2HCZX

Crystal structure of expb1 (zea m 1), a beta-expansin and group-1 pollen allergen from maize
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
241
Chain Sequence
KVPPGNITTNYNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and activities of EXPB1 (Zea m 1), a beta-expansin and group-1 pollen allergen from maize.
pubmed doi rcsb
molecule tags Allergen
molecule keywords Beta-expansin 1a
total genus 44
structure length 241
sequence length 242
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01357 Pollen_allerg_1 Pollen allergen
X PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 2hczX01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2hczX02
4FERA 3SUMA 4JJOA 3X2GA 3CZBA 2PICA 2PI8A 2G6GA 5GLXA 3SUKA 5GLYA 4JS7A 2ENGA 3SULA 3X2MA 3D30A 3FT9A 1N10A 1OA7A 3X2OA 1WC2A 3X2PA 1WHOA 2KQAA 1OA9A 4JCWA 3X2KA 2AE0X 1HD5A 3X2JA 2PJJA 3X2LA 2PNWA 2G5DA 4AVRA 4L48A 3X2NA 2VXQA 4FG2A 1BMWA 5H4UA 4FFTA 3X2IA 2BH0A 4JP6A 2GAEA 2HCZX 3SUJA 3M3GA 4ENGA 4ZM7A 1BW3A 3ENGA 1BW4A 1WHPA 5GM9A 1L8FA 2JNZA 3X2HA 3FT1A 4JP7A 4FG4A
chains in the Genus database with same CATH superfamily
2QVIA 4QT5A 5EO9A 1HCVA 3ARBA 4BDVB 1E4WH 2XKNB 3GSNB 4ELKB 3VD4A 3C6SA 2R56L 4NEHB 4LHJB 1JUFA 3IGAB 1E2ZA 1OGAA 1L9NA 4TVPH 5AYQA 4FFVD 3ZW3A 4XCYA 4Z7WF 3PLXB 3ETBJ 3JWOH 4OU3A 5AG8A 4J8RB 4JM2B 1JPSL 1EZLA 1DO6A 4OJYA 5K1JA 5IEHA 3K72B 1KLGB 3RWDA 3GEWB 4WAFA 1Q90A 4E9RA 1BF8A 1U92B 4NIYE 5C07D 7PAZA 4ES9A 5L0QC 4ZFOB 5IOPB 4P2RA 4IEFB 2X10A 2X4NA 1IGML 2JKTM 4W81A 3MREA 2AQTA 2ARJB 3BKCH 3A6OA 4IGBB 4LAJH 1MIEH 5TF1H 2BJMH 2OJEA 5DYFA 3VGAC 4PUBL 3D0AA 5CEZL 1DANT 2PNDA 1THAA 4X5WA 4KJWC 5FYLH 4BK4A 2FIKB 4JRYE 1CIUA 3BH9B 3Q1SH 1TVHA 4LSPH 4H0HB 4KZDH 4D0DA 2WNKA 4BXVA 1SN5A 4NJ9H 3ZUCA 1DCEA 1ILSA 1AYRA 3QC8A 2EDDA 2E9WA 3JBG7 3N55A 3AU0A 5I0XA 1T0NA 2ADIA 5GS2H 3SE3A 2NTFA 1YN7A 2APTA 5H94A 1ESOA 3SDYL 5H37A 4ODUB 2AKRB 2AMGA 4WCYH 5CZVL 4E0RB 1LJMA 2H6PB 1VCAA 5F21B 3P3TA 1YDPA 3FCUB 3W1ZA 3D33A 4BQ9A 4L37A 1CWVA 4OFKA 4YSPA 4UM9B 2R8SL 1LK3L 4HUXA 4TLTA 4PP2B 2R2EB 2Z0UA 4JKPH 4LDEB 5L4FA 4RFOL 2PCFB 5I75C 4OFYD 2PO6C 5J12C 2Z91A 5I0ZA 4LSPL 3X1FA 1ZRUA 1MREL 1RUAH 4PJEB 3RVWC 4PV1C 4ZUSB 3QUZC 3VD5A 4LLYA 3NIGF 2GVYA 3ME0A 1XCWA 3CFMA 2ITDA 2VWEE 2H0EA 5MI0C 1A7RL 1TENA 2D9CA 1CCZA 3SO5A 1OGSA 4F7PA 1PIGA 1QBML 3B5TA 1INDH 4WJG3 4FI8A 4XCCL 2ADFL 4AVRA 4AJWA 2J71A 3BP6B 5FFGA 1JNNH 5EZJB 1G7IB 1G1YA 2MEJB 4DQOH 1I1YA 1ZEAH 1YY8B 2XN1A 4OCXL 4KVCL 3SBWC 3US0A 1CFSA 2CKBB 5DC4B 3SKJH 3O3DB 2P4AB 4FAAB 4Y5VA 3DV4B 2IANB 3ESMA 2K4WA 4FHJA 4D9LL 4FXTA 4MD4A 4UBDC 4Z7VF 1KFAH 3ARDC 4DP7X 4OBRA 2D0GA 1QRNB 1QSEA 4TSCL 3HR6A 3LN4A 1ZLUH 3WFEL 3FH8A 4A6YA 3DARA 4IS6A 4IRZA 5ALBL 3WSQL 5IIEA 3CGTA 3AREA 1ANUA 3ZTNL 2GHZA 1TJXA 5CJ8A 1K5NB 4XCFL 3RVVD 2G5UA 4UZSA 3EOBB 4Z78B 5E8OA 3VI4F 3QEUA 3LH2L 3DX9B 3ARFA 2WLJA 4LO9A 3WY3A 1U41A 4MXVF 4R2GD 4MS6A 3SBWA 1I3RB 2F74B 5DDHB 2XWBB 1KEML 2AXJA 4ZX4A 2A74C 2X4SB 3MO1A 3RAJH 4GAYB 4NZDA 4AENB 4JFZL 1C16A 5CD5D 2Y5QA 4G8EB 2X0WA 4GFTB 1LMKA 2Y72A 4G8GA 3K2KA 4AI7A 2X88A 4YZWA 5ETUA 2HLAB 3GK8H 1VKXA 4POZC 4GI6A 5EBMA 2P5PA 2AI0H 1MFNA 5CAYB 3HZ3A 3N0PB 2P5WB 5FW8A 3FHAA 2YZ8A 5BOPA 2DQMA 5D1XE 3PQYA 1OB0A 4R26H 3MROA 4BFIB 1ZA6A 1EAPB 1ZPUA 1J5HA 1LXMA 1P7QD 1NFAA 3EIFA 1JZFA 1FORL 5AZ2H 3UZVA 1IEBB 3MBEC 3FF8A 3LZFL 2YPLA 5ACLA 5CEYB 4DP2X 1ET5A 3HR5A 5E5MA 1ND0B 4N8PA 2Q3ZA 3MRJA 3ZIYA 5GS1B 1BZ8A 1YEJH 4JFFB 2WLYA 1T89C 1HL4A 1K72A 1H6TA 2NW2B 2FATH 2Z35A 2EADA 5IJDC 2WP3O 3VMNA 4IBLT 3TS8A 1WC7A 3QRGH 1XAUA 4XN2A 2PETA 2WINA 1KYAA 2VPZA 1U58A 1WZAA 4RAUB 5E1HB 3CAFA 4ECNA 1JAEA 1HD5A 3DPDA 1F3JB 1E7UA 5ABZA 4HCFA 5C07B 3QR0A 1A21A 1KGCD 3CN1A 4UTBL 1SDYA 5EHFA 1HZHL 3VXRD 3GTTA 3P73A 1IGFH 1PCXA 1MJ7H 2IH3A 1NSNL 4QXUL 2CHXA 5MEPB 2PPCA 3P4MB 5ANMB 5DD6B 1UFGA 3FUNA 3SDDD 3LRLA 1PLCA 4YHKL 1FGVH 4QRAA 1JF6A 2ICWJ 4R97C 3WJJC 1HC1A 4KJYB 5LAPA 3IDIA 5LNEA 1CC3A 2V37A 4QAMB 5FWQA 5EO1B 5DEGB 3CHQA 1DL7L 3PPEA 3QFJD 1MJJB 1TU2B 1P6AB 4QOKD 3GJFA 1NOLA 3WKPA 2VQTA 2ZUVA 1Z3RA 2AAAA 1J1XL 4P23A 3OJ2C 4M3JA 4NRZA 2CO6A 4QJ3B 5EPMA 2HTKC 3N9GL 3NK3A 2GTQA 5EO0B 3GXNA 3HC3L 3MLWH 3BZFA 3BPNB 1KGIA 2RACA 3PJSB 4MDRA 1RIHL 1UM6H 2HTLD 4HKJA 4HULB 1YLBB 2KZ1B 4A7TA 5I1IH 4GP4B 2N1TE 2MMXA 1U8PB 1OAXL 4TUJA 1LO3H 1EZUA 2IG2H 2OMXA 2WXHA 2CD0A 4F27A 4AMKH 3C5SB 2CH8A 1WRFA 3LRSB 3U1PA 4LPCA 5C6WH 4PREB 1QBMH 3MRKB 1ACYH 4UIMB 5T5FA 1HCZA 1A4JA 2I7SA 1AO7D 4FJZA 2YEQA 1QSFA 1I8MA 2VQUA 1VENA 4JRXB 3SDXF 1G9NH 2QKSA 2CUIA 1XF5B 1A6ZA 2HWZH 1I3QA 2A3TA 2VDLB 3LB6D 1SYSA 4XAKE 1A9BB 3X1EA 5BVJA 2F54D 2LAAA 4CAGA 3EXJA 2W07B 5D1ZI 3ARUA 3RNQB 1NGZB 1NOAA 5JQ6L 1OF0A 5GGQL 1OPOA 5D1XA 3EJCA 2D03H 1Q9WB 4JRXE 4UINL 4XO3A 4YUEL 5GGTH 5F1NA 3B3IB 4LP5A 5DQDH 4ZW8A 5CJQH 4EXKA 3ZKMD 3CH1B 2BHZA 2WLIB 3TJHD 1WFUA 4M7ZC 3HAEH 4OCMC 2BX5A 4Y0GA 4FFZH 4JGMA 3IGUA 1A14H 2WZ5A 2AJVH 1OTUC 1SM3L 4WUKH 3W82A 1OAUL 3ZZSA 1SEQL 5LBVA 1JGDB 2B5IC 3STLB 3BPOC 1N59A 4HLZH 1X5IA 3II3A 1PX3A 1BW3A 4PMFA 3L3HA 1GGUA 1DQTA 1XL6A 1K83A 1RJLB 3BP6A 4WI6A 1XWVA 3HI6H 5CEZH 1EZSA 4JQXC 2Y1AA 5EZPA 4NSKB 1U8PA 2VRKA 3KPSA 6FABH 4AQ1C 1WBYA 1PZAA 2F7PA 4OLEA 3DBXB 3UBXI 3ZYOA 1MHEB 3PP3H 4M5SA 2FEDC 4JHZA 3RPIB 1G0YR 4XNAA 3HS8A 2GEQA 2C4FT 4HF5H 4XMLH 4ZYKB 2IQAB 4A2GA 4RESB 4ZMLA 5I1KL 1FV1A 4ZAKC 3BISA 1AXSA 2EC9T 4QYOB 3FZUC 4IRJC 3D05A 5EUOA 1D5BB 3GZKA 1M7IB 3NBNA 1WG3A 2R0WL 4KK5C 3VH8A 4XNQA 3FF7A 1QYGH 4MAZA 4ZMTA 1DN2A 2VDPL 3QK0A 5IW1A 2BFVH 3AAZA 3IDYC 3OKEA 1A4KA 3FO1B 4ZOCA 4UM9D 4WW2B 3U36B 1IGIH 1NGZA 7FABL 1CXEA 1WBYB 2WIIB 3MODL 4O58H 5GGRY 3UEQA 3CFDB 2NCMA 2VXTL 2OTWB 1NC2D 1SHMA 1VRSA 5KSVA 3MCKB 4HKZB 3CDYA 5T3ZL 3JYCA 3TBYA 5HJ3A 2YD1A 1K6QL 4NUMA 4B9JA 3T0EA 5DZAA 2Y25A 2ED6A 2P42B 4P5MA 4LLWB 1HWHB 1JGVH 1YECL 2G5BA 4LLDB 4LXFA 4AL8C 2QEJA 6TAAA 4B27A 1Y07A 3RIKA 4WWKB 1IGJA 1S6NA 2OMNA 3ECWA 2DMRA 2D0FA 1HHJA 3CVBA 1PJWA 2PCPA 4ZUUA 4RQQB 5IJVA 4MA3A 3P4OA 1TQUA 2YMTA 1XO8A 5D7LD 3BP5A 3NA9H 5DZLA 1ADQH 5E1AB 2YUJA 5F3HA 5GJTL 3SCMA 1JNLL 4A7QA 5KG9B 4LU5L 3C87A 5DK0A 3HMXH 3UBXA 1WAEA 3VGBA 1KQFA 5D1XB 5CEXB 4GLRH 3MKGA 1BEXA 2BNQE 4FULA 3TF4A 4TUOB 4Z7VA 3THML 5K9KB 4HWEH 2YSSA 2J57A 2ICEA 2PYEE 5FYJH 1FFQA 3NJIA 5B1BB 4G8GB 3E6HA 4GS7C 4TNFA 1JN6B 4M6ML 5LGYA 2HUHA 2DF3A 2W0FB 1Z9MA 2Q7AA 3NK4A 3PWNB 1NUGA 5IR1B 4EN2A 2Q0ZX 4PJDB 1A7BA 1OSPH 3BHBB 4NLAA 4R5XA 4XE0A 1EVTC 3T3PE 2AERT 5C09A 1TITA 3B5HA 1KXHA 3WFCH 3HUJB 4G7YH 1CYWA 2XYCA 1JHTA 4UIKH 4KV5E 3RGVC 4DEPB 3QXDA 5J6HB 3GJFH 1EXHA 1QD0A 2MHAA 4M43H 1D5IH 1IC0A 3VI3F 2XV3A 5A16B 3LKNA 1JRHL 2NR6A 3KGUA 2IV8A 6CGTA 2CM5A 4JCMA 4HWEL 4CBPA 5KZCD 5CLXA 4ZNEA 1QBLL 5IHBA 4JFSA 3LNEA 4XE5B 3RWEB 1G5GA 4MDIA 2FX8H 5AAMA 2DY2A 1V7MH 4QHNB 1WC7B 3BJ91 2CDGB 3E80A 1EWHA 4Y5XA 2G5BB 1QLEB 1BEYL 1WT5A 2ZX5A 2C3WA 1T20B 3K2UH 1ED3B 4MJID 1YMMA 4LOUC 2WYIA 4L9DA 3RILA 3V5DA 5IROA 4XCCH 3LRHA 1SLWA 1FWXA 3CHOA 4KDWA 4NM4H 3HHRB 2XTJC 1M2VB 2JJSC 5KVMC 1MELA 2P28B 4RMUA 3CN2A 3FFCA 2H45A 1JWMB 3RIAF 2Z8SA 1JPTH 1GTFA 3PXLA 4OGXL 1PQHA 2PWHA 1Z7JA 3RL2B 4XVTH 2YS4A 4OZFB 4GEJA 2D8KA 5IOKA 5D1QD 2F8OA 4PG2A 1T1ZB 4PJEE 3WIHA 4EIGB 5B3JE 2HJFA 3F00A 5DD6A 2APVA 3QJQB 2XY2A 3UABA 1MIMH 1MUJB 2AXGA 2P44B 4OF5A 3EOTL 3SJVD 4FG6D 2GJJA 3HMWL 1B3IA 3QUXD 5HGDA 3TBYB 4EOWH 5FV1L 2BVPA 1QSFD 1NCHA 3DGDA 2YRPA 1A6WH 2XFXB 1T0OA 1Y1DA 1Y6KR 1AFVL 1ITBB 2Q7NA 3JTSA 1S7VA 3R1GH 4PSPA 4WUUE 2VO5A 4ZMQA 4PJ8D 2H9GB 1KXVC 3BKYL 4RFEA 1RULH 1LE9B 2VLJD 4U6HB 1TO5A 1UXLA 4LGRB 4R4FL 1L7TH 3DV6A 2WLLB 3IXAA 1D9KB 5L8KB 2J8OA 4YFLI 2A4CA 5J6GB 1V54B 2FQGA 1F6LL 4XXWA 2H6UA 4UQIM 3HOGA 1U93A 3QQ4B 4LNRA 4QRRB 4CVZB 1BX2B 1OAKL 4AEHH 4QHMA 3EUUA 4QWWC 2F61A 3NZSA 3O9WB 4AL8L 2V0AA 4QRPD 4XI5C 3ULSA 1YYLL 3FBQA 5C6PB 4ZO6A 3P4NA 2PJJA 2UY6B 4YH6A 4KUCD 1KCSH 4PRID 2FSEA 4JRYB 2DQTH 1ZVNA 2O6CA 1MI5D 4U6YA 1KB5A 1ZD6A 3BGFB 1NDGB 3MLSH 3P2TA 3UTPE 3WUWB 4XO5A 3DSFH 3L3GB 3PPSA 3D9AH 5KSAC 1DJGA 4NO2A 4GQPH 2VDKH 3GF8A 1G7JA 4GI9A 4OIIH 4L29A 3T2NL 5JHLL 3X2HA 15C8H 1P9MC 4M8UA 5DHEA 2Z34A 3F6LA 3FRPA 1WDAA 2H8PA 2OTUA 1FFOB 5GLFA 1G5AA 2DM2A 4N2BA 4DGWC 5DJCB 4HJSA 1WA1X 2GFBB 3EYQD 3RB5A 2H41A 2XWTA 4MNGE 1KB9K 2R2HA 1UXMA 1FZKB 5AZUA 4BZ2H 4JLRB 4RISL 5T1KD 3ARTA 5C09E 1Q9WA 4FQLL 4HS8L 4M03A 1E5BA 3SKNB 1MCOL 3G9VA 4HIHB 2A69D 1H19A 1RZPA 4A7GF 1GAFH 1BD2B 2EEDA 3ZR5A 2X4TA 4LCUA 4ZBJA 2B7DT 3L3OC 1OM3L 2AK1H 1BQHA 4LCWA 4YDIL 1KPUB 3FUFA 1Z9SA 1XGZA 1BJMA 2XZQH 3I9GL 4G70B 5L4IA 3DHUA 3NCJH 3VD3A 1I82A 1DQKA 3LQZB 1CI5A 3S48A 1SLVA 3SN6N 2BXZA 5JHDA 2UY7A 3K46A 2YWYA 2J7LA 3IDUA 4P3DA 2MNJB 1HX0A 1WFMA 4XMUA 3TEYA 2V2WA 1ERNA 2Q86B 2ZSWB 4PRHD 3T77B 1XSKA 5KYXB 2IBBA 4XRCA 1EQWA 3HBQA 5T5NF 4ODWB 4HV8B 2ZXEB 4OCLC 1R0AH 5L9DH 1JWMA 1MF2H 4NB7A 3AM8A 3JZYA 3M1BB 5D1ZA 3QDMD 4A55A 4F15C 4M00A 4F7TB 5SX4I 3MRBA 5F7FA 1YMME 2C34A 5EBLA 4BCXA 3PWPD 3T0ED 3R7RA 2DTML 3L4XA 1FO0B 5IQ7L 1F4YL 1KFAL 3GRWL 2UWEF 4URKA 4FQ2H 4MJ5B 4QGYA 2QSTA 3WE6A 3DOHA 4HUCA 4GFXA 1C1EL 3EGXA 3O6MH 3KL3A 5JW5B 3MLRL 4LGPB 5D7LA 1MQKL 2B3IA 3LZOA 3QZNA 4KU1A 4X6BB 1A66A 4PP2A 3SE9L 4P59L 1CGSL 4XVOA 2W9LA 2F54E 1GJIA 4MAUH 1M9SA 2FWOB 5C0CE 4AW4A 3F64A 3GSOA 4WKZB 1ZE3C 3KVQA 4KK6C 1JF1A 5FW6A 3V0VB 2RHEA 3EHBB 2HJLA 3WXWL 4YHNB 1SFOA 3HUJA 5GGUB 2H2PC 3IJSB 1WAPA 4HPYL 4HJJH 4LCUB 4X4ME 3PQYD 35C8H 3EOAA 3RKPA 1MW0A 3KYKH 4MXWL 1OSYA 3QIWB 3AJ7A 5KBNC 4UT9A 1CD0A 2KZBA 4LL9A 2P49B 1QMUA 2IPTH 1YEKL 5L2KE 3DRTB 3Q2WA 4J6RH 1NC2A 3QNFA 4JFWA 2YD0A 4ZODA 2X87A 1UOKA 5KYUB 3Q9QA 4ANXA 1CTMA 1ZT7A 5KJ7E 3QXDB 4OLXL 1GZPA 4X4YA 2Z8VC 3VFUA 4L3EB 2NR6D 3MJ9L 2MCMA 4K3HA 3E6HB 3QUZB 2Y5TB 5BOJA 1YA5A 2XICA 4MNGB 4UV7H 1F4HA 2A74A 2H6OA 1D7CA 2AQNA 3MCLL 3V5HB 4LAQL 4JQIA 1WTGT 4HOXA 4F7KA 3Q8BA 3RWFA 3F7VA 4L4TA 4R5VA 3L08A 1QP1A 1KJ3L 5IQ9B 4UT6H 1CL7I 4I8DA 4RIRB 5K9OB 5I6LA 1HKFA 4EI5A 4CJ1A 5L88H 3HZMB 3OKMB 1KTLB 5T3XL 4Z3IA 3WIFB 2UZYB 4WNJA 3L2NA 3FU5A 15C8L 1E2WA 3MNZB 2CLZA 3GBNH 1AI1L 1G7PA 1TQTA 2XBZA 3DDGA 2HZHA 1ZT1A 1A5FL 2PYFB 3GINA 3LYRA 3MJ9H 3ILPB 4IOSD 1P84J 3O4LB 3GMLB 1S8DA 2K8QA 3GGWB 2FBJH 3MRLA 2EDQA 4QXTA 1X5HA 5GRZA 5KSBA 3S88L 1RURL 3RA7H 1WV7T 3TIEA 3OKOA 3KNBB 5DRZA 5GXBB 1QEWB 4ALAC 2PR9A 3RU8L 2JF1A 2XZCH 3CHXA 3RJDA 1U2HA 3OKNB 1AA6A 1TJIL 3SO3C 3FSWA 5FF6A 5I6XB 1BQSA 2CGRH 1MCWM 3EGSA 4GINA 4MQTB 4A38A 2BOLA 1RZGA 4U6XB 3SGDI 2X6BA 1UUSA 4AH2B 4LVOC 5IHLB 4B3EA 2GCYA 2ZOKB 5FO8A 1M7DB 2OMUA 2C4FU 1KCLA 4MA8L 3CTTA 4O02H 2K7PA 1NDMB 8PAZA 2YD4A 4A37A 3QRBA 2VH5L 5I1JH 1OCZB 4QTHB 1TO4A 2ENGA 1HINL 3LXAA 1BCIA 3AXLB 4BSVA 4N68A 4X0KB 1KUMA 1CD8A 3LDBB 5T3ZH 1JZDC 1ECYA 2F19L 1S9VB 3S5LA 3UJIL 4DFIA 1RJYB 5DJZA 4ZNEE 2PTVA 5D55A 4KO9A 1KENH 4GXVL 3E9TA 1ED3A 1F5WA 4BV1A 1T03H 5AVXB 4HP5A 3FQ1A 3BDYH 1C8QA 1I9IH 1S7UA 4XC1H 4M61B 3V7AG 4BHUI 2OM5A 3H1ZA 4IBUA 4JR9H 2VWEC 1MFDL 2DKUA 4KNTA 1ZSHA 3SQOL 1FPTL 2UX7A 1R3JB 2J2ZA 2YA0A 4U49A 4IBTA 1XCXA 4MVBC 3Q48A 2DMBA 4UT6A 1JTPA 3HN3A 1SBBA 3QHTC 5TDNA 4LARH 3NN8A 1NCCH 5HDBF 1UM4L 5C0AD 4HC1A 4HPOL 5JTWA 3EJTA 3KEDA 2HG5A 5FO7A 2R7EA 4JDEA 2J6EH 4PY8I 1FL3B 2WVUA 3V6FA 4PJHE 3FSZA 2VW7A 3IKCB 2HKHH 3AXIA 4Z7UF 3ZL1A 5GGSB 4OKVA 3L5WA 4JAMB 4A68A 5DYGA 4NFBA 2GBTA 1DQML 3NIDB 4HIHA 4WV1A 2YGPA 4X5QA 3HRZA 3GSVB 2WBJA 5DS2A 3OM3B 1I1RA 5A7EA 1NCNA 3CFKA 3BPLC 3LEYH 5GS0D 1RH8A 4JB9H 1F90L 1E18A 2OMBA 4DOHE 1QQDA 3LRKA 4BIKA 1N5AB 1BIIA 2UZXB 3SPJA 4DZBB 1AE6H 4JHUA 5DTFB 2ZYSA 3HI6L 4G6AD 3PIQB 4UNUA 3TFBA 4V1DA 1OAUH 2J1YA 3K8KA 4AUYA 3OJDA 2IMNA 3QWZA 1IIIA 1I75A 4OCYL 5ILTH 2BOCB 3L3DA 4L9LC 4ADIA 3L4WA 4JY6B 3A4DA 3ZTJG 1QG3A 5GZND 3L1GA 4Z6AT 3OMNB 3T65B 5BNXD 4GAGL 4NNYB 1IARB 1CVRA 1IM9A 3HG1E 2XQBH 1FVEB 2JIRA 4JO4L 5HD8C 3IR7A 2V4LA 2GK0B 2WV3A 4NM4L 3G5ZA 4TUJB 4YHIA 3GS7A 5IM7A 3GUTB 5FGRA 3GBML 1PD1A 1MAMH 1RK1A 2BIOA 3S35H 5AAMC 1AOHA 3FUHA 2ESVA 1E27A 4Y9CA 4QRRD 4GPVA 4Y2OB 2XA3A 1VHPA 4FZEL 3PJSA 4LLMA 3W11D 2V17H 5CEZD 1X9RA 1XMWA 2CA4A 1RZKH 3G6DL 3KLLA 4KRPD 4CW1A 1HILA 1XGUA 1E5YA 1XR9B 4PGCA 4I4WB 3LKSB 4HC1L 4JFPB 3TCXA 4UI2A 5D1QA 5A6IA 2CIKA 1HU8A 5FO7B 3WD5L 5F7HA 5I1EL 1YMHB 4WW1B 3OGCB 2ETWA 4OJEH 4ZX3A 4GKSA 1R5WB 3HCVA 1IBBA 1OARL 4IRZH 3ESOA 5F71A 3OHXC 4QRPE 5AOLA 4P99A 5I1IL 4ES8A 3IF1A 2Q20A 2CNZA 1LO3L 2NZ9D 3L3IB 1RUPH 4LEOA 3EADA 3HE7C 2BSED 3UTPD 4G80B 4NQUA 4X7FC 1YEIL 1RJZA 4NSKA 4P2QB 5I19L 3ES6A 5HI4C 1TTUA 1EHXA 4LLAA 1BVKA 4HUVB 1C9SA 1E28B 1IZKA 4OIBA 1FNFA 1WGVA 2OULB 5LCVA 3N04A 1DQDL 3V8CA 4I0PB 4HGKC 1B2WH 2BOBB 2LFGA 2QDVA 1KIQA 5EBGA 3MV7D 1M2OA 2V7NB 2VZSA 3BD4A 1AGBA 4PVLA 4Y2DB 4YHML 3OAYH 4NM8L 1G94A 1H3PL 1ADQL 1KY6A 2YA1A 3CSPA 5DJ0B 3UJJH 4PWIA 3WIFA 3OHXA 2ZXAA 1MDTA 1FDLH 1Q16A 2ZWZA 3S36H 3CD4A 2KZKA 5BZZA 1PX4A 5FX3A 4KPHL 4BKTC 4U1MA 4Y8AA 1C7TA 1J7VR 4FP8H 4N1CA 4ZTPH 4C57C 2X9ZA 4OT1L 2ZUXA 2Y06H 2Y36H 3Q01A 2VLLA 3TM6A 2P7TA 3MROB 5ECGA 2UZXA 4BFIA 2K4AA 4LLVB 4E41E 3TYFB 3ELQA 4YXKH 4MNGA 1UENA 2DMCA 1KIRB 3K72A 2E27H 5EOTB 4JPWL 1EZVY 3BVDB 4CW1B 1G9NC 2Q7YB 5TDPA 5T3XE 3WTTA 2RR3A 1TKWA 1QOKA 3DMMA 3KDPB 4KI5C 5E6RB 3I02B 1FNGA 3CV5A 2UXFA 1NBZA 4LF3B 3QIBB 1CDHA 3VW3L 3ABMB 1MRDH 2DWDB 2G3MA 2ZCLL 4HXBL 1I7ZB 1WF5A 5AUMB 3MLWL 4GW5A 1J12A 4NCC1 3MXVL 2CRYA 4Q9QH 1RFDH 2FECI 2P8LB 1X5AA 1ZTXH 3QJXA 4OLYL 4OT1H 4I3GA 3BP5B 5H8DA 1Q94B 3MA9L 1JD7A 2BFGA 1Q9KA 3QIBC 1W0WB 4MX7B 3ZOAA 3BPCB 3QEQA 4NHUB 4HF5L 3OXRB 4JZNB 2JK5A 2A6IB 4MTMA 1RUQH 1U33A 4O4YH 1M6OB 3K1KC 5INDA 2MKWA 3KWTA 4NP4L 4ZMOA 1CO1A 3U30C 3X2NA 4K15A 1UFUA 4TM9A 2QDWA 2I32A 5DZNA 3OG6B 2QADB 1OTTD 5HJ3B 4DPRA 4X6DA 4YXHL 4Z7UB 1S9VA 2NZ1A 4LRIA 4UT9H 4XVSH 2N56A 4BQ6A 1UQSA 5ID0B 1WBZA 2FSDA 2F1EA 3OB0H 5JA9A 4G9FD 3TA3B 2A0LD 4WWKA 43CAB 4Y19E 4PTTB 3OSVA 3SYOA 1NBVH 4DCQA 1YSOA 1OZUA 4AQ8A 5IREA 2W88A 3HC0A 4JCWA 4M5ZH 1H9DA 2CJUL 3ZDYF 1PVHA 4QUOA 1AP2A 3O6FA 5AW4B 5B3SB 1FN4B 1QLRB 5K93A 3U83A 1QVOB 2MNWA 2VDNL 3ME0B 3CZLA 1D5MB 4OR1A 4MS8C 3OD3A 2BK8A 4F7PB 4AXWA 3VJ6A 3BUPA 1FH5L 1A6UL 3GXFA 4DUWA 1A6TB 4FQCL 5ANME 1YEDA 3HTLX 4NZRH 2XXCB 1WO2A 3TWYA 3DMMB 3SODB 2R7EB 1NWPA 5I8KL 3QGVA 2P8MB 3D0LB 5F6IB 1JL8A 3ZX1A 4JMNA 2LGNA 1S7UB 1K3IA 1T7VA 2OZ4A 1B88A 1I8IA 1ES0B 4BD4A 1I7RB 2Q1EA 1KBVA 5KVGE 1H3VA 4J3OF 1ZHKA 2BVYA 2B1OA 1VCBC 3O11A 4OLZH 4AZ8A 1X6NA 4R7DB 5E6IA 1BFVL 1KTBA 1J5DA 1S9YA 1W72A 4IU3B 5C07E 3RBGA 1YNTF 4IBSA 3WNOA 3PF2A 2FYVA 2BVQB 2WQXA 3I50H 4S1DD 4B53A 4BA0A 4OZHE 5E8PA 4JO2H 5ADPH 1XF4B 4FOMA 5EIQA 1V5JA 5F3FA 5E08L 1SF5A 5FO9A 2J56A 5HYEA 3GSXA 3F58H 2HKAA 4NQDA 2A9ML 4AYDC 3IXTB 3ML8A 4PY8J 2WXGA 2GK2A 4RV0A 4H8UA 5IHZA 4JFFE 1F4XL 4UZUA 3D12B 4DAGL 3D69B 1RJYA 3LH9A 5DJZB 5FDWA 1JGLH 4Z0XB 3FMGH 3IDXL 3KPSB 5TDOA 1T20A 2BNRE 3O81A 1QNZL 1U3HC 3ZR6A 2RFXA 2HKFH 2EDRA 2B1HH 2VXSH 2A9AA 5KBLA 1HOCA 3S5LG 2LABA 3MRCA 2WLIA 5CJXC 3DMMC 2VDMH 1GGBH 2HN7B 3DXAB 4HISA 1PLBA 1JP5A 3UYRH 4KXAA 3S3DB 4ZG1A 2Y07L 4PJ8B 5ICYA 3C6SB 2VE6B 2V33A 2OTPA 3MRIB 4KHTL 3IM1A 4N9GB 1UCTA 4J8RA 4JM2A 2IBZX 4XP6L 4BHUA 2CUAA 3NEEA 3RX9A 3F8UB 4QHMB 1P4BL 4UM8A 4PJGB 1EJOH 4DW2H 4P5SA 4AIZB 5JORB 3DX7A 3IWVA 2P5ED 1BVOA 1E5UI 1T6WA 3RFZC 4AYGA 4FNTA 5SWZD 1N3NB 1U8OB 4ZZFA 5EO9B 3VXRB 1OGTA 1PLGL 3MJ6A 5F72S 1N64L 2CDFB 4ELKA 2HWZL 3S37X 3QQ3A 4H26B 3FB7B 3RFZB 5EU5A 3U4BH 3D0VB 4I77H 3OF6D 5DUMH 3X12A 4QIWA 5T1DL 1CT8A 2N7BA 5C70A 4HIPA 5C3LD 3TBWB 2R92A 1G7LB 2GKIA 3LD8C 4P49A 4FG6C 3SBRA 1OT2A 1GTNA 1TOXA 1ROCA 3EZ8A 2G2RA 2OYPA 3LNIA 3D25A 1JI1A 5FTJA 1F02I 1TTRA 3EFFB 1RK1B 3DX8B 4S2SB 3U1SL 2C9RA 2I27N 1KOAA 3H9HB 3G6JA 3V8OA 5D7IF 2C26A 2IDFA 2VDNB 1KLUA 4UB0L 4RMBA 3BFQG 4PJ8C 5BO1L 1HNYA 1F3DJ 5DJ0A 2F19H 5AWNL 3CFCH 3A21A 3B2PA 1MI5E 4PJ5A 2QR0B 5TFSL 4GXVH 4ODVL 1I1YB 3CZBA 2E7CA 1Q0XH 3ABZA 4D3CH 3U6RB 4PLNC 2XX1A 5DRNA 5ERWA 1F3RB 1BQKA 2QV2A 4F57L 1T22A 3NCXA 4POYA 2YOCA 2ZAGA 2ITDB 4WU5A 5CCHE 2BDNL 2PCFA 1U8QB 1KMGA 4CU8A 2ATAA 2G9HA 5JOPE 2A7BA 5E7FA 4ZQKA 1XV8A 4P5MB 4XMXA 5T5FH 1D2OA 5KSAD 1L6PA 1W0YT 4OLXH 2CO7A 3QXVA 2QSCH 3HZKB 4AT6B 1X5GA 1YDPB 3QZBA 5CCKL 2R1YA 1T2XA 5KYNA 3B2UD 3PAZA 1GPOH 5F3BA 4Q14A 4YHYC 5JDSB 3DRQA 5AB9A 4J6RL 3ULVH 5DD1L 5HYSB 5IJBC 5IESH 5LAXB 2YN3A 1CFVH 1MEXL 4GG6B 2VUOA 3LH2H 3VO0A 1UACL 2ORBH 5HHXL 4MMZC 2E6PA 2VXVH 3O2WH 3VDCA 1JJUA 5JPNA 2PXYB 2AJ3A 1F1AA 4Z77A 3O0RL 1ETA1 2FE0A 3BH4A 4W70A 3PV6B 3S98A 5KYWA 5ADOL 2VM3A 4B0MB 1V27A 3DTXB 1KPRB 3L4TA 4I3SL 2JWYA 2W60A 2HT2C 1I9RH 2W0FA 3FB8A 1SDAB 3NACL 1H8SA 4YO0A 5AAWA 1G4RA 1R19A 2XA8L 3PHAA 1QKZH 2Y3NA 3BWUC 4OKDA 3DBSA 4MQ7A 2ZNXA 4JE4B 3UMTA 4ODSH 5HDQH 5EF3A 2QHLA 2G5DA 2YBGA 2JI2A 1YN6A 3BE1L 3O2VL 1NL0H 4DEWA 3E6FA 4M9OA 1MPAH 2JLLA 1DZBA 2V5TA 4OCRH 2VDLH 3TA3C 4Z7AA 7FABH 3FFOA 3GMRB 1ZGLB 5EBWA 5KOVC 1AGCB 2JIMA 3ATBA 3L95B 5HDBB 5CBAB 4JPVL 3REVA 2R4SH 4DF9A 4DNLA 2I85A 3LKNB 3HG1A 5HHXH 4I2XB 2YKLH 1CZ5A 3H9ZA 3E38A 4X4ZA 3TNMA 3C09C 1B6DA 1IC7H 1JHKH 1SVZA 1Z66A 4HJGA 4WHYG 4NC2B 2EUXA 5FW7A 1EAPA 1B9KA 1RK7A 3HE7A 5B7EA 3T0EC 1K4CA 2VL4A 3GDCA 3NIFB 3IJ7A 1TZGL 1SJHB 2CKBH 2ZICA 3ABGA 3DJTA 4ZW5A 4TVSa 4LVEA 4PJ9B 5J5EA 3UC0L 1I3GL 3PWNA 4A2MA 3TBBA 3ZE1F 5LCVL 5CU5A 1I3RA 4N2LA 1BP3B 1NEUA 4RSVA 5LWYL 4LL4A 2V2XA 4P5RA 4GAYA 1WBZB 3FK3A 4Z78A 4GB9A 1N18A 3RDJA 3Q1EA 3ILQC 2H2SC 1II4E 3US1A 4LPXA 5LHDA 3TVMB 2MCAA 4DGVH 4ZSOA 3CN0A 1CQKA 5IK3A 3L5HA 1QSEB 2DRUA 4NHCH 3KLHC 3DC0A 3TPUA 1T1YB 3FFDB 2UZYA 2J88H 2QTVA 4PRIA 1A1NB 3AREB 1T6BX 1W0WA 2X0VA 2AQRA 1JZHA 1WCQA 1UZ8A 4AQEA 1CVSC 3P9MA 3QAQA 4XR8C 4YO0B 5DD5H 4OQTA 4Z7QB 4NQDD 1BW8A 3T08A 4OCSH 3CPUA 1OVZA 4JM4H 2QPSA 4GKZB 1I7UB 5B1JC 2UVEA 5DVLA 4QOKA 5CN2A 3GRGA 3NZ8B 4HDIB 4AV4A 4KITB 1ZEAL 4YPJA 3WLWC 3X11A 3L3KA 2F54A 4N5EC 3EFDH 5DFWH 5C6TL 2JKLA 1YYMH 4ENGA 3L9EA 4NC1C 4YHPB 4ZQTA 1MZZA 3QQ4A 4LNRB 5LAXA 4QRRA 3RZCB 1BPLB 4B9ZA 2AK4E 1E4KA 3MRNB 4YDKL 3WFHA 4UZGA 1AANA 1XMEB 3BIKA 3DI3B 5FTKA 4MA1C 5E95B 2J5LC 3VXQB 4C4KT 4WF7A 4MSWB 4I0PC 4JFZH 4K5OA 1JBJA 3WS3A 3APFA 4W9HC 3W39A 1HCFX 1QLRA 4LQFH 1F86A 1LTXA 1PQZA 3W81A 3U48A 1F41A 4L4VB 2BSSB 4W1TA 1MJUH 1NUFA 2O5YL 4JPKL 4WCYL 5JHDD 3QULB 4O2CB 2VABB 3MSPA 1NGPL 4EI5C 2FEEL 1J8HA 3EJPA 4U1KB 3LY6A 4MNQA 5I1HH 4BH7B 4FCAA 3LKRA 3CF2A 1OHZA 1C5CL 2J5WA 1DBMH 1ZWIB 4WK0B 1UHEA 5KS9A 5TE4L 1BAFH 2R1XB 4X7SH 3WI9A 4B0MM 5CKAA 4QRTA 2R2BA 2CDEA 2XC8A 4WFFE 3NSFA 1ZKAA 1E7VA 3SDCA 1TVHB 1MNUL 3CDZA 4NPYB 1XBDA 4JGUA 1LO0H 1A3ZA 5I6MA 3SE3C 5DRWA 5I26A 4KKRA 4J3UA 2O6FA 1DMRA 4K3DH 4YNYA 5GZOC 2AJVL 4MJ2A 4OVVA 4K23L 2E2IA 4HFWA 5C97A 1Y6NR 1GY1A 2AEIT 3F7QA 4WFED 3PHQA 1QA9B 1NBCA 2JNZA 2VN3A 4UQ2A 1P7QB 1TZIB 4I9WE 4AKQA 4M93B 4XP1H 5FFLA 2H5UA 3WN6A 5H37G 3TOPA 3BJLA 3MJ7A 4QGTA 3NFSL 2DQTL 3DJZA 4FZ8H 5AW5B 2JVUA 2DQHL 3WTSA 1CLYL 3FFCD 3UP6A 1ZA3B 3CFTA 5IROD 3BDXA 1UASA 1S7QB 4EUPH 2FJHA 4AEHL 1SOSA 4N0RA 1JHLH 2FX7H 3QPXL 4GG6F 1RZKL 2BP8A 4LNVA 2C45A 2B2XH 2ENJA 4ZFGL 3UTTD 1TFHA 1OEZW 4CMMB 1RPUA 3WLBA 2YGQA 2WUCH 2CDFA 3MAWA 2EKJA 4ZO8A 3CDFA 4N28A 4OLVH 5DTFA 5C0CD 2AW2A 1N4XH 1XF5A 4W9EC 3S8FB 4XP6H 2R39A 5BV7L 2OMVB 3ZDXF 1XGRA 4YZFF 4FQCH 4PJGA 4ZSOE 2CUMA 4FA6A 4JM2F 4HOZA 4ELMF 5JORA 3C8DA 3BP4A 5EEVA 3NFNB 3WIIH 4QXWA 4Z18A 2EVFA 2C8NA 2XTJE 3VCLA 5FGBA 1GS6X 3NT0A 4ZUVA 2CU9A 3UZQA 1N5YH 1BVNP 1FVEA 4IRSD 2OP4H 3VD2A 4XMKH 2AGJL 3M86A 5E99L 1AKJD 3CMOH 4PRIE 1RUMH 4IRJA 1F18A 3QUMB 3MVSA 3DBXA 1J9SA 2NXYB 5FYLL 3RIAK 3W0WD 1W72H 5CZXC 4XPAL 4YHLL 3HLAA 1JTTA 3B8YA 3S34H 3G9AB 3RQ3A 3LIZH 5EIIA 4J3WA 3G6JF 1AY1H 3F58L 5IFAH 3U0PA 5FGCB 2X4RA 2VLKB 3DIVA 2WNGA 2QKIC 3U0TB 3KBFA 5DLMH 4CVXB 1KYDA 4N0YL 5CGYD 4HFUL 1CLCA 1T4KA 3CX5K 4L1BA 3MQIA 1WZKA 4WWKD 1OLZA 1E8YA 3MBEA 4A67A 4JPQA 3V0IA 3WNLA 4DN4H 3B5GA 2ICWA 2QGDA 5KYWB 5F6HJ 3LDBC 5G2NA 5B4MD 3EG9A 3AG3B 2HYMA 1UZGA 4LSVL 5CINL 5EMYA 5C0BA 2ZAHA 1RZ7L 1JYWA 1YRKA 5FFOA 1VB9A 2IVFC 1CTNA 1V7NH 2VJ0A 1KC5L 2FHFA 3PQYB 2R29L 4P46A 1R46A 3B2VH 2I9LB 3EO9L 5IVZB 1RZGB 4U6XA 4X4XA 2YUXA 5IW6B 5IR1A 3CZSA 1J5OL 1PFOA 3CDGA 4QF1B 5FB8B 2EUVA 2BHUA 4LVOB 1PYUB 3SSGA 1CXHA 3FTGA 1UJ3C 3FONA 1FC2D 3TT3L 1YEEL 4OZGA 5F0JB 4LPWA 1FYTA 3OJVC 5FYKU 5DWPA 2F2HA 2JLPA 2GQHA 4KJQD 1ZHNA 2XWZA 3FB5A 2IH1A 3GTNA 3H53A 4B5ZA 2FEJA 1CF1A 3HE7B 4BFFA 4JRFA 4J6IA 4AAYA 1L0QA 4I18B 3PLYA 3BAJA 4HK3J 3BH9A 4U05A 5LLIC 1X5YA 2QBWA 4F8PA 4C56A 4HJUA 3C5JA 4IOIA 1YZZA 3ABLB 5EEUA 4XBPA 1OIOA 3DIFA 1AC6A 1VFAB 4L8BB 1LO4L 5KSBF 4YX2L 5I8EA 1CQYA 4AH2A 4XWGH 4TLUA 4ZXBB 4AVHA 4QXGH 1JDCA 1TWCA 4PG9A 3UO8B 2P8PB 4P04A 4DKFL 1XHHA 3S8GB 4XNZB 1XTLA 2OQJA 4KK9C 5ESAA 3PXHA 3IFNL 4CSZA 3GMOA 4F33A 1JGUH 2CKBA 4ZRGA 4NUGH 3VMPA 2NNFA 2XN9E 1YYCA 2O4EA 3L3OB 1TSRA 1JHKL 2VQ4A 2OL3A 4HEMA 2HVJB 5JPMA 1HQRA 1N70A 2HX7A 5C0DA 2WQRA 3TWCL 3QWRA 4BWWA 1S8DB 5HHOD 3RIFF 2JKWA 1MRCH 4Z3TA 5C0BB 3N1MC 1EX0A 5AENA 2UWEB 2PF6A 4QRPA 5B1KA 2R0WH 1ADQA 1A6ZB 1QYGL 2ERJC 4YSAA 1AACA 2CA3A 4UANA 2C7UB 1N4XL 2ZUTA 3AU1A 3HS0A 4UMGA 3TN0C 5BS0E 2NY3B 2AJUL 2HMIC 3FULA 3M46A 5IBLC 2XQYG 5FM5M 1KN2L 2FD6L 3O4OB 1JZGA 5D71L 4GA6A 2R2CA 4MD0B 4HIIA 3S35L 1T1ZA 5I6PA 2GUOA 1F4WL 2C3VA 2DIBA 2IALA 4M5YH 1JNHB 3DUUB 2HXAA 2PW2B 3IJYA 2OYLA 3SDCD 3O0RH 3QUYB 4KKAC 4NI6A 4OM0H 4Y4FC 3GBMH 1CDYA 4NQVB 4FXLA 2GAZB 3B9KC 3KXFE 3J8F7 1HCYA 5IMLA 4LCYA 4NQSB 3NZUA 1T04B 4P2CG 3FTZA 4KKCC 3WJJA 2EDXA 4K55A 4P2QD 3W0WB 3ZY7A 1MCDA 1MCCA 3JWNC 3V5KA 1PT1A 2EICA 4JG1H 3SDAA 3FCTB 4XXDB 1FLRH 5D5MB 1MCFA 4MDIB 4HUKB 4PLKC 3CMOL 3DURB 2FWLB 5E2UH 1XB3A 1PAZA 1ZLVK 3TP4A 3VRJA 2JB5L 4O2CA 3U9UA 4KKLC 4RZCA 4UDTB 5C0JB 3UAFA 4Y19D 1DVTA 1DE4B 3GSNL 3I6KA 4JG5A 3IGKA 1F58H 3T0WA 3HAEA 3VVVA 1YNKH 3B2DC 4PJCB 4FXGA 3AM8C 4EPSA 1H15A 4G5AA 2DQCL 2ZUYA 1BF2A 1V3MA 4WGKA 1ID5I 5AW2B 3ZIMA 3F5WA 4G8IA 4A2EA 2ZOUA 1J8HD 1CF8L 2WLZA 3AS0A 3UH8A 4YDLB 3TCTA 4HWUA 2F53E 1RU9H 3O41A 5DF0A 5GGVL 5EUOB 3SCMC 3V6OA 3D1MC 2BWDA 5IVXB 1MG2C 5I1AB 5F7UA 1D2PA 2BRRH 2I69A 2ZXDA 2FJUB 5AOIA 3OZ9L 4PJBA 4GNKB 2RB8A 4M7LT 2EZ0D 4KQ3H 3NZHH 3CVIH 1D5XB 1U2YA 4W68A 5F1IB 4AGLA 3GMOB 3GBNL 2OJEB 4NBYB 2QQQA 4AGPA 3DSNA 4NUJA 1H0HA 5DMIL 1ZA3A 3CQZA 3VSQA 1UM5H 3C6LA 4U1GB 2Y1ZA 5AD0A 4OCWL 3CZFA 5HPOA 2FR4B 4XNUH 1ZT4A 3ISRA 5EN3A 1P5UB 2IFGA 4JDVA 5E9DB 4OY9A 4LSSL 3FT3A 2VM9A 4L29B 4TOYH 4XXCC 2IPUG 4L2LA 3S4SA 4U2ZA 1DUZB 4H88H 4HEME 5FYKD 5KW9H 4GY4A 5DC2A 3COOA 3T4AC 3Q8AA 4ONGL 1PSKL 2PPFA 2XN9A 3RTLA 5GRUH 2PMZA 2AJXL 4P4RA 3RWGA 3PWJA 3CU7A 1FLTX 4EDXA 1RK0B 4XVUC 1EHKB 1X7QB 2IAMD 1WWCA 3ZHFA 2GJ6B 4OUOA 5MHSD 3ZTCC 2AMUA 4E9QA 4R4BB 2CAKA 2IDSA 3E8VA 3CE1A 3FAXA 2X5PA 1MRFH 2NZIA 5IQMA 2ARWA 4B5EA 2WLLA 2ZCKL 4NLHA 2E9JA 4RA3A 5CR8A 5FB8A 4YHNA 4OUUB 3N1QC 3KS0J 3QNYA 4E5XG 3CNKA 2YIHA 1M71A 2XZCL 2Y7SA 3G08B 2G3NA 3F12B 1ZS8A 1TPXC 3FRPB 2FVNA 3K81A 1P1VA 3MA7B 4LASH 1CFBA 3FCTA 4GT7A 4RDBA 3FQ2A 1TTGA 3FPXA 1KJVB 1OB1A 2A5UA 2K70A 2VAJA 3MRMB 3BZ4A 4BRVA 1YEJL 5DMKB 1JWSB 1WWAX 5F96H 1MHEA 1J5IA 2FATL 2WXIA 1Z1WA 4ZZKA 1NCAL 2CLRB 3WFEH 3S3JA 4YC2B 4PGDA 4JY4B 3ZL4L 1MFMA 2NAPA 1XCQA 3LQAL 2JA5A 4IMKA 5B6CA 1MPAL 3BESR 3QYNA 3AUVA 4QXVA 4C56D 4K3JH 3KMDA 1T1WB 4HVBA 3BWAA 1WFOA 4NZRL 3UTTE 5HHMB 5IF0B 1F42A 2YPLD 3WNIA 4ALAH 4QAWA 3P0YL 1PYWA 1TZ8A 4P4KA 4JFTA 5DLML 2EDHA 3MV9B 1N2RB 3IMWA 3RL1A 1DLHA 4G3YH 4BFNA 1YJDL 2VXUL 1KPUA 3BZ4B 3UGEA 4TYUA 2J21A 2NT1A 1D5MA 3PJNA 1PZ5B 3BSZH 4Y1TA 2GTWA 3OMAB 4R8WH 4MQSB 5CNHA 3VWJB 3U82B 1SUJA 1OANA 2FGWH 4ZUWB 4PFEA 3QWRD 1OY3B 1OCWH 1DJWA 4YIQA 1LEIB 2VN7A 1ZVSA 3ATFA 5DEFA 1N6QH 5DA0B 1IAKA 1IAIL 4FDWA 4PCKA 1SYVB 3ZRCC 3H6JA 5BV7C 3D7PA 4S1QH 4XVJH 4HUNB 3KYMB 3A6BL 4PJ7F 3I9GH 4PJBE 1BEYH 3IK2A 3K2UL 3ZE0F 3WY4A 4K2UH 4CMHB 4NQCB 2CO7B 2BM3A 3ZE0E 1XCTA 2VKWA 4MYWB 5EOCJ 4W4OA 2CZNA 1XB8A 2KI8A 4U2YA 5EDSA 5KVFL 5CZVH 1MCBA 2X1OA 1WISA 1GW0A 1YJDH 3NJVA 4GAJL 4RIRA 4X6DF 2IAMB 3H85A 4TL4A 3H42L 2B5IB 2WWMD 5D2LF 3SUKA 3AQXA 2EYSB 3ZQWA 1GYAA 1TF4A 2PO6D 2G4EA 1E90A 3PHSA 1C1EH 1FUNA 5LKNA 2A74B 2NNAB 3MGAA 5E6IC 4W9LC 1M4KA 1TJGH 3C5XA 4DN3L 5FHAH 1KBPA 3I6GB 1QNIA 2GT9A 3T0DA 3KYAA 4W9DC 3V2AR 2BIPA 1U42A 3RVUD 5L8JB 5IT2L 3E6FB 3CLFH 5F0MB 3MCG1 4LOEA 5EN2B 5GS3A 1AGFB 3GTPA 1I1FB 4G1EB 4LEEA 4HHWA 5ALCH 4U33A 5JQIB 4PB0L 1NTDA 3CVIL 4A2HA 1BVLB 1N64H 5C0AE 3UBXG 5A40E 2VMEA 2WXJA 2J8UE 3OVUB 4I77L 3V4PH 3SPIA 2VXVL 2NX5B 2DYRB 4ELMB 1F11A 2PYEA 4NIKB 1Z3GH 2IPTL 4L05A 4PN6A 4UMSA 5AW9B 3ARDD 4MA7L 4LCCB 1U8JA 4AJ0A 1P2CB 1A02N 3E1F1 3ZYZA 5L2JB 2I7OA 3P4MA 3SPVB 1TLKA 4HJJL 1HIMH 4YC2C 3EGDB 3H7LA 2LR4A 4MMYA 1CDIA 1H15B 1JXDA 2VERN 1D5RA 1KCUL 1W0VA 3AY4C 4FYSA 4KJYA 4PRDB 3TO4D 4APXB 1KTKE 4OZFH 1EFXB 3IYLW 2KLTA 4E2OA 2AJXH 3DX3A 1NKGA 4NJAL 5FV2A 4H0IA 2EC9U 4GUPA 2N7AA 3VFOB 2YXWA 4OF7A 2HH0L 3QQ9C 1WTLA 2AEQH 5EOCL 4XCEA 3IN2A 3T4YA 3BGMB 1MVUB 1K2DA 3FUDA 5CMAA 5CR1A 3KLAB 3WKYA 2F7OA 3DVGB 5DWUL 1H0DA 4XNYH 4NN6B 2X70A 4N8VA 1KGWA 4F7EA 4PY7A 1IGTA 2CO1A 2NW3B 4XVTL 4Z95H 3GC3A 4L8DB 3PABB 4NQVA 4OSUL 3ZDZB 1QO3B 1YHPA 4OZHA 3UIYA 4ABVA 1JERA 3MODH 2O5XH 1G6VK 3B7SA 5KJRL 2XV6B 3MV11 3CFDA 3ILQD 4R97B 5J1AA 4ZFZA 3C9NB 3MCYA 4CVUA 1FNLA 3KCWA 4FQHA 4PGBA 1KTDA 2P3YA 4QOKB 4JY5L 1AZCA 5HHOE 1QR1B 2WXPA 1DEEA 3BOVA 3MPCA 2EXWD 5TQ0L 5JHDB 1IC1A 1M05B 3B6SB 4HIJB 1OK8A 5E00A 5EU6A 2JXMA 2JKNA 1E32A 1LE5A 1PG7W 1TJHH 2VM4A 3IPEA 4NO0D 2DH3A 5IKCB 1BYOA 4LCIH 3OMZA 3T77A 4JFEE 1QABA 1S78C 2IAMA 3FH5A 5BPPA 1AZRA 5I2IA 3DO4A 3I6SA 2VZTA 3ZDXE 4BXSV 2IOIA 4L1HA 3WFHB 1QFWM 3GPSA 4TNWK 4AYSA 3UBXB 1Q72L 4WUUA 3VI4E 5A2AA 5G4NA 4KAQL 4KK8C 3DHPA 3OBAA 1TLMA 3H3KA 1ZV9A 2DLHA 3SDAC 3V6FB 2DN7A 1XGTA 5F2FA 3IFLH 1KCKA 3TONA 3EDEA 1GH7A 1DBKL 1WWBX 3BUBA 1DDTA 1FFOA 4N0UA 4PJEF 5B3JF 3ZYIA 3F7YB 1NFKA 3LSOB 3N42B 3GT6A 1JGDA 1TZHB 4EKJA 5I8CB 3NDYE 3CX2A 1R5VA 4PJBF 1FZKA 3IU3B 3ARGD 5GRJL 1SVBA 4DSYA 3ZL2A 2HT3D 4D9QE 5FGSA 2A2QT 3UO1L 1XGQB 3REWA 5ABDE 3LPPA 4PWFA 4WV1C 1BAGA 4I48B 1XBRA 2HVBA 4CMHC 1XH1A 2VR8A 1HI6B 3O9WA 2CDEB 4V1DB 3G6JE 1XH0A 4LVNC 3LNDA 2IH8A 4HYTB 4IEFA 4L1TA 3S35X 2PPDA 5K33A 3NJNA 1TEFA 3TASA 2W38A 3FKIA 4ZS7L 5GSVA 3T0XA 3QNXB 3GHEH 1MSPA 3PP4H 5E9NA 2HTLC 4PIBA 2WVTA 5LBSL 3PV6A 4Q6IB 3HC4L 1OTSD 4ZM7A 2XU9A 3VDAA 5GZOD 4NQEB 4KLNA 4RETB 4MB4A 3TEUA 1G9EA 5CCJA 4U6HA 3CFBA 1BXAA 3EKCA 1E6OL 3MNDA 2IADB 3PGFH 1EDYA 3D3VE 3CIAA 2WJ7A 2ZYHA 5FUOH 4AMKL 1DVFD 1WBXB 2YO3A 4K9EH 4R0LC 1IAOA 1QR4A 4J3VA 4G9DB 5I8OL 1ZYRD 2PCYA 2XXGA 4QRSB 4O2FB 3P9WB 3QNYB 4HALA 2Q76A 2OJZL 1CBVL 3N06B 4Z7NF 3DETC 4GRWB 3RVXD 2NY4D 3ULUF 1GIGH 5GHWH 2R9HD 1SFHA 1UVQB 5E5RB 1E6JH 4K5MA 2YJLA 4HJEA 1UKQA 1KDIA 1J18A 2NYKA 4IJTA 4KZCA 5K9JH 4YX2H 3CQFA 3ULVL 1L5GB 2K6YA 1ADWA 1D7DA 3P69A 2H6PA 2J4WL 5EV7A 4DKFH 2G75A 3OZLA 1WAAA 1NMBL 4XBMA 4I0PA 3ZKMC 1VC3B 5FM5O 4MX7A 3D2UD 4WI4A 4PAZA 2Q8AL 2A6DA 3N41F 1YC8A 4D0CA 1GMIA 2X4OB 4XH2B 1JVKA 1J0JA 2VITB 3FOMB 4WW2F 3JWOC 4P2QA 5DHVB 2JMRA 1KCWA 2V2TA 4Z7IA 3F3HA 1MWAB 2VTFA 1SJMA 4DTGH 1OTUD 4U0QB 1HNFA 2PO6B 4XHJD 1QZ1A 5J12B 4HU2A 3OLDA 1O5PA 4B97A 3RY5A 4IU2B 4MB3A 1TQBB 4G7QB 1GGCH 4M56A 5AL8A 3G5YB 4P9ML 1KLFA 5E2JA 1RHHA 4PGEA 2PP8A 4JFEA 1YMHA 5DD3H 1FZMA 4O02A 1Q9LB 2NY1B 3JWDC 3PDDA 4JDZB 4NKDB 3OMIB 2WY3B 4OV5B 4L3ED 5FTNA 4AGMA 3IMTA 5F88A 4B3VA 3WKQA 5EOTA 5IBTL 1OT4A 1RIVL 4X6EB 3MX0A 5D6CB 2FEDD 2EDTA 1M1XA 4KQ4L 3QG7H 2BZDA 4HXAL 4NZ8A 3ARSA 3X3GH 3MACH 4WWOA 1JHTB 4G1MA 5L2KA 4HIEB 1L9TA 3R8BB 1BV8A 2OCFD 4OZ4A 1KN4H 3A22A 5J9PB 3CXHJ 4NRYB 3FZUD 5I1KH 1D7FA 3FU7A 3VGAB 5E2TL 3MJGX 1BZQK 1FQ9C 3BAEH 3H9SB 4IGBC 2V3EA 1TNMA 4HEPA 5HDOA 4AZDA 4YPGB 4PG9B 4NKDA 3FO9B 5CN1A 1N67A 4P5TB 2A99A 5C86A 1U3NA 3NFSH 3RYMA 5EH1A 4UOW0 2OCJA 2IWGA 2YQGA 1OZTG 3QDGB 1HHGB 4MKMA 4XN1A 3T2QA 3FW6A 2Z1PA 5E1QA 4JM2C 3VYPA 4AGOA 2WYTA 4DVRH 1ZLSH 4YHMH 2G60L 1K6QH 3OKKB 3DYOA 3VI3B 3IDJA 1CD1A 3L9RA 4X99A 2HRHA 4PCYA 4MQXD 3QI9D 4UUJA 3SKMA 1DBJH 1MHHB 4Y2NA 5LDSA 1PT0A 4P3CL 3C5JB 4IOIB 4JHWL 2WBJC 5FYJE 5BZWB 3BAKA 3VD0A 1DSFL 2QGEA 4YDMA 3KM1A 3O8XD 4XMTA 3QHFL 2Y9RT 3UTTA 3FMGL 3IDXH 2DW5A 4NN7B 5AW0B 5D96C 3GI8H 3GSXB 1RP9A 1WLHA 3HC2A 3MLTA 1IBZA 4PJ7E 4LLUB 5KS9F 1O7DE 3VFVA 1U8LB 1S3KL 5JLZB 3VWKB 2C3VB 5GGQH 2X53A 1S9XA 1HFUA 1OQOA 5AVRB 5IB1A 3O6ML 1YQVL 4YE0A 4YBQC 3NRQA 2AITA 3LKQB 4B9FA 5FLVA 3U6XS 4BBWA 3UJTL 5I6OA 1F4YH 3NAAH 2A1WH 1XF2B 4LQFL 3EYUL 3RRQA 4QR7A 4TLSA 2B15A 4N2DA 3S96A 2AJYL 3G6AA 1LD9B 2C1PA 5E4AA 1QFWH 1UT9A 2G2NA 5CZKA 2GK0A 3IS0X 3BDYL 3GD1C 4GBXD 1ZGLM 3L4UA 3RGVD 3BQUA 2HSIA 4PGBB 3VFMB 2Y7OA 3D18A 1YNND 1SDDA 3EBIA 1MFDH 1JXFA 2WZPD 1AGDA 4X9HA 3MRJB 3CN4A 3G5VB 2GJRA 1GVIA 3FRPG 3QCVL 4RA0C 1FL6A 4K8RC 4ZAKA 1HI6A 1DSYA 5MP6H 3ULVE 1S7RA 2WVSA 3MRRA 2RIKA 1A47A 1RZIB 5IJKC 2BVTA 1JGEB 4ADGA 2HMID 3T6WA 4CVXA 2NY3C 1G7JB 2F7IA 3DJSA 4TULL 3QUKB 3FO2B 3MV7E 2ERJB 1UB6A 5EUOF 1IKFH 3ZRSA 4HBCH 2VZ1A 2NSQA 3QUXA 4JX0A 4K5PA 5SV3A 1KB5B 2G9KA 3S5LB 5EZIH 3S9DB 3LQMA 4M1CC 1P5UC 4KDLA 2ITEA 4QKXB 4YSOA 4K5NA 2P45B 1KGYE 1M57B 1S7XB 4N26A 1E60A 4JB9L 2EH7H 3ATAA 3LV3B 3B9KD 5BO0D 5CIPH 3T6ZA 1BM3H 3FU7B 1M56B 1YEFH 2P46B 3KPPB 2J1ZA 1L9MA 1BECA 4H8QA 3F84A 4PYHA 3FUJA 4ZNCD 1WP6A 3Q2NA 1QDNA 4K3EL 2ZOTA 1G7QB 4XPFH 3TJEL 2LVCA 3VXMB 5JHMA 2AC0A 1A4JB 2OZ4L 3ISYA 1Z3GL 3Q44A 5DYOB 1UWXH 2C3GA 2WQWA 1UATA 4JRXA 2CG9X 3VMOA 1AOZA 1CFQB 3QEQE 5D7SL 1IQWH 3OKDB 1KB5H 3BKML 2FBJL 1P5UA 3MOAH 5GSVB 1C08B 2RFXB 1WICA 5HYFA 4QXTB 4HA1A 3DDFA 1JZJA 3DX6B 4L3AA 1ZIAA 4GUOA 2VSDA 4NZUL 5LGHL 5B7MA 1D6EB 2DM7A 5GGVY 4APQA 4Y4KB 4ZDHA 4QTFA 2VIRA 3GZOA 3TIWA 2I07A 4RCAA 5J7CC 2A77H 1XZ0B 4FABH 3BWSA 4GT0A 3SCMD 4OSUH 3AUWB 4K3JL 1MWAA 3PREA 4MDJB 2UYLA 2H1PH 3V4VL 5I15H 4GQRA 4JDTL 1LILA 2ZSVB 2PP7A 4AEIH 1QUNB 4QWWD 4BE5A 2XA8H 3D2UA 4CU7A 4AQAB 5AZ2L 4P2OB 3U46B 1D5XA 5SX5H 3VG0H 3A5VA 2XIBA 4U4BA 2HUEA 4ZOAA 3U0PB 4FCHA 1RVFH 3HLKA 3LAFA 3P11L 4I85A 5HGGS 1JF5A 1BQLH 3EBGA 4JVUA 4N3UA 1NKRA 3FSOA 2W8CA 1RZFH 1Z0NA 3I9PA 4JBSA 2VJXA 4LT7A 1CPUA 2OR9L 3X2MA 3LIZL 1L5GA 2ENQA 5EU7E 2RD0A 1AVAA 1DBBL 3EYFA 3IE9A 2FL5A 3NCYP 3AG4B 3FUMA 2P80D 3KH4A 1IGFL 1NM9A 2B8OT 2JI3A 2X9YA 2XN2A 5DJDA 4JM0A 3V0VA 5DT1L 5MHSE 3HZKA 4AT6A 3APMA 3OV6A 3QIWD 2CKBL 3CUPA 5HHVH 1WIPA 2X4PA 1WT5C 4W93A 1J8KA 2CHZA 3NPZB 1YEIH 4TS6A 1FRGL 2G9HB 1OGYA 1GZHC 4ADJA 3QWQB 4BWTA 1LDPH 4U1JA 5BRZB 1CBJA 2G3ZA 2GSGB 4U3XA 4KTEH 3NCEB 1TYRA 3PWPA 4UQCA 1ZAGA 1WCMA 5GSRA 4LBEB 3ALWA 3TEZA 2BZ7A 1FCCA 2BSEA 2XACC 4DKDC 4EUPB 3L2MA 2NXYC 2L7QA 3IDGB 1AKJA 5HDLA 5K9QI 1VZGA 3O2DA 5AKTA 4F2MB 1DQVA 3VXOA 2FQDA 5FHAL 4AJYV 1U91B 1GC1L 1VAHA 2B0SH 3TT1L 4KUZL 3QAZC 3UTSB 5I76A 5JMRA 4MWFB 1ZHLA 1OM9A 3L16A 2ESVB 1XZ0A 3R19A 4M29A 1XCQB 2LV4A 2UZIL 3TX4A 3ES6B 1JYVA 4M7KL 1P84K 2WQAA 3GM8A 4UV4L 2Q2EB 3BD3A 1EIBA 4E9TA 1ZJAA 4KO6A 4OQTL 4RGOH 2E2HA 2Q87A 3MCLH 3MLXL 2DQDL 1EGJL 1IGCL 5FKAA 3MUUA 3MI6A 4KZEH 3BKJL 4LP4A 4BUHA 2NVYA 3D3VD 5AW1B 1UCBH 4J3TA 5F44A 1OAQL 3OKDA 3ETSA 4G1MB 3WO4C 3ENEA 3OGCA 1BZEA 3RAJL 2A68D 4GH7B 1C5BL 1IBGL 4X8GA 3JWNE 4Q2ZA 1G84A 1S9WA 2RJMA 2O72A 2EDOA 4JHBA 5I17A 1JS4A 1VKXB 1A4BA 3MU3A 4DP0X 2BRQA 3UCRA 1BWMA 2C3HA 3EHBD 5K69A 3L48A 2NCEA 1OV8A 2QSVA 3N42F 3KDMB 4MBOA 4ODTH 5DK0B 4B9PA 2W94A 4BSWA 5CEXA 1E2VA 1QRND 3NTCH 4PJXA 4N85A 4KK6D 3SDYH 3JV4B 1PY0A 2A6JB 1T21A 5DO2C 3QJUB 4WI0B 5KW9L 1MQKH 1VLXA 3KH3A 4GBXA 5EN2A 5IGXH 3O3DA 3H2PA 3FTVA 5EA0L 5IJVB 4K94C 2B77A 3JUYA 3BZDA 4D9LH 4H88L 3RTQB 1N6UA 1KXQE 3CLWA 3NPSC 3ARGA 1ZVHA 2J73A 3GS0A 3U0WL 1UXSA 3BQUB 4NPYA 4XBGA 3VXOB 3ZYJA 2WXRA 4E9SA 1X44A 1U8KA 3TYGL 1HOEA 4YEEA 2BCKB 4F9LA 3SQRA 1GOHA 4YEFA 3QFDB 1E5ZA 3HN8A 1CIDA 1QEXA 1X4ZA 2EYSA 3CK0H 3MOAL 4PP1C 4X6CB 5C0CA 2HRLA 3TU6A 3L4CA 2IFFH 4GRLB 1BG9A 1HQ4B 1HWWA 4PEEA 2M83A 3P9LA 1U21A 4KRNA 4X42A 3ZDYB 2FX9H 3EYOB 4JQVA 4GUQA 2QFPA 1XFPA 2VABA 4M5YL 4WENB 4U1JB 5HJDA 3IMUA 5BRZA 3MOBL 4F8TA 1QACA 5CS7A 4U1NB 1J1OL 5T1MB 3WFDL 2G5RA 3EBHA 1OO2A 1D9KD 3L5WB 4JAMA 4EBQL 5J8OA 4TVPL 2Y0SA 1FG2B 2OR9H 1UGNA 3QJHB 2PPAA 2KYIA 5HPMA 4TXVB 5BQ7A 3KPNA 1MW2A 5C0EA 1GAFL 1S9XB 1J05B 3OJMB 1J48A 4PG2C 1RVFL 3D6GA 1KJ2A 3WS6C 1BMZA 1MCOH 2BMKA 3EGDA 3K6DA 5ESVA 3LEXB 1KT2A 1MVFA 3MXWH 4H1LH 3BUQA 1HQ4A 1IRAY 2J1WA 4EOWL 3LTVA 1JE6A 2N0MA 3QW9A 2WD0A 2W92A 1BZ7A 4P4RB 3WFBL 4ODVH 1U3YA 3T1FA 3D07A 3O4OC 2IV9A 4ENED 2HKFL 2D9QB 4EVNB 2YRBA 4AJVA 2GJ6A 3CBRA 1HAUA 5DT1H 2LLGA 4C4UA 3R0NA 3GTGA 2MTAA 5DR5L 5DRXA 1SEBB 2QFRA 4ZI8A 2DIJA 1NPJA 2VLRB 1QFWI 4FI7A 4PVMA 3W3BA 2E59A 3PDGA 3TVMC 4R7VA 3RWDB 4XBGB 4XTRC 4DPBX 1FNSH 4CDGC 3CJJA 4IIQB 4OZIB 1JFHA 2IF7A 4XCYB 2BRRL 3RFRA 5ICZA 4U6YB 2WXMA 4P2YA 1C08A 4GJTB 1M7XA 1OLLA 3QEQB 1NIBA 1U8CB 2E8YA 2NUPB 1G7HA 2DD8L 4OB5L 3APCA 3BO8B 1HT6A 4LMQE 2XWCA 4PJ9C 3MXVH 1U92A 4LSRH 3NFNA 1KPVA 2I5YL 2K3TA 2VDMB 2VLJB 1EK3A 3I3BA 3RX8A 3STZA 1BDYA 2BY2A 5EEXA 1ONQA 1D5IL 3ZGHA 1FZOB 1NCUA 5DUPH 3TBWA 2L0DA 4XN8A 1K4CB 2B16A 3FL7A 2B08A 2IWEA 3GXDA 5DJ2B 1OXYA 3BP7A 4PB9L 4RMTA 3VXMA 1PKQA 4Z7NB 1V7NL 3OR6A 5E00B 5EU6B 4CMMA 4TUKL 2IPKB 4I18C 4G5ZH 5D2LA 3V0WL 3AMLA 7TAAA 1P7QA 3X1BA 1GW6A 3DPBB 3T6QC 1KXQA 2ADGA 3KCPA 1A3LL 2KQAA 3QE5A 3HRPA 4QI3A 4G43A 4I87A 2K0RA 5JOFB 4H8WL 1U91A 2DQJL 1MZYA 4UQ2B 4NFCA 5EIIG 5C0JA 4RBPK 5ITBL 2BWIA 2Q8AH 5C08E 4PJFF 3EYVB 4WU5B 4FQ1L 3BX7C 5F9OH 4NERA 3CVHB 1RD6A 2RCSL 4ISVA 4OM0L 5K39B 3TBSB 3ZT6A 4YWGL 4YXLL 1SXAA 1FNHA 4MDJA 1V3JA 2CIIA 2QTEA 3SDAD 4WNQA 3RI5K 3T09A 2HLEB 3P30L 2GSGA 2UUDK 5D6DC 4G9FE 3SYPA 4CRYG 4Y9BA 1R6VA 4JFDE 1AQKL 3HN5A 5IB5B 3EFOB 3LMJH 2ZNWA 5G5DB 5AOZA 5HYSA 4GO6B 3SE6A 2Y22A 5I8KH 3I2CH 4G43B 4Q0XL 3EF4A 4XMPL 3TZVA 2ZPKL 4JFXB 4XNQB 3ARGC 3FC8A 1E0OB 4O58L 5IMKB 3FTGB 4ODWA 4RZKA 4TTDD 3ZU8A 4WK2B 2H0FA 5KBPA 1DJYA 5D1ZB 2AJSH 2QGCA 2QPUA 4RAVA 5E4OA 1T7ZA 3FU0A 2ZYIA 1DJZA 1VFMA 4JVWA 4XB7A 4K94L 5DD0H 4BZYA 3FUIA 1U8QA 2ICEB 2DYSB 5L9DL 1NFIB 5C3TA 2R2EA 3LS4H 1K4DA 3LN9A 3SPHA 2E7BA 2IMMA 1KJMB 5KBDA 4X6BA 3IKKA 2X40A 1RMFL 4G71B 3TJEH 1UXWA 3FTXA 3BUIA 4RX4A 4QCIB 4E0RA 3WN5C 1Y18A 4YSEA 1IUZA 5GJTH 1Y0LB 2CBPA 2VERA 2W5PA 4HDIA 4N2FA 4RQQA 4A6YH 4JFHE 1AR1D 4KTYA 1AY1L 2ICEC 5SWSB 5TGBA 2Y6SD 3LVEA 1KTRL 3ML9A 4FMFA 4KWUA 1FNEB 5IWLA 2BW5A 2MPAH 1W72L 4KHTH 4U3HA 2ZX7A 3HFMH 2G0KA 1AD9A 4L18A 3MOQA 4XX1E 1OP3H 5EWIH 3QO0A 4W6WB 3RWCA 3ATEA 4OD2A 4BZ2A 4GQQA 1RI8A 5DS1A 5HDWA 4Z7UA 2NTSP 2X2HA 2AS5M 3U4EB 4OUUA 4WUKL 1J5CA 1ULVA 1B3JA 4MD0A 1NC2B 4PSRA 3DGGA 3V0FA 1MG3C 4NO5B 2HAZA 1W2KT 4UOW1 1AG0A 4JE0A 1G6RA 2CCWA 2GI7A 2NLJB 3QG6B 5F6HI 5TJWK 1KJ2H 2Z1KA 3WNKA 3EOAB 1BOGA 3OC8A 4BUQA 4EE2A 1H8NA 5HPMB 4K7FA 4Z8FH 1K8DB 4BCYA 1WZLA 4NAMA 4NNXA 4JP6A 3CFJA 1SOKA 5EU3A 3GXTA 1AIFA 2J8UA 2I5YH 4XO4A 4G82A 3V55A 1PKQE 2AJZB 2BMKB 5C9KA 1YEWA 1FVDA 4HPHA 3UTZA 1WIOA 2NXZB 2Z8RA 4KKQA 5EZLA 2A1WL 3N43B 3O6LH 1M1XB 5I82A 4FFZA 3N5AA 4UNIA 3F5WB 4GQZA 1NFIA 1HK6A 4F92B 2DD8H 5IFHL 1JG9A 1L7IH 5F88B 4XPHH 1PDKB 2VDQL 4HEPG 3KVDD 3RB7A 1U3ZA 4EN3C 1A6TA 1ZE3H 2VJ8A 2H8PB 2OTUB 4MQ7B 2P8PA 2NYYC 5F8RC 2XRAH 3O45B 3ELAT 1DN0B 4Y4HD 3EFOA 4DQAA 4FNQA 1VFAA 1L0XA 4Q9RH 3DURA 4Y9EA 4X80H 1Y1VA 5TGBB 5EG6C 1S5HB 1NGQL 3CPLA 3Q6FA 4EN3B 4P2AA 1EANA 2BSRA 1S7TB 4HWBH 1Z5LB 1ZV2A 4PV9A 1QO3A 2KQNA 3S2CA 5DQ9A 2VGLM 3N6YA 1U8KB 4ZMNA 3C60B 4WSGA 4PRNB 4JZJC 1OCRB 4XP9L 4D8PA 1M7DA 2OMUB 4L5FE 2KZWA 5EO0A 4MA1B 1PW3A 3T2PA 3KPRE 4JG9A 4I5BB 2Y7QA 3VUAA 1HKLL 4P9HL 5I1HL 5GRWA 4H7VA 1WK0A 3JTSB 4JO3H 1TT6A 4HSQA 3FKUS 1DBML 1KNOB 4U1LA 1H6FA 1CGXA 4K07A 3RGHA 2GTZB 4EBQH 1QFOA 3L1OL 1A0QL 4PLJD 3GIZL 4CKVX 3Q5YA 1NC4A 1UEYA 1YAZA 1PKQB 2VZVA 1QSFE 3KWXA 5D7EA 1PY9A 5IJKA 4FQXB 1ITCA 4XNMB 3ZVVA 4KGLA 1WEJH 5IB1B 5H35B 4QPEA 4FXKA 4PV8A 1MCKA 3FT2A 3SDDA 3IETA 5KVEL 3VXPA 1LNUA 1MCHA 4UTBH 3UBHA 1XIWC 2YXMA 3CVDA 3WS3B 2CSPA 3MNVA 4TQIA 5JNYB 1OOWA 4OD3H 5KAQF 3PFQA 3RWCB 3TO4A 1JDAA 1EH9A 2IPUK 3QFJA 4N6RB 1CLZL 4EIZC 2W59A 5C18A 1RZJC 3T9WA 3NCMA 4V1DE 2XPGB 1F6FB 1BVLA 3MZGB 3EYVA 4ZTEA 2FLRT 2R4SL 5ICZB 2H3NB 3TFKD 3H6AA 1RUKL 3EO0A 4XC1L 1I8KB 3QIUB 2X05A 2F9BT 4GI8A 4V11A 3LRSA 3C6LB 1XH3B 1J11A 3E9UA 4F2FA 3ECBA 5FGBC 5D7JB 5IMMA 4S1DC 4JFYB 4CN6A 3WIHL 3VB8A 2LU5A 3ULUC 1U3HB 1PG7X 3O41B 1CJYA 5DJAA 3K71B 1I85A 3FH7A 5F7MC 1MVYA 5E2WL 4HFWB 1EJ6A 2JIOA 1I1CA 2AQ1A 2KT6A 4N25A 5DJ8B 4U1HA 4J3BA 4DZBA 1CMOA 4DHLA 3QQDA 5AL0A 3ZDXB 5KSVB 3DRQB 1KNOA 3BQUC 3WEAA 4LHUA 3M6DA 3QH3B 3TEXA 1QLEL 2XQYA 2GTZA 2RQEA 2CR0A 1YJDC 3D30A 2GEEA 4HW6A 4P05A 4PI2A 3X14A 1BIIB 1HHIB 1HXYB 1OALA 2AGJH 5E99H 4OD1H 4RFNB 2OMTB 4M1CD 2O5ZL 5ENWB 1L4IA 3IE4A 4BZ1A 1TEGA 1G0XA 3MXWL 4AUUA 4MAYD 2Y3AA 5HHOB 4FLHA 4M48L 3TH3T 4KDTC 2PXYC 1QUNA 2VPXA 4M7KH 1MY7A 1R33A 4YSSA 5MENB 4NDMA 2D3JA 1QBBA 3LNHA 1HEZB 4UU9B 5DC9B 1GCFA 5C7ZA 5IF0A 1LMIA 2E0PA 5IMOA 2YPLB 1S3RA 5T1LD 2EXSA 3GNMH 2C9XA 4PRPA 5AB0A 5CJ5A 4LHUG 2IWKA 3ILEA 3F7LA 4J39A 2NY5H 2WXLA 3V6ZA 5LUMA 2YC1B 1MWOA 3LS5H 4HJIA 3T0EE 3VA2C 4QJ5B 3CVHA 4ISVB 1KELH 5GISH 1MFBL 5ADOH 2A9DA 2Q8BL 1CFNB 4LSQL 1EAOA 1VEMA 4GG8A 3S5YA 1W91A 1A7QH 4KKBC 4X7CC 3WGVB 5A1AA 4JKWA 4H4NA 2X0UA 2ZE0A 3KD4A 2DQUH 1N19A 3AQYA 1ORQA 3BZEB 5HHQB 2CGZA 5DGQA 3BAYA 1UH4A 1LEKB 4RWYH 3SGJC 3AU1B 3HS0B 4ZMWA 2WO4A 3KPOB 3LVTA 1WH0A 3GHBH 4OF8A 3SGKC 1ZMYA 4NKMB 5EU6E 1LLAA 2AJZA 4Z7NE 2R0ZH 1AS6A 3ALPA 4F20A 3LZNA 5DK3A 3VH8G 1FF5A 5BMFH 1DANU 5C1MB 2XPZA 4J1UB 2VKXA 1L9SA 1UWEH 1ZSDA 4R83A 4ATWA 1WD8A 1J9CT 3QJRB 2WPGA 3SPVA 2J8UB 5GLYA 3NUKA 2V2XB 4XZUA 2VC2B 2BDNH 2VLJE 4JFVA 3JV6A 3GSVA 4EZLA 3QB7C 1UD8A 2ZG1A 3D52A 4XBPB 5F0LB 3VG0L 4WY7L 4BZ1L 5D70L 1QWHA 1NFDB 1WFNA 1GJUA 3EOBA 5FYKH 1MI5A 4PJ5E 2ITCB 2FJFA 4IOFD 5IG7A 4TL5A 3EBAA 2IAND 3INOA 4NC1E 2B2XL 4NOBA 3BLPX 3QIWC 1NICA 2ZX6A 3WE1A 2O61B 4P4KD 4KTDH 4CC0A 3P9MB 1BXXA 5DZVA 3GS4A 2VLRE 5I24A 2F7QA 4BM7A 5IFJA 4WFGE 1ZHLB 3ZSTA 1QAWA 1UM5L 1VGKA 4PS7A 3NP4A 3OQ3B 3CZNA 3FS9A 5MEOB 3SUJA 1IBDA 3ZE0B 1BVNT 3PUCA 4Y4FA 1AHMA 2R4RL 4JRYD 4E9YA 1TYEB 3J27A 4KY2A 1I7ZA 1ZLUK 3AQZA 5A3IC 1XEUA 1JK9A 4JKPL 2D31B 1GA2A 3I74A 4HHAB 1MHPL 4I0CC 4PM1A 5IVXA 5BVJB 2IOMA 2Z6FA 3DWTA 2E7ZA 3WEMA 4WI2A 1SMOA 4XNMA 1IT9L 3NA4A 3LZQA 1AS7A 2ARJQ 4X6FA 4RMVA 4X7SL 3BUTA 3KWUA 4WGWB 4RFOH 2FLMA 3HI5H 3OXSB 1J8HB 4PRHA 3IFOB 4JQXA 1E8WA 4G42A 5CILH 5HP5A 4CN4A 5JNYA 4MMYB 2YPVH 1FN4A 3OF6A 5E2WH 1GYCA 2CBTA 2XVLA 1KIUA 4RRPM 3BW9B 4AEIL 1IO4C 3G04B 4FQXA 2AQ2A 2CNYA 3A6BH 1U8JB 4HOWA 5AOKA 3MV9E 4DEUA 1R7RA 1A65A 5EU4A 1VIWA 4I9XA 4TNVF 5FXCH 4JQIL 1I8AA 3BEVB 1YNJD 1DQJA 4G7SB 3SJVB 4JG1L 5DUBA 1HL9A 5I18L 4TTGA 3FJTA 1HZKA 1LO2L 3ZDYE 4HKXB 5CIPB 3QVAA 2NSXA 1UD5A 2WSDA 4OJCA 3VU2A 4F3FB 3QUMH 1P7KA 1TMQA 4X6CE 3IJHB 1T4WA 4ZFFB 3OC5A 4PH8A 4NQDE 1DBBH 2UVFA 1E67A 3NRFA 4FGMA 2DWXA 4GUPB 4X5LA 3VFNA 4N8CH 1R34A 2VLRD 3CPLB 2AXHA 4X7EC 2BOBA 3MUHL 4D7ZB 5K1NA 3POCA 2ZUQB 5E4EC 1AI1H 3OAZK 5ADPL 1A7PL 2EP6A 3K2MC 3I3EA 4JFFA 3SE8H 3W9DB 4F24A 4PS3A 5DO2D 2PWFA 1OA7A 5D7KD 1XGRB 3V0JA 5E7BA 3TGXA 4MBRA 1EFXA 1U2CA 1RJCA 5B39A 2VAAA 5GGVH 2QLVB 4LGSB 4XBEL 3AG2B 4K7PL 2ADJA 12E8L 1S9YB 5F1OB 3V5HA 4F3FA 1E4XH 3KHQA 1Y1WA 1NGWA 1RU9L 2IDCA 5KSUB 3KYOB 2JE8A 43C9A 4NHCL 4AQOA 3DK2A 2QADC 2R59A 4OFPA 4N5ED 2TAAA 1ROWA 4DVBB 2UXTA 4P48A 3NJXA 3QO1A 1BF5A 4NRXA 4X98B 3ARXA 3F6IA 1U8HA 3UYRL 1HESA 1G7QA 2C9AA 1UA6H 1F6AB 3EOTH 3WLBB 1CICD 4X9YA 2BP5M 1Z9PA 3I75B 2CHDA 4F93B 3BVVA 1FIGH 3NGBB 4RAHA 4UM8B 2DYPA 2XXFA 2HVJA 4RX4D 4U1IA 4Z5RA 5D7JA 5CHNA 1OOAA 4NAQA 1JZ8A 4Q6IA 4TQEL 1UWGL 3QSKB 1TMOA 1FFPB 4YFDB 2RQ8A 2VN5A 3HI1A 1QNZH 2LU7A 2Y2WA 4EI5D 2ZXCA 1CLOL 3TBVB 3LEVH 1ZS2A 3O0LA 1KYFA 4UNVA 1E4XI 2RCSH 3ZXAC 3X2PA 4Z76B 1SEBA 2XRAL 5KG9A 4FFYH 5CFAA 3UTSE 2AXFA 1XR8A 1JV5B 2C9QA 3O3AA 4HK0A 2XTSA 4ONOA 4RNRB 5D7LB 5TE7L 4R84A 4HUVA 2G2RB 3GTOA 1E30A 2WSKA 2N4IA 4MGXA 5DRXB 1TZOA 4RRPG 4ZMZA 4IOSA 4MCYA 1JXKA 4Q9BA 2DYPB 5T5MD 1P4UA 2QQKL 1IAKB 5IVXE 2YN5A 3BW9A 4YQXL 2DLTA 3V4VH 5B8CA 2A4EA 1UUNA 3B1UA 2DEXX 3MRFA 3LS4L 4H0GA 2MQ3A 3HEIB 2ZF8A 3N43F 5DJ6A 5LGHH 5BXFB 4HMCA 4PLOB 1PLAA 3M07A 4G7YL 3S3CB 2WKLA 1FVCB 3ZKNC 3C8KB 2NY6B 5KYYA 4WWPA 1YAIA 2FL5B 3AGVA 3RURA 3T3PF 5I5MA 1L9QA 5AZEH 5IROC 4ZUSA 1FAIL 2AABH 3E3QC 2XG5A 1MJ8L 5H37H 5B3NA 4LPYA 4JK0D 1AH1A 1KCVL 1ML0A 2QQLH 4OFYA 1WCBB 2ZUSA 2OL3L 1UB5B 2F53A 2F68X 4X4MA 3VU1A 3DUSA 4XODA 3IU4L 1EBAA 2B4CC 3FXIC 4PJ9D 2NVXA 3FQTA 5HGBA 3LNGA 4UAOC 1FGNH 3S97C 4JO5A 2NUTA 1T1WA 4GRLD 3BDBA 1HL5A 3EJZD 4Y4KC 1XGQA 4ZW7A 3REWB 5DJ6B 1COBA 4JHAL 2Y23A 1CGYA 1T6VN 4NM8H 3KPMB 1IBFA 4UU9A 5FTMA 1SMYD 2Y6TE 1Z9LA 3L9BA 2IO5A 3OHXB 1LL1A 1MCSA 1DVSA 1GOGA 3PHOA 2C5DC 1KEGL 3QFJE 3J07A 2XYBA 2QQNL 5SV4A 5JHBA 3BZEA 3DVGA 3NSYA 4PRPB 2VRAA 5HYJD 2Z0BA 3QFDA 4A04A 3VD1A 3IXTA 4GKNB 4WIQA 3WENA 5JO5A 1F0LA 2F5BL 5CBEA 4GW1A 4CGUB 4MMZA 1E42A 4H0LC 2XI9A 4GG6A 4CDHA 2PR4H 2AZAA 4XRCB 4XP4L 5ISZB 4UTAA 4J7RA 3ARED 2AEPL 4RWHA 2VMDA 5HI3C 1XDTT 3LX9A 3MRPB 4HLJA 3P3SA 4PGJA 4G8FA 1NAKL 5HGBB 1CK0L 1LO2H 2A6JA 4KXCA 3FUKA 3ZE1B 2PTTB 2LHAA 1W6WA 5CZXD 1FP5A 3A67H 4ZPTB 2DLIA 3MLPA 5FUOL 4U7SA