2HCZX

Crystal structure of expb1 (zea m 1), a beta-expansin and group-1 pollen allergen from maize
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
241
Chain Sequence
KVPPGNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and activities of EXPB1 (Zea m 1), a beta-expansin and group-1 pollen allergen from maize.
pubmed doi rcsb
molecule tags Allergen
molecule keywords Beta-expansin 1a
total genus 44
structure length 241
sequence length 242
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01357 Pollen_allerg_1 Pollen allergen
X PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2hczX01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2hczX02
1WC2A 3X2LA 2AE0X 3X2MA 2VXQA 1BMWA 2GAEA 3CZBA 4FFTA 2PNWA 4JCWA 4JP6A 3X2IA 1N10A 3M3GA 1L8FA 1BW3A 2JNZA 5GLXA 2G5DA 5GM9A 1WHPA 2BH0A 2PJJA 3SUKA 3X2JA 2KQAA 4JS7A 3SULA 1BW4A 1OA7A 3X2PA 3FT1A 3X2KA 4FG2A 4AVRA 4L48A 2G6GA 3SUMA 2PICA 1OA9A 1HD5A 4FG4A 4FERA 4JJOA 3FT9A 4JP7A 3X2GA 3X2NA 3X2OA 3D30A 1WHOA 4ENGA 4ZM7A 3ENGA 2HCZX 5H4UA 2PI8A 3SUJA 3X2HA 5GLYA 2ENGA
chains in the Genus database with same CATH superfamily
3B7SA 1IC0A 3L5JA 3DXAE 4GBXA 4YVUA 1CU4L 5EBLA 2YQBA 3SZ6A 3RX8A 1SN2A 1I8IA 3QVAA 2W0LA 4X4MA 1HJCA 4IRSB 3VNZA 1VGKB 1XV8A 2W59A 2YKKA 4R26L 3H9YA 4IQHA 5C0BB 1JZ4A 1GJUA 3FQ2A 3O3BA 5A6MA 4O51A 4TTGA 5KYYA 4TSBH 4L3AA 3OJ2C 5BOJA 3U9PL 5HDBE 3NIGB 2DB8A 5C7ZA 3FOLB 3VVWA 1N5YH 4JANA 1CXKA 1M3IA 1NGXA 2KL6A 2H3KA 2QT6A 3WKMH 3RKDD 1AKJD 1Z5HA 2CQVA 2UXGA 4NZRH 3C5ZB 4IBZA 1C5BL 4UM8B 5GGUA 4S1SH 2WYZA 3N9GH 3W11D 1RUAL 2WLLB 3CFKB 4FFZH 5D7LD 4OI8A 3TASA 1BSIA 4U3HA 1EWHA 5IROA 3IAGC 1N0LB 2J4WL 2XWTA 1F6AB 4GKLA 3SE9L 2HTKC 1CLVA 2MQGA 2AXGB 2G3NA 4XPBL 4H8VA 1MW2A 3G6JA 3VG9B 2DD8H 4A2FA 1QUNA 2WQAA 5DEZA 3S37X 4KXAA 4R7VA 1GGBH 4NZUH 3JUZA 4LNRB 5ETUB 3QCVH 4TNVK 3R0NA 4QTHB 1KENH 3ARPA 4ISVB 3NDZE 5F71A 1U9KA 1BM7A 1FGNL 3ETTA 5AEAA 2X4NB 4PRIE 4MAYA 1KJVB 4BUHA 2OMWB 1KUMA 1HEHC 3N41F 4CILA 4YK4B 1QLRA 1IM9A 2P28B 2NYAA 2DEYX 2OYMA 5ISZD 3GSNH 3BVVA 4ZFFB 2CKBA 4AVRA 2XTJC 3EH5B 3OAUH 1BAFH 4BCZA 2AJUH 4UV7L 3NJFA 2OX5B 3ZKXB 4AG4L 5D93C 4GO6B 2G2RB 4NDMA 3L5HA 3E6HB 4FA7B 3WHE0 4ZS6C 3A3YB 5H4YA 2APBA 3TJEL 2QDVA 3BRFA 2EZ0C 1L9SA 1Y0LB 4JFVA 1I1YB 3I02A 3N1QC 3NSYA 4OLWH 3U2IA 4Y8AA 4ZNCD 1A2YA 3LNFA 4LCIL 3ZQ9A 3CSPA 5FDWA 3RFZA 1XGPA 5EPMA 4HKXA 3KW8A 1T22B 4DGIL 3ZDZF 3MOAH 4FKEA 2W0KA 4NZFA 5SX4I 2J3SA 3CMOH 3SPJA 2J55A 1WISA 1SYVB 5D7KD 3PJNA 1F2XK 2KYIA 5HVFB 1R3HB 3SGKA 4JW3A 3BKYL 4B9ZA 4J1UA 5FO9A 4ZQKB 3VQ1C 2WJ7A 3FULA 1ZGLM 3QIBA 5EORL 5C6TH 4QR7A 3MV7E 3TWYA 3C2AL 1P6FA 1XVSA 4L8SC 4JCWA 1KEML 4YHYB 1ZPUA 3J27A 3TEUA 2Z93A 5SWQB 3HI1B 2XZAL 3OHXA 4ZQKA 1PZBA 2B9AA 2B59A 4AMXA 5F1KC 4YXLL 2CGRH 2VLJE 1FIEA 2BSEA 2YWYA 5DMGC 3OXSB 3T9WA 4JFFD 1F86A 2P3YA 4ZMOA 1OALA 3RBSA 1QD0A 3ZTJG 3FT3B 4HIHA 1FO0B 1T4KB 5HHOA 1RQ5A 3NSCA 1LXMA 4TLKA 3CPLA 1DQLL 2PW1B 3E8UL 3L5XH 4UQEA 2EIMB 1KLGA 1BIIB 4RRPM 3ZGHA 5D2NC 5A3ID 2MMXA 5HI4C 1GYWA 3TNMA 1XGYH 1IBBA 2IV9A 2BVTA 1MDTA 1TZHB 1ZHNB 2G2RA 3KPNB 2H1PL 3MRBA 4NWTH 3LPGA 3IKKA 5HHOD 2H1XA 3VM5A 1KYUA 1GJWA 3GS7A 4P05A 5K9KA 3MACH 1DE4B 4GS7C 3UCRA 4GAJL 2YD9A 3OL2A 5FKAB 1K8DA 1SJHA 4Q56A 1XGQB 1PGRB 5TDPA 1F11A 1Z5LB 2VC2H 4BH8B 4J4PD 2KZ1B 3ZDXE 3KPPA 1GZQA 4R7XA 2BRQA 5K1VA 3UGUA 4G6JL 2G3MA 1T89A 3FPYA 4AIZB 4S1RL 3VD2A 2IPTL 1N8ZB 1SYSA 5CJ8A 4G8GA 4JB9L 4H40A 4JG1H 5CJOH 1DBMH 2FATH 3BWUF 3MA9H 1TO4A 4G6AD 3B3BA 3EBGA 5EZPA 3CN1A 4M43L 1Z0NA 4N8VB 5LQBL 2JIXD 3L13A 1BXXA 1II4E 3OQ3B 3EO0B 3CK0H 4F2ME 2LVCA 4HJJL 2ZNXA 4NJAL 3SDDD 4XP5H 3AAZA 4MCMA 2ESVA 1JZGA 1W0WB 2WWKO 3D4GA 4X0KA 3X1NA 4YSUA 1JPGA 2VPWA 2DM4A 2ERJC 3SE3A 3D2UD 2V8LA 3WUWB 1NOFA 4DK5A 5JLZA 1A25A 2JJSC 3MV11 5EHFA 3TEZA 2H3NA 3ELAT 4YFLI 1FLTX 4Z7UA 1UOLA 1IW7D 4NKDB 4QCIA 4TQEL 4QRUB 1RPQA 2J88H 5B38G 5HI5C 1K5NB 1RZIB 4YSAA 4WKZA 1VENA 1V3JA 3UPCA 2ZJSL 3SGEI 4I4WA 4ZMLA 1FG9C 3QJHB 3LMJL 5J4MA 2LR4A 4KI5C 5IVZB 3RIFK 2NUTA 4YGVB 4W9FC 5BQ7A 2IQAB 6FABL 2AK4E 4AQ1B 5T1JA 4NX0A 1UA6H 3V7AG 4XB7A 1AS7A 4QTHA 5IT2L 1B4LA 1ZKAA 3MOQA 5IQOA 3E2HB 4DVRL 4NO5B 1BQLL 3LEXA 1TWHA 1OW0A 2OQJB 2VR6A 3TCLB 5D7HA 3D50A 3EJZD 1BXAA 1HH6B 2VDQH 1VFMA 3QUXD 1R5VA 3QZPA 2BP0A 5E2UL 1SMAA 4NQQA 4D7ZB 5K93A 4UQAA 5DYGA 1HZHL 2XTLA 4JJHA 4F2MA 1JF5A 2NW3A 1N8ZA 2ICWI 2W81C 3OHXB 4XPFL 2EJ1A 5F7AA 3V0EA 1L4IA 2VUOA 2A73B 4PB0H 3VFOA 4LSQL 4FMVA 1Y1VA 4LPCA 3EH3B 4H1LH 5C18A 4OLXH 3H4FA 1U3JA 5KYYB 4TUOA 1EO5A 1WC7A 3MHZA 4G8GD 3TO4C 3WIAA 3ULSA 4JFDE 4HLJA 2A68D 3GS0A 3KPLB 2W9EH 5BVJB 1PG7H 4RZCB 1AO7E 4PJHF 2ZUQC 1XZ0A 2GEEA 2JKIS 4AQ8A 4Y2OA 4Z7WB 3HBGA 3BESR 3UTOA 3RWHA 2I25N 2ZICA 4XPTH 1EVUA 3ALXA 3KLKA 3VO0A 3RWCB 2PMZA 5C71A 1INDL 1LMIA 3GTMA 1WV7T 4QXGL 2WWNA 3NQKA 1BVKA 3ABZA 1ZVSA 2EVHA 4KY1L 4Z7VA 3DK2A 5BPPA 3I85A 5EOQH 5IHLB 3HHSB 2EXSA 2XXGA 2ZG1A 2F7IA 1WO2A 2E6QA 1JPFB 2AQ3A 1IJ9A 4G6KL 3HFMH 5LNEA 3HE7D 3C08H 4ALAL 4C4KT 4IBUA 3QEUA 3S3JA 4PJDB 2FX9H 2XZCH 5KVGH 1D9KA 1E4WL 4LCIH 4L1SA 1NCCL 2GTZB 3ARTA 5H37A 1WZKA 1AY1H 3LEYL 3EDKA 3IN0A 1FLRH 2OQJA 1OHZA 3QUZA 2B20A 1KGCE 1TITA 1YEJL 2X41A 4R5XA 1JRHI 4N8VG 5ISZA 1DSFL 4J12A 2X88A 3STBA 3KYKL 3RTQA 5F1OB 1ERNA 1I9RL 3FUEA 2PPAA 3KPQB 4OZ4B 2DQTL 2VPYA 1CS6A 2A6KA 5HYJD 1Z7JA 3C8HA 4LLWB 3VFUB 1J05B 5EC2A 5TE7H 1WBYB 1R5WB 5ICZA 1F8TL 1UYWL 3UAJC 4NOHA 1L6XA 1TNNA 2C3VB 4RESB 2Q6WB 1YZZA 2GQHA 3Q2LA 4JJ5B 4KKCD 3FOMA 5AAPA 1N6UA 5FYKE 1WA1X 2VRKA 4JHBA 4JVPA 2ZOKB 2V7HB 1CL7L 1JV2B 3K7UA 2A6DB 1E6JH 2OK0H 1OPGL 2ZG2A 4BKTC 4H8PA 3O2DH 1WGOA 2V9RA 4JFXA 3MRCA 4AVKA 4HG4J 4IU3B 3GIVB 4LESA 4NPKA 1R24B 3PL6A 1PD0A 4JANB 2XNAA 4PUBL 2EICA 1N6VA 4B96A 3MV7B 4Q6IC 1RD6A 4PG9A 4TULL 4PMEA 4U1JB 1ZSHA 5CZXC 2OLDA 2EE6A 1A0QL 3OZKA 4LARL 2I60H 3DA0A 4FFZL 3AU1A 4AL8H 3SDAC 3O2WL 7PCYA 3SJVD 2J8OA 2Z91A 4MNQD 4NZRL 4W9KC 3LIUA 1AGEA 1H3GA 4YXHL 3GYRA 4ADGA 4WI4A 5GGSA 3L4TA 1RUMH 2FWSA 43C9B 1XF2B 1PSKH 1M1SA 1V10A 2VLJB 3KCWA 2AKRA 4P2OC 4AYDC 5IEKB 3K4ZA 3LVEA 3I6SA 5E6IB 4G3YH 4F7KA 2FEEL 4K73A 3P9LA 3KD4A 2VXSH 3LZNA 4QI3A 3TT3H 5JIMA 2I9LB 2RR3A 1FL6B 4OU3A 5JDJA 4FXTA 2HVJA 3DV4A 3KYOA 5IEKA 4HGMA 2EEAA 4MJIB 2CMRH 3NZUA 3CH1B 3KM2A 1I3RB 3G5XA 1YEDB 2GB2A 3LRSB 1NANI 2VXTL 3RJQB 3QO0A 3BVWA 3HHMA 4ZOCA 3BHBB 3QCTH 3KPNA 1XGUA 2R4SH 1R0AL 1PQEA 3H42H 4N2LA 4JFQB 3Q9PA 35C8L 3WTSA 3BO8A 2EDWA 1NLDL 4WEBL 4FJ6A 1HI6A 2NXYC 4N0YL 5HHXH 2P46B 1KPVB 3TFKC 1G9ML 3TGXA 1BLNB 4AKQA 3RU8L 3Q2CA 3G5VA 1ADQH 2JELH 1E5CA 4JFOA 5GS2D 2GABA 3MLTA 5HYSB 4EI5C 1CMOA 2BW4A 2PXYD 5E1GA 3WLBA 4U1HA 2XPGA 2DLTA 5FTLA 4NKIH 3BQUB 3EYVA 2EDRA 4XMPH 4GSQA 1CFSA 1WQVT 2YQGA 4JFXB 5FF6B 2CR0A 1KY6A 2TSBA 2YOCA 1WCBB 5K9OA 4QUOA 5ITBH 1TSRA 4K8RH 3FAWA 1L9NA 4M5TA 4NP4L 2HJFA 2NY5H 3TH3T 1FNAA 2F15A 2J8UF 1B3IA 4B60A 4BA0A 1HE7A 1Y18B 3EYUL 3BD4A 4N0CC 2Y2YA 3HMWH 3V8OA 1YNTA 4D0BA 3VD4A 2H2SD 5HDRA 5H35B 3T2PA 2AP2A 1OCCB 4OT1L 3HC3L 1DLHA 5CIPB 5C2UB 3SDXE 2ZKYA 2HFGH 1Q9OA 3KWVA 4HIEA 4P59L 4NO3A 4YO0A 4OLYH 5D6DA 4WFHE 3QAZC 4A66A 4HULB 1H15A 2ZOTA 3AT9A 3VTTA 2FL5A 4FLOA 1H3PL 2FB4H 4K9EC 5IJVA 2XV0A 3HVNA 2WKOF 3S8GB 3EYQD 5KUMA 1ONQA 5DO2D 4K3HA 2B3IA 3BHBA 5E1AA 4BGDA 1AD9B 2KH2B 25C8L 1IC7H 25C8H 1GRWA 3KGSA 5DJXB 1ZHKA 5E03A 1X9RA 3AB0C 4IBTA 4HSAC 4QF1A 4QHMB 2MTAA 3LKQA 5IEHB 4WKZB 5EULV 3QFJE 4OCXH 3BIAX 3PWNA 1RPUA 4V11A 3SDCB 3ARFB 2FWUA 2L7JA 1OF2A 1DVFD 1U8HB 2VQTA 3RDTC 3D0VB 4OLVL 3L3HA 2QQNL 1TFHA 4DK3A 2VTFA 1ZT1A 4QJ5B 1TZGL 4AZUA 4GKSB 1CTOA 4Z3GA 5EA0L 1A8JH 5FYLD 12E8H 2VABB 1W2KT 3CJJA 1LP9F 1NAKH 1QTYT 1HK6A 4U1HB 2P5WA 3WNKA 3SPCA 4DP8X 5DK2B 5CZXD 1NIDA 3H85A 1UWEH 2NYKA 3MRKA 4YGAB 3TO4B 3VMOA 5G2NA 4TUJA 3X1EA 4MB3A 4OAWA 1HOCA 3KS0H 5DJYA 3RUGA 3SEPA 2EIZA 4NNXB 1CBVH 5TE7L 3FUNA 3ULVL 4N2GA 4IJ3C 1YEFL 3JWNC 5EOTA 3RAJL 4HFUH 4JJ5A 4XVSH 3SZKC 2WANA 4HJTA 3RA7H 4Z7NB 1EA9C 3GXUB 4NKIL 3NOIA 5E1QA 4KKBD 1Z3GL 1QHQA 2OCFD 3VFGH 2BOLA 4L9LC 5GJSL 3FSZA 2BOCB 4RSYA 3P3UA 3HLAA 4YPJA 3SD5A 4FGMA 1S7QB 3NG5A 4WSKA 4WO0A 3L4ZA 5IW1A 2V7HA 4XCEB 1GAFH 5KSBF 3FQWA 3V5HA 4FTVA 2O72A 2Z7YA 5I15L 5ESAB 3TIEA 4FQ2H 5DK0B 3TPUB 1NGPH 5FK9B 4JZJA 1RH8A 3NPSC 4IKIA 3APMA 3NN8B 5HYSG 2XWCA 4HS6B 1FVCA 3C6LA 2NUTB 4LIQH 1ASOA 2YGOA 1CR5A 4G6MH 1P4BH 4EN3A 2YFNA 4WEMB 3X14B 2A9BA 2ZP0T 2EEXA 4KK8D 1KFGA 4KDTA 3TESA 2FEEI 4XOBA 3DRQB 3F05A 1N64L 2J1WA 5F3HA 1BEYL 2QFRA 3VMNA 3TNNB 2IDUA 2WWOA 1D7FA 2YS4A 4GKNA 3QNZA 1D9KB 3CFNA 2Z8WC 3JTTA 1X6NA 3H3PL 4MVBD 4QRRE 2YC1B 4A1RA 2ERJB 4CKQA 4NQXA 4EN3D 3O4LE 2HSIA 1YY9D 3ZE1F 4OCLC 3HW7A 5GIRA 5IW6B 5GSVA 3RUGE 3GIZL 2JJVA 4FI6A 1SJEA 4CGUB 4PJ7A 4LFHD 4NO0D 3UTTB 2YGQA 4GMSH 3MRLA 4TSCL 2OMXB 2P8LB 4FQCL 4F8QA 4BGLA 2Z65C 5KZCD 5GGQL 1TTRA 3JVGA 1RJYB 3BFOA 2X09A 3H7LA 4LLYA 2BPBA 1PJ9A 3JT2A 4GIPD 1MF2H 4LEXH 1CLZL 2ZG3A 3ESUF 5C0CB 1HAWA 3UERA 1W8EA 3S35L 1SRDA 5T5ID 2H2PC 2AE0X 1XZ0B 4JFFE 2B1HL 4HGWB 5DJAA 4PW3A 2O5ZL 4IJTA 4G8FA 3GBMH 4AGPA 3ULSB 2IADA 3RZWA 3MNMA 4JFFA 4JM2B 4XNAA 5IT2H 5JIQA 1G7PB 1FG2A 3DGGB 3GFUA 5J1AB 2Q10A 5I0DA 2BSSB 3HBZA 3PGDB 2JFCA 4TM9A 2E6PA 4GJTB 4FNRA 2E76C 1PX4A 5AW3B 2HT3C 2E7HA 3LIZA 5C0RH 3OXRB 4GS7B 5BZZA 5CKAA 3BPCB 4DZBA 5KYUA 2HVBA 4F1SA 1NCDH 2YR3A 4YSRA 2O6CA 3MNVB 4HP5A 4FQXB 3MRQA 3QJHA 5E6IC 4JPVL 5HP5A 2JVUA 4C4BA 4N8UA 5TF1H 2FX7H 4FYRA 4JPKL 3HZYA 2X2IA 4DN3L 1ZSDB 2E74C 4NNYA 4Z7VB 5D2NB 4L37B 3UROR 5MHSD 2F8IA 5E0FA 2XSKA 5FUZH 5FTNA 1E2VA 3HCVA 5KVGL 4RFNC 3I9GL 4HHGA 3QQDA 2B0SH 5DCCA 4B7LA 1KG0A 2YN5A 3VD1A 1I3RA 3G5XB 1BBJA 2YUVA 3SGJC 4QRPB 5LQBH 3OXSA 3QQ9C 1RERA 4OJCA 2YQ2A 2PJJA 3N0AA 4G3YL 1T7YA 4YZWA 5I26A 3D2UB 5CLWA 1OB1A 2NAPA 4OV5B 1J8RA 1WTGT 1Y7VA 2WNWA 4TRPL 1OEZW 2YZ1A 4QRAA 5IBUG 1RFDH 1VFAA 3LV3A 4FADA 4IBVA 3ZDZB 2R0LL 3BGAA 4IIZA 2JK5A 5LN8A 4PJEF 2IH3A 3ZHLA 3OVUB 3FQXA 5BNXD 3NK3A 3EDJA 1O5DT 2I60L 2EC9T 4WK4B 4PTUB 4JRLA 1HINH 4JQXA 1MCWM 2J12B 3NCWA 1A5FH 3FTSA 2FQFA 3DHMA 3FU9A 4G6AC 3AU0A 5DJ6A 5I8CB 1JV5A 2Q7YB 4FG2A 1WT5A 1JWUA 4NQSB 5IVXB 3HTLX 3MRKB 4X2UA 4LEBA 2RBLA 1SVZA 1JRHH 4YHKL 2O5NA 2AF2A 4DSYA 1HX0A 2H8PA 5DJZA 3UPRA 1ES0A 1OPGH 3L1EA 4UM9A 4JN1L 3CE1A 5ICUA 2VR5A 4M8RA 2HG5A 3E8UH 4DQOH 1PZ5A 3SBWA 3I75B 1BF2A 5I75C 3UJIH 4N3TA 5I1CL 3S5LA 5C0JB 3KXFE 2QJDA 2WYTA 3L9RB 2DWTA 1JK8B 1A1NA 1HH9B 1G7MA 3CHXA 4NP4H 3RVXD 2XBDA 3SCMA 2VDPH 1O9VA 4L2LA 3FT3A 3K91A 4HCRL 3IE4A 4TXVB 5E6SB 3MGOB 5H94B 2Z31B 4F7PB 5LXGL 3MROA 1OIOA 4HAKA 2HLFC 3BSZH 1CK0H 1EVTC 2A6JB 5GRXG 3GHPA 3MO1B 3BEVA 3D69A 1J10A 3ULVF 4OZGA 5C97A 1GCFA 1MREL 4KMTL 4UOJA 4XH2A 4E2OA 1X4XA 5EO0A 3UG4A 3VWKB 3AT0A 2J8UE 1SEQL 2DQMA 1J48A 1UCTA 5HJDA 3CSTA 2D0FA 4ADIA 3GLDA 4BQ8A 1MFAH 2WQUA 4N4YB 5E6ID 1QBML 1FO0A 3OV6A 4EIGB 3HPJA 4AY0A 3ZRSA 3VXSE 3MUHL 9PCYA 3HPLA 2CK2A 4S11A 4YNYB 3HA0A 3N1MC 3UC2A 4MNHA 3T0DA 4FMFA 4DKEH 1SEBA 4XP5L 3OHXC 4D94A 1MUJB 2P5WD 4GKOA 4OZFA 1CBJA 1PZAA 5E95B 2FSEB 5E8DL 2GSMB 2AHIA 3B9VA 3BZ4B 3QHZL 4H88H 4KV5F 2NTFB 3N5AA 5I1JH 4DMRA 1MNUH 1TZ8A 5GRWA 3EGXB 2V37A 1GSKA 2P52A 2AV7A 4RWHA 4ZUWA 1K8DB 1SJHB 1BFVH 3BP6A 4KKQA 1E4XI 4QAWA 3T1WA 2K3HA 2W9EL 3C6SA 4PAZA 1QNZH 1ZTXL 1U8LB 1WH0A 4OKVA 1F3DH 2IWKA 1LJMA 3E2HC 1H19A 3HE6A 5E23A 2V9TA 2EIJB 3EJZC 3GSOA 1W15A 1G9EA 3TFBA 1FDLL 2AEPH 4H20H 2I85A 4DPAX 1ID2A 1WJ3A 5FYJU 4AQ1C 1XB3A 2VMCA 3Q8BA 3L9RA 1LYQA 5C0IB 1UVQB 4NCC2 3VCLB 5AAWA 4GNKB 3V0JA 1E67A 4XNMB 1CD9B 1O75A 2H32B 2L7EA 3ZMEA 4CBPA 1SOQA 1LP9E 3R0MA 1QYGL 2WXPA 3L6FB 2IANB 4FFVC 3PP3K 4NQDD 1QBAA 1OT2A 2OMNA 3LNDA 5CBEB 3NN8A 1RKRA 2NY6C 4OH2A 4CJ1A 4OCYL 5GS0L 1X9QA 1WITA 1IKFL 4DZBB 2A9NH 2WSPA 4PJBA 5DK0A 3TIEB 3TPUA 1DVFC 3V0HA 1JDCA 1R5IB 3PUUA 2F54E 1TG8A 4PWEA 4DUVA 4IGBD 3VI4B 5JOPE 4LAJH 3SN6N 5MENA 3I6GA 1Q94B 2CHXA 4FZEL 4U6HA 4JPQA 1MFBH 1P2CA 3C9NB 4PRPE 3W37A 1H8LA 2D9CA 4UOQA 1IBHA 3RX7A 4L8CA 2ADIA 1M3JA 3QG6B 5ACLA 1E5AA 5HGDB 3L7EA 2E9GA 4Z7VE 3WV0A 1UT9A 2XZAH 5SWZD 3SY0A 1T7XA 4GXFA 4HX1B 4BZ2L 4YUEH 4MXVE 1XX9C 5B3JF 1EHAA 1T1XB 3L3KB 3ULUL 5DXWA 4HBQA 2O1AA 5D7LB 4RIRA 4TQ8A 2VDNH 2V17L 2OPCA 3VFNA 3VXMD 2B1AL 4JREB 3FB5B 1UD3A 5CILH 1NMAL 5I30H 3NYKA 1CYWA 2V5TA 4GY4A 4J23A 5JXEA 2CDGA 2HA1A 4P5TC 3OM3B 2AK1H 4MMYB 5IROD 2WXIA 3FRUB 4QHKJ 2OR9L 1H5NA 1WAAA 3PHQB 3X2PA 2VDKL 1OZTG 3APDA 3LD8C 5I30L 4B9FA 4ALAH 1EMTH 4ZO6A 1TO5A 4WIQA 2XZZA 4N2IA 4OLWL 3GTTA 3GXTA 1RSFA 3CN0A 3PAYA 3OKOA 3WL9A 5EFIB 5IF0B 3U7WH 4A6YH 1KOAA 1VGKA 2YD6A 1U8PA 3PREA 3EYOB 1AO7A 4JB9H 1IM9B 2TSAA 2P4AB 3GMMB 4KVCL 1KCVL 3BP5B 4BWWA 1TCMA 1I8KA 2UV3A 3VXTA 3RY6A 4K15A 1DL7H 2XQYA 4XPTL 1ZGLA 1ZXKA 4KFZC 5D1QA 3DWTA 3H9SB 4MA1B 4HQQL 4P8QA 1NSNL 2QPSA 5CAYB 5A3IC 3GSUB 1WIUA 2GKIA 2Q86A 5C0AD 1M7XA 1WAAF 1NCAH 3KW7A 2IAMB 2IBZX 2VR3A 3CU7A 4LVOC 2V9QA 4OD1L 4NZ8A 4WHTB 4X7EC 5C07B 5I5MA 3I9PA 3U6RB 4I77L 5JTWA 4UIKH 4J3XA 2VSKB 4L1DA 4JFTA 3IMRA 3MJ9H 4G6FD 2O6DA 4AK1A 5HPOA 3PFQA 3PJSB 3K2UL 3QUMH 5AOMA 3G5ZB 1A21A 2C34A 1S7XB 3EFFB 3QEUB 3UBXI 4YHYC 4L8SB 1AACA 2X89D 2UWEB 4ZAKA 2HFEB 5C0AA 2WCSA 2CDFA 3MKGA 5GGUB 2IG2L 3Q5TA 4OB5L 4QNPF 4PU2A 4ETQA 5CN3A 1Y18A 5FO8B 1MCRA 2YXVA 3HG1B 4M6NH 3DMMD 4D0CB 1OAYH 5HJ3B 4HJUA 4LPXA 4GSRA 2H3XC 3ROOA 4AE1A 2PPDA 5T1MB 2B63A 4UTAL 4EZLA 2NW2A 1TYJA 2OI9C 4OAWB 1J8SA 2X4PB 3C5XA 1PD1A 3MCG1 2M2DA 4PP1D 4ZDHA 3UTTA 5D7JB 2F54D 5IIEA 3KEHA 5GS1A 2ADFH 1CLYH 3GPSA 5GSVB 2NX5B 4MJ5A 3D6GA 3FO9A 4LAQL 2YFOA 4GBXC 5F93C 4XMKL 4HWEL 1N5YL 4P4KA 1SY6H 2I07A 3W0WA 2D0GA 4YQXL 5F7NC 4FQHB 3H55A 5LBSL 4Q6YA 1VA9A 4HLZH 2HAZA 3ZDXF 2VCOA 1BLNA 5D5ME 1OO2A 2P8PA 1G9MC 2B3RA 1RULH 3ZKXC 3VXSB 1R47A 4NRYB 3VRLE 3W38A 2Y36L 2A73A 2ZP9A 4FNQA 4AYBA 2YPLA 3SDDA 1XGUB 1A3RL 4N0FB 3CMOL 3GJFA 3FMGL 1WLFA 3MJ7B 3LOWA 3SOTA 3A4FA 4YHNB 3SIKA 3WSQL 4L0ZA 4JFPA 4X5XA 5FV1L 2QKIA 4PJFA 3RFZB 4HJSA 1MRCH 2X4UB 4PJIE 4DUXA 2Y7QA 4KX9A 4F9LA 2GSIA 2IH9A 1DANT 2BSDA 2NZ9C 4K0OA 3RVTC 3TYGH 4CMMA 4ELMB 3HC0B 2MIZA 3K2KA 1SJXA 3MRGA 1NFDA 5D4HA 1G6RL 3ULUH 1CK0L 4XZ4A 2HZHA 2NXZD 4GG6F 2J44A 2VR9A 3MA9L 2XYCA 1OM3H 1J1XH 1BX2A 1GH7A 1KJ3H 2CM6A 4BWTA 1QACA 3PWUB 4F33B 1CR9H 4KVPA 1VEPA 5AYUH 1F02I 2FIKA 4R0LB 1EX0A 4K2UH 3DETC 4F8LA 4UDTA 1TTCA 5AVWB 4YHMH 4ZD3L 5DWUH 3ZHKA 2VLLB 3S98A 4G42B 5BUGA 3LHPH 3M1BA 3BMWA 5ALCL 2PICA 5I23A 5FLVA 1EXGA 4NN7C 3SE3C 1E8XA 2E5EA 4N3UA 2MRYA 4JY4A 2QGDA 1F6LL 2WNGA 5KVGE 1KTBA 1O7DC 4AQOA 1J0IA 5HJBA 2X6MA 2BFVH 2JIXA 3QEHA 1KBKA 2IMMA 3HR5B 4DEPB 1YEGL 3AROA 2HRLA 3QS2A 2AJ3B 4JPIA 3NDYE 2EYSA 1MVFA 1Q4NX 3MJ8A 3MV01 3WIIL 3SDCA 3FOMB 2A9MH 2WZAA 3S48A 3DTXA 1TQBC 3L95A 4FNLL 3DVFA 2CLRA 4E9TA 4B9CA 5A7EA 4FHBD 1UD8A 5EU4A 4PJGE 4BFEA 2DH2A 3CZFA 2CUMA 2B2XH 2E56A 1NBZB 2VLKB 4W70A 4RDQF 2IIJA 4ZX5A 1JL8A 4HD5A 4IBSA 4P57B 1IL1B 1NM4A 4K55A 2NOYA 3BH4A 3KPPB 2WBJC 4I18C 5C09D 2WTRA 5KVDL 4FAAB 3TURA 3KS0J 4P9HH 1XGQA 4JN2B 3MBEC 3O6LL 2Q8BL 1JZJA 4LSPH 2WBJB 3ZXAC 2XA3A 4QTIL 1IGJA 3W3BA 4MLIA 2EQDA 1U42A 3E6FA 4Q4EA 4U6XA 3LQAC 4FQQB 3CFJB 4OGAC 4G7YH 5IHUH 5L2KE 3MNZB 3SDXA 1KCSL 5SWZE 3MX0A 4YAQA 4R83A 5EEXA 2NNCA 1R33A 2CU9A 3VFVB 4XBPB 4O02B 3KPTA 4P4RA 3K3QA 4J3BA 2K9FB 5I0WA 5MERA 4XGZA 5I0ZA 4XNUH 1XGTA 3CSYB 1KGCD 5CINH 5HHNB 1UVQA 1XR9B 1G7QB 2DAVA 4W6WB 1DHKA 5I71B 3RDTA 3ECWA 4UILL 3WKNA 4JPVH 4EEEA 3T77B 1MCIA 3HUJF 3QZOA 5KSAB 1WGVA 1IBYA 1RUKH 3VMPA 4PY8I 2EH8H 3EYSH 5KSBB 1ACZA 1PKQA 3S96A 1KB5A 4WV1B 3AY4A 1X5GA 1KIQA 2AV1B 3MV8D 2BJMH 3RA7L 1ECYA 2JCCE 1GJIA 3CFEB 4NZTH 4NC2B 4AGLA 1F5WA 2F18A 1TYEB 2DEWX 3VE0A 3WMQA 4QHLB 4NQDE 1P1VA 4KRPC 5IB2B 4Z0XB 1ZLWK 5GLYA 4PRHB 1FZOA 3R06B 1SBSH 1FH2A 4F92B 2YSSA 3K2MC 5E9AA 4AYGA 3GJFK 4HPOH 3HG1A 1NPUA 4D0CA 4OQTA 1UJ3B 5DTFA 2XG5B 2AJSH 2HFEA 1AR1D 2JTYA 1YY8A 4MNHB 1WFOA 4P2YA 1WUNT 4RA3A 4ATTA 1JVOA 2XV2A 3JTSB 2D7OA 1F1AA 1P7QB 3WG7B 2BP8B 1ZLWH 2WZ5A 1XF5A 4JL2A 1WD8A 2XVKA 5GPRA 3TCLA 1Z1WA 5AOZA 3OGCA 4WHYG 3LNGA 2BS8A 3UADA 4M7ZC 1QABA 3A67L 1KELH 4Z77A 2JCWA 2ZPKL 2F8OA 3W57A 4EQ2A 3OLDA 3UAJA 2UYLA 5BV7B 3VI4E 5CJQL 1DBKH 4EAEA 5LXVA 3OKEB 5ID0B 1ACYH 4LSSH 1M7DA 1E40A 3LNHA 1EZLA 1NGYA 1SUJA 2XG4A 1J0HA 3S34H 3T65B 1Y5IA 4Z18A 2VZOA 4A6YA 4JL1A 2CLZB 2VOTA 4KXCA 3LXAA 3O6FA 2N0MA 1BVNT 5JQHC 5A2IH 4APXA 1P4BL 3MLXL 5IQ7L 2DWEB 2EO7A 3MGAA 4H1LB 4PRBA 2XWDA 3HZKB 2WXLA 5E4EB 3KBEA 4CDHA 5EN2A 2DQEL 1E0OB 1OV8A 4ZG1A 1HT6A 1ITCA 4HS6A 5GLFA 1A66A 3FUFA 5ITFB 1I53A 3GZPA 2CJUL 5D7JC 4PR5A 3UIYA 1CFTB 4XNXL 1CURA 4J6RL 3FB6A 3FYEB 4AEIL 5DMIL 5KG9A 4MMZB 4HDIA 4LEEA 4NKMB 3OPZH 5DMYA 3MN8A 4R6UA 2O5YH 1ADQA 2IALB 2AEIT 1U4EA 2VPXA 2WV3A 3E3QE 3FQRA 4XN1A 2HFTA 3QDJD 4LVHC 3QQNA 1X9LA 4XWOC 1E30A 4QHUB 3GMOA 3F3HA 5SX5K 4LHUD 2KT6A 3TO2B 3ZMRA 3RBGA 2Z92B 4OGXH 3V0IA 3Q13A 2YXWA 4K7FA 2OCCB 3LPPA 4CVZB 2A6KB 2XQ0A 4PRID 5B4MC 2CO2A 3F5WA 1J8HB 2DYRB 3GBNH 4FXLA 4JFHD 4JM2F 4GI6A 5FO2A 4HUUB 3HKZA 2VDML 3C6LC 4OFVA 5LLIC 3CHPA 3VWJD 3M1CA 1AR2A 2JSFA 2VRAA 3BFWA 1RUPL 1RIVL 5HYJB 2UXTA 1GR7A 4QRPA 3KNBA 4N2AA 1NCHA 1H3VA 1VPOL 4PJAB 1EFXD 3V0DA 4BSJA 3HZVA 4UQ2A 4UQ3B 2JIMA 3CGTA 4JDTL 4ALAC 2A1WL 3GBDA 3GTVA 1D5RA 4X80L 2NYYC 3GSNB 2VZSA 3HS8A 2VNCA 2Y22A 4N0CD 5CJXA 2B7DT 4MD5B 3BKML 4WUUE 4F2EA 3L9YA 3BUYA 4W9DC 1OQXA 1EEZA 5E08L 2H3NB 3V0GA 4EVNB 2NY5C 5GGQH 3WDJA 2ENYA 5DJ8A 3FKUS 4DKFH 1UH4A 3ISYA 4K9JA 4Y5VB 2RGSA 3S5ZA 1TJGL 2B2XL 2K6ZA 4Y2OB 2H9GA 1UB6A 2NY0B 1V3MA 2VR7A 4NYLB 4J8RB 4OUOA 1DN0B 3CQFA 2HKHH 2A69D 4XO4A 3IJ7A 1G7IA 3NIFF 1KN2L 3JVGC 2VSDA 3SUMA 4F9PA 4HMCA 2R2EB 4URKA 3Q3GA 2X6UA 1G8JA 4TOYH 3QR1A 2H1LM 3OC8A 1PKQE 4A7GA 4XRCA 4R8WH 1D6EB 5BZWB 1S9YA 5H2BA 3JWNE 3BKMH 1HQRB 3RWJA 5I8KL 1CJYA 5AVYB 5KUKA 2P80D 2YD8A 3F00A 2DQDL 1D7CA 1D5BB 3MLVL 2XV6B 4LBAA 2FWLB 4X4XA 1HCYA 3TWCH 5JORA 3RWJB 3PWPA 3LH9A 5HVWA 4ZPVB 3N85H 2PWEA 3GMPA 2APWA 1VERA 4AUJA 4R9HA 4XZUA 2SODB 2WN3A 4LQ1A 4PRNA 4ZFGH 2MPAH 5DLLA 3X12B 4HKJB 4OJEH 4ZD3H 3GMRA 2UWEE 3MBWB 4UTAA 3LPWA 3C5JB 4WI7A 3OAZH 3FTUA 3RB5A 4N2CA 3BEVB 1A4JA 4BUQA 2A6ED 4V1DD 5FA4A 1G0YR 1T0NB 4OJFH 3MBEA 3GM0A 3PXJA 4IOFC 5F7YC 2CR3A 1I4FA 2OX5A 1FZJA 3BH8A 3TBWB 5FGBC 3G5WA 3HN3A 2BVOA 3VFGL 4CJ0A 1YEKL 3BGMA 2P9RA 2AZAA 3KYKH 4LCVA 3RGVA 3PDOB 4UUJA 2YRBA 4Y16C 1L7TH 1DJSA 4FQPA 1HI6B 4RGNC 5EN3A 1U8JB 3O8XB 4HG4K 3BN9D 2NXZC 4X6EA 2HG5B 2J5WA 4GQRA 3DRTB 3G5YB 5DJZB 4Y4HD 4LL1A 4KXZI 2H8PB 2A74C 3LB6C 1QR1A 1NUFA 2D3JA 4A7UA 1M57B 2C1PA 4M61A 5LKNA 1NCGA 1U8QB 3Q06A 2WBJA 1DQIA 3X1FA 1S7RA 3CQZA 2BH0A 4LOEA 3ME0B 5FS5A 4QRBA 1OQOA 1JG9A 3P9LB 4U31A 2Z7WA 4CNIA 1R7RA 3DJZA 4EKXA 2BIQA 4CC4C 5D71H 4G71B 4G5ZH 3MQIA 1G4MA 2GYSA 2VLJA 1P6WA 3IU4H 4OZHA 5HDBB 2RQEA 4IGBC 5JHBA 2FZ3B 2LQRA 4JZNB 5EU7C 5I0YA 1TQVA 1G7LA 1KPRB 5E51A 3VNYA 4ZYKA 5F3BA 4D9QE 2NY1C 4V1DB 4XVTL 3VGGA 4BKLB 1IC7L 5B8CB 3MODL 5CP3H 3S3PA 4DN4H 1PG7W 1VACA 5DT1H 4IU2A 4NBXB 5CUSL 1N70A 2H0PA 1HC1A 2EYSB 1U3HB 4NJ9L 1BD2A 4JHAH 4JQVA 3FHAA 4M8QA 2LLNA 3WIFA 2AXFB 3W11C 3UZEA 3HR5A 4GW5A 3VWJB 3U9UB 2FLRT 2E0PA 2MNUA 4TMPA 3AWGA 3WEBA 1RK1A 5LCVH 2JJSA 4JO2H 2XY2A 2ZUVA 3ZGIA 1JNNH 5IFAH 4G8EB 4GKSA 1SHWA 1QPPA 2QZ5A 2V3EA 2Z31C 1PDKB 3K74B 4XI5D 1KYAA 2CDEB 2R0KH 3GSXB 4XNYH 1CGSL 4AOKB 3CDYA 4NKQB 4LKCB 4XOAA 1P5UC 1W72B 3QQ8A 1OARH 2DBLH 3W5MA 4Y89A 5LGYA 5D1ZC 1AOHA 15C8H 1UENA 3VYNA 2HB0A 1MHPL 4Z0BL 1OD9A 5BZDA 4YZFF 3MRPA 2RAMA 3HRPA 2BNQE 2D7NA 2K7QA 1YN7B 4LF3A 4I9WD 5ITBL 3BYYA 1XL4A 1B3JA 3VFMA 2F19L 4NP9A 4M93B 3UFIA 2DQTH 4FG6D 2OMZA 2WAHA 4YL4A 3UAAA 2DM7A 4EOWH 5IJKC 4NCC1 1UC6A 2VL5B 4OBRA 4PY7B 2J2ZB 1H6EA 3DVNA 2QHRH 3ARDD 5I1EH 3B43A 2GT9A 4W1TA 4RFEA 3K81A 4P5KB 3FZUD 3P30H 1MCHA 2OTUA 1OAXL 2E27L 3CVHL 3EFOA 1P9MC 4R7LA 1J0KA 2EDDA 2ZUTA 2XJKA 3OX8A 4DETA 1M56B 3GB7B 3GEFA 3DX6B 2J1KA 4DTGH 4LKXB 4RFEB 4LASL 4XXWC 1AP2B 3C8DA 4G7QB 4AI7A 4C83A 4KJYB 5DA4A 1CO1A 5EO9B 2YMTA 4NIKB 1WWAX 4UF7C 5LB1A 5ELIA 5I2IB 1E28B 3RTQD 3UH8A 1ED3B 2DYPA 1ZS8A 3ABLB 3L4VA 3HMXH 1UM6L 3D39B 3N6YA 3BDYH 3RNQB 4E9WA 3F7KA 4Z78B 4GI9A 2G30A 4HIJB 4IOSA 2F1EA 2P5EE 3ULUF 2X2UA 4GSDH 4I9WE 2XN0A 1H3XA 1KIQB 2AV1A 2R59A 5GRJH 3B83A 1FCGA 2D4DA 4GUPB 1A3LL 1TMOA 2XIBA 4LKCA 5HHVL 2YHGA 1QWHA 4G6JH 1YPZF 1AKPA 4P2CG 4RFNB 3SSGA 5GISL 2P44B 3CHQA 3GZOA 4XWGL 4X6BB 3O2WH 4PBDA 4IS6B 43CAA 2NQ3A 4IOSD 1TF4A 1EDYA 4AQEA 1MWOA 1U8OA 4RRPG 2AW2A 3FSOA 4AJVA 3W1ZA 3MXWL 2NW3B 5I24A 2X7LA 1I82A 2G75A 4RBPH 2O30A 2VUKA 3APNA 2BP0B 3RVVD 4L5FL 3IM1A 3S8FB 3IDJB 1SXSA 5DLMH 1TR7A 5JDSA 1S3KL 1JGDA 4NS0A 1HH6A 3KBFA 4NNPL 1FNLA 1AO7D 1FPTH 3FTZA 4E9QA 5JW3H 1DQML 4DVRH 2WYIA 2XVGA 1YPZB 3CXDL 4JGJA 1DCLA 3UJTH 1UATA 4L4VA 1DBJL 2WLYA 1E3FA 3CZEA 3ZDXB 4JM2C 2R15A 2PUQT 3SKOA 1UQSB 4ORGB 5FUCE 1DJYA 5L8JB 1F8TH 2FYYA 3UBXA 2G4EA 3P2BA 3QORC 4JDTH 3U2SB 4IMLA 2WXHA 4OZHE 2CR6A 3K46A 4Z7UB 1HNYA 1MH5A 1ZANL 1B9KA 3OR7A 3O3BB 5AVRB 2AJZA 3SBQA 4UQBA 4QGYA 4MA3B 4HKBB 5JXEC 2A6HD 2BSTA 3OKKA 5HYQB 4HT1L 4XBEH 1AKJB 5AENA 2J71A 3WNMA 2EZ0D 3K6SB 2JF1A 1Q9LB 3TM6A 5HHPB 5HTSA 4CBZA 3A47A 1NC2D 1AR1B 1E5YA 3CXHK 2PN5A 3U6XS 4F8PA 3C08L 3UTQB 4PFEA 1MIEL 4BKSC 4JJOA 5ANME 5D7LA 3TU6A 4A7TA 4IBWA 4KO8A 1GMEA 1Y6MR 4BH7A 4KY1H 1KNOA 1QAWA 5DS2A 2C9SA 3U7AA 5T5FL 2LTQB 3GTGA 2F1BA 4XR8C 1D5MB 2ATPB 2VXQL 4OZIA 4B53A 4ZTEA 5FWRA 4DGWC 3P3TA 4V1DE 1P0SE 4DKTA 3UO8B 3IAPA 4I87A 3ZX1A 4CA4A 1MHEB 4I48B 2W65B 4FKHA 4Z3HA 1NKRA 4XVOA 4L48A 4JFDB 1F4WH 4JRYA 1AS6A 4A67A 4GAYA 5DQ9A 2FDBP 1YEHH 5CLXA 4KOBA 3RRQA 1XHHA 3MCLH 3UYPB 4X8JA 1U95B 3ZT6A 1YMME 1H0HA 1D5ZB 4NSKA 3L2LA 4X7SH 2JKLA 3T3MB 4GG6B 2FO8A 2JA5A 3QUMB 4XAWL 5F1NA 1RL1A 3UAEA 5C1MB 3UO1H 1G7IB 2QVTA 3MODH 4LSSL 5E2UH 1L5GA 2JLPA 3LIZL 3EJQA 1GGCH 3RIAK 1BVKB 1PLAA 2E8YA 1DQLH 5DD0L 4P3CL 4EMZA 5EEZA 3FAXA 3LEVH 5GRYA 3KDPB 3MLSH 3D4CA 3L3IA 4ZTPL 4R96B 2CO3A 3DK0A 2X5PA 1BVZA 2ZWNA 3OMIB 4KKRA 4P5TA 2H7WA 4BV1A 3F7QA 1FFPB 2R0LH 4C56B 3T4AB 5DEFB 4ZOBA 3RZCB 4TRPH 1L0PA 4Y2DA 2X0WA 4WW1B 1I3GH 1KDIA 3HI1A 3LZPA 1MLBA 4GFTB 4JEGB 3C2AH 4ENEC 2F8XC 1AZNA 1M2VB 3K71A 3VH8A 4HMDA 1D7DA 3SDCC 4K9EH 4Y88A 5C08B 1RJLB 5I19H 1F58L 3FF8A 4GBXD 1P7KA 2KQMA 3PWVA 4FQIL 4I1RA 3VXSD 3V6FB 2PTTB 2HPOA 2DQIL 4EI5D 1Z66A 5HPMB 3BXNB 4KRLB 3AREC 2ARJB 5G4NA 3KWWB 3W2DH 2VDPB 4OF3A 4LVEA 4QRRA 1FVEB 2ADGB 2F7QA 3WENA 5JYMA 2ORBL 3BQVA 1N0XL 4BDVB 1VKXA 1NFDF 1NA8A 3QA3A 4HZLA 2CGYA 1DQDL 5ENWA 1I3VA 4OFQA 3QBTB 1GW6A 1T7WA 4L8DA 1TEYA 4BFJA 5KVFH 3SPGA 1NIBA 3QORA 2YUJA 1HHJB 1NQBA 4AYFA 5AVVB 2F68X 4S0SD 1OP9A 5IVZA 3NMEA 4M1GL 1IFGA 4U33A 2OYKA 5IB5A 4FCHA 3WN5C 3MDJA 4W93A 2F61A 3CHOA 1ZJBA 4GAFB 4NC1C 1RV6X 3AFLA 2IV8A 3CN4A 2KQAA 3CDFA 1X44A 5D9SB 3C8KB 5FYJH 2CO1A 4MSWB 3GSVA 3VFTB 3JWNH 1EO7A 2H4EA 3P4OB 3BAIA 3P4OA 3HUJB 4I3RL 1OAUH 3QFDA 2FBJL 4PJ5B 5A2LH 4AM0B 1FPTL 2A9NL 1OAZL 1SZNA 3PHQA 5IFHL 2R83A 5CR1A 3T1FA 1O9WA 2DQDH 2V9UA 4P48A 2DIEA 5FECB 3N1PC 1HESA 4EI5B 2PWFA 3I2CL 1MCQA 3KJ4C 4WO4D 1CLZH 3ARUA 1TWGA 4UBDC 1MFUA 3GRGA 3TJPA 4E41E 1BZ8A 2WTOA 3MXWH 3IJSB 1WEJH 3LN9A 4FFYL 2BIMA 4MCYA 3VB8A 4M3KB 5BQDA 1EGJH 5GS0D 4QAMB 2GC7C 3EOYG 3T3PB 4FFYH 4FXKA 3KXFD 1A6UL 3QRGL 3RL2B 4DP1X 1G87A 4LCUA 3RZCD 4U7KA 4YLCA 3D0LB 3EOAB 2QLVB 3JWOH 1J5DA 1GY1A 2MQCA 1A7PL 1WWCA 3RFRA 1MY7A 5DMKB 3QPQC 3TX4A 3HS0C 2EUVA 4FKKA 5D7JD 2OBGA 4YWGL 1BFVL 4X42A 4OTXH 3ETBF 3EYFB 3RVWC 5DU7A 3UL4A 4WI2A 4EDWL 3BZDA 5H4ZA 3JWNG 2ZSWA 4BHUA 4Q9QL 3EGSB 4FYTA 3FU6A 1YY8B 4AL8C 5LNDA 2Y6SD 1V7MH 3ATAA 4UTBH 5TJWK 2VMFA 1VPOH 4MNQA 2NQCA 1QFWI 2DMCA 4ODXA 3T4YB 1JZHA 4HUWA 4LIQL 1JHKH 3V4VH 3ET9F 1NIEA 1GHFL 3PNWA 3QR0A 1KLUA 4PLKC 3MBXH 3GSRB 4QXTA 4WK2B 1PZUB 2BOBB 3ZQWA 1P1ZB 4LE8A 5D5MF 3IFOA 5DVMA 4J5VA 3VI3B 5J7CC 3VRLF 1WC2A 1T0PB 3MOAL 4ACPA 5H8DA 1R4XA 3WO4B 3QXDB 5KS9F 1RI8A 4RFOH 3VCLA 2EKSA 4HWBA 4IDJH 1T83A 1BMZA 1JXFA 4HKZA 4PJ8B 4HK3J 1J1OH 1PNDA 1L9MA 1A1OB 1U91B 4BHUI 3KYMB 4R7DA 2V33A 4LL9A 5E00A 4NGHL 3OPZL 1JPTH 1N8OE 3B7RL 3N0PB 2DYPD 1J18A 4F7TA 3MJWA 4FLQA 2F19H 4MGXA 3RAJH 4I0PB 4YDVA 4N2BA 2YXFA 3WO3B 3GXPA 3ZDYE 2YPVL 2Y1AA 4IKJA 3FTYA 1CFNA 1BFOB 2XWBA 3CUPA 2F54A 4MMXB 1G7PA 1MFDL 5F89B 3Q5YA 5T1KD 1KDJA 1M7IB 1HHGB 3V5DA 2A9CA 1F4YH 2KHAA 4ZSOA 4K3DH 4PJEB 4QXWA 1ZJAA 3CX5J 2VDOH 5DJCA 5L2KB 1KENL 4EQ3A 5KTEH 4Z8FL 1T22A 4G7RB 4P57A 5JYLA 1P69B 5CZRA 1JP5A 1M2OA 5EO1A 1WD9A 1RHHA 3CFBB 4TNEA 3T6QC 1I1YA 2ITCA 1S9VA 3AVEA 3LQMA 4PWKA 4U1MA 1QRNA 1P4UA 1DBKL 4YJZL 1QWUA 3ZL4L 3NJIA 1I7TA 1HN1A 2QPUA 3D39D 2WZ6A 1W6WA 2F53A 4NI6A 3B3IA 3PDGA 2UXVA 3TH4T 1J0YA 1EAOA 2KKQA 5JO5A 1T6VN 4PJ9A 2IG2H 1YRKA 3EOTL 2CO6A 5I8OH 2VT0A 3FT4B 1TWFA 1MFVA 3A4AA 4KDTC 4G9FE 5AZ2L 5CHNA 4HOZA 1O5PA 5GGSY 3FQTB 4OGAD 3DDGA 1YMMB 1ZWIA 3QUKB 4PJGF 1YSOA 3ZE2B 3VXNA 3IFPA 3MRDA 2ITEA 1MCCA 1E9OB 2MPVA 7FABH 1UEMA 3SHSA 3I9IA 1VF5C 2XTJD 3ZYZA 2GBVA 3QQ3B 2QVKA 3HMWL 4HUVA 1CGXA 2PYEA 4W68A 3O3EA 2DL2A 1SHXA 2UVEA 2WKOA 3CSBA 4TV3A 3UBGA 4HF5L 1DVYA 2E7CA 2DLIA 3BVNB 3ZHNA 1SBSL 1DVUA 5ABDE 4NGHH 4YHOL 1SXAA 5GGVH 4N5UA 2NNAB 3ML8A 4TPRH 2Z8VC 3WXWL 2YJLA 5AW1B 2CRMA 1BOGA 3OKMA 4OGZA 1PQHA 4EZJA 2GTWB 4I18A 5TF1L 1RSYA 3BISA 4O2CA 3OKDA 2DQUH 5KANG 2EVIA 3MV8A 3HAEA 1CFVH 4KXBA 2GJZA 1FWXA 1D7BA 3D12B 4F8NA 4M00A 3PP4L 3ZZQA 5T3ZH 3OJDB 1WS7A 3U4KA 5C0RL 4GKZB 3MRFB 5FO7A 3Q8FA 1NLDH 2CM5A 4NCDA 4POZD 1I9IL 2OMVA 4ONHA 2OKMA 4QRTA 4WEBH 4RGMB 4WU7B 3WIHH 4TNGA 2G0KA 3UC0L 5F6HI 5EWIL 2OJZL 5L4MA 3PXHA 1U3HD 1B2WH 2JCCF 3RWIA 4GUQA 3KE0A 1V7ML 1OTSD 3LNIA 4UTBL 2BVYA 3D7PA 4P2RA 1ZIAA 3ESNA 4JRYD 4ZW8A 5BMFH 1OGTB 3SE8L 4XP1H 3ZL1A 3V6BR 4ECNA 3WTYA 2I07B 4H44C 3W0WB 4G83A 4Y2DB 1Q9WA 3S37H 3QFJD 1W0VA 2EVFA 3VDBA 4G59C 4LEXL 4CRZA 4OLUL 1JE6A 1WFNA 2BFGA 3QIWC 3V10A 3MV8E 3QRGH 4X98A 4XE5B 4XO9A 2XACC 4AT6A 3RVTD 3UZQA 4HWZB 5CIPH 1RUML 2Y7NA 3LRKA 2MWCA 1L8FA 1A8ZA 2A4CA 2X10A 2ZXDA 1PLCA 2HRHA 2GW5A 4HWUA 2XQYG 4WDIB 3CF2A 4WFHD 4U7MA 3VFWA 1TJGH 5AKTA 2PR4L 4BA8A 3UTTE 4XN8A 2EEBA 2IWFA 2PYFB 4UDUA 1A6VH 3VI4F 2QPDB 4KQ4H 1S7TB 1WWWX 4KVNL 4KK8C 1FE8L 5DF0A 3QDGB 2MKLC 4YDJA 4APQB 3IBOA 4U6YB 2E9JA 5JIIA 4WFGD 4FI7A 1RK0B 1NFIA 1CXEA 3CVHA 4DFIA 1PLBA 4ZW5A 1GY2A 4G6ML 5IBLC 1SXBA 2J2ZA 3AGWA 3DVNB 1LE5B 4OI7A 4NC1E 4XX1G 1MJ7H 5EUOE 2VQ1B 1CL7H 4X9GA 1JZEA 2RALA 3PABA 1JFHA 3L4XA 1OM3L 1KLFA 2H26A 1T5WB 2NY2C 1MPAH 5FCSH 1WT5C 4KPHL 4L4TA 4IRJB 4LLQB 3SKMA 3V0FA 5MEOA 5FC9A 3OR6B 3MRHA 2P24A 3BSHA 1PYWA 4ABVA 3BIBX 4CW1A 6PAZA 4Q14A 1LE9A 1T66D 3FN3A 3Q1EA 4DP0X 4Z6AT 5KN5B 1CC3A 2NQDA 2VW4A 1UFGA 2ZKHL 3FSAA 4X6CE 3OPUA 2VN7A 4GP8B 1XZWA 3MLZH 1RZKH 5ESQA 3WFBL 2DV6A 4ZNEA 2WINB 3FU3A 3OB0H 5HHMB 2IV2X 2FIRT 2IWEA 4AK2A 2XXCB 5F9AC 1XH3A 4YHPB 2E46A 3ZIYA 4OM1H 2OA9A 3FMGH 4IMKC 4X9IA 5C0CD 4ZMAT 4Z7AA 3VWJA 2K7PA 2PXYC 3MRRB 4M62L 4N2EA 5J13B 4QO1A 1UHEA 4K9EL 5JIHA 3WIHA 5DJ0B 1QP1A 3KAAA 5A2CA 4Y7MA 3ARED 2EXYD 2ZXGA 5DGRA 1PPIA 1VIWA 2YSTA 4NO0B 4FFWD 4ZUVA 4FA6A 4OZIE 2OMTB 4KJPD 1F4HA 1I3GL 5IBTH 5CM1A 1RJZB 2JJUA 5FYKD 3ZTNL 4HWEH 3IDYB 3QG6A 1JNHA 3MRJA 3RE0A 2VDPL 3FONA 4KH9A 3GTNA 5F70A 2FX8H 1SMOA 2XN9B 4FTVE 4I88A 4NO2A 3LRGA 4KTDL 1X7QB 4MJ4A 2VZVA 1E8YA 4K5OA 2F6AA 3M07A 4XBGA 1JPSL 2V6HA 3Q44A 4FQXD 2R92A 5LBGA 2GVYA 3FO2B 3DVIA 1J0ZA 3O4OB 1KC5H 4Z7UF 2JI3A 4E9YA 2WLZA 4B41A 5EOTB 4XB8A 3H2QA 4OIBA 2Z0UA 5K1JA 1JRHL 3QJFB 5CBAB 2QSTA 1B0GB 4J4PC 1E9OA 4OLYL 4E68A 1V3KA 2DI9A 2LE9A 2H32A 3ARGD 1MQ8A 4WWKC 4XMXA 1HYRC 3GKWH 1IFRA 4ZNEE 3EJYD 1IEBB 2CSPA 3F62A 5CJBA 1FCCA 2WC7A 4MQTB 3CFMA 1T6WA 3QUYB 2NPLX 1VRSA 1BCIA 3KBPA 3V55A 4ERSH 2BK8A 4KK6D 4MD4A 3VXRE 3CZBA 5EU3A 4F37F 5DD6A 5EUKB 1CT8A 3KL3A 4L0PB 1RFDL 1NCAL 3ARZA 4LMQI 1UTDA 3CDCA 3D08A 1ZGLP 5FTJA 2FQGA 3BWAA 1KPUB 4OFIA 1TUPA 4WFFD 3IFLL 3RY5A 5L4JA 4HC1A 5T5FH 4PRAB 1DFXA 4WI6A 4DP6X 4EJ1C 3B9KD 2IH1A 1A9EA 2P8MA 1F1GA 3CN3A 4UB0L 4QD2E 2UY7A 3GI8L 3LH2H 3C5SB 1SM3L 4OZFB 3IDGA 4PRPB 3WNOA 1QOKA 5DJCB 4PLJD 1P53A 2VLRB 2A38A 5FYKH 1CDYA 1PW3A 1ND0A 3GRBA 3C60D 3QI9D 1ODAA 3B9DA 4GT0A 3VG9C 2PR9A 5I66A 2AK1L 3IGAB 1EEYA 2YGNA 5FDYA 1P84K 1U8KB 2L04A 2WLNA 2DRUA 4ZOEA 4F3FB 1BJMA 5AAMC 4L8BB 2A6IB 4L29A 2UZYB 4UT9H 5EOCH 4AQZA 5IB1A 3AABA 2VDNL 2X9WA 3F01A 1OWRM 2LT9A 4Y16D 5IZ7A 1DUZB 3QCTL 4BZ2H 4DGUA 2QMJA 3II1A 3GI9L 4Q0XL 1T1ZA 5CJ5A 3VFRB 1VZGA 3IF1A 5DSCA 2L4OA 3IKCA 2YD3A 1A9VA 2A83A 4DVBB 5SV4A 1GTNA 5DVOA 1T7ZA 4AM0Q 3WOVA 4XPGL 2CG9X 4FL4B 2IWGA 4MD5A 5BVJA 3NFPB 1K5WA 4QGTA 5D1XD 3V4PB 3AS3A 3FW6A 2B4CL 1PDKA 2I5YL 2YBRA 3MRIA 5CNHA 5FTMA 2BERA 3V5KB 1HILB 3WI9A 3K1DA 5AFAA 1V55B 3RNKA 4LARH 2P26A 3MZGB 4ZPTB 4JPWH 4KTEH 2LAAA 1NC2A 1ZA6A 1XGZA 3A4DA 3LSOA 2D4FA 3W56A 2P42B 5I9QC 5I8CA 1M9WA 2WLIB 4PRHD 2BFVL 2UUDK 1IGFH 1I1AD 4K3EH 1HYSC 2HKAA 3BN3B 2HKHL 2FQDA 4MD0B 5CO1A 3FCTB 1D3CA 1KJ2L 3H53A 5E7FA 4MBRA 2AEOA 1HHHB 4F7EB 1SVCP 3LS4H 4XP6L 1UFUA 4YDKH 4NUGH 4A7QA 2Z92A 3D05A 4PJHA 2VSCA 2AK4D 4XBGB 4F5CA 3LHPL 2H45A 4P2OA 2FZ3A 2N59A 2GFBA 3CU1A 3OKLA 5AQ0A 5DWUL 3CVIH 2Z4QB 2QZQA 1OB1B 5K59F 4DIXA 4CN6A 4BSVB 5L6YH 1VLXA 3X2KA 2DWDB 1VCBC 4L0YA 1E61A 2K6YA 3OLIA 4XCCH 4Z7NF 5MI0C 2PW2A 2UX6A 1NAMB 2BSRB 4AW4A 3WKYA 1SDDA 3B9EA 3BW9B 1M1XB 1GZHC 2R69A 4PW9A 3ZTDC 5IVNA 5EIIB 3TPKA 4L1LA 3U0WL 4UAOC 3VGEA 4MJID 5C6TL 5BV7L 1T03H 1MWAL 3CFDA 4UOW0 4W9GC 2C4XA 4HU2A 2QSQA 4UT9L 4YFLF 4J3WA 3DKHA 4M62H 3QZWB 3VB9A 3PL6B 1GAFL 1AGCB 4WJ5A 2ISDA 3R1GH 4UANA 4LBEA 4NEHB 2GJ6D 2XZCL 3HNSL 1PCXA 3K2IA 3KGTA 2G9HA 3LKRB 4MJ6A 5E4OA 2AK4B 5MHSE 2YGVA 3OC5A 1BOYA 3JZYA 2DI8A 1U92A 3JZ7A 3K80A 3S5YA 3EG9A 4N9GA 3T0EE 4MQSB 2EACA 4F57L 1DTUA 2CKNA 3P9MA 1E5VA 2YD5A 3GC3A 4PJDE 4Y9BA 4FJYA 1DN2A 2DMRA 1OPOA 1V54B 3WFCL 1AXTL 4X9YA 1M6UA 4UOW1 1E50A 4HSCX 3PABB 3ULVC 3SDDC 2FYVA 5T3XL 1RU9L 2VL4A 4C4KO 1K4CA 3VRIA 4F7EA 1E4HA 1T5XB 1L0XA 4MKMA 1IAKB 2G3XA 3CQPA 2ADFL 1WTLA 4JAMA 1TZGH 4MB4A 1TIUA 5J12B 3GSNL 2EDOA 1XCWA 3GMQA 2LW3A 3FSWA 3WKQA 1RMFH 2IH8A 2ALAA 3NZ8A 4GIAA 5TDOA 1IV8A 1UWXH 2BNUB 2BVUA 3GO1L 4LCWE 4EN3C 2EUZA 1PAZA 2LTQC 3S8WA 4JRXE 2XETA 7TAAA 4JMNA 2BY1A 1A1MA 4CADB 1A6VL 3VI3F 2C9VA 4CC0A 3GTKA 3MLRH 4M7LH 4UCFA 1OAQH 1FNHA 1TZHA 1ZHNA 3RURA 4DPBX 1AMYA 4IEFB 3MLYH 4EI6A 1CGUA 4LK4A 4LBEB 3FFCD 4D8PB 1KC5L 1VGEH 1PZ3A 1ZVSB 1KY7A 3QDGE 4AVIA 4ZW3A 3GSWA 3O11A 5JHDA 5L9DH 3CCHB 3DX2A 2NDFA 3L54A 2NSQA 1YJDL 2W0FB 1E43A 4FQJH 4ODSL 2ZX8A 2HLAB 1L0QA 4AENB 3TFKD 4EF3A 5IMKB 1ZLUK 4P59H 3BUYB 4BFBD 3BAXA 2OTPA 2YAFA 3DMMA 3NESA 5EZJA 5J9PB 3QP3A 5AW5B 5F7FA 1NDMB 2ZUUA 5AWNH 4OR1A 4UU9B 3AQXA 1MI5A 2X3BA 5BJTB 4P3DA 5D5MA 4CSPA 1YNND 3A6BH 2PYEE 1ACXA 4CC4A 4Z7QE 2E6JA 1T2QH 2A6IA 4L29B 1S7WB 2CLVA 1BD2E 1CYXA 5FYJD 3KMDA 1P5VA 3S35X 2ZT9C 3GMQB 1F90H 1Q9KB 3F84A 2OFQA 2PP9A 2K1MA 3RWGB 1LNUA 4ENED 3H7BA 5IM7A 4PB9H 4JPKH 3N40F 5AKRA 3FUKA 1KBVA 3GHEH 5IOKA 2R69L 3VD3A 4N8CH 1OXYA 2D0HA 4RGOL 1UKQA 1FFOA 3H6JA 1FYTB 4JFHE 4ZODA 2KC0A 1T04B 4WHYH 1E9PB 4NAMA 1GSMA 3BSGA 4HUMB 2ZAIA 3ZRCC 5KBKA 4G9FD 3SQOL 1HNFA 2OW7A 2AI0H 1LTXA 4EUPG 2YA0A 1CT8B 4C56E 2OW6A 4WTZG 2B5IC 3ETSA 2NCEA 3TTSA 4ODWB 3BZFB 2WQVA 2VDRB 1EJOH 1XAKA 2EE0A 4S1RH 1NZRA 4QRFA 1T3FA 4GRLA 2NNXA 4NI3A 3WJJC 4ZS7H 4MQXD 5MEPA 2BO0A 3HZKA 1CL7I 2HRPL 4JVUA 4DP5X 4KROC 2QDWA 2IAAC 4BRJA 4F2FA 5HYQA 3QT2A 4MCNA 3EYQC 5KVDH 3P3YA 3OR7B 2IAMD 1IT9L 3QEQA 4E5XB 4NKOB 2AAVA 3DX9B 3FBQA 4KXDA 5GXBB 3DO7B 4TQHA 1IC4L 4TSCH 5K9JL 1MF2L 4RMBA 2H1PH 1T0MB 4NWTL 3UEZA 5E24E 1ZA3B 4JQIA 1I3UA 1A4AA 1UD2A 1ZVNA 2ZUYA 3LRHA 5D7LE 1XSOA 2FR4A 1U30A 1I8MB 2F53B 3OD3A 4WTWA 4XXDB 2AMUA 1BD2D 1A7NL 5FYJE 5ISZE 3E9TA 4LDEB 1ZPLA 2I27N 2X1WL 4XXWA 1FBIH 2Q8AH 3ZE2F 1Y6NR 2VQ4A 3PQYD 4XPAH 1J87A 2BC4A 5CXPA 1TDQA 1QNZL 3DXAB 5F7LB 4W9LC 3GRWH 1ZHLB 4Q89A 3B34A 1MHCB 3CV5A 4ES9A 2XKSA 4A7GF 5ACZA 1MVUA 1G4RA 4BWUA 3O6FC 4DK6A 4N87A 3QO1B 5JPMB 5E5MB 1I7RA 3Q6GH 1X4ZA 2AQNA 5F89A 2ZCZA 3HG1D 4PYHA 1BYPA 2AJYH 4ZPTA 4K23L 1UZ6E 5B1JA 1CFNB 4XCYA 3U4AA 4M02A 2ENJA 3VG0H 3HU3A 3JVFC 2ZXEB 5SWZB 1AVAA 5EC1A 5IB2A 2ICWB 4WZ9A 2JB5L 2ZWKA 32C2B 1QASA 3H3KA 1T83C 1F45A 3HNTH 3QUXB 4QRQA 2V3VA 1MFMA 1CFSB 3ROLB 1CICA 1NL0L 2AI0L 2XKNB 1MZZA 2YQ3A 3X11B 1JGEA 4OLZH 3QUGA 4RGNE 5C1BA 2J43A 3X1GA 1ZIBA 3IDXH 2OYPA 3IS0X 1JF1A 3MRQB 5E2WL 3EW3B 3QC8A 3BEWB 1UH3A 4WEUD 5ERWB 3ATDA 3WJMA 1PJWA 3BDXA 5CZKA 1YN6B 1PS3A 1KWGA 2DQIH 2E7MA 1IM9D 2QL1A 4NQDB 1ZK5A 3LY6A 3ILPA 3QXAB 4FQIH 4Z3JA 4H0HB 4YLQT 3VTAA 4YSCA 4XNQB 1O9ZA 1RY7B 5EEYA 2WN2A 4L8BA 2WIIA 3N44B 2HVJB 1KTRL 4YBLC 3EH1A 2OSYA 5LDUA 3F64A 1N4XL 4GAYB 4IGBA 3TN0C 4H8HA 1ZHLA 3CLFH 4A2HA 3NEOA 3QNYB 5PAZA 4XMUA 1XD0A 1XAUA 2G3ZA 5HI4D 4NHCH 3W0WD 1FNSH 4ABQA 4TVPH 5E94A 4FRWA 3BZEA 1TTAA 2FHCA 1G6VK 2X4SB 3BP4A 5DD0H 3STLB 8CGTA 5K59E 4X6CA 2NY2D 3A4EA 4WUUB 5CR8A 1OGPA 3QJTB 5FV2A 2PWHA 3RJOA 5I1DA 4PJCB 5D55A 3QYNA 1N5AB 4ZK8A 2JE8A 2BIIA 1H3PH 2FB4L 2MHAA 2UXFA 1LK3L 2WZPA 1S9WA 3K2UH 3DTDA 2HH0L 3KWTA 3E1F1 5I17B 3BVXA 1DEDA 4MDJB 4NKOA 3DJRA 2R4RL 3BLBA 4LCWB 2JV6A 3QFDB 3MCLL 2Q3XA 3FUJA 3PRZA 5IG7B 5F9DC 3SDYL 1T20B 4E0RB 5AZUA 3L16A 1G9NL 3FU7A 1AFVH 2SEBB 5MP6L 3NIGE 4G9FA 3U30B 1SIWA 5EZLA 1MDAA 1OTUD 1YUHA 2YEQA 5T3XH 1K3IA 3MA7A 1ZE3H 1ZT4B 1RZQA 1IGML 3PWUA 1HKFA 1U8IB 3IJYA 3IK2A 4KX8A 4F33A 5ESAA 5F3BB 1CYGA 1JWSB 4ZYKB 4HLZG 1QFHA 1SXZA 2HX7A 2DM2A 1REIA 2AQSA 4LLWA 1SQMA 4URTB 3VFUA 1BMGA 4DHLA 5D1QD 3DPBB 1KGJA 2YAPA 2OL3A 4Y4FB 3NFNA 3WS3B 3R19A 4IK7A 1PEZA 2ED9A 4WO4A 2DQCL 1MIEH 1CD8A 1Q90A 3LKNB 4J3OD 5E8OA 3V9CA 3V0VA 5F6IC 1RJZA 5SX4H 2D7PA 4N6RB 1NCDL 2AS5M 1ADQL 4NPJA 3T3PE 1K85A 3U82B 3LKPB 3C75A 3JV6B 4XMWA 3QDJA 3GQFA 4QYAA 4TVPD 4QO1B 4F80A 1SXNA 1GHFH 1OSPL 1SMYD 2DTSA 2NZIA 4LU5H 1JAEA 1F90L 2ENGA 3QJSB 5FYLE 5C0BE 3S6CA 1OSEA 1U8JA 2WKGA 3NCYP 3EO1B 3O6KL 3DYPA 1DQJB 2B5IB 2ZSVB 4I13B 4L1TA 4QOKB 4WI3A 2VABA 4FOMA 4PY8J 5DYIA 5F7DB 1MFCH 4NN5B 5KSVA 2PPCA 4OFDA 4LSRL 4JG1L 5F9OL 2Q20A 4IBLT 1ZT1B 4PIRF 3HUJE 5DS8B 1XF4A 5K39A 3S35H 1JZ6A 5AWNL 1QEWB 1KJMB 2VXSL 4K8RD 1TPXC 1KYDA 3FTXA 3K6IA 4X83A 5IK3A 3HE6C 1A7PH 4FNTA 2TAAA 4L9LA 4G43B 3IMTA 2K70A 1A6UH 3MLWL 2VC2L 3TA4D 2AFNA 5C3LD 1CDHA 1EBAA 1ZTXE 4YDKL 1HDMA 2R1XA 1DQMH 3D25A 4HMEA 1A0QH 5SWSB 5DD3H 2IXQA 4FXGA 1ZLVK 1KCBA 4EI6B 1E9QA 3VTMA 3X13B 4UI2A 3LZFL 3QDAA 4KJYA 1T21A 3RQ3A 3TZVA 4PJEA 2OP4H 4KHTH 2O5JD 1EHKB 2X6CA 1AHWA 2ICEA 2OL3B 1XGYL 2GBAA 3F85A 4UZSA 5B39A 4GUOA 4X8GA 1F4AA 4X50A 4YPGA 4YPGB 1HL8A 3EBAA 2XPZA 3UYPA 5ALCH 2J8UB 2X4QA 1AHWB 1R9FA 2IAMA 4F5CE 1LK2B 4TN9A 3D2TA 1FJ1B 3D52A 3EKCA 5GM9A 2VLRA 2XA8H 5HHVH 3GKZA 4JMXA 4NT6A 3X1BA 4KOCA 4ZMNA 1AQ8A 1OSZB 5F44A 4YSTA 1DSWA 3CPUA 1E5ZA 2BCKB 3QJRB 1VADB 2ZYSA 5IV2B 1JGVL 2NUPB 3OB0K 5AVSB 5LAXB 1UWXK 1H6UA 5CLTA 5E4EC 2NY3D 2QR0A 2WGXA 3K5RA 5JPNA 1L3NA 4I4WB 8FABA 5M95B 2UVFA 3ZYOA 2R0WH 5GRVK 3VXPB 3NGBC 5BZDB 1I9RH 1NCBH 3SCMC 5I6MA 3FCSB 1WUZA 2DIJA 1XR8B 2OMUA 2BNRB 5JNYB 3G6JE 3IDXL 4D9QD 5E1HB 3O4LA 4PJHE 1PZ5B 1Z3GH 1PZ2A 4NQVA 5I8EB 3LQAH 5IQ9A 3EHBC 2CD0A 2BC4B 1DSFH 2WLHA 2GEQA 1FNGB 3WFHA 3HNSH 4FTVD 1QBMH 4XVUC 4ANWA 1OK8A 3DHPA 3BH9B 3MBED 1YNJD 3AWFA 5E5MA 4PJ9D 5F7MC 3RVUD 2WLJA 1K8IA 1A6TB 2DWSA 4WNQA 3QJFA 5CP7A 1NBQA 4QKTA 4RMTA 4OLEA 4B5ZA 4HIIA 4N90D 4E9LA 1AZVA 4LCYA 1GXEA 1TETL 1LP9B 2DL9A 1AC6A 4WI0B 1JK9A 4LLDA 4QXGH 1IB5A 2ZOWA 3D0LA 1GMIA 2C7UA 1HHGA 3V5DB 4M4PA 4WO4B 3WHXA 3RTQC 2XTJE 3IMVA 1PG7L 2WQSA 4AV4A 1UJ3C 1JHTB 4OQTL 4FXKB 4R4BA 1MHPH 4FTDA 3NPZB 4L23A 1Q94A 3MYJB 4FQJL 1UEYA 2FJUB 1PZCA 4K8RC 2X1XR 3LZQA 1A64A 4P3CH 4E41A 3WJJA 1TJHL 4XNYL 3SYPA 5CSBA 3FB6B 4FE9A 4M6NL 5TFSL 1MCFA 1VFBA 4N9OB 1QI4A 5FUOH 2JNZA 4G1EA 2CNZA 5DRNA 2WP3T 3BAJA 4NO0A 2OZ4L 4UAOB 3QULB 3NBNA 1JF1B 1JF6A 1GGBL 3K4AA 4NZUL 4GRWH 4KI1A 1HQ4A 1H6FA 1MCWW 2HTLD 1DJXA 2CHDA 2HP4A 3ZT7A 2V5SA 3HCVB 1JZ5A 4YSEA 2R56H 3GSVB 4P23C 5MI0B 3NSXA 4PP2A 3VFTA 5I71C 3DPDA 43CAB 3PAZA 5E4IA 2W0PA 1PY4A 3P3RA 4DO5A 4IRZL 3AITA 3LN4A 4Q6IA 1H0DA 5D6CA 3VGAB 4HQQH 2B16A 1MJUH 5E8PA 2R7ZA 2ZYIA 3UTPE 1MAMH 2D7TH 3HLKA 1V7NL 3GBLA 3OKEA 4G5ZL 5DQJA 1YEEL 2R8SL 3U0PA 2VXQH 3QXVA 3UTTD 4H4NA 5E6YA 5D72L 3HR6A 5FCUL 1BVOA 4HKJA 5FB8A 5DHEA 3FRPG 2WBWB 3CHSA 1YAZA 4G8GE 2WVVA 3UGEA 2HN7A 4N2OA 2WVVB 4F7MA 4L18A 3MUGA 5B39G 4G11A 2DKMA 4NAQA 4UQCA 5J5EA 4LSUL 5E0QA 5HDQH 2J88L 3DBXB 4GQ9H 2VDKH 2OTWB 2R2BB 2XCMC 3G08A 3O9WC 3IETA 2K45A 4JRXA 1AZBA 1EU1A 1QSEA 2CIKA 1G9MH 1E2ZA 1ZHBA 4S10A 5HHOE 2Y24A 3NK4A 2BIPA 2EH7L 2MQ3A 5DFVD 2NX5E 4A2GA 2J1XA 1XGRA 3MOBL 2FX7L 2N1TE 1BEXA 4QWWD 4UDUB 5D5MB 1OAXH 3ARFD 4JCMA 3BP7A 5CD5C 1VSCA 5I5IA 5JOEA 1ZE3C 3P54A 1QWNA 1SFDA 2XN1A 2VIRA 4RISL 6PCYA 3TS8A 1EHLL 3D3VB 4X9HA 2UY7B 1Q16A 5CLZA 2Y5TB 2WUBH 5L6YL 3DMMC 3FQNB 3TT3L 1WIPA 3HG4A 3NA9L 2WQRA 1G7HB 3HRZA 5GS1C 4X8XA 5CMAB 2EKSB 3AY4C 1TKWB 3DSNA 4YE0A 3NUKA 3U25A 1MAJA 1M1XA 1XGTB 1KXQE 3CSYA 4MB1A 1U6AL 4G82A 1ROWA 5CCJA 1GS7A 1L9PA 5TK4A 3SDAA 1DDTA 1MCLA 4O02A 3L4WA 2P5EB 4PEEA 4QRSB 1TU2B 5D7EA 1OGTA 4ZUUA 4MA7L 5JW4R 4MAYB 4AMKL 1LO2L 2ZYHA 4PPTA 1OD7A 5I1KL 5I8KH 3UPAA 2GK0B 3WFDH 3CC5B 2FGWH 4LVNB 5GZNC 4PI2A 1L6PA 5JIKA 4WFEE 3GJEA 3FQ1A 2PR4H 3P11H 2PCPA 1GC1L 1MCBA 1ADWA 3QQ4A 4KO5A 4FERA 2F5BH 4LCCA 2AEPL 4H20L 4N6RA 1IC5L 1H8OA 3QISA 4D9RE 2FJFB 4HH9A 2XV3A 3O81A 1MSPA 1IEAA 1KBGL 4LSVH 4FQLL 3L5XL 3OKNA 3D8MA 3JQOB 3NRQA 1NC2B 2ZQKA 1JPSH 1BOGB 3OKMB 4BJLA 1BW3A 1UWGH 4Y19E 4KI5E 3U4BH 2Y7LA 3JWDC 4AQ1A 1DQQB 4DGVL 5C0DB 4N9GB 1IZKA 2DMKA 2HRGA 5CCKL 2XOTA 4WWKB 3P1VA 3DHUA 3GZQA 4JRXD 2BVPB 3TH2T 1ZT4A 3CG8A 3AQDA 1HIML 5FECA 1LO3H 2C1OA 4MJJA 2ESVE 1PT0A 3OWRA 4GSUA 4H2CA 4KUCD 1UZ8A 4PJ5A 2O6PA 1T20A 1DBBL 2IQ9H 5KYWB 3O2DA 4P46A 3BKYH 4MZIA 4N0UA 5KSUA 2WXRA 1NCTA 3VXOA 5IVXF 1MFAL 4ELDA 2C1OB 3PP4H 3C60C 3BYTA 3QI9C 4DKDC 1SEQH 3QFJB 1R27A 4ZZFA 5BVPL 4BQBA 3ZRFC 3H9SE 2MJWA 3A22A 3TJEH 1KBBA 3U83A 5EOCJ 3PLYA 1LHZA 3EJTA 3V6ZA 1UG9A 2HYMA 3SJVB 3IDYC 1DZBA 3OZ9H 5ES4B 2AJXH 4M5ZL 3BPCA 2AJUL 1I1AB 2O5YL 3PDDA 4UV7H 2FWOA 3QIUA 1FHNA 2ICCA 5J6HB 3S88L 3GLZA 4BQ6A 2GAZB 2WXOA 4ZUTA 3DOSB 3H54A 3HFFA 1VFUA 5CSGA 1ND0B 3PE9A 2WXGA 2IAMC 3BPNC 1JYNA 2WQWA 5FGSA 1TVHA 2MPAL 2NLJB 2PXYB 2NT0A 5AKVA 1SQ2N 3O4LD 5A16B 4JDZA 1BQKA 4KC3B 1WCQA 2HX8A 3VD5A 3JTSA 3MZTA 4M4RA 1DQKA 3QIWD 3M46A 3CD4A 4BXVA 2DYSB 2PCXA 1XR8A 2OMUB 2V7NA 3MLXH 4YR6B 4ZFZA 5IQ7H 4GRMB 4K3JL 4Y4FD 3BAEL 2QQLL 4U6YA 1ET8A 3E9UA 4C58B 2G60L 2Z1KA 3KPMB 4BFIB 1F3JA 5D7IF 1IMHC 1NUNB 3AW5A 4Y1AD 3CLWA 1J9TA 3F6JA 3QCVL 3KPOA 2YMXL 2JKRM 5AL0A 4PJ5E 3BUPA 2EDKA 2W38A 4N2NA 2F7RA 1CFQA 1GZPA 5DRZA 5I5JA 3HOGA 5JHLL 1RUAH 2KERA 1HD5A 4MQ7B 3OQRA 2W07B 4Q2ZA 3ZL4H 4N0UB 1KCRH 1URLA 4PV9B 2WOBA 1DQVA 2P7TA 2J4WH 3NABH 4O58L 3UABA 3CFDB 1RVFH 5KYXB 1JVKA 3UMTA 4LCWD 1EEZB 2DDQH 1FI8C 4RLDA 2VLJD 2R1YB 5D4IA 1KPVA 3IETB 2ICEB 4MZ3A 2MCMA 1TCRB 2KMWA 1R3LB 1ZS8B 4MDRA 3U2SA 1Y1WA 5FM4A 5SWSE 4D8PA 4O9HL 1FL5A 3LKNA 4JHWL 5D7IB 4ORGA 5DC0A 2IDCA 2JIPA 2XN9E 3LHAA 4PJAF 2FH6A 4XP1L 5SWZA 3DJ9A 3MYJA 3QC6X 5IMMA 4PJIB 2C9AA 4PCKA 4U1LA 2EXTA 2B0SL 2XN9A 3DGCR 3EGDA 3KPRD 4NO2B 2FEDD 5IOPB 2VQUA 3IDMB 3QQ9D 5CSZB 2HLFD 3UYOD 2V7NB 3UYRH 2OJEA 4WHTA 1I85C 1BWMA 3P77B 4PGCA 2NNFA 2EH7H 4HD9A 4LMQE 2HT2D 4XX1E 1CCZA 1QSVA 3B4NA 3COOA 4XCFH 3IMUA 5A2KH 3JYBA 4QIRA 4DP9X 4RMUA 4KK6C 4MTMA 4K7FB 2X05A 1RUKL 2JMRA 5I9QB 4HJJH 4JFED 4IDJL 3D18A 3AQYA 4GOSA 3RU8H 4TSAH 4RFOL 2HJKB 2AITA 3ZTJH 1PX8A 5DQJB 4QRRD 3EFDL 5GGTH 1RZJH 2YGPA 4GRLC 4K94H 3ARGB 3NSFA 4OZHF 1DBML 2DJ4A 2FATL 3IFLH 4F15C 4W6YB 5GGVL 3WXWH 3VXRB 1U2HA 3QQ7A 2P5EA 2VDRH 2D03L 4NQVB 2JIRA 1FZMA 3C87A 1WA0X 2AEWA 3ZKMC 4ILDA 3ZKND 3P3SA 4J3UA 4X4YB 5E5RB 4ZFFA 1IGMH 2X53A 4KK5C 3LXUX 4U4BA 4MXWL 4AXWA 3O0RH 1MJUL 5EF2A 3EUDA 4KUZH 3GF8A 4Y1AA 1G9NH 4KGJA 2PLTA 4TUKH 5E94B 1TVBA 3BAKA 1DANU 1VCAA 5FR3A 3RTLA 4LNVA 1F0LA 1HHKA 4AEHH 4I7ZC 2KQNA 1KXHA 3DARA 4BZ1L 5I2IA 4FQCH 4WI0A 3F6IA 1JBJA 3RB7A 5FTKA 1HCZA 4EZMA 1LK2A 4OCRL 1J7VR 1NIAA 1OCWL 3P77A 4RMQA 5DHVH 3U7YL 3H9HB 4ODWA 5DHVA 4TQPA 3F7YA 4E41B 1C16A 3IDMA 3B3IB 4XC3L 4RAVB 4MNGA 3NCJH 2PO6A 2R39A 3KYAA 3M8OH 5F1SA 3RWDA 4DZ8B 4AYSA 4PJIA 4PV1C 1WEJL 2XWJB 3FN9A 1P84J 4PJ6A 3QE5A 3SPVA 3HZMB 2A7BA 4UMSA 3VM7A 4GG8A 1BJ8A 3SO3C 4OD2A 3EIFA 4PWHA 5AOIA 4JX0A 5D4JA 3L2NA 5C0EB 1JGUL 3WY2A 1KQGA 5CIPA 3N40P 3PQYB 3D25B 5E70A 3WLWC 5CGMA 2FBJH 1X5IA 4XO3A 1PEWA 3BXNA 2ATKB 3B5HA 1WBZB 1WLHA 3BT2H 4PGDB 2A0LC 5DC2A 5DD1H 2JXMA 4YHIA 4ZXBD 4D0BB 2QGCA 1KEMH 1P7KB 3O3DA 3B6SB 5JZ7C 2VAAB 3IB4A 3UC0H 5GGTA 3OF6A 2BP3A 3P02A 3BWSA 5EBGA 1LWRA 2X9XA 4O2EA 3VH8B 5I0XA 2WK2A 2Y0SA 1I9IH 4JY6B 2BCMA 1NGQH 1NCIA 1Z9NA 1Q38A 1X5KA 3F8UB 1Y1UA 1J9CT 4R7NB 1K2DA 2CAKA 5JQ6L 3QUYC 2YEVB 5EV7A 4L1HA 5D1QE 2BSED 3L1FA 3TT1L 3WUWG 2A9DA 4HIQA 5DUBA 5IMKA 5BOPA 3OAYH 2HJLA 4JFOB 1UUNA 2ZXCA 5FM8A 2VMJA 4XNBA 2ZKHH 3CVCA 1S7TA 4M7KH 3C09C 1J9SA 4JM4L 3OJDA 4HJ0C 4ELKA 4PSRA 2NRDA 3NACH 4XAKE 5CINL 3SCMD 2WO4A 1AJ7H 2VIRB 3MREB 4P2AA 3S4SG 1CXHA 3IFOB 1YUKB 1J12A 3RGVD 4B3EA 3DSFH 4L3EB 1S46A 4ELKB 4PWFA 3G5ZA 12E8L 1KIPB 1RK0A 4Y2LA 4XHJC 1EXUB 4I0PC 1NOAA 3MR9A 3SQBA