2HDHA

Biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVAKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKRAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical characterization and crystal structure determination of human heart short chain L-3-hydroxyacyl-CoA dehydrogenase provide insights into catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-3-HYDROXYACYL COA DEHYDROGENASE
total genus 115
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 1998-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2hdhA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hdhA01
1YOVB 3GUYA 4HFRA 1GU7A 4GSLA 2QHXA 2J5RA 1KVTA 1U3WA 4DLBA 1XCBA 4NZ9A 4M86A 3ZU5A 1ISFA 1YONA 1DHTA 2X4GA 4KUGA 2OP1A 4L4SA 1UXHA 3INTA 2EF1A 3LLVA 2O4UX 3VHRA 1IE3A 1PS9A 1UDBA 4BOYA 5IXSA 1EVIA 2A94A 2VT2A 4PGFA 4GVLA 3SC4A 3V2GA 4BNJA 4ZVVA 3FSRA 1DBVO 1H9AA 1F0YA 4FDAA 3A1NA 4ALJA 1OMOA 5HS6A 3WNQA 2HAEA 1FDVA 3ZU3A 2DUUA 3DBRA 3TL3A 3D4NA 4ALNA 4B3HA 4D44A 1Q7GA 1WDMA 1PL8A 3V5NA 5KVQA 1P1RA 3VH3A 2CF5A 4D41A 2ZJ1A 3Q9UA 4J7CA 4OL9A 4RCVA 4CMCA 1FJHA 3MJSA 4Q3BA 1U28A 4RDIA 1BRMA 2G17A 1YBVA 2PD4A 3O8QB 4BNVA 1NXQA 1DLIA 3L6EA 4I9NA 1QV6A 2Z1NA 4OQZA 2Y1EA 3RVDA 1QLJA 3VTZA 2PLAA 3UW3A 1UUFA 2EERA 4C7JA 3PXXA 4A73A 2NTVA 3UCEA 5DT9A 1ENPA 1XLTA 2GCGA 4Z9XA 5A3VA 2HMVA 3L9XA 1FMCA 2RHRA 5I8WA 3GN2A 1I01A 4PLHA 4BNXA 2XXJA 4NBWA 3ZU2A 3GNTA 4J91A 4OM8A 4IDGA 4RVGA 5B1YA 3WGIA 4DYVA 4CUKA 3I9LA 3UICA 1B7GO 1T1SA 4GKBA 4DQUA 4QECA 3ZWCA 1NPTO 1T4BA 1Z45A 3RUAA 1ADBA 1VRWA 2IODA 1A27A 1E1LA 3LT0A 1GDHA 4FGSA 4GMGA 2VOJA 2ZB7A 3C85A 4J49A 4IINA 5IAAA 3AU8A 4K6FA 2JAHA 1XYGA 1ZW1A 3BTVA 2HSDA 4DA9A 1EDZA 1PS8A 3L6OO 3OH8A 2DBRA 2GUGA 5HM8A 4II2A 4JJGA 4YWJA 4CM5A 2AXQA 5ER6A 3W8DA 2HCTA 3GAZA 1ZSVA 1LC0A 1XHLA 1H9BA 2GZ1A 5JNLA 4CMEA 4R3NA 4N5LA 1ENYA 3BZUA 4II3A 3DHYA 1YQXA 1DC6A 2R2GA 5BQFA 4Q39A 3DR3A 2VYND 1P77A 2JCVA 4IZIA 1ZNQO 3ASVA 3K6JA 2PH3A 1SZJG 3KSDO 3PDJA 1NPDA 3SEFA 4FFOA 4OKIA 3VPXA 2HDHA 3AFMA 1CIVA 1H94A 2FR0A 3PGXA 5F1KA 5CHEA 2OXIA 2YQ4A 3JQEA 3B20A 4FPXA 4U0KA 1DJNA 5EERA 1MV8A 5L7TA 1PJQA 3ONDA 1I8TA 3WLFA 4FFRA 4BNYA 3WGTA 4MVJE 1CQJA 4Y8VA 1MXFA 2BFOA 3K73O 1PWZA 5I8ZA 6ADHA 5L4NA 4ZHSA 3PWSA 2IRWA 1VJ1A 4AJKA 3OECA 1A9ZA 2VZ9A 1Z7BA 5T8KC 1PGOA 4I1IA 1NWCA 3F4LA 1DFIA 2CUKA 5T5QA 3OETA 5AXAA 3S1LA 2C29D 1DLJA 5G0UA 1Y8QB 3RASA 5GY7A 4Y98A 3GLQA 4E12A 3D7LA 1ZEMA 4D0RA 2BH9A 4GLLA 5EIOA 4CQLB 1ZK1A 3WLEA 4BKQA 4XKJA 4RORA 4Z0HO 1R4NA 2O7SA 1WDLA 3R3SA 4BO1A 2GDZA 2GLXA 1G0NA 3DDNA 4J1NA 1PGJA 3DOOA 4J4TA 4Z9FA 2X1HA 2AG5A 3OEYA 4JBIA 1QG6A 4KOAA 3VPGA 4JNKA 1N92A 4MKRA 4OXKA 2A35A 2NUAA 3F9IA 3GDFA 4LRTB 5H81A 4A0SA 1B8UA 1HXHA 2JD0A 4E2YA 3E9MA 3DOJA 2Y05A 4A7PA 3EDMA 2NVWA 3ZV6A 1N5DA 1TA4A 3S2IA 2C07A 5BNTA 3H9JA 3H9EO 3P19A 1G0OA 1ZO8A 3RUDA 3I6QA 2G1UA 1NHGA 3QSGA 1ISJA 3QRWA 3L6DA 4OQYA 3EGOA 3B1KA 4YJHA 4IS2A 5I7EA 1T2AA 2OZPA 3O9ZA 4XQGA 4D3SA 4QEDA 4N5NA 4R5MA 1PGPA 1LJ8A 5FFFA 2PWZA 1KEWA 1UXIA 3V8BA 4DLLA 2I3GA 4IM7A 1GL3A 1PL6A 5GZ3A 8LDHA 1TEHA 1U2GA 3JQAB 1EVZA 4BGUA 2A9FA 3D64A 1K6JA 1BXGB 3GVPA 4IIVA 2V7PA 4ZJUA 1R4MA 4NBUA 4PN3A 5ILOA 2Y67A 1JQBA 4AJIA 4HX5A 4BGVA 1LX6A 1WAMA 3TF5A 4AICA 3BMQA 4B3IA 4Z3KA 2DBQA 5DN9A 4KZPA 3MTJA 5G4KA 1D3AA 1QR6A 3OFSA 3OSUA 5JCJD 4XYEA 1E0DA 3IOYA 3W4IA 4BNGA 2Z5LA 4BNMA 1Q7CA 4DWVA 1DDOA 4J0EA 4IIUA 3TDKA 3PHIA 4P38A 4YEDA 3QE3A 4XYMA 4YACA 3NGLA 3AI2A 3RAJA 4E3ZA 3BTUA 3NDRA 5F3RA 4JROA 4RPHA 4Z9YA 4XYBA 1DIAA 3D5QA 3MCVA 1UJMA 2EGGA 3W4JA 4UVIA 3E9QA 4B4UA 2ZYGA 1FXSA 3H5RA 1ZBQA 4CMEC 4R1UA 5H82A 5TC4A 4B7UA 5FYDA 2ZYAA 3ZZNA 3I9JA 4Z0PA 4E31A 5FF9A 4NK5A 1LEHA 3IKVA 2B4QA 4UVEA 1R37A 4LMRA 4M8SA 4XD2A 3BMCA 4N7RA 1PR9A 4YBZA 1R0KA 3BTSA 5ENVA 5IFLA 3H8VA 4BO5A 2DM6A 2J3HA 5JY6A 3I3OA 4OIMA 4IMPA 4WKGA 1Z82A 4WCDA 4P22A 1JWAB 1TT7A 1ZK4A 4MVJA 3U09A 1E3SA 3BHMA 3GRPA 4I5EA 2D0IA 4JN6B 5CP8A 3KOUA 1KBZA 4WGGA 2NU7A 2QW8A 4L4XA 2VUSA 1HYEA 4OJNA 1DHRA 1UDAA 3OBBA 2BKAA 3FD8A 4PG8A 3CH6A 4QSMA 1C1DA 2BFPA 2HUNA 5G0VA 1ZH8A 4BL5A 3HFGA 2ZB4A 2CF6A 5JS6A 4KMSA 3L4BA 4UUOA 1P1JA 2IZ1A 3LSYA 1KERA 1RM3A 1YL7A 3P5SA 1GTMA 2QQ5A 4FS3A 3UOGA 2E49A 2PGDA 3EUWA 1EVJA 3LT4A 4BQPA 5JO0A 3IJPA 1WPQA 4O1MA 4Q3NA 4BQRA 4CM7A 1ADCA 1Z6ZA 1W8DA 3EK2A 3P7MA 2YV2A 1V0JA 4RF5A 5FWNA 1W0CA 1IPFA 2X23A 1YRLA 1CF2O 3IQDB 1AGNA 1C0LA 3HZZA 2FR1A 2WTBA 2JD2A 5IZ4A 4MKZA 2VQ3A 1K6IA 1GZ6A 4M55A 1EE9A 4MP3A 4CV2A 1P31A 4WEQA 1MG0A 4B3JA 4NU5A 2GRAA 4M1QA 1GFSA 4CLOB 3AUSA 4RQTA 2D8AA 4MVJF 1HWYA 2JAPA 3MTGA 3DEYX 3ZU4A 2YY7A 4LSMA 5F5NA 3KO8A 1G6KA 3HDJA 3TZHA 3U9LA 1EUDA 2VWPA 4NJOA 1HE2A 3KXDA 4JBGA 5IDYA 1T25A 2YDYA 1GZ4A 4N5MA 4OMUA 1HDYA 1YB1A 2PKQP 2GGSA 3SX2A 1YL6A 2EKQA 1F8FA 4I5GA 5T67A 2NNLD 3IP3A 2C7GA 3TZCA 2NU6A 3X2FA 4H16A 3GGPA 1GV1A 4NFHA 3DZKA 3W4KA 5L53A 1XKQA 3C7CB 2VTDA 4MVJI 5DBFA 3A9WA 4WNCA 5CG2A 4WLFA 1SB8A 1X7GA 1YS4A 2CNBA 2H63A 1NQAO 4B7CA 1EEHA 1KC3A 3ZWWA 3ITDA 2X6TA 3AFNA 3M2TA 2GN8A 2VHWA 3AOGA 4LVUA 2C54A 2FZEA 1QYDA 3G3EA 3DFZA 1SBYA 4QX6A 5ILGA 3JQ6A 1AXGA 3H3FA 4N18A 3IMFA 3KLMX 3GAFA 3WYBA 2ZK7A 1P1HA 4OXYA 4CM8A 1SPXA 4EJ0A 4PG7A 1QYCA 1X7HA 4GX1A 4DL9A 3OP4A 4EYEA 2BMAA 2HMWA 3RWBA 5B4TA 4YAEA 3QJ5A 4N54A 4D46A 3WQQA 4KWHA 4MIEA 4BVAA 1HDRA 3B1FA 4H15A 1E6UA 5AXCA 5IZCA 1GUFA 1PJSA 4MVJP 2Y0CA 3UHAA 1YE3A 4WLOA 4PLPA 1PJCA 5TQVA 5AYVA 4FOOA 3DONA 1KVSA 2VUTA 4DIBA 1N7GA 4E0BA 3E6AA 1IYZA 1Z7EA 2GO1A 3HDYA 1PZFA 2QX7A 1N9GA 4W6ZA 3V2UA 4LCEA 4NDNE 1DAPA 5JAQA 3OQBA 3Q1LA 3F1KA 1P9LA 2BGKA 1GEGA 5KJCA 2RAFA 3JV7A 3E5RA 1E6EA 1PEDA 4LVCA 4FJ0A 2X9GA 1E7YA 3RBXA 3CZMA 5TJ9A 4F6CA 2BD0A 3NRCA 3AM4A 3PEFA 3PHHA 4HFNA 4ZGWA 4FSHA 1B2LA 1I30A 2R6JA 4PLTA 1PZHA 1W4ZA 3DZHA 1O5IA 2PH5A 1A5ZA 1NNUA 4QTZA 3SXPA 4AJHA 3NDJA 4ALKA 3NT5A 2ZB3A 1I2CA 3BAZA 3FRJA 2BFAA 3AUUA 2Q2WA 4PRLA 4AJ1A 2VHYA 1A72A 4Z0TA 3VZQA 3I6IA 3ETEA 1C3VA 2I76A 1X13A 4J7XA 4XCVA 1X0XA 3UFXA 1W6UA 5IDQA 2NV6A 3TSCA 3HB5X 2CY0A 3JQ9C 5A04A 1VPDA 2Q3EA 3L4BC 4D79A 4DGSA 2LDXA 1SO8A 3IP1A 4XJSA 4FR5A 4I5DA 5JMWA 1LRLA 1XELA 3KBOA 1IZ9A 2B36A 4PLWA 4PZCA 1HYHA 1TT5A 3S2GA 3WXBA 4A27A 4B8WA 4D7AA 4TSKA 4UREA 3HDQA 3NTQA 4NBTA 1H2BA 3PK0A 4MINA 4HP8A 4AJJA 1PL7A 4A03A 2FWMX 3OQ6A 3M1AA 2X0RA 2Y0EA 3WMWA 2WD8A 1J49A 1PJBA 4J9VA 8ADHA 1ULUA 1LNQA 4ZRMA 4FQ8A 3G17A 3PYLA 2Y1FA 4XJTA 2NTNA 2BLLA 2VHXA 3ICCA 2Q4BA 4YVFA 4Y6PA 1E7WA 1B8VA 5IDXA 2PY6A 2C82A 1B15A 1P33A 3UGKA 5IXYA 3ST7A 1IHYA 4FB5A 4W9NA 9LDBA 3VZSA 3AM3A 4NHEA 3PQFA 1XSEA 4YAJA 1GCOA 2UAGA 1ZK0A 2POQX 1HDCA 4BMNA 4BMVA 1UH5A 1MX3A 2G82A 1B8PA 1FDTA 4YDRA 5DP2A 5LDGA 5JFOA 1LBEA 1NFQA 1DIHA 1Q1NA 2YQ5A 3ANMA 1GYPA 2NLOA 3AK4A 3F5QA 1K0UA 1LDBA 3VTFA 3OMLA 4CLHA 3UAGA 1ZXBA 3PRJA 3EZYA 2O2SA 4J1TA 1YL5A 1X7DA 3RUFA 5JPIA 2GASA 1A4IA 4W82A 2PR2A 5TLSA 3JQFC 1ONPA 1KVRA 2V6GA 4Q9NA 5AXDA 1LDEA 3VC7A 3QV1A 4LISA 4F46A 5JDIC 4BO7A 3BIOA 4NR0A 3VPSA 1UXGA 1GPDG 4IPTA 5T6BA 3U4CA 2VHZA 2W4QA 4UAGA 4BNUA 3CKYA 4RO0A 5DCUA 2F1KA 1C14A 4ITUA 2O3QA 4RZHA 3PFFA 1HDZA 1ZXLA 1YBMA 2EJWA 4RQUA 5I9MA 5JDCC 2VHVA 3KZVA 4CL3A 5DNAA 1LU9A 1SEVA 3C7DB 2WWRA 3WGGA 1PZEA 1HDOA 2QYTA 4FFPA 3WGHA 4IQ0A 3U62A 1WDKA 9LDTA 3MJVA 1LRKA 4F6LA 2YHIB 3NV9A 2OHXA 3ADOA 3OA0A 1QLHA 1YOVA 2HLPA 5K9ZA 1OBFO 1EUCA 3RC2A 4YJFB 1HEUA 4Q3DA 1Y5RA 4ZU3A 1R15A 4FGWA 3UXYA 1XEAA 4CM1A 2ILTA 3CPSA 2FR8A 1X0VA 3RSHA 2I9PA 2I6TA 2J3KA 4CL8A 2E4AA 1I3KA 3GFGA 1H6CA 3L07A 3ZGYA 4RPKA 3RUEA 4CLRA 3C1AA 4OYRA 3U4HA 1LDMA 1AUPA 1A71A 2FPIA 3RI3A 4BNHA 3FR8A 1BXKA 3LK7A 3F4BA 3T7CA 1Z74A 4GBJA 1JKFA 5A9TA 3U49A 1Y5MA 4IXWA 3TQHA 1PQUA 5JSFA 4R16A 4U6SA 4TRJA 5EN4A 2B35A 1XDWA 2EJVA 1YH3A 4ROSA 1GAEO 1K6XA 3AY7A 5COBA 1RYEA 5HRUA 2IZZA 5JXWA 4CR8A 3G0OA 2HU2A 2NVUA 1EDOA 1GPJA 5EQDA 1M76A 2B37A 3H9UA 4J4HA 4YB8A 3A06A 3DMTA 1LA2A 3DXFA 4PLYA 4PZEA 4NPCA 4UULA 4DRYA 1XG5A 1QMGA 1E7RA 1WP4A 1S6YA 1R4MB 2P9CA 2VZ0A 4MP6A 4UUPA 4CM3A 1NTOA 3Q2IA 4XZ3A 4NBVA 2C7VA 4P4NA 1BVRA 2FSVA 3MWEB 1M75A 3OICA 4Y9DA 4F45A 4QUKA 1ULSA 3H65A 3LU1A 3HWRA 4OSOA 1J4AA 2D59A 4OXNA 3EHEA 3KUXA 1MB4A 2JD1A 2JFGA 3H6KA 4BMSA 2HQ1A 4DPMA 3I83A 1KEUA 1ENZA 3EY4A 3F47A 4XGNA 3OJEA 4U8GA 4XIYA 2CVZA 3H3JA 4URFA 1QYWA 1WVGA 2ZKLA 4W9NC 1ZMTA 3CXRA 5KIAA 2YUTA 2FZWA 4TVBA 4JP2A 4IQGA 3GEMA 1SAYA 2V6FA 1S7CA 4RPLA 4YPOA 4S3MA 3FBGA 3ROPA 5GMOA 4FJ1A 3RUIA 5I7FA 5HS4A 2P5YA 5FI5A 1QV7A 4D45A 1M6WA 3GR6A 4WE3A 3ZWXA 2D1YA 2BRUA 3DAGA 1Y6JA 3CMCO 4XDYA 1QSGA 2ZQYA 3ZWMA 4D42A 3I9NA 3K8ZA 4XA8A 5A9RA 1KC1A 5JMPA 2R00A 1DOHA 4GI2A 4XIJA 3VVBA 3TWOA 1Y9AA 1V6AA 4AG3A 2C20A 3JQ9A 1MC4A 1TLTA 2FRDA 2CVQA 4GSKA 3DWFA 3B70A 3VPFA 3W1VA 1DRWA 1FK8A 2PKRA 3BMOA 1NX6A 3GUCA 3PJFA 2UUPA 5THQA 3OM9A 4IDAA 3IJRA 3R1IA 2IE0A 2A4KA 3E03A 5AOVA 1LSUA 1AXEA 5LCXA 4XRGA 3HB4X 3QVOA 1C1XA 1YQDA 2QIOA 4CM6A 1JKJA 4JJIA 3D4OA 1SB9A 4PLVA 3E82A 3BA1A 3LC1O 4WECA 4WOJA 3RKUA 4DXHA 3OHSX 3QA9A 2DU8A 2PNFA 2ZIZA 1VL6A 2AEFA 5DP1A 3DAFA 3R6DA 2ZTVA 4YJFA 5EQFA 1KY5A 3DQPA 4CM9D 1DXYA 2QZ9A 4R41A 1Z73A 2FY8A 3LF1A 4O0LA 3V1YA 1N9GB 1OZAA 3RIHA 1E3JA 4BNFA 2AQKA 4R9SA 3ETDA 1TT5B 2G76A 3ROKA 4YRBA 3HN7A 2DC1A 1I5RA 2UV8A 1E5LA 3RBVA 1I2ZA 3ZNQA 1GYQA 4LRSB 3INGA 3ITKA 2H9IA 2WYVA 3A14A 5TF4A 2EGHA 4QT0A 5G0WA 1PTJA 1VI2A 3VH2A 3TFQA 1KETA 1ORRA 1QYVA 1LLQA 1VSUA 1JVBA 3VZRA 2NVUB 4ND5A 5L9AA 3QW2A 3IDSA 4BNKA 4J16A 4KUEA 1BXZA 2Q2VA 2JFHA 1NQTA 2DQ4A 4RVDA 4L75A 4HV4A 5KKCA 1ZFNA 1U3UA 4CMJA 1KVUA 4DC1A 2C2XA 2VNAA 4PG5A 3WGYA 4K1LA 4HFJA 3MOIA 3C1TA 1LXCA 3BMNA 2GPTA 2EHDA 2Q45A 1ZUD1 4WNIA 4RF3A 1VL8A 3PTZA 4GWGA 2GN6A 4MIYA 3ZHYA 4OGWA 4ALMA 2SCUA 4DYDA 2B0JA 4FC6A 3DFUA 3OJLA 2RH4A 2HK8A 4KQXA 1O9BA 4ZA2A 3RUHA 4E5PA 2O3RA 3WTCA 3MWDB 3PHLA 3RJ5A 2NVBA 3N74A 1BGVA 1YWGO 3KB6A 4WCFB 4GQAA 4IDDA 4J9UE 4NQZA 1OC2A 1YXMA 2PFGA 3PZRA 2YFQA 1ZK3A 3P2YA 1Y9EA 4NK4A 2PK3A 3WG9A 3I4CA 3JQ8A 4UUNA 5BR7A 3PQDA 1IZ0A 2D5AA 4AJNA 3VVCA 3WX0A 1SCUA 2VCYA 1NQOA 4GL4A 3COSA 4FCCA 3W8EA 3JYLA 5ITWA 1U5CA 3FNEA 2IZ0A 4EW6A 2CFCA 5EMHA 2X7HA 1G1AA 3NJ4A 5F1OA 5CDUA 3WTBA 1FDUA 1K3TA 4WLVA 2YDXA 5HBRA 1ZJZA 1NWHA 2IXBA 4QFDA 2RCYA 3GGOA 4BS9A 1CWUA 2D2IA 4CM4B 1E6WA 3SLKA 1I3MA 5L95A 1DFGA 4PVDA 3X2EA 1KVQA 3GA0A 2FHSA 4RPGA 4FD3A 4E4YA 2Y0DA 4YT5A 4BIIA 2CVOA 1F8GA 4E5YA 2FOIA 1XA0A 2OGUA 4EDFA 5COAA 3MOGA 1MP0A 3FN4A 3PLRA 1A9YA 2GNAA 2D5CA 1C1DB 5A02A 5KWEA 5A9SA 3FPLA 2I65A 2A92A 2Y1GA 4EEZA 2VT3A 4F3YA 3W6ZA 1HF3A 5J23A 4EGFA 1GQYA 2X0NA 1WZEA 4TVOA 4NG5A 3HFSA 3ONFA 5C3MA 4E2XA 3IAHA 2OL4A 1U8XX 3CTMA 1BVUA 4BO9A 3WGZA 2YZ7A 1NP3A 2OMEA 2O2YA 4YA6A 1J6UA 4L76A 4HNHA 4XYLA 4DPLA 2NU9A 4NFYA 4PCVA 3E8XA 2AHRA 4RGBA 1L7DA 4WLEA 2UDPA 2BHLA 5IF3A 2QRJA 2I5PO 2YJZA 1U5AA 3MJ4A 3KYBA 3ZHXA 3DMTC 3LVFO 2BI8A 2OO5A 4CQMB 4CMBA 5C7LO 1ZKMA 3PIDA 3OJ0A 1EBFA 1M66A 1RM0A 5AQ1A 3PJEA 1VL0A 3GY0A 4PG4A 3K96A 1HRDA 3ZW8A 1NYTA 2X8LA 3EZLA 3PP8A 4J7UA 1I33A 4WUVA 4OOFA 3L0DA 3QVSA 4YYZA 4ZQEA 2JKVA 4IQ8A 4D3DA 1HE5A 1KEPA 3JQGB 3Q6IA 1BXGA 3UKOA 1YGYA 1UZNA 5HWSA 1XU7A 3GZNB 5BSEA 1ENOA 1D1SA 3HG7A 1ZZEA 4XR4A 5JBIA 4IUYA 4CM9A 4CLXA 4YAIA 5KTKA 2NACA 2H1SA 1I3LA 4S1VA 3C1OA 2WYWA 3TZ6A 4KDEA 1DPGA 1D4FA 1WNTA 1JAYA 3V1UA 1ISIA 3NKLA 1PR3A 4ND4A 1NASA 4ALLA 1JTVA 5TT0A 1E1KA 3SLGA 5MDHA 1V9LA 4BV8A 1EMDA 4YJHB 4Y6SA 3JQ7B 5KJFA 1YQGA 4RDHA 5G2OA 3ZWVA 1K89A 4DPKA 4JCOA 4PZDA 3DBHB 1NVMB 3H5AA 4YCAA 2P4HX 3JQFA 3WBBA 3QVXA 2W90A 1H93A 1NR1A 2C2YA 3TRIA 1HT0A 3QWFA 4P4LA 2NTJA 4UVGA 1KS9A 3AY6A 4YRAA 4GKVA 4ZQBA 3MJTA 1LLUA 4WPGA 5JLAA 4QXMA 3OF2A 4B4VA 1U8FO 3TOZA 5L40A 4CLDA 2DFDA 4BNLA 4B7XA 4GX2A 5AXBA 4IXTA 4YAKA 4TZTA 4XR9A 5TJHA 4BNNA 3MZ0A 2Y1DA 4CQMA 1O6ZA 3G1UA 1PQWA 5I7SA 2X5KO 1LLCA 1IOLA 3E9NA 4B4WA 3VAZA 2HO5A 1WMAA 1GYRA 5G0SA 3GVXA 2J3JA 4WEOA 3KSZO 3NJ8A 1Q7BA 2ZTUA 5KNLA 2YHIA 4ZRNA 5KVVA 1KIFA 4W4TA 2JL1A 3GGGA 1ISHA 1SMKA 4XX0A 2YW9A 2AE1A 2JHGA 5A9SB 5TS3A 5T8KA 3GPDG 4NMHA 4AVYA 4DIFA 1O0SA 2J5KA 3CTVA 1IY8A 1PIWA 2DT5A 3D4PA 3M2PA 2D3TA 1JU9A 4CLEA 2PD3A 3DZJA 3B1JA 3PQEA 4CR7A 1ZCJA 6LDHA 4JBHA 4GWKA 4R1SA 1WLYA 2W98A 4FOSA 4GPD1 3GT0A 4BKUA 3JSAA 3AU9A 4IJUA 3H5NA 3K5PA 3UUWA 1SEPA 4B8ZA 2Q50A 3QWHA 4R69A 3ON5A 4BUCA 1A4UA 2O3UA 4Z6KA 5BNIA 1F17A 1AHIA 1DAOA 3M1LA 4YQYA 2AE2A 1OC4A 5HA5A 2ZTMA 3RROA 5CDYA 3FHLA 2HRZA 3GEGA 3T4EA 4GGPA 1PQPA 2CDCA 5L4SA 5I9NA 5TT1A 1BDMA 3OEWA 3ZI0A 1BW9B 3JD0A 2XPCA 3KYCA 3O8QA 2ZYDA 2Y93A 4LSWA 1HZZA 1NAIA 3I5MA 5A5FA 1M2WA 3WYEA 1U7HA 4DIOA 1H0KA 2DKNA 3N7UA 5A1TA 2D4AA 1RJWA 2WMDA 4BB6A 1YDEA 1E77A 4IJKA 5IN4A 3NT4A 2EIHA 5T64A 4GVXA 3TL2A 4Q3AA 2Q1WA 5TIIA 3U3XA 1U1IA 1V3UA 4AJ4A 2DAPA 1J5PA 3JQAD 2QRLA 3H2SA 2AW5A 3OIGA 3FWZA 4XB2A 1NQ5A 1D1TA 4GAEA 4Q3EA 3UCFA 4ND2A 1ONNA 4X54A 2X86A 3HE3A 4R68A 4WOKA 4OKNA 3GDGA 4AJOA 3KVOA 5IN5A 4INAA 2O4CA 1B16A 1P44A 3WFJA 4KTVE 2HMUA 3GZNA 3GK3A 2P68A 1U7TA 5EJ2A 3QQPA 2FMUA 1GD1O 2VTEA 2P5UA 3OQ1A 1NM5A 3AI1A 4FJ2A 4ZICA 1WW8A 5JAZA 4XQ9A 4KP7A 3GN1A 5TX7A 1JVSA 3ZWNA 1NFFA 3QHAA 1E1NA 4BGEA 2FPGA 1V3VA 3LC7O 3ENKA 2YV1A 2NQ8A 2FPPA 2J3IA 3GOHA 4CM4A 4JIGA 5DZSA 2PV7A 1YB5A 4E33A 2ZTLA 2X9NA 3WGQA 3CZRA 4Q3CA 4CMIB 3FI9A 4CM8B 2AQ8A 3PJGA 2Y66A 5KCZA 4M87A 4EI2A 2EG9A 2H6EA 4TKLA 2VUUA 5ICMA 3WWYA 3D3WA 4IZHA 3KEQA 1CQIA 3ULKA 3ICPA 1PJ2A 2IDZA 3IC5A 3GDOA 4WJZA 4WK6A 5L7WA 2Y68A 1DO8A 1FF9A 4BKOA 4LMPA 3NGXA 1F06A 2H5LA 2AQIA 3U4IA 1OI7A 4BNZA 2DLDA 3IUSA 5A06A 4R1NA 2B4RO 1D7OA 3L77A 4TRMA 5JCXA 2Z95A 1R0SA 3C24A 2EEZA 4UVDA 3TPCA 2AG8A 1LSOA 1T2EA 5CDTA 1LDNA 1MFPA 3FWNA 4ID9A 3BHIA 1ZK2A 4NI5A 2AEMA 4AFNA 1P74A 4KTTE 3I23A 4E2ZA 2QG4A 4YR9A 5F21A 2HRBA 3DOCA 1KEVA 4IGFA 4G2NA 1MA0A 3JYQA 3QLJA 1HZJA 3K92A 5K0ZA 4GGOA 2J8ZA 1EK6A 4I9HA 5G0TA 5A4DA 5LDHA 1B3RA 1WMBA 2X5OA 4U5QA 3SBOA 2Q1UA 3CINA 4BKPA 3BMNB 5IG2A 3JQGA 3AM5A 3DAPA 4M89A 4R5HA 2W2KB 3WICA 4NNJA 1EQUA 2B5VA 2YHUA 3F5SA 4L0QA 1F12A 4ND1A 2E6UX 3RUCA 3KSUA 4BGIA 3CIFA 1YB4A 1JWBB 3IIEA 5K6AA 4E13A 1PJTA 1XWFA 1H6DA 3GVIA 3GEDA 4IS3A 1LTHR 3F3SA 4CQLA 1ZJYA 1IUKA 3JYNA 3S8MA 1E3WA 2FP4A 3QY9A 5TSDA 3PIIA 5JE8A 5U1PA 5FI3A 1R12A 4TROA 1Q0HA 2VWHA 5I7VA 3ANNA 1V8BA 2W2KA 5G4LA 1PJ4A 3VDQA 4K28A 1JDJA 3HUDA 1TB4A 3DBRB 4R9RA 2O7QA 3FTNA 2QRKA 1YO6A 3K2BA 3TZQA 5CEFA 2PZJA 1DRVA 3P2OA 3GRKA 1GUZA 1NVTA 1ZIDA 3IS3A 1PJLA 3FNGA 2GERA 1PU2A 3S2FA 1L1FA 1I0ZA 5JW6A 1EE2A 1ZSNA 1DSSG 2BF7A 1P1KA 1U3TA 4EJMA 4NIMA 4O5OA 1E7MA 1GQQA 1B3BA 1UAYA 2GN9A 3NDIA 5THKA 3QWIA 4L4RA 3KETA 1SNYA 3GZ4A 3QP9A 3RJ9A 5ER9A 4OHUA 1T24A 3WJ7A 4TRRA 4GMFA 2R00C 2EW2A 3DB2A 1PS0A 2JJYA 4EEXA 1JA9A 5C7OO 3H7AA 2P4QA 1PX0A 1DEHA 1BW9A 1E5QA 1OFGA 3HNPA 3OA2A 4XGKA 1YBAA 4CMIA 4J6FA 1X1TA 2RBEA 1OAAA 1DIBA 3EAGA 1E3IA 1HYGA 1BDBA 2YV3A 3WWZA 3DC2A 5JO9A 3ZV5A 5JYDA 2DBVO 1BWSA 3D3WB 3ZWYA 2O3JA 4RZIA 1MLDA 2OFPA 5L45A 3RCBA 2I67A 1HETA 1GY8A 2CDAA 1NHWA 3QIVA 4XB1A 2VOEA 3AW9A 3H9GA 2HMTA 4NFSA 1VLLA 4IY1A 5G4KB 5MGBA 1DFHA 4HY3A 4UUMA 4W7IA 1L7EA 4CQMD 3HQ4O 1EQ2A 4ND3A 1ARZA 5KKAA 4Z3DA 2EP7A 4EZBA 3CMMA 1T4DA 3ANLA 4IGEA 4TZKA 4WCFA 1PWXA 1R16A 2VRCA 3RC9A 3WQSB 3KLPX 3ZWAA 2VN8A 3OJFA 1BHSA 3BMCB 1P3DA 2I99A 1CYDA 2ZQZA 3NTOA 5DBIA 4YT8A 2Q49A 3LDHA 4DTIA 4CODB 1UDCA 1JLLA 4A26A 3DZBA 2CSUA 1MC5A 4XGIA 1EVYA 1CERA 3M6IA 2ET6A 3KHUA 3R3JA 3RD5A 4IDEA 3VZPA 1XR3A 2HK7A 4FFNA 5TNXA 4FN4A 5B12A 1P0FA 4LW8A 2BGLA 1SOWA 4GX0A 4IDFA 4TQGA 5GZ6A 3ZDFA 2V6MA 1W73A 1YVEI 1H2HA 2E48A 3EYWA 4YJGB 4I9UA 4JGBA 2W2LD 3NEPX 5CFZA 1T2FA 3V1TC 4CMHA 5CPFA 4W7HA 4PRKA 1ONOA 3AOEC 4EBFA 1CJCA 5I9LA 3WS7A 2OBNA 3WBFA 1EZ4A 4H7PA 3PLNA 4HBGA 3MJEA 3QVTA 3KYDA 4JXKA 2X58A 1HLPA 5BSHA 3TFOA 3AOEA 1GV0A 4OOEA 3I1JA 3DTYA 3Q11A 1U9JA 2WD7B 4HFMA 3AUAA 3VH1A 1J0XO 1LSJA 4XWYA 2DTDA 4GLOA 4DMLA 1XIVA 5EL0A 4B79A 1PGQA 2QZZA 3DBVO 3NTRA 1N1EA 3ZWBA 2VNSA 2HK9A 3LC2O 1ADFA 4PG6A 4RF4A 4NH4A 3ENNA 4MOWA 3PZBA 5IDWA 2OOSA 3JQBA 5L4LA 3VKVA 2O50A 4LN1A 1Q0LA 3NUGA 1U3VA 4MJLA 4KQWA 5BNFA 1Z75A 2HJRA 2RH8A 1N8KA 2Y99A 3SJ7A 1X15A 4BO0A 1UZLA 3NYWA 3ONEA 1WZIA 4K9DA 4AJPA 1EBUA 4RVUA 4RVHA 2C5AA 4RL6A 2G5CA 1LDGA 5JYEA 3WSVA 1X1EA 4WLUA 2WYUA 2X0IA 1UR5A 2CMDA 1F14A 1HE4A 1VSVA 3JD1A 3ZCXA 1I10A 1O95A 2O48X 3Q9NA 3DHNA 3INRA 4I5FA 5CPBA 4XQEA 4JK3A 3SC6A 2C0CA 1HLDA 2GZ2A 4RLHA 4D0SA 3U0BA 3ZWPA 1N2SA 4O6VA 2NWQA 2VZ8A 1KOLA 3UF0A 3GFBA 4MKXA 1OOEA 4A10A 4JJFA 2JCYA 3UCXA 3ROQA 3SJUA 3ZNNA 5ADHA 5L51A 3S55A 4L8VA 4CV0A 4CPDA 1VKNA 3TZKA 4G81A 4WLNA 4Y67A 4CJXA 4FBGA 5C5IA 1HTBA 4RJTA 4RV9A 2B5WA 1RM5A 5ITVA 2IYOA 3QWAA 1M67A 2FSSA 5COQA 3WDSA 3OIFA 4DVJA 5KVSA 4J1QA 3QVWA 4XRRA 1NVGA 4FFLA 3F1LA 2TMGA 1QP8A 4A2CA 2PZLA 1UP7A 1I32A 2G0TA 1B14A 5A5EA 3DMYA 2DVMA 5KJ1A 4YAGA 3G1TA 1VC2A 4CLRB 4MP8A 3GF4A 3LZ6A 1NBOA 5H83A 2DUWA 2C59A 2CDBA 2GSDA 1WXDA 3VKUA 3HJAA 5JCJA 3HDHA 4DQXA 5DCYA 3JYOA 2B83A 1R0LA 1ADGA 1H6AA 2I66A 3C8MA 4ILKA 3DBLB 1VE9A 4TKMA 5DBGA 3EMKA 5U4QA 4P4GA 3O03A 2EP5A 1B26A 1YJ8A 1H6BA 3GHYA 2EKLA 4RVFA 2GD1O 3WJAA 1DRUA 4R4JA 4FIZA 5JC1A 3I9MA 2IEDA 3DTTA 4AL4A 3EW7A 4DMMA 4J0FA 1JW9B 4ALIA 3I9OA 1UP6A 1QYXA 3F6YA 5AVOA 5DOZA 4HKTA 2Q4EA 3WQRA 5CDGA 4PLGA 3C7AA 4IDBA 4DC0A 3PJDA 2YYYA 1TVEA 3RFXA 3GHHA 1A7KA 1NFRA 4YT2A 3LF2A 4D43A 2XF8A 2VYVD 3Q2KA 2AQHA 2WEKA 3ETGA 3FBTA 3K9QO 4YJDA 3H9QA 4FFMA 1AE1A 4M49A 5L3ZA 5TGDA 2VYVA 3FNHA 4PLZA 3B6ZA 4BNTA 2YFHA 1KY4A 2VWQA 3GG9A 4K26A 4CUJA 1MG5A 1C0PA 1IL0A 2OUIA 4XEHA 1K5HA 2OBYA 3E18A 1DC4A 3TOXA 1Y1PA 4R3WA 3UH1A 3L9WA 1HKUA 4NBRA 2XOXA 3DZGA 5JAMA 3WGOA 4BO4A 3FF4A 3ZW9A 4EITA 2UUOA 3U5TA 1QORA 1MUUA 2PTGA 2V6BA 3Q0EA 2IYPA 1GCUA 2QYSA 3MJCA 2JHFA 5KVCA 4DLAA 1X14A 3JQBC 2ZATA 2PGLA 5B37A 4C7KA 2AEJA 5HTOA 3RC7A 4JLWA 2Z1MA 1JKIA 1XGKA 4BB5A 4E32A 3ROMA 2WJPA 1HDXA 1UXJA 4MDHA 1VM6A 3E48A 3WYCA 3NX4A 4IJVA 3V2HA 1E1MA 5DULA 5ES3A 2O3TA 1E3LA 2J5QA 5A05A 3GMDA 4L9RA 1Y7TA 3PYXA 3PVZA 2EKPA 3TJRA 1DIRA 3IUPA 2VWGA 5F5LA 1UZMA 5DDIP 3CUKA 2LDBA 2DBZA 1P0CA 3C3XA 4D3FA 1RKXA 2VRCD 2Y1CA 3FCOA 3ZV3A 3FTPA 1Q2XA 4WCFC 1RPNA 1PZGA 2JFFA 2CD9A 3GH3A 4MIOA 1FDWA 3DO5A 4K6CA 3PFWO 2BGMA 3DZIA 3AI3A 3K30A 4EUHA 5T57A 1ML3A 3QWBA 4W99A 2Q1TA 3KRTA 4CUZA 2GN4A 1UAGA 2DPHA 2EV9A 3DBHA 5GZ1A 3RC1A 4OAQA 1XU9A 2TMDA 2IEBA 4MVJM 4AJ2A 1TXGA 4J2HA 7MDHA 4CMAA 3VPHA 1NR7A 1T2DA 4JQCA 1RYDA 4U0JA 3LQFA 4R1TA 4MVJG 3BYZA 1LC3A 1EFLA 1LLDA 4RPJA 1O89A 2X22A 2DTEA 5CEJA 3RFTA 4E6PA 2Q46A 5EESA 1CEQA 1E3EA 3DL2A 1ISGA 5ICSA 3GVHA 3G49A 3HHPA 4Y6RA 1PJ3A 3PPIA 2Q2QA 3E5MA 5EPOA 4CMKA 3SVTA 1LQUA 4C4OA 1DC5A 3DZFA 3CE6A 3AJRA 4AJLA 4BHTA 4E2WA 2CZCA 3D0OA 3OJOA 3AY3A 3ABIA 1T1RA 1MXHA 3KYCB 4LGVA 1EUZA 4BNWA 1VJ0A 5CG1A 3F46A 4J2OA 4CLOA 1C0KA 2B4TO 1V35A 2J6IA 4QQRA 2DFVA 3IKTA 5JC8A 2JCXA 2O23A 4R51A 2V65A 2BELA 2E82A 1GR0A 3HSKA 4TMFA 1A7AA 1R4NB 1NAHA 5L7YA 4LK3A 4DREA 4YRDA 4PLCA 4J1SA 3N58A 4ZD6A 4IMRA 1XQ1A 1GEEA 4DBZA 1E3WB 4LCJA 3GPIA 5K6AC 1JN0A 3WIEA 4YJGA 4EUEA 1AN9A 3BMQB 1E92A 3ADPA 3JQDA 1Y81A 1E7SA 3RU9A 4PIVA 3KV3O 3JCZA 3U4DA 5JY1A 4QO8A 4BO3A 1ZEJA 1E7QA 1U4OA 4DUPA 3TN7A 1BTOA 3L4SO 2P9GA 3JQCA 1Y8RA 4NU6A 4ONEA 4NJMB 2X5JO 4BO2A 3ORFA 1N7HA 4H3VA 3WMXA 2Q99A 3AWDA 2PZMA 2P91A 4L74A 5IJZA 2ZCVA 4IDCA 1IHXA 4GH5A 4J4BA 3EVNA 3GC6A 2BFMA 5DCWA 3D1LA 3GQVA 3JQAA 3OIDA 5DF1A 2I3AA 4R01A 1I24A 4B4OA 5CDSA 3S2EA 5CAEA 4PLFA 4U7WA 4MPDA 3GNSA 3D3EA 2B69A 4CMGA 1Y8RB 3LLSA 4XYGA 4EUFA 1I36A 4NJMA 3WR5A 3ZNOA 4BKRA 3ZHBA 3ZWOA 1DC3A 3KTDA 1DB3A 2PA3A 1D8AA 4KWIA 4AJEA 5FEUA 1ZVMA 1MGOA 4XDZA 5BSGA 4DBVO 4PFJA 2ZJ0A 3KM0A 1M6HA 2DTXA 4U6QA 5EINA 4M54A 2NADA 3I4FA 4JP3A 4CV3A 2VRBA 1LRJA 4HADA 4CR6A 4A5OA 2XAAA 1K2WA 4R54A 5BSFA 4ZQGA 1RM4A 1LQTA 4I08A 3KYDB 1VKOA 3WFIA 2RIRA 3G79A 3HADA 1U4SA 3UVEA 3IL2A 4OSPA 3O26A 3STHA 4O59O 3DBLA 1N1GA 4RF2A 2P2SA 3WB9A 2UVDA 1PSDA 2GYYA 4QFCA 4YQZA 4E5MA 1ZSYA 4MO2A 4QO7A 3WNVA 2HMSA 1I2BA 5JDIA 2UYYA 3MEQA 2F00A 1C1XB 1EFKA 1JAXA 2WM3A 1ID1A 3NT2A 4HXYA 1XQ6A 3JD4A 2PD6A 3H2ZA 1BG6A 3VDRA 1HSZA 3ZN2A 1ZMOA 4YTEA 2IXAA 1YKFA 3I9KA 1ISMA 4I8XA 3W6UA 3D5TA 4MVJH 3ZHZA 1SOVA 3ZV4A 4E5KA 3BMOB 4MVJD 4KUHA 4RLSA 3GMSA 3VOSA 5JDCA 1WWKA 4EJ6A 2EWMA 2GZ3A 3H4VA 1AHHA 1TI7A 1V3TA 2NQTA 1DJQA 4CV1A 2C5EA 3TNLA 4BV9A 3WOHA 2EXXA 2W2LA 3PI7A 1UXKA 4ZN6A 5U9CA 1LI4A 4UEJA 2Q1SA 3E1KA 3T7EA 4ZQFA 1T26A 2BI7A 3ZNPA 4OO3A 3BXXA 5LC1A 2AA3A 5DOVA 1P1FA 4XQCA 3RQSA 2DPGA 4E30A 4O63O 1CETA 7ADHA 1HDGO 3KEOA 1EK5A 2XXBA 4TRNA 4YXFA 1GUYA 4HWKA 1MFZA 3T4XA 1RWBA 1IB6A 3PWZA 2NU8A 3K31A 5KJ6A 1LSSA 1SC6A 1HSOA 3RU7A 2WDZA 3CEAA 3BHJA 3DHEA 1I3NA 3PHGA 3JQ8B 2FN7A 5JAIA 4RVSA 4GX5A 3ZH2A 4IBOA 1QRRA 3CSDA 4J3FA 3I52A 1NPYA 3K2EA 2O3SA 4UVHA 2P9EA 1O8CA 2GF2A 1QXSA 2VYNA 3RKRA 2NSDA 3JD3A 1B0AA 2WE7A 5A03A 1Q0QA 4J90A 1QKIA 3HN2A 2PGJA 4OH1A 4JX8A 3GVCA 2E37A 1DIGA 4UEKA 3PHJA 3JD2A 3LT1A 3O4RA 3Q3CA 1KYQA 1VJTA 2HKIA 5F1PA 4G65A 4HNGA 1PGNA 1UP4A 2AMFA 5B4UA 2Y1OA 3O38A 1BSVA 1U2DA 1P45A 3PWKA 5C7IO 2ZCUA 4IJWA 3FNFA 2WD7A 1GQ2A 3GNQA 4E21A 3A28A 3JYPA 4DQVA 2HJSA 3ASUA 3R0IA 2PZKA 1GADO 4WASA 3BTOA 2WE8A 3FPCA 2RHCA 3NAQA 4HUJA 3EC7A 1CDOA 4P8RA 3JTMA 5A3JA 4TWRA 4UEOA 4KDFA 2WSBA 5KJEA 5ENDA 3GG2A 1IULA 2X9VA 3RBZA 4J43A 1R66A 1T2CA 5CEEA 2PKQO 4L73A 4BO8A 2NM0A 2EW8A 1H5QA 5KOIA 4G5HA 1BMDA 2OP0A 3PYMA 3WSWA 1Y8QA 3EVTA 1CRWG 3PGJA 1HL3A 5IZCC 1HE3A 1YJQA 1LDYA 1P1IA 4BNIA 1R6DA 2ZB8A 1GZ3A 3LYLA 4PVCA 4YT4A 4ESOA 3JQ7A 3AUTA 1LUAA 5TRTA 1C0IA 4BO6A 2GR9A 4E5NA 1YDWA 5C37A 1O94A 2OORA 5BT9A 3FR7A 1FDSA 4FC7A 2W8ZA 3RFVA 3A4VA 4FW8A 5B4VA 4ZQHA 3PDUA 2X0JA 3LT2A 1IPEA 3VH4A 3W8FA 3UN1A 3WIDA
chains in the Genus database with same CATH superfamily
1ZC4A 2RGYA 3FYCA 1ZWKA 2NZVG 4Y2RA 3A2KA 3F6SA 3W78A 4AUMA 4GSLA 3QUCA 3U60B 3CF0A 2J5RA 3OTGA 1IG3A 2YJ6A 4M76B 1YCHA 1E32A 3CUWA 1OT5A 3GCDA 1D1PA 3K72B 5FA6A 4NZNA 3IBSA 5J2UF 1OLUA 1WBJB 1D03A 2C58A 2X4GA 2OP1A 2YY5A 1UXHA 2C9MA 3BOSA 2VBCA 3MXOA 4L4SA 3VHRA 2FFRA 1PS9A 1UDBA 1ACMA 3WWCA 4CI0B 2VT2A 5MN6A 2AC2A 2GKOA 4GVLA 4P2GA 5EE9A 4LDZA 3DL4A 4LDAA 4MPTA 3LRXA 4WXMA 4ZVVA 1IXYA 3IHKA 4AWXA 2AT1A 5B55A 3A1NA 3QXHA 3WNQA 5HS6A 1JDUA 3F49S 3N5CA 2GA8A 2DUUA 4C3VA 3QMWA 2H4WA 3GYGA 4B3HA 1A82A 1KZ1A 2FDCA 1QQAA 5TARA 3U3KA 3QKUA 4YR7A 1CJKC 3LUHA 4LBVA 5KVQA 3V5NA 3ICQB 1MF7A 2CF5A 3GLHA 4OHMA 3VH3A 2ZJ1A 4DRXA 1NZDA 4IOLA 4E1BA 1SXJA 4J7CA 5DYTA 4ISBA 4ZVLA 4EPTA 1QTQA 5IXJA 3SR0A 4YHHB 4EHNA 3LM8A 3COJA 2EC5A 3QBEA 3UMRA 2JLUA 4KR2A 1M10A 3K9NA 4GI3A 4OLAA 2C1ZA 2DULA 2JBAB 3L01A 3O8QB 4EO4A 1KQPA 3F3YA 3HO8A 2Z56A 5DXAA 2Z1NA 4QYTA 3H3XA 4I6JA 2Y1EA 1IQRA 2QXYA 4KPUA 1UKAA 3OLQA 3MT0A 3REFA 1ESEA 4GRDA 1QUFA 2E7ZA 4MS3B 4D6YA 3RANA 4MQEA 5B7PA 1QLJA 4I19A 2PLAA 2GXSA 2BSXA 2X2OA 4B7AA 2EERA 1RZRD 5KNDA 3PXXA 1JEJA 2NTVA 3UCEA 1NBEA 4BLTA 1E2KA 2OO5C 2YC4C 1ENPA 3T1TA 4AAYA 4Z9XA 5IKOA 1P4RA 4OXQA 2HMVA 3QNMA 4C14A 3L9XA 3SQNA 3LG2A 4WD3A 4URYR 5I8WA 3I53A 3GN2A 4BNXA 2XXJA 2FUG6 2IEAA 2ODWA 2CL5A 3UAZA 3MGGA 4MI6A 4BJHB 4Q4LA 4E94A 1SVNA 2H2GA 5TGZA 4JLJA 3DMNA 1XPOA 2OB1A 4JEHA 3TXAA 1YFKA 4DYVA 4M6WB 3QW4B 1DQYA 2ZJZA 1T1SA 2YHAA 4GKBA 2V5AA 4L0DA 3M5DA 4MQEB 3R7DA 3HUUA 3VR3A 4CNQA 3NHFA 5KWIA 4N7BA 1POWA 1BYUA 4L27A 1Z45A 1R6XA 4V24A 4YAUA 1DELA 1VRWA 2QX9A 3QI2A 3Q9LA 5B6IA 4FEEA 4H7DA 1A27A 2R5NA 3D2AA 5BSUA 1B0PA 2ZBFA 3PR1A 3VYVA 4K6FA 1PFKA 1JEQA 2VDOB 1WUJS 3UHFA 2X8JA 2I6FA 3BTVA 5E4JA 4WK4B 2RCNA 4EVIA 5LJIA 3ADBA 1EDZA 4I1SA 4J76A 2A30A 4GSYA 5FHQA 1E4OA 3OH8A 2DBRA 3AY0A 2A9JA 1UOOA 2E4XA 4II2A 9ATCA 1VE1A 2KYRA 3KU4A 3ZY2A 4CM5A 4G9GA 4JSRA 4TLEA 5CB0A 4EA6A 1IQUA 1KI4A 3PEWA 1XHLA 1H9BA 2GZ1A 5JNLA 4W1RA 5LLTA 1Q44A 1DAGA 4WBNB 1Z8DA 2BHNA 1L4KA 1GWNA 2EJTA 1JLMA 2J87A 2AN3A 3B7WA 4Q9JA 3T1QA 2X8JB 4IVPA 2AKAB 1C41A 1ZKDA 2BDUA 3DR3A 3HY6A 2E3JA 1GZHB 4C76A 2JCVA 1JKXA 2JFOA 3CR3C 4GZ5A 3N8KA 1ZNQO 2ZE5A 5GJWC 4DC9A 1QAQA 2E2WA 4ZI7F 3Q6MA 3SEFA 4ZZ1A 4Y1GA 4MUAA 3FY4A 4P54A 2C8JA 3VPXA 4ZDWA 4ABTA 4CHTA 1CQJB 3A4LA 3JQEA 4MRNA 1P62B 1LGYA 1KAGA 4FPXA 1MAUA 5J4VA 1FIUA 3NWJA 3SQLA 1II8A 4FEGA 2Y9MB 4LCBA 3KFXA 5AVYA 1M2GA 3O74A 4G84A 5DFAA 5L7TA 1I8TA 3JAWB 5DGCA 2I2WA 3NMUF 3RS5A 1TK9A 2P1DA 1G8MA 4X62B 2ZRNA 1MXFA 3L4JA 2BFOA 2RE8A 2IGBA 4F93B 5L4NA 2GBLC 4KV7A 1ZGAA 3IFSA 1J70A 3QVKA 4WBXC 4F7DA 3KJEA 3TPFA 1AQ6A 1WSDA 3PWSA 3NALA 2WMNB 1Q7TA 1E1CB 5EUBA 1OIVA 2EOAA 3MMZA 4J75A 1CHDA 4I1IA 4JEIA 4R2XA 1NWCA 4I5IA 3RODA 3OWHA 2JH8A 2CUKA 4RA6A 1N2IA 1QHHA 2VYQA 4UFOA 5B1DA 3H99A 3MRVA 1BFKA 4MVYA 2Z2YA 4S2EA 1V2HE 1E9CA 3PNPA 3RASA 3EARA 3T52A 3ROXA 3ZDBA 1DBSA 2O05A 3ICWA 4IVRA 3U1TA 1C5KA 1FLAA 1L8AA 1ZEMA 4KHZA 4Q48A 2BH9A 4GLLA 2VAVA 5ERYA 1ZK1A 1W9HA 3EIFA 4N8DA 3R7WB 3ZH9B 3HKCA 4LXTA 4BKQA 4XKJA 3RYHB 1TRHA 1Z33A 3OUTA 3QVUA 2F1JA 1WDLA 2O7SA 1YASA 1YAHA 4MS1A 2I3ZA 2JLWA 1KRWA 1FNCA 1DEOA 3BIXA 4R9VA 2GLXA 4DV2B 4LJ4A 3M89A 1P5FA 4J4TA 3R4VA 4FDUA 1XXHB 2AG5A 4A2PA 3HJHA 4O4JB 2A35A 3F9IA 1SZCA 4EKDA 5H81A 1H65A 4KMMA 1TU4A 3BZWA 1TC2A 3LX6A 3L8CA 4ZMRA 3EDMA 4O2AF 4KSBA 2QRPA 2IA5A 2FPGB 3R6LA 5BNTA 5BURA 3H9EO 1QKKA 4IICA 4WOCA 4QGAA 1DS6A 2G1UA 2HU5A 1ISJA 1XZLA 1F6WA 3QRWA 4PTLA 4MRSA 4OQYA 4PNZA 4YCJA 2GAAA 3EGOA 2XNDA 3DNFA 1G2OA 4UQOA 4YJHA 4BRWA 2HT1A 4M7RA 5ES4B 1TEZA 2OBBA 5FOUA 2TECE 4XQGA 2VJQA 1SIWA 1N25A 3QPBA 4ZTZB 4L2IB 2VKTA 1V11B 2G8LA 1PGPA 2BR4A 2ZE7A 4B43A 5FNVB 2DMRA 2PH1A 2PWZA 3MYYA 3V8BA 4RK1A 4P33A 4EGSA 3EXHB 4CEHA 1UDXA 3ND6A 2O52A 4YRJA 3VPBA 4BGUA 1YUMA 2VP0A 3U7QB 2A9FA 3JU3A 4E5UA 4NCAA 1A1SA 2WUFA 4GHWA 4LHEA 4IIVA 5JV5A 5JSKA 1YFJA 5IBCA 1XN1A 3DOHA 3P0EA 2AH5A 4PN3A 1AS3A 5ILOA 3GJTA 3NBQA 4JD5A 4HX5A 1WAMA 4B3IA 4CKBA 4PZUA 3D7MA 1ZLXA 2AUMA 4KZPA 4PX3A 3NKVA 3SY8A 1RWNA 3MTJA 3OOJA 1HR0B 3OT4A 3EIOA 1GNVA 1RLJA 4C89A 5JFGA 4BNGA 4BNMA 4ER5A 1VHQA 5EMJA 4J0EA 4RXTA 3ZQUA 1H22A 1VYUA 1X1AA 4NMMA 4YEDA 4XYMA 1AA9A 3NGLA 4DKJA 3MRXA 3RFUA 3AI2A 4MAFA 1Z5NA 5AM5A 1AQUA 3BQMB 4WESB 3RAJA 1DQNA 1PWEA 2ATVA 2IW3A 3I2JA 2F59A 3OZUA 1OAKA 4XYBA 2C4UA 4FBLA 1N1DA 1GTJ1 2EGGA 2XMRA 3MGKA 1EFPB 1SJ9A 2WAXA 1W34A 2AJDA 3IDFA 3KJIA 4ZXPA 5TEVA 1OWOA 2J4FA 3EIHA 4UBNA 4UVIA 4B4UA 2ZYGA 1FXSA 2EKZA 3Q10A 3KPYA 1ZBQA 5B53A 1TIKA 4R1UA 4CMEC 5KYXA 1UM9B 1PO7A 5TC4A 1NOKA 3SE7A 3T7SA 3UT5B 3I9JA 4H59A 4M1ZA 4RFSA 5E9AA 1UPCA 4UHDA 5SV2A 1I94B 2BP7A 3LOUA 3W9BA 4ERNA 1S1MA 5K01A 1NKVA 2AZTA 4N7RA 1PR9A 1W47A 3NEJA 4M0FA 4MR9B 4WFQA 3X2SA 1HFJA 2XD9A 4BP9A 4E15A 3HUTA 3NS7A 1XD8A 3TMAA 1BJKA 5JY6A 1A7UA 2JRLA 2OYSA 4JQYA 4DM3A 4OIMA 2FVYA 4IMPA 3EH2A 4PS1A 3GIWA 5TY0A 1XVVA 1Q6YA 1JALA 1E3SA 3MINA 3LDUA 3OU6A 5JQGA 3U09A 3KOUA 1KBZA 4DV7B 3MQFA 4MKIA 4DJDC 3G5AA 2PMKA 1HDIA 5LZ7A 1S1CA 1UDAA 3OBBA 1UJ2A 3E4DA 4L4YA 3JAKB 1ZMBA 4QSMA 1OGYA 4XX1A 5G0VA 4DEVA 4A2WA 5F7XA 2CL0X 1VKRA 3SEQA 4BL5A 4QQNA 1IFXA 3T7RA 2R8OA 4KMSA 3UM9A 3OEEA 2PLWA 2HX1A 3KPJA 1I80A 3M70A 4JODA 3P5SA 3CH5A 3DNPA 2W7TA 4FS3A 4HZGA 3UOGA 2E49A 3TRJA 1EVJA 2JLRA 4AYWA 5JO0A 3H2BA 1I1OA 2RHGB 3ZHSA 2ZWOA 1EK0A 1MOSA 2EL9A 2HRQA 3BRQA 4IWXA 1Z68A 2YINC 1FYVA 3EK2A 4LOHA 5K3AA 2CXUA 5C34B 4D9GA 5J2TB 2Q0HA 1IJKA 2WQ6A 4B9EA 2ISQA 1YRLA 1CF2O 1F38A 3FUWA 1ZR2A 1MQAA 3HZZA 3M34A 2JD2A 2ZAOA 4NENB 2JVIA 1RRPA 2IKQA 3EEFA 4EG7A 1GZ6A 3LCCA 4XGRA 5FBVB 4CV2A 3LWZA 4B3JA 4OU5A 1JQ3A 2ZJOA 5H1YA 4NU5A 2GRAA 1C0EA 1PK8A 3DLCA 4CLOB 3AUSA 3ID6C 1V45E 4GBGA 4HWGA 3LY5A 4EA7A 1PZXA 4MA4A 3VR2D 3SM3A 4KDCA 3W7AA 1RCUA 1G6KA 2VAXA 4JJZA 1C7QA 1V7QA 5DXFA 2CFTA 2PQ0A 4JUIA 1CZUA 5MN4A 1Y5NA 4IIHA 3P9YA 3CONA 4JLPA 1E96A 4KH0A 5K6RA 4TLLB 1NMSA 1YB1A 4AO6A 4BGDA 5C5EA 3U39A 2BTQA 1I2MA 3EDOA 4IYJA 5EEHA 1KOJA 4DLWA 5BOSA 4RULA 4DUYB 1WOMA 4XGQA 2QTAA 1F8FA 2HSJA 2NNLD 3CU5A 4EQ6A 2E89A 2NU6A 1M7HA 3GGPA 4H16A 3UMSA 4B6QA 4ZI5A 3VHQA 3K9HA 4UOEA 2CZQA 4MVJI 4F72A 4KR3A 1I3CA 1UIRA 3A2LA 1N4DA 2Y3IA 3PNSA 1V1JA 3BSYA 4JLAA 4WNCA 1SIUA 2A5GA 4DZRA 3SZGA 3V42A 4OPMA 1TNDA 1AZTA 4B7CA 2PSEA 4CW7A 4H6WA 4TKVA 3ITDA 1L4EA 1QK4A 1U94A 1UBRS 3IOCA 4G1MB 4M1KA 5MGNA 3AOGA 2BZ0A 2JAUA 5BOVA 2VAPA 1X8JA 1Q7EA 2NPFA 5A6SB 1T0HB 4RABA 2AZXA 3H3FA 5FLYA 3KLMX 1GNPA 4MWTA 3UJHA 2O0KA 2ZK7A 1B1CA 4FZVA 4HWOA 4OXYA 2I7DA 4YRRA 5IWCA 2XBUA 1X7HA 2XNSA 3EIQA 3P71T 4IDNA 4PHFA 4XCXA 2BMAA 2HMWA 2Z5GA 4Y2PA 3EVZA 5DEIA 4EYEA 1YIOA 2ZAIA 4N54A 4D46A 3SC2A 2Y0PA 4MIEA 2QE7D 2AFIE 3ZS9A 5E9WA 1E6UA 2FPLA 3CZPA 1RR6A 3Q7RA 3EQ8A 3KT3A 1NQUA 5ALTA 1J23A 4MVJP 3UHAA 4EECA 3IEUA 4F2WA 3VNQA 5K3BA 1DJLA 2VDPB 4OBWA 5AYVA 4FOOA 2ECOA 4OXRA 2RGNC 5EXEA 4QHTA 1N7GA 3STVA 1NXSA 5FAXA 2FN8A 3O4GA 2IHKA 1PZFA 3MMSA 4AP5A 1XRPA 2P8JA 5A3RA 4Q15A 4TYMA 2HQBA 4LCEA 4NDNE 5JAQA 2V4ZA 1C81A 3P97A 4HS9A 3I30X 4KXVA 4QODA 2EFHB 3LNTA 1G55A 1TQ4A 2O8NA 4TYWA 3LFUA 4BFYA 1EWQA 1PEDA 2VLBA 3PQ7A 5J1TB 4BE7B 2X9GA 2ZDGA 4DCTA 1DCMA 2PRIA 1IN4A 3R5FA 3REQB 2QM7A 3IODA 2ZYWX 1QM5A 3PHHA 2BWJA 3H9BA 4KE7A 4TV9B 3UEOA 1ETHA 4WY5A 1QQ5A 5HUJA 1TCUA 2GHRA 3H4IA 4PLTA 1W4ZA 3PKIA 2ILVA 1C1HA 3SHQA 3A4YA 2PH5A 1A5ZA 1NNUA 4UAJA 4O4IA 5SICE 1SULA 3NT5A 3U31A 2OAGA 2WIFA 1I2CA 1UMCB 2GEFA 2JAQA 3BAZA 5HIKA 1EDBA 3GFQA 1IEWA 1OBVA 2FEPA 4PRLA 4C4ZA 1SVOA 1PG0A 2ZTSA 1EJ2A 4FDVA 3VNSA 2PO7A 1RQLA 2WWHA 3DV0B 4Z0TA 3ETEA 1C3VA 4ABYA 4M99A 2ID9A 1LS6A 5EQJB 2YIDA 3DFIA 2E0IA 3UFXA 5IDQA 3TSCA 4P7JA 5IP5A 2PZBA 3GCZA 1X1DA 2OECA 2JJ1A 3GJXC 3JVDA 3MILA 4G01B 5GAJA 1B8NA 3WRYA 5A04A 1GLNA 1Z0DA 1FJGB 3E3LA 3L4BC 4D79A 2B1GA 2ZRAA 2LDXA 3NBZC 3RVLA 1HK7A 1A5AB 1J9EA 1RWMA 3G6WA 4RKWA 5M5BA 1XELA 4G67A 1OT3A 3HM2A 2VUIB 3AIIA 4PZCA 1V96A 3N2GB 5AJZA 4D7AA 1NP7A 1HZZC 3CH7A 1JZSA 1SXQA 2HWKA 1ZP6A 3EZGA 4UREA 2Q07A 4TTTS 2PXCA 4WNAB 4BQEA 1H2BA 1TJPB 5CM2Z 4JXXA 1FW8A 3K7EA 1FSSA 3S3TA 3IP9A 4AJJA 1JDNA 3A1UA 1KJZA 5KQSA 3QOYA 5CX1B 4A03A 1RC0A 3CLRD 1O97C 5JNRA 2OCAA 1EFVB 4B31A 5FBQB 2WD8A 3RLIA 1DJOA 4PFSA 4J0GA 3VR6A 3K9BA 1JQKA 1LNQA 2YWDA 8ADHA 3KKPA 2A84A 2QGZA 3I5XA 1A5SB 2BLLA 5BN3A 4WY2A 3C3CA 2GHIA 4KGXA 2PM8A 2XUZA 1I7DA 3CLSD 2AG1A 2GFQA 4JBNA 5IDXA 3JWJA 5BWCA 1U90A 4XJVA 1B15A 1YZUA 3G89A 1TU0A 1ESZA 4KGDA 4S05A 1E69A 4LTDA 3ZEAA 5HX7A 1LBHA 1SBCA 3DVLA 4W9NA 2HSEA 3VZSA 3PQFA 3HKBA 1ADYA 2UAGA 4BMNA 1ESNA 3QXCA 2PS3A 2G82A 1C7EA 5LQDA 2D1FA 3A6EA 5ENZA 1FDTA 5DP2A 3P9ZA 4MDFA 3U3OA 1OYVA 1NFQA 2XNKA 5JFOA 5CCBA 1SG9A 3AK4A 2Q4DA 3F5QA 1LDBA 4MI3A 3N2KA 3P9XA 1VE6A 4MGHA 3VTFA 3ZLTA 2ZUVA 3KB2A 3NAZA 3RT9A 3UAGA 3EIEA 1EG7A 2QUBA 4EKIA 1V4VA 4EHDA 2FMTA 3SMQA 4EFKA 4QM7A 2GASA 3U13A 1A4IA 4M0DA 5TLSA 2PE5A 2X3YA 1CUYA 4Q9NA 4REOA 5AXDA 4O2AA 4F71A 1TAUA 5JDIC 3ZI4A 4BO7A 4JXZA 4ZKEA 1UXGA 2X1MA 5HNKA 3H6GA 4QGFA 3G0HA 2VHZA 5JSZB 3CNOA 4YP0A 2C00A 3SYLA 3HYRA 1VPWA 1PNVA 1G8FA 2M9MA 2QDKA 2VATA 4K9OA 3TDNA 1RKQA 3G9QA 3OQVA 4TLAA 2IC5A 4AWAA 3OPYI 1UK6A 2WWWA 4M0UA 3UT0A 3W9YA 4EY4A 4MS4B 2O3QA 3G88A 2YVKA 2AYZA 4YJ3F 1E0KA 3PFFA 1F2TA 1HDZA 1J8YF 1YBMA 4RQUA 5JDCC 5CA0A 4OHBA 3NV7A 4TMWA 1SEVA 3C7DB 3WGGA 2GXAA 3CX8A 1PZEA 3GQBB 3WK5A 1HDOA 4ZOAA 1CSEE 1CZRA 3U62A 1Z0UA 3VTAA 3SEZA 2M1ZA 1JKJB 3ZPXA 3EFEA 3NETA 3PCRB 3UWSA 4DLYA 4F6LA 2YHIB 3AG6A 1N2XA 3B5EA 1QS0A 3ADOA 3NV9A 1PZMA 4PYQA 4X97A 3VBCA 5JQGB 1G5HA 1N6PA 1OFUA 5LQMA 4FT2A 4YJFB 1HEUA 1R15A 4FGWA 3UXYA 1XEAA 5ESWA 4CM1A 1RNLA 1HKHA 2QORA 3D8UA 3K0HA 3CPSA 4I3HA 1X0VA 3BD7A 2XSZD 2I9PA 2H5JA 2I6TA 4PIPA 4RPKA 2J0QA 1H6CA 2O8CB 2CVPA 1VJCA 3B6EA 3HBAA 4Y0NA 2MHCA 3U4HA 4CU2A 5AJUA 4U1RA 1W87A 1YJ5A 4BFVA 1L4LA 5AVXA 4MV5A 1KZHA 3VYTB 3NLLA 3O8OA 1VE5A 2E9SA 4QBHA 3OBIA 1RAAA 3I9V1 2GBGA 1PDWA 4GBJA 1Q7RA 3IO5A 3MM4A 4MPJA 3ND8A 5I7RA 1PFVA 4K9NA 3GLHB 3TQHA 2W6MA 1PQUA 3HO6A 1SCNE 2HXYA 2QL7A 4QYMA 5JSFA 4U6SA 1JMKC 4TRJA 3FX2A 5ESXA 3UC9A 2FWRA 2QN8A 2XRMA 4ROSA 3ZLUA 2XUOA 4UBJA 4A92A 1QZUA 2ZIXB 1K6XA 4NCIA 1RYEA 1AUXA 4UCFA 2CJWA 3C4JA 4P7GA 3DVRX 2HU2A 4RZXA 3TYXA 4R0MA 2PKXA 3QYFA 4A6XA 1YK1A 4DYHA 1NNEA 4EG0A 1SRQA 1GPJA 3II6X 2NXWA 5F1YA 4FEAA 2BMFA 2FF5A 1JPNA 2OZLB 3LOPA 3QVMA 2MDTA 4B0PA 4EA9A 2B37A 3LRTA 5K0GA 4J4HA 1F51E 2BM0A 3VXKA 4EMSA 4FNGA 4GOLD 5FB3A 1LA2A 3DXFA 4PLYA 5TQ2B 3WYAA 4R8KA 3TGPA 2LE0A 2JCGA 2QXUA 4J16C 1S6YA 2P9CA 3P8ZA 1N6LA 1R4MB 1NBWB 2DYKA 3DEKA 4TQUS 5D2CA 5PNTA 3AF5A 4LRWA 1W49A 4CM3A 4ZHQF 4ATNA 3T7TA 4HQ6A 1RRCA 1BVRA 5C9ZA 2O5EA 4OAOA 5J63A 1ZMRA 3DWEX 4PHCA 3TRKA 1TX4B 2R4QA 4HSGA 5CRIA 5EUCA 5FLEX 3J7AC 4AT1A 2WJAA 4C4AA 2WINI 4JVMA 4TKVB 2WAOA 1G5IA 3LU1A 2VJYA 5FWYA 3HNOA 4OSOA 3RJTA 1J4AA 4LYYA 2D54A 4KREA 4OQFA 5LVAA 1UEIA 1FX1A 1A88A 5DHQA 5KTYA 2ZRPA 2PX8A 1UWCA 4KEAA 4BMSA 2HQ1A 3WHIA 3A04A 2J1LA 1ENZA 3F47A 4CDNA 1T0JB 3K0CA 2XVMA 4RTMA 3NBFA 1JIIA 4H7KA 1U8YA 9ABPA 2XB2A 3DP9A 3TS1A 3M6MD 2RJOA 4O8CA 1GGKA 1CPYA 1GQOA 4B83A 1Y8ZA 2R11A 2FZWA 3BICA 4G5XA 4TVBA 4H08A 5BW8A 5E8RA 3UZUA 1H4TA 4EYGA 3R20A 5CBKA 1N36B 2DF8A 1FVFA 2V6FA 1FU8A 4RPLA 4F4IA 4BRZA 4MROA 4GXRA 2ZBRA 3ZVMA 3BULA 3EXHC 2H0RA 3M82A 4HEJA 4RZQA 5HS4A 4YN3A 2P5YA 4TYQA 3M6XA 3WK4A 4D45A 1XZQA 3G0IA 2WJHA 3GR6A 3CB2A 2D1YA 2HU7A 4WXHA 3CGGA 4OLJA 3CMCO 4H2DA 1NIJA 1QRUA 1WVMA 1TUBB 4AUKA 3I9NA 1O5OA 5JMPA 5F76A 2Z8XA 4XD7D 4TXJA 3AB3A 4YJ2F 1Y9AA 1VDMA 5D6NA 3N28A 2NO5A 1ZGCA 3UPTA 3KHKA 2FRDA 3EBLA 4CKYA 4OY3A 3EXIB 4QWMA 1ZGZA 3JQQA 3B70A 4TV8B 4GMKA 1DRWA 3BMOA 1U3CA 2PKRA 4O4IB 4MUMA 3WL3A 5JTTA 2M2IA 2CCKA 4BLUA 5CNJA 1WB5A 5THQA 3DGFC 3ZXSA 5HRCA 4G0WA 4S1NA 2WU3A 3MJDA 3E03A 4ALNA 1LSUA 1U0EA 4HDNB 4L02A 4BVKA 3CA8A 3C98A 3GT3A 1CVRA 4G4IA 2QIOA 2WIBA 2YTZA 2JHCA 3HR7A 1K08A 4JJIA 4PLVA 4WECA 4WOJA 2Q3DA 4BFSA 4YP7A 4DXHA 5EIBC 3KQQA 3V8RA 5BQ3A 2PNFA 4G5SA 1SCKA 3EQ2A 2OR3A 1XEWY 5D1HA 2ZTVA 4HAWA 2OBLA 3BJIC 3QOFA 3Q8MA 5JROA 4UMVA 3DQPA 4KMRA 4CM9D 1DXYA 1Z73A 3U7JA 4LJYA 4O0LA 4YRKA 3A70A 3ROTA 2P67A 3V1YA 3V80A 3RIHA 4CF6A 3ETDA 2G76A 2WG2A 4QGGA 3RF6A 1ZA2A 1YB2A 1G8HA 2QRGA 2UV8A 1E5LA 1I2DA 4CIYA 2JNWA 2QB5A 4U9HS 5TMBA 3ZK9A 1H2RS 3RVRA 4F5EA 3LS2A 3ITKA 3S6JA 2I3BA 4WZZA 5KNBA 3D8BA 3H17A 1EBBA 1FFWA 1HEYA 1YZ3A 4HN4B 4MUBA 4QT0A 1E4YA 1PTJA 2GTPA 1PR6A 4Z53A 5IWAB 3TFQA 3X1WA 4ZYWA 1VSUA 3VSCA 1E4EB 5L9AA 4OI1A 4B9AA 4J16A 3E1SA 3OQOA 3G0DA 1DC7A 1BXZA 3TKYA 4F97A 5IAOA 3GELA 1THMA 1INLA 2F1HA 3P9KA 1II0A 4UBMA 4EJSC 1TQ6A 2XJ9A 2ZR9A 4HV4A 5CA1A 1ABBA 4CMJA 1KVUA 1XU4A 2J3DA 4GOND 4DC1A 4F1KA 4C07A 3HXKA 5K4GA 2C2XA 3Q8KA 4MYHA 3S1AB 1XC7A 3BIJA 5JTUA 5LYJB 4M1OA 1R0ZA 3IKMB 3DT6A 4RXMA 4H31A 4HFJA 1IM5A 1BH6A 4XIGS 1AKMA 1J00A 2G06A 4Q9HA 1T0BA 2EHDA 5EMKA 1JYFA 5JRDS 3ZQ6A 2VCEA 4MQ6A 4C2AA 2CHFA 2Q3LA 1ZUD1 3AZQA 1M6VB 4WNIA 1LVGA 3C43A 2VJDA 3WV4A 4X1KB 3PTZA 4GWGA 2GKGA 3ZHYA 3A1VA 2XYPA 2F3PA 1UPXA 4FC6A 3PNBA 4O1IA 1H42A 5EQTA 3W2GA 1S96A 4OAPA 5JZSA 2HF9A 2RHLA 3OJLA 5FBKA 5HP4A 4FZ3A 6CHYA 4ZA2A 5LD2B 3OOHA 1WU8A 3KELA 3RJMA 4ZGGA 2O3RA 4KN6A 4MEJA 5KDOA 1HT2E 1UBLS 3PHLA 4LSZA 3F5DA 4QXPA 3K94A 2ZUTA 3VHXB 1IXZA 3X1DA 5CFLA 3V4ZA 2C9ZA 3KB6A 2VZEA 1PCXA 3EISA 4FFSA 1N7IA 1YXMA 4WKPA 2O8FB 2PFGA 4JMPA 3PZRA 2YFQA 3P2YA 4LHSA 1JI3A 1Y9EA 5BVGB 4NK4A 3E3AA 2H8KA 3EOAI 1FMFA 2FJUA 3TNDA 5K8IA 1RHMA 3ICVA 3ZDXB 5CA0B 1NXXA 3E5NA 4GR9A 1NQOA 2QE7A 4R1OA 2CNOA 2ZSFA 3GAAA 4FD2A 4FCCA 3W8EA 3JYLA 3ANXA 5ITWA 2BFEA 5LQJA 4EW6A 3CNEA 2WVGA 1XN4A 2BUBA 3IE0A 1G7SA 3NJ4A 4BMDA 4EB6B 4PYKA 5CDUA 4RDCA 5HXAA 3VI4B 1YHZA 3O0TA 2FSPA 4FU0A 2IUFA 4RHEA 4ASUA 1NWHA 2D8MA 1DRKA 2XB6A 3AUYA 1XZKA 2IXBA 2KPOA 4QFDA 1W44A 3MWYW 2RCYA 5C8ZA 4RTKA 1E1QA 2B6HA 1XLUA 2D2IA 2FRXA 2AV6A 3X0DA 1NBIA 1XDGA 1Y4DE 1I3MA 2B2CA 5C31A 5LZ5A 3EH1A 5L95A 1J8FA 1O2DA 1U2PA 4RTPA 2XKKA 5BYKA 3K4HA 3V4OA 3DDOA 2GETA 1JSZA 4LG1A 5AFSA 2GZSA 1X6VA 2DQYA 1PEAA 1VG1A 4G25A 3IAM6 1XZHA 4MDYA 1RIIA 4URZR 4E5YA 4POOA 4QBIA 2FOIA 2F4VB 2OGUA 4ZALA 3RIMA 1E9DA 4MPRA 1XKLA 3IIJA 3FN4A 1YQTA 1GSIA 1F4LA 1GPNA 1UFKA 1UKZA 1W94A 4Q16A 3UMFA 5A02A 3UMMA 5A9SA 1CUVA 1Q14A 3AI7A 1XX6A 3ESXA 3FPLA 4ETNA 4DSNA 2VDJA 4P0PB 3NB0A 3QENA 2YZNA 4GT1A 2WA1A 4HQ0A 3LQQA 1TA0A 2X0NA 4TVOA 2ZBDA 2N0SA 1GVHA 3HFSA 1X9IA 3ONFA 2B8EA 4Q4JB 1M8KA 3NXSA 2SBTA 1Q0ZA 1U8XX 3CTMA 3R6GA 1ZVQA 4TSFD 5ALKA 4CL2A 1C3JA 1MTOA 5F51A 1NP3A 2OMEA 4C6TA 4YA6A 4OL0A 2QW0X 5TMEA 1J6UA 3OQNA 1GAQA 2X0DA 5FAKA 4JYPA 1GG9A 3E8XA 2A9PA 4N7JA 2OHOA 2G25A 1X7XB 4WLEA 2UDPA 3W2FA 3DLHA 1KFJB 2QRJA 2JFBA 3RR2A 3UMJA 1U5AA 2KBEA 3JWEA 3COPA 4RHFA 3TVYA 5CXQA 3A1WA 2BI8A 2OO5A 2JJMA 1TO6A 4B2LA 4NCJA 1TVKA 4CKEB 3RTEA 3IV9A 4OB7A 5HOEA 1M66A 1W6RA 4ENQA 1DMSA 3PJEA 4FCVA 3NWBA 4MIKA 4ZREA 3GZTB 3UWDA 3WZMA 1B41A 3PP8A 4C3ZA 2C4WA 4JI8B 1J0DA 1OA0A 2CK3D 3RSQA 1R18A 2A57A 2VNHA 5DV9A 4DDVA 1I33A 2FW6A 1OX5A 1Y0BA 1GCGA 3ISJA 2FZGA 4UNQA 5J4LA 1Z5OA 2O0HA 2REXB 3QE2A 2PWPA 2V1XA 2Q9CA 1QYRA 1Z88A 2X2FA 2DQZA 5IJ9A 1P60A 2XUPA 1PX2A 1AKNA 2ZANA 1C4KA 4Z86A 3ET4A 3GT7A 2VFAA 1HE5A 1KEPA 4NRDA 1BXGA 2JI9A 3AR8A 3ONNA 5KC8A 1NJGA 1XU7A 1TZJA 5BSEA 3V9AA 2YOFA 4NU0A 1D1SA 3HG7A 3K9FC 4C4RA 2H2AA 2IYAA 2VR1A 2DWCA 5CAEB 2IELA 4WFKA 1QTNA 1T5SA 1A2OA 3CUTA 5LBTA 3HDGA 3GPLA 4BMXA 2NACA 1SRRA 4MHSA 5JISA 3SD7A 5J3JA 1ILWA 2QF7A 3C1OA 3FKJA 4V39A 1TPZA 2VH1A 3TZ6A 4EM6A 1DPGA 2JKZA 2M98A 2R6DA 2RG1A 5DYGA 4Z2AA 2PYDA 1K75A 4Z8XA 1OFUX 1ISIA 1IY0A 3TLEA 1RE0A 1TTHA 1E1KA 1GGEA 3SLGA 1R0YA 1G8JA 3DAYA 1F2VA 4MW7A 1EMDA 2IXGA 2D00A 4G8DA 1K1EA 1M1XB 4MXDA 3JASB 4A82A 5AJWA 4RDHA 5G2OA 3FTFA 3FVRA 1T5OA 3F9RA 5EWJA 4LFCB 4UQPA 1A7JA 1N0WA 1BKYA 3CRNA 1U9IC 1WSAA 2IUYA 3JQFA 3O75A 1ZZGA 4ZV9A 1R10A 2ICAA 3K0FA 1PHPA 1MJ5A 4KNYA 4O2AB 3R5SA 5DHAA 1ZJ4A 4G4JA 4IG4A 4NCBA 1DO2A 3BXFA 4LHYA 5SYMA 1NJSA 3IDZA 3AY6A 4AC9A 2HA4A 3JRNA 3MJTA 2JBHA 4LXUA 1YR9A 1P1CA 3R8FA 1S01A 1Z39A 2AD1A 1JA1A 1E2HA 3KQVA 2W2OA 1U8FO 1KO7A 5FD8A 3SNKA 5L40A 4O2BB 3SEAA 3LO5A 3SYRA 4BNLA 4B7ZA 2ECQA 4ZKDA 4GX2A 2HHHB 2HF8A 4YAKA 1NW6A 4TZTA 3A7DA 5TJHA 2POCA 1NSTA 4QOFA 1ZYUA 4BNDA 2QD1A 5G53C 2QQEA 1EXDA 4RWEA 2Y1DA 2WMYA 1FNMA 1EFTA 5I7SA 2X5KO 1LLCA 4B4WA 4MEBA 4EW3A 3EMBA 4F0JA 5J47A 2IHNA 1W5BA 2OC4A 1N57A 1GYRA 3GB9A 2C5SA 2VJPA 3GD5A 5G0SA 3GVXA 3AEUB 3OC0A 4EZIA 3L8FA 2GFIA 4GLBA 3AEXA 3NJ8A 2ZTUA 4RHUA 2G4CA 2YHIA 4DFDA 4TKUB 5ETJA 3AR7A 4KYVA 1YCDA 3Q3JB 3R3YA 2PL5A 4P84A 2CLEB 2YZKA 3QTLA 1P29A 4DIFA 2B94A 4AVYA 3GFFA 1O0SA 1AKTA 1ZN9A 2Z8YA 1PIWA 5E7QA 2DT5A 4HNQA 1QFXA 1LZLA 3F6RA 1A8UA 2H4FA 5IAGA 2PD3A 3L7KA 1JS1X 1DBIA 3DZJA 1XWWA 4F3TA 2CE2X 6LDHA 1HTTA 2W2QA 4DNFA 5H0IA 2W98A 4FOSA 4K3UA 4EHIA 3V8PA 4GPD1 2DFPA 1EXWA 5H9WA 2ZUEA 1GGMA 3QEAZ 3PXDA 4R98A 4IJUA 4J07A 1RJGA 5HVNA 2ZULA 4NOLA 5KNBD 1SM4A 2I8CA 2PRKA 3L8GA 2Q50A 1VHWA 2FLKA 2UUAB 1C8VB 5LFAA 4II7A 2JK0A 2SICE 5F9FA 2GBFA 4TS9A 4M0CA 3WMFA 3M1LA 2QJWA 2R7NA 4KQFA 4WXPA 5G40A 3FDXA 4H7IA 4YQYA 1GSHA 3FNRA 5HA5A 1BQ4A 1K6MA 4LZAA 3NHBA 3FHLA 1R3UA 1A9OA 5FBZA 3GEGA 1R8XA 1FRQA 3T4EA 4GGPA 4EJSB 4DXDA 1LW6E 1UBEA 1TAQA 2PMDA 4M8IA 3ZI0A 2HGZA 4PAOA 4BFUA 2ONZA 2CL6X 5TE9A 2Y93A 1VHDA 4LSWA 4OQ4A 3F6EX 4M8NE 5EP3A 1NY5A 3I5MA 2JRCA 3EVCA 4QYIA 3KKLA 1XRNA 1M2WA 3WYEA 1Y82A 1M2KA 1H0KA 2ZWMA 3QKIA 2AF4C 3BCRA 3W3AD 2Q28A 1GNSA 2D4AA 2G83A 1CG6A 3FMVA 5B2ZA 4M7OA 3RNOA 3D3QA 2IQ5A 3NT4A 3R3ZA 2ZSKA 5EXTA 1GXSB 2HYDA 5T64A 3ZDQA 5EJ9A 3KQHA 1R9GA 1WBBA 1ZBDA 4QBFA 2GPYA 4R7GA 3U3XA 2H65A 4LGMA 1BNCA 2DAPA 1CRLA 5EKTA 4MYRA 3ZCQA 1YS2X 1F7UA 4JL5A 4GVPA 3R0VA 2VTVA 4NONA 4ND2A 3TXYA 4FCTA 4Z7QB 1ONNA 3U0VA 3SKYA 2QTFA 1UKYA 4Q18A 1JG3A 4FLFA 3KVOA 2CNLA 1PK9A 1IC6A 3F3KA 2MMGA 1U0LA 1UXOA 1P44A 2EEPA 3UY4A 1OXKB 4GPZA 5J2TF 1F3LA 2HM7A 1CT9A 3FPEA 3WI7A 1OBOA 2VTEA 1JLKA 2RHTA 1ECJA 1GUDA 1YOBA 3BCUA 4WK0B 2AI1A 4CF4A 4EVRA 5JAZA 1T6NA 3ZWNA 2FMIA 1M8JA 1NFFA 1DARA 3LVBA 4RYLA 1E1NA 1J1ZA 4ZYYA 1E79A 1T8PA 3TI7A 2FPGA 3L4EA 1IRXA 4WFIA 1KO8A 1UQTA 3CRVA 4CTKA 1XQWA 3IOBA 2BGTA 1QB7A 1SN7A 2FEKA 2EHJA 3IA2A 1P3Y1 4GYWA 1Y4SA 3VX3A 2RMKA 2C84A 4C4TA 2JJ2A 3CZRA 1G8GA 4M1MA 1FQWA 4QPCA 1XF1A 2FK7A 3QPCA 4HD8A 4Q37A 3RBAA 3RTCA 5B1HA 2C7RA 1YNSA 5HRAA 1E2MA 4JQZA 2J3LA 1JSXA 2VP4A 1ZICA 1QQTA 2EG9A 2HBZA 2QY9A 2H6EA 1JHXA 4EI2A 1TTPB 2VUUA 2XA9A 5ICMA 4HVCA 4C4XA 2PSDA 1ZIYA 3L8MA 4G5GA 3IEIA 3NYRA 5EE3A 3GDOA 5CVDA 3MW8A 1FF9A 4REQB 3ZBPA 4BVBA 1F06A 2AQIA 1IPHA 4HYTA 1OI7A 3IEVA 4BNZA 3OX2A 3P2MA 2QMYA 2XDAA 1X42A 4LC0A 2B4RO 3VISA 3B1XA 3KXPA 4Q4JA 1WHSA 1M2JA 3L77A 5JCXA 5CFNA 2Z95A 4TTJA 3U4AA 7AT1A 2LV8A 4ZAGA 3OE1A 3TPCA 2N1MA 2JANA 4UM8B 4BWYA 1T2EA 5CDTA 1A9XA 3EXAA 3IAS6 2BCEA 4P3KA 1N5MA 4KTTE 2Y2UA 4Q03A 2V0CA 5B58T 1BHJA 5CBPA 4GNKA 2J6BA 1GL7A 2VC2B 3PVSA 3KFLA 2PCLA 1IUOA 3EOBI 2OTCA 1GKLA 1W5TA 2HMAA 3DDCA 5F21A 3ZI7A 3DOCA 4C6HA 5AW3A 3TGLA 2D74A 3U4MA 4H1VA 4OYYA 2ZGVA 5IKPA 2HWUA 1D07A 3FYUC 5TQ0A 4AXBA 1MA0A 5AM2A 3QLJA 1W4AA 3TLKA 4B47A 4ZXFA 5AKKA 2NUAB 3RAGA 5K0ZA 1XP8A 2YIVX 4GGOA 3FNBA 3NVDA 4XARA 4I9HA 3O8LA 4GMXA 1E9AA 4HBZA 3LYAA 4OMDA 5DBHX 1SHLA 4NULA 4HX9A 5AKYA 3QGMA 4MUFA 2WVHA 3M83A 4WCVA 4CTJA 5JT1A 1SD1A 4DADA 2QRUA 3ZGVA 1HNXB 3ERCA 2VK4A 1SXJC 4Z0NA 3BQ9A 4J0IA 3L1KA 5AHRA 3VYUB 2QTHA 2G28A 3CIOA