 2FX9H 4AQEB 4RESB 3QZWA 4L8BA 2PXYB 4K9EL 5ADOH 1UTDA 3QYNA 2A73A 3RYMA 3GSOB 1A6AB 1N4XL 2VQ1B 4ZO6A 5L2JA 4MMZA 2C3VA 3KYOB 5HHNA 2XTJC 5D2NB 4EOWL 5HGBA 1FNFA 3TBBA 4N1CA 4POZD 4BH7B 3T1WA 4YDVA 3IAQA 3QRFM 2I9TA 2IDUA 3CDGA 5JORA 5FUZH 3HNTL 3UJTL 5LBSL 5FF6B 3RTQD 5C0IB 5DJDB 5BPPA 1JD9A 1F97A 4YDJB 3ESMA 3VFOA 4K7PH 1WO2A 3CZLA 4L48A 1AZBA 3ZE1B 4E5XB 4NWUL 3ZVVA 2AJZB 1I7UB 2YC1B 1SXAA 1R34A 3IU3A 1DLHB 1H0DB 1GC1H 1SMAA 1BDYA 1LEIA 3MJ7A 1X5GA 4WI6A 4ELKB 4U1HA 3VG9B 2IANB 3NCYP 5I16A 1YO4A 2BNRB 2QLYA 3GSWB 4H13C 2WQUA 3RHWK 4Y5VA 4RMUA 1XF3A 3VYNA 5FYKE 1LE5B 1DQDH 3N9GL 3KL0A 4Q9BA 3ES6B 4NNPL 3QFJB 3U48A 1EUUA 1FH2A 1H3VA 3KPNA 4WW2C 1G8KA 4UM9B 4OV5B 1FQ9C 3RPBA 2NW3A 2ZSVA 3QEQA 4H1LB 3ULSA 1AGEB 1ZE3H 3BGMB 1KGCE 3MLXL 3PGFH 4J3VA 3RWIA 4F8TA 4I2XE 4MASA 3IGAB 2DQ6A 4R4NC 2AJ3B 5E7BA 1EJ6A 5TE7H 2H2SD 4FEMA 4XNMB 1NFDA 4J12A 4DH2A 2DZEA 3LCYA 3MV11 2CLVB 3MA7B 5JLZB 4AUYA 2JJUA 4L2LA 3WU1A 1ZLWH 5AVZB 2JF1A 1KBGL 4BXVA 5FO9B 4Q9RL 3V0WL 2R2CA