2HE0A

Crystal structure of a human notch1 ankyrin domain mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
HNQTDRTGATALHLAAAYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a human Notch1 ankyrin domain mutant
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Notch1 preproprotein variant
total genus 69
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2he0A00
3V31A 1WDYA 1YCSB 5AQ7A 1K1AA 1IHBA 1UOHA 5EN5D 5EIBE 1BI8B 4LSZE 4G8KA 5AAOA 2AJAA 4DX5D 2F8XK 3AJIA 1D9SA 1K1BA 2B0OE 5HS0A 5ITZF 4OAVB 4YDYA 1SW6A 1N0QA 2A5EA 4O1OA 2XZTG 3B95A 3W9FA 5EILA 1SVXA 3TWXA 4DRXE 2JABA 4DX2A 4ZHBA 2QC9A 5AN8A 5ENRD 1AP7A 2F37A 2KXPC 5ENTD 4HRMB 2PNNA 4N5QA 3T9KA 3HRAA 3J5QB 3JUEA 4HLLA 5D66A 5ENSD 3V2XA 3D9HA 4K5AB 4O1PA 4DX6D 5KWDA 3NBNB 4GMRA 1MYOA 3JXIA 4QQIA 4HRNA 3B7BA 4NIKA 4JB8P 5AQAA 1BD8A 3T8KA 5JMND 3V79K 2FO1E 1BI7B 3TWRA 3ZKJA 4CZ2D 1BLXB 4U8YD 2RFMA 4HI9A 4BSZB 3AAAC 1A5EA 3Q9NC 5KNHD 5KBAA 2NYJA 3C5RA 3Q9UC 4F1PA 2ZGDA 4HNAD 2DZNA 2F8YA 4K5CA 2DZOA 5EYLA 5CBNA 2KBXA 1IXVA 2XENA 4U96D 1N11A 5CERB 3IXEA 3NOCD 2Y0BG 4HBDA 3ZU7B 4HQDA 5CECB 3EHRA 1YYHA 4Z68A 1NFIE 2XEHA 3F6QA 5ENQD 1G3NB 4GPMA 5AQ9A 1YMPA 3TWUA 5BXOA 5HKPA 4QFVA 3DEPA 5EIDA 2ZGGA 4HI8A 2DWZA 2ETBA 3ZUVB 2VGEA 3JXJA 1QYMA 4LNUD 4OAUC 5FIOA 2MYOA 4LG6A 3TWWA 3EU9A 3KEAA 4YDWA 4UUCA 4J8YA 5ENPD 3LJNA 3TWVA 5CEAA 1MJ0A 4F6RD 4DX7D 3W9GA 3J5PA 1MX2A 5CBOA 3NOGD 5EYPF 4RLYA 5AARA 4BESA 2XZDG 5FINA 3EHQA 4U95D 5KNGA 4O60A 4HRLA 2ETCA 4TUMA 5BXUA 1TR4A 3DEOA 4DX1A 1BU9A 1IKND 5JA4D 2DVWA 4BEPA 2BKGA 4C48B 4J7WA 4K5BA 1WG0A 2P2CP 1K3ZD 2HE0A 2V4HC 4G8LA 5ENOD 1DCQA 5CEDB 4B93B 2ETAA 5HRYA 4A63B 4DUIA 1OY3D 4BERA 3TWQA 1S70B 4U8VD 4CYMD 1DC2A 3UXGA 3TWTA 3V2OA 3SO8A 1MX6A 3V30A 1MX4A 2BKKB 2RFAA 3TWSA 4ATZD 2V5QC 4BETA 2XEEA 5AQBA 2J8SD 1N0RA 1OT8A 3HG0D 3UI2A 2Y1LE 3UTMA 4ZFHA 2L6BA 1AWCB 4HB5A 2QYJA 3ZNGA
chains in the Genus database with same CATH superfamily
3C3QA 4GTTA 1YCSB 3Q7AA 2I6HA 5D2MC 4DLQA 4I1AA 4U63A 4HOQA 2HYZA 1SVXA 1SA5A 5AN8A 4IULA 5KJKA 3L54A 1H2VC 3QWWA 3GYZA 5AQAA 4DJAA 5G05C 1A5EA 5KNHD 4YVQC 4HNAD 2QFCA 3PE4A 4W9RA 1HS6A 2V4LA 1N9AA 4UQZA 3ZYQA 5G05J 3DXKG 4UI9K 2L0IA 4DI3A 3F6QA 1YMPA 3IKOB 3E30A 1QYMA 2LAHA 4N2QA 5J90A 4N5CA 3ML9A 3VLEA 4BX8A 3TWVA 2GRPB 5KJMA 4FJZA 3UIOC 4WNFA 3DSVA 4L1BA 4A3TA 4AEZC 4I1MA 4TXQA 2H6FA 3CK7A 4TUMA 1Z3YA 2R5SA 5FQ7A 5LP0A 3ABKE 1N54A 5BW8C 3RK6A 1H0AA 2V4HC 2VSOE 2V8SE 3BEEA 4G8LA 1LF8A 3X2QE 1PY1A 4ILHB 3FDHA 3TWQA 5G04C 2ZU6B 2XS1A 4RG6A 3PVLA 4HFGA 3V30A 3Q79A 3RJVA 3TWSA 4FA6A 3ZPJA 2J8SD 4BTAA 3CKCA 1XGWA 3MX3A 4HB5A 3ZHEB 2WXOA 1JPLA 1NZNA 2GRLA 5ITZF 1AP7A 1SZAA 3QNKA 4IRUA 4F3VA 5D66A 4AY5A 5KJLA 2LSVA 4B8AA 3CVLA 2DBAA 3PZ1A 1EDUA 2XPZA 2OCCE 2XCCA 4GZ3A 2WXPA 3RO2A 3MCXA 3UM0A 1W3BA 4C0EA 1NA3A 3Q9NC 4CT4A 4PDXA 1O1SA 3U9WA 4KVOA 3CKBA 3S7JA 3NOCD 4HBDA 4HQDA 3S7DA 3WG7E 2FEZA 2F0YA 5ENQD 3TWUA 3MGBA 1GW6A 4OAUC 2M63A 3EU9A 3EIJA 3SZ7A 4TUUA 4J8YA 3B7RL 4FADA 2WXKA 4LEUA 3NOGD 2IQCA 4GCNA 4WAFA 4O60A 2A5UA 3DPDA 3QWPA 4B94A 3ABME 1HE8A 2PL2A 4FLHA 4J7WA 4RQIA 3UX4A 2WQHA 5T4YA 1E8ZA 4FP7A 5E75A 3B7UX 4PS7A 3D9JA 3FTYA 4A1SA 1Z6TA 2X6KA 1S64A 1Q2ZA 2J09A 5EIBE 2Y3AA 3DSTA 4DX5D 4JEHA 3LDZA 1SW6A 3W9FA 1TNZA 4U04A 3L08A 2F37A 3PNTB 1MHQA 4WNDA 3AG1E 4GTMA 2C0LA 3NZUA 1BI7B 4HS2A 2Q7FA 1HG2A 2I1KA 4F1PA 4KYOB 2F8YA 1DNPA 2KBXA 4YVOA 4FU3A 4JHKA 4NRHB 5CECB 3U4TA 1QBQA 2WXFA 1V55E 4UWFA 4I6EA 4F7AA 4IYPA 3NB2A 3FULA 3FUHA 4GTOA 2GRNB 4HVBA 3CSTA 4RLYA 2H6HA 3EHQA 4GAAA 4G26A 3I4RB 5AJDA 3HDXA 3DEOA 4OVVA 3PREA 3Q78A 2L0TB 4A63B 5HRYA 2HO1A 3APDA 3DSSA 3SO8A 1MX6A 1HG5A 3HXDA 2KZTB 2RFAA 3ESKA 3GZ1A 2V5QC 3D9PA 4ZFHA 5AQ7A 3PZ3A 3CIAA 1E90A 3DRAA 5FQ4A 2XHEA 2LUHA 2J49A 3ZVVA 3MEKA 5CCLA 4XE0A 4L2LA 4DX6D 5A6CA 2ZISA 3FH7A 3QK0A 1E96B 4AXHA 3GZ2A 3TXNA 4GA1A 4UWLA 5EX3A 3TJPA 3MV2B 4L23A 5CBNA 1IXVA 3B13A 3ZU7B 2WXNA 3D9MA 4GPMA 3UKUG 5FJYA 2WXGA 2CHZA 3UM3A 1HH8A 4MBGA 2Y4UA 3QAQA 4FHJA 3NQPA 4AV7A 2AWIA 3CSFA 5AARA 2NSZA 4JA9A 2KM4A 1E7UA 3R9MA 5A23A 1ZBPA 3NZSA 3D9OA 4GA2A 3G2TA 1WG0A 3ZXPA 1UW4B 3MYVA 1SZ9A 2BTDA 4DUIA 1S70B 4DLOA 4CYMD 3HXBA 4R7LA 3QKYA 3UTMA 5AYWD 2WPVA 1K1AA 4I43A 2XGOA 4NURA 4JW1A 2WXQA 3CVQA 2X6JA 3B95A 3Q7FA 3CVNA 2XRYA 1TJCA 2KXPC 3CHQA 2PNNA 1D8EA 3HRAA 3J5QB 3LY8A 2V0PA 3ZYLA 4LUNU 4EZJA 3FU0A 2R2LA 2FO1E 2LXLA 3IBEA 2HR2A 3SBTB 3PDNA 3O48A 2C0MA 4EHMA 3Q9UC 1JWGA 3UQ3A 3ASFA 2Y0BG 2RKKA 2IONA 2IFUA 3ASHA 1YYHA 3RIBA 1OCRE 3HXCA 4XEIG 1YA0A 3DEPA 3FWVA 1KZPA 2VJ8A 3UIPC 4ATGA 4ANXA 3VLFA 3CVWA 1P5QA 3D9LA 3FTUA 1KT1A 3U64A 3G2VA 3CVXA 5BPPA 2P9UG 4H7XA 2IEJA 2R03A 1FVHA 3E4BA 2KZTA 2P2CP 4WWNA 4Q69A 4B93B 4EBAG 3APFA 4BERA 3UUXA 2LO6A 3AG3E 1DC2A 5ANRA 3CHMA 2WQ6A 4JHRA 4CT0A 2J4DA 1HFAA 3HG0D 4V3IA 2DIWA 3PH0C 4HOSA 5CRUA 1H6KA 3PNLB 3FUEA 4OAVB 2IU1A 2XZTG 3FUMA 1V54E 1A17A 5C2YA 2WM9A 4KT6B 4N5QA 4AJWA 4HLLA 1JWFA 3V2XA 3LY7A 2WXRA 5D0QD 5CMYA 1BD8A 5JMND 2RFMA 4XX5A 2FO7A 4A3VA 4FC8A 4DK5A 1N11A 2XPYA 5C1DA 3PEVB 2IOLA 4N3CA 4EZLA 4XI0A 3C98A 3KD7A 5EIDA 1OUVA 5AJLA 2HM8A 2VGEA 1SQMA 4PUCA 2H6IA 2WMOA 4FULA 2XRZA 3W9GA 4C9BB 5CBOA 3C72A 1DVPA 2XGMA 3UKRG 3D9NA 4NQ0A 3FTSA 5JA4D 3DXMG 4U07A 4C48B 1H6OA 1U2VG 3SFZA 3HHMA 4GYWA 5G2NA 4JL0A 1E7VA 1FT1A 3L6AA 4BSXA 3RO3A 3U66A 4M3OA 3OXGA 4ILGA 2J07A 3V31A 1B89A 2LSUA 4EZKA 5EN5D 3DSXA 1BI8B 2Y4TA 4G8KA 1KLXA 1IHGA 1K1BA 4GMLA 3SHFA 3JUIA 1N0QA 4GTQA 4G24A 5LFAA 3JUEA 3T5XA 4OVUA 3Q47B 4I17A 3CHRA 1E8YA 1QQEA 3OXLA 3E33A 3AAAC 2AXVA 3BG0B 1LTXA 2ZGDA 3CK8A 3CR3A 2XENA 4U0UA 5CRVA 3AU5A 3CHOA 3LY9A 2ZGGA 4AM9A 4BY6A 2CFZA 3FTZA 4KXKB 4F6RD 2PM7A 2XCBA 5EYPF 3QARA 4BESA 3MA5A 4G25A 4AP2A 2VYIA 2ETCA 4KMOA 4GYOA 3I4GA 3LJ3A 4DPRA 1FT2A 2VGYA 1FCHA 2QYUA 3VTXA 4OYSA 3PS6A 4TV3A 4YNDA 1WY6A 1Z5SC 4URKA 2Y1LE 2KCLA 5JJ6A 1WDYA 1UOHA 4UWGA 3FFLA 1H19A 3D3MA 2A5EA 3HXEA 3T5VA 5FZRA 3I3NA 3G2SA 1UN8A 3ULYA 4UWHA 4KZCA 5T3RA 1X5BA 4HLEA 4GMRA 2KCKA 4QQIA 2MOWA 3TWRA 5B1BE 4BSZB 3EU5A 3ZXSA 3SGHA 4BFRA 2ZIRA 2DZOA 2UY1B 3ONKA 4U7EB 4K03A 3HYMB 2OOEA 2FBNA 3SD5A 3GW4A 3DPYA 4QFVA 4JA7A 1IYGA 4NACA 1OCOE 4KVMA 3L13A 3FUNA 2GW1A 2XPIA 3KAEA 4WUYA 3RRMB 1VDYA 2IY0C 5JJTA 3ULEG 4HRLA 3DSWA 4M7CA 4Q94A 4GMJA 3ZGQA 4B89A 3E34A 4MS6A 3BUAA 5LOZA 4ATZD 3UINC 3RRUA 2XEEA 2WXJA 4I6JA 4J0UA 1HZ4A 3OTNA 3CGHA 3MV3B 2VGXB 3ASNE 2WMNA 3AS4A 3G2WA 5DBKA 4YDYA 1H2TC 1TEZA 2QY7A 2ILRA 4AY6A 3PRZA 2KATA 1NL4A 4HRMB 2X6IA 2I9CA 2C2LA 4UI9C 3B7BA 4NIKA 1OWNA 2B6CA 2R05A 4GZDA 3C3OA 3PE3A 3S2AA 4ANVA 4BT8A 4CDMA 4XI9A 3FH8A 5KBAA 2NYJA 1O5MA 4J8FA 2R59A 3SI5A 2EIKE 3CQCB 4UWKA 4G1TA 3BU8A 1UJJA 2XEHA 3FP3A 2J08A 4Q96A 2CFUA 5BV0A 1KZOA 4XZ4A 3SFYA 4LNBA 4LERA 3QDNA 1O1RA 4YDWA 2Y69E 3FTXA 3FHEA 1O1TA 4GB9A 5FT9A 2GRRB 3ESLA 2DVWA 4BEPA 2UWJG 5H7PA 2EINE 5AIJA 3FUKA 5FQ8A 1EYHA 4HOUA 4BWRA 3QJZA 2BF0X 3TXMA 4EBAA 3D9KA 4P29A 3TWTA 3L17A 5A7DB 5AQBA 4D10C 1OT8A 4CCAA 2DCPA 2QYJA 2AVPA 2GRQB 3UM1A 1NP7A 5BV1A 3JQ0A 2F8XK 4FHKA 1FPPA 3SNXA 5BT1A 1N94A 4TXRA 4HOTA 4L9PA 4ZHBA 3PUKA 2ZXWE 3U3WA 3TL5A 4UI9J 3ULQA 4KBQA 1EPUA 3EIQC 1U3CA 3CVYA 4B8CB 1MYOA 2VTBB 1U3DA 4G23A 3UT4A 4BT9A 2VSNA 3T8KA 2UY1A 3ZKJA 3RSEG 4GZ5A 3RU0A 2X6HA 3CV0A 4GA0A 1ZU2A 3LVRE 4CDNA 2LAIA 5G04J 3FUIA 5CERB 3I5PA 1H6PA 5HQ8A 5M72A 2AXZA 4I9CA 5AQ9A 3AG4E 4GTSA 2QZAA 5T8IA 2FF4A 1JCQA 2H6GA 3JXJA 2YINA 2NXPA 3B7SA 3FEXA 4RVBA 5CMWA 3Q49B 5ENPD 4J8DA 3SFXA 2EQXA 3AS8A 3O4ZA 3TAXA 1TN6A 3EHMA 2MRIA 1TR4A 3SBSA 2PQNA 3PUJA 3AG2E 1E8WA 5CEDB 1Y8MA 3ASOE 1SA4A 1OY3D 3GZSA 4CGWA 3ABLE 2KCVA 3V2OA 3EUVA 3FU5A 4L7TA 2L6JA 2OVBA 1QZ2A 3CEQA 1AWCB 3ZNGA 2E2EA 5J08A 3OAWA 4I2ZA 4GPKA 2AJAA 4J6IA 2YNQA 5EX0A 1KPSB 4J8EA 4I9EA 3ZFWA 4ME2A 3ASDA 4GTVA 3FU3A 3Q73A 4WNEA 4GZCA 2QC9A 2E0IA 5JHBA 4YDEA 2EIME 3Q4AB 2IO2C 3T9KA 3PZ4A 5KWDA 4AIFA 3D9IA 4JZYA 4N3BA 3PZ2A 3APCA 3LEWA 4MLPA 3FH5A 3ISMC 4APOA 2IJGX 1HF8A 3FUDA 1N52A 2VSXE 3ASGA 3ZEFA 3ZYMA 1NFIE 1PC2A 2XGSA 1NA0A 5HKPA 2YQ8A 1HXIA 5D0OD 4HI8A 5HI7A 1OWPA 4ACKA 5B1AE 3ZW3A 1XNFA 3QWVA 4CDRA 2P9NG 4ACLA 3UM2A 3EJNA 2XZDG 3CLJA 4XKCA 1MZCA 2P58C 4F1SA 5AENA 4WWPA 3L9TA 1BU9A 1Z3XA 2BKGA 1K3ZD 2HE0A 4WWOA 2LNIA 3ZN3A 4JPSA 3EDTB 3WXXA 4JEUA 4ANUA 1LD8A 2BKKB 4DI4A 4N2SA 5KCMA 3QB2A 2IO3C 2V5FA 1IQUA 4I1OB 1INZA 3MKQB 3AJIA 3Q75A 3EHNA 1L5JA 3ENEA 2IOSA 4MKTA 2JABA 4DX2A 1UG3A 2J4BA 2FULA 3MZLB 3NF1A 3PZDA 4Y6CA 3SY2A 2A4ZA 3JXIA 3QOUA 3URZA 4U0SA 4JB8P 4A1GA 1BPOA 4CZ2D 5BUZA 4HI9A 4E85A 3CQGB 5CCMA 2ONDA 2VTBA 1KT0A 4RG9A 3N71A 4U96D 3E37A 3JQ1A 2DYSE 4JD2G 2X3MA 1G3NB 1X81A 4ABNA 2WXMA 4E6HA 3LCAA 2I2OA 3JCKC 3KEAA 5LCWJ 3BG1B 1UJKA 1S63A 4DX7D 3KEZA 1MX2A 1N4PA 2P9IG 3LS8A 2OEVA 5IY5E 3R9AB 3ZRHA 3QC1A 2ETAA 3K9IA 4U8VD 2VSYA 1WAO1 3MJWA 4LCTA 4Y6WA 4C0MA 3C3RA 4XKBA 2L6BA 1IHBA 1PAQA 5AAOA 5FZQA 5HS0A 4N3AA 4K0RA 4GTPA 3LVQE 4DRXE 3TWXA 3ML8A 4LRZA 5ENRD 3DBSA 4MRUA 2XEVA 3AU4A 1HU3A 3D9HA 5CHEE 2WB2A 2WXHA 4HORA 3NAWA 3V79K 4AVXA 1BLXB 1IQRA 4BX9A 2JLBA 2XS8A 3B7TA 5G55A 1ELRA 4I2WA 1OWOA 4EQFA 2R17C 2OV8A 3P2BA 3LKUA 1TNYA 2P9PG 5BXOA 3CHSA 4CGVA 4LNUD 1DCEA 4RSYA 3L22A 1TN8A 3DSUA 3LYAA 3IEGA 2P9LG 1TN7A 2X6FA 1ELWA 3CVUA 1RW2A 2IF4A 5JHAA 4BTBA 4DX1A 2VQ2A 2KC7A 2R02A 4K5BA 5ENOD 3HVEA 3PEUB 3VTYA 4G2VA 3MKQA 1N0RA 3CVPA 4TXPA 1N95A 4B0ZA 2WXIA 2B0OE 2GROB 4PS8A 1H2UA 4ILIA 1S0PA 3UPVA 4K5AB 5FQ6A 2WVIA 4UQYA 3OXFA 3HXFA 4HRNA 2CHWA 3KS2A 4WNGA 3KSLA 3RRNB 3FY4A 2MHKA 2DZNA 3AS5A 5EYLA 2PZIA 3IXEA 4X8QA 3RKVA 1OWLA 3FTVA 4FLBA 1OWMA 1Y6IA 3FEYA 1TYQG 1TJFA 3TWWA 4UUCA 1HX8A 4PS3A 5CEAA 5FINA 1MQSA 3G2UA 5BXUA 5JJ7A 1IKND 1UN9A 2AW6A 4A55A 3TG5A 1DCQA 1TNUA 2XQ0A 4FJYA 3R7QA 5FTPA 2PM6A 5B3SE 3ONLA 4JC8A 2GRMA 3IHYA 4LNGA 1D9SA 2CG2A 1D8DA 2YHEA 5BNWA 2FI7A 2J9QA 5ENTD 1ZB1A 2YHCA 3S7BA 4U8HA 4O1PA 2GGFA 5ENNA 3MKRA 3Q5MA 1E8XA 4L2YA 1NI1A 3CK9A 4U8YD 5LX8A 4K5CA 4I6GA 2RD0A 1N4QA 2RG8A 2EILE 3EHRA 5FZSA 4Z68A 4PH4B 3FUFA 1TNBA 4GYYA 5ARFA 2DWZA 2PQRA 4GZ6A 3SQVA 4GU5A 5FIOA 2MYOA 1HO8A 3LJNA 3J5PA 1K8KG 4GTRA 4H7YA 1JUQA 1N4RA 1WM5A 3Q15A 5LCWC 4G11A 4U95D 5KNGA 3FUJA 3HVEB 3SF4A 3ZIMA 5FWQA 2VGXA 4XIFA 4CRWA 4YDOA 3FU6A 2I1JA 2P9SG 2BEDA 4BETA 2WQ7A 1ELKA 3LPZA 3UT8A 3FTWA 3TG4A 3UI2A 2BUGA 3BQOA 3E32A 3ZYKA 4LSZE 4UQXA 4O1OA 5EILA 1OXJA 3VLDA 4O6FA 1TNOA 3UMVA 2JEKA 4CEMA 4JVSA 5ENSD 5EKQD 3NBNB 3L82A 2L9BA 4U0ZA 2OVFA 4AOFA 5DIZA 4IN3B 3IV0A 4F53A 4J8SA 1JCSA 3R7RA 3CHPA 2DYRE 3C5RA 3S7FA 1JCRA 4TRQA 4EECA 1RZ4A 5EDSA 3LXUX 4EPZA 5ANLA 1FVFA 5E76A 1N4SA 3KSQA 2ETBA 4HXIA 3RAUA 3ZUVB 2WXLA 2CHXA 4LG6A 3L16A 2X38A 3JYSA 2P9KG 1MJ0A 4ANWA 4JHJA 2EIJE 3CVVA 3ZHEA 2CG3A 4JXTA 1EF1C 5KJNA 2AXUA 1OCCE 4KZ0A 3HIZA 3T8MA 3DWLG 3UT7A 2OEWA 1LD7A 3TGOA 1QNFA 2NC9A 3UXGA 4GCOA 1MX4A 1OCZE 2LXMA 4APFA 4N39A 3IHVA 5ARGA 3P1UA
chains in the Genus database with same CATH topology
3V31A 1WDYA 1YCSB 5AQ7A 1K1AA 1IHBA 1UOHA 5EN5D 5EIBE 1BI8B 4LSZE 4G8KA 5AAOA 2AJAA 4DX5D 2F8XK 3AJIA 1D9SA 1K1BA 2B0OE 5HS0A 5ITZF 4OAVB 4YDYA 1SW6A 1N0QA 2A5EA 4O1OA 2XZTG 3B95A 3W9FA 5EILA 1SVXA 3TWXA 4DRXE 2JABA 4DX2A 4ZHBA 2QC9A 5AN8A 5ENRD 1AP7A 2F37A 2KXPC 5ENTD 4HRMB 2PNNA 4N5QA 3T9KA 3HRAA 3J5QB 3JUEA 4HLLA 5D66A 5ENSD 3V2XA 3D9HA 4K5AB 4O1PA 4DX6D 5KWDA 3NBNB 4GMRA 1MYOA 3JXIA 4QQIA 4HRNA 3B7BA 4NIKA 4JB8P 5AQAA 1BD8A 3T8KA 5JMND 3V79K 2FO1E 1BI7B 3TWRA 3ZKJA 4CZ2D 1BLXB 4U8YD 2RFMA 4HI9A 4BSZB 3AAAC 1A5EA 3Q9NC 5KNHD 5KBAA 2NYJA 3C5RA 3Q9UC 4F1PA 2ZGDA 4HNAD 2DZNA 2F8YA 4K5CA 2DZOA 5EYLA 5CBNA 2KBXA 1IXVA 2XENA 4U96D 1N11A 5CERB 3IXEA 3NOCD 2Y0BG 4HBDA 3ZU7B 4HQDA 5CECB 3EHRA 1YYHA 4Z68A 1NFIE 2XEHA 3F6QA 5ENQD 1G3NB 4GPMA 5AQ9A 1YMPA 3TWUA 5BXOA 5HKPA 4QFVA 3DEPA 5EIDA 2ZGGA 4HI8A 2DWZA 2ETBA 3ZUVB 2VGEA 3JXJA 1QYMA 4LNUD 4OAUC 5FIOA 2MYOA 4LG6A 3TWWA 3EU9A 3KEAA 4YDWA 4UUCA 4J8YA 5ENPD 3LJNA 3TWVA 5CEAA 1MJ0A 4F6RD 4DX7D 3W9GA 3J5PA 1MX2A 5CBOA 3NOGD 5EYPF 4RLYA 5AARA 4BESA 2XZDG 5FINA 3EHQA 4U95D 5KNGA 4O60A 4HRLA 2ETCA 4TUMA 5BXUA 1TR4A 3DEOA 4DX1A 1BU9A 1IKND 5JA4D 2DVWA 4BEPA 2BKGA 4C48B 4J7WA 4K5BA 1WG0A 2P2CP 1K3ZD 2HE0A 2V4HC 4G8LA 5ENOD 1DCQA 5CEDB 4B93B 2ETAA 5HRYA 4A63B 4DUIA 1OY3D 4BERA 3TWQA 1S70B 4U8VD 4CYMD 1DC2A 3UXGA 3TWTA 3V2OA 3SO8A 1MX6A 3V30A 1MX4A 2BKKB 2RFAA 3TWSA 4ATZD 2V5QC 4BETA 2XEEA 5AQBA 2J8SD 1N0RA 1OT8A 3HG0D 3UI2A 2Y1LE 3UTMA 4ZFHA 2L6BA 1AWCB 4HB5A 2QYJA 3ZNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V31 A;  1WDY A;  1YCS B;  5AQ7 A;  1K1A A;  1IHB A;  1UOH A;  5EN5 D;  5EIB E;  1BI8 B;  4LSZ E;  4G8K A;  5AAO A;  2AJA A;  4DX5 D;  2F8X K;  3AJI A;  1D9S A;  1K1B A;  2B0O E;  5HS0 A;  5ITZ F;  4OAV B;  4YDY A;  1SW6 A;  1N0Q A;  2A5E A;  4O1O A;  2XZT G;  3B95 A;  3W9F A;  5EIL A;  1SVX A;  3TWX A;  4DRX E;  2JAB A;  4DX2 A;  4ZHB A;  2QC9 A;  5AN8 A;  5ENR D;  1AP7 A;  2F37 A;  2KXP C;  5ENT D;  4HRM B;  2PNN A;  4N5Q A;  3T9K A;  3HRA A;  3J5Q B;  3JUE A;  4HLL A;  5D66 A;  5ENS D;  3V2X A;  3D9H A;  4K5A B;  4O1P A;  4DX6 D;  5KWD A;  3NBN B;  4GMR A;  1MYO A;  3JXI A;  4QQI A;  4HRN A;  3B7B A;  4NIK A;  4JB8 P;  5AQA A;  1BD8 A;  3T8K A;  5JMN D;  3V79 K;  2FO1 E;  1BI7 B;  3TWR A;  3ZKJ A;  4CZ2 D;  1BLX B;  4U8Y D;  2RFM A;  4HI9 A;  4BSZ B;  3AAA C;  1A5E A;  3Q9N C;  5KNH D;  5KBA A;  2NYJ A;  3C5R A;  3Q9U C;  4F1P A;  2ZGD A;  4HNA D;  2DZN A;  2F8Y A;  4K5C A;  2DZO A;  5EYL A;  5CBN A;  2KBX A;  1IXV A;  2XEN A;  4U96 D;  1N11 A;  5CER B;  3IXE A;  3NOC D;  2Y0B G;  4HBD A;  3ZU7 B;  4HQD A;  5CEC B;  3EHR A;  1YYH A;  4Z68 A;  1NFI E;  2XEH A;  3F6Q A;  5ENQ D;  1G3N B;  4GPM A;  5AQ9 A;  1YMP A;  3TWU A;  5BXO A;  5HKP A;  4QFV A;  3DEP A;  5EID A;  2ZGG A;  4HI8 A;  2DWZ A;  2ETB A;  3ZUV B;  2VGE A;  3JXJ A;  1QYM A;  4LNU D;  4OAU C;  5FIO A;  2MYO A;  4LG6 A;  3TWW A;  3EU9 A;  3KEA A;  4YDW A;  4UUC A;  4J8Y A;  5ENP D;  3LJN A;  3TWV A;  5CEA A;  1MJ0 A;  4F6R D;  4DX7 D;  3W9G A;  3J5P A;  1MX2 A;  5CBO A;  3NOG D;  5EYP F;  4RLY A;  5AAR A;  4BES A;  2XZD G;  5FIN A;  3EHQ A;  4U95 D;  5KNG A;  4O60 A;  4HRL A;  2ETC A;  4TUM A;  5BXU A;  1TR4 A;  3DEO A;  4DX1 A;  1BU9 A;  1IKN D;  5JA4 D;  2DVW A;  4BEP A;  2BKG A;  4C48 B;  4J7W A;  4K5B A;  1WG0 A;  2P2C P;  1K3Z D;  2HE0 A;  2V4H C;  4G8L A;  5ENO D;  1DCQ A;  5CED B;  4B93 B;  2ETA A;  5HRY A;  4A63 B;  4DUI A;  1OY3 D;  4BER A;  3TWQ A;  1S70 B;  4U8V D;  4CYM D;  1DC2 A;  3UXG A;  3TWT A;  3V2O A;  3SO8 A;  1MX6 A;  3V30 A;  1MX4 A;  2BKK B;  2RFA A;  3TWS A;  4ATZ D;  2V5Q C;  4BET A;  2XEE A;  5AQB A;  2J8S D;  1N0R A;  1OT8 A;  3HG0 D;  3UI2 A;  2Y1L E;  3UTM A;  4ZFH A;  2L6B A;  1AWC B;  4HB5 A;  2QYJ A;  3ZNG A; 
#chains in the Genus database with same CATH topology
 3C3Q A;  4GTT A;  1YCS B;  3Q7A A;  2I6H A;  5D2M C;  4DLQ A;  4I1A A;  4U63 A;  4HOQ A;  2HYZ A;  1SVX A;  1SA5 A;  5AN8 A;  4IUL A;  5KJK A;  3L54 A;  1H2V C;  3QWW A;  3GYZ A;  5AQA A;  4DJA A;  5G05 C;  1A5E A;  5KNH D;  4YVQ C;  4HNA D;  2QFC A;  3PE4 A;  4W9R A;  1HS6 A;  2V4L A;  1N9A A;  4UQZ A;  3ZYQ A;  5G05 J;  3DXK G;  4UI9 K;  2L0I A;  4DI3 A;  3F6Q A;  1YMP A;  3IKO B;  3E30 A;  1QYM A;  2LAH A;  4N2Q A;  5J90 A;  4N5C A;  3ML9 A;  3VLE A;  4BX8 A;  3TWV A;  2GRP B;  5KJM A;  4FJZ A;  3UIO C;  4WNF A;  3DSV A;  4L1B A;  4A3T A;  4AEZ C;  4I1M A;  4TXQ A;  2H6F A;  3CK7 A;  4TUM A;  1Z3Y A;  2R5S A;  5FQ7 A;  5LP0 A;  3ABK E;  1N54 A;  5BW8 C;  3RK6 A;  1H0A A;  2V4H C;  2VSO E;  2V8S E;  3BEE A;  4G8L A;  1LF8 A;  3X2Q E;  1PY1 A;  4ILH B;  3FDH A;  3TWQ A;  5G04 C;  2ZU6 B;  2XS1 A;  4RG6 A;  3PVL A;  4HFG A;  3V30 A;  3Q79 A;  3RJV A;  3TWS A;  4FA6 A;  3ZPJ A;  2J8S D;  4BTA A;  3CKC A;  1XGW A;  3MX3 A;  4HB5 A;  3ZHE B;  2WXO A;  1JPL A;  1NZN A;  2GRL A;  5ITZ F;  1AP7 A;  1SZA A;  3QNK A;  4IRU A;  4F3V A;  5D66 A;  4AY5 A;  5KJL A;  2LSV A;  4B8A A;  3CVL A;  2DBA A;  3PZ1 A;  1EDU A;  2XPZ A;  2OCC E;  2XCC A;  4GZ3 A;  2WXP A;  3RO2 A;  3MCX A;  3UM0 A;  1W3B A;  4C0E A;  1NA3 A;  3Q9N C;  4CT4 A;  4PDX A;  1O1S A;  3U9W A;  4KVO A;  3CKB A;  3S7J A;  3NOC D;  4HBD A;  4HQD A;  3S7D A;  3WG7 E;  2FEZ A;  2F0Y A;  5ENQ D;  3TWU A;  3MGB A;  1GW6 A;  4OAU C;  2M63 A;  3EU9 A;  3EIJ A;  3SZ7 A;  4TUU A;  4J8Y A;  3B7R L;  4FAD A;  2WXK A;  4LEU A;  3NOG D;  2IQC A;  4GCN A;  4WAF A;  4O60 A;  2A5U A;  3DPD A;  3QWP A;  4B94 A;  3ABM E;  1HE8 A;  2PL2 A;  4FLH A;  4J7W A;  4RQI A;  3UX4 A;  2WQH A;  5T4Y A;  1E8Z A;  4FP7 A;  5E75 A;  3B7U X;  4PS7 A;  3D9J A;  3FTY A;  4A1S A;  1Z6T A;  2X6K A;  1S64 A;  1Q2Z A;  2J09 A;  5EIB E;  2Y3A A;  3DST A;  4DX5 D;  4JEH A;  3LDZ A;  1SW6 A;  3W9F A;  1TNZ A;  4U04 A;  3L08 A;  2F37 A;  3PNT B;  1MHQ A;  4WND A;  3AG1 E;  4GTM A;  2C0L A;  3NZU A;  1BI7 B;  4HS2 A;  2Q7F A;  1HG2 A;  2I1K A;  4F1P A;  4KYO B;  2F8Y A;  1DNP A;  2KBX A;  4YVO A;  4FU3 A;  4JHK A;  4NRH B;  5CEC B;  3U4T A;  1QBQ A;  2WXF A;  1V55 E;  4UWF A;  4I6E A;  4F7A A;  4IYP A;  3NB2 A;  3FUL A;  3FUH A;  4GTO A;  2GRN B;  4HVB A;  3CST A;  4RLY A;  2H6H A;  3EHQ A;  4GAA A;  4G26 A;  3I4R B;  5AJD A;  3HDX A;  3DEO A;  4OVV A;  3PRE A;  3Q78 A;  2L0T B;  4A63 B;  5HRY A;  2HO1 A;  3APD A;  3DSS A;  3SO8 A;  1MX6 A;  1HG5 A;  3HXD A;  2KZT B;  2RFA A;  3ESK A;  3GZ1 A;  2V5Q C;  3D9P A;  4ZFH A;  5AQ7 A;  3PZ3 A;  3CIA A;  1E90 A;  3DRA A;  5FQ4 A;  2XHE A;  2LUH A;  2J49 A;  3ZVV A;  3MEK A;  5CCL A;  4XE0 A;  4L2L A;  4DX6 D;  5A6C A;  2ZIS A;  3FH7 A;  3QK0 A;  1E96 B;  4AXH A;  3GZ2 A;  3TXN A;  4GA1 A;  4UWL A;  5EX3 A;  3TJP A;  3MV2 B;  4L23 A;  5CBN A;  1IXV A;  3B13 A;  3ZU7 B;  2WXN A;  3D9M A;  4GPM A;  3UKU G;  5FJY A;  2WXG A;  2CHZ A;  3UM3 A;  1HH8 A;  4MBG A;  2Y4U A;  3QAQ A;  4FHJ A;  3NQP A;  4AV7 A;  2AWI A;  3CSF A;  5AAR A;  2NSZ A;  4JA9 A;  2KM4 A;  1E7U A;  3R9M A;  5A23 A;  1ZBP A;  3NZS A;  3D9O A;  4GA2 A;  3G2T A;  1WG0 A;  3ZXP A;  1UW4 B;  3MYV A;  1SZ9 A;  2BTD A;  4DUI A;  1S70 B;  4DLO A;  4CYM D;  3HXB A;  4R7L A;  3QKY A;  3UTM A;  5AYW D;  2WPV A;  1K1A A;  4I43 A;  2XGO A;  4NUR A;  4JW1 A;  2WXQ A;  3CVQ A;  2X6J A;  3B95 A;  3Q7F A;  3CVN A;  2XRY A;  1TJC A;  2KXP C;  3CHQ A;  2PNN A;  1D8E A;  3HRA A;  3J5Q B;  3LY8 A;  2V0P A;  3ZYL A;  4LUN U;  4EZJ A;  3FU0 A;  2R2L A;  2FO1 E;  2LXL A;  3IBE A;  2HR2 A;  3SBT B;  3PDN A;  3O48 A;  2C0M A;  4EHM A;  3Q9U C;  1JWG A;  3UQ3 A;  3ASF A;  2Y0B G;  2RKK A;  2ION A;  2IFU A;  3ASH A;  1YYH A;  3RIB A;  1OCR E;  3HXC A;  4XEI G;  1YA0 A;  3DEP A;  3FWV A;  1KZP A;  2VJ8 A;  3UIP C;  4ATG A;  4ANX A;  3VLF A;  3CVW A;  1P5Q A;  3D9L A;  3FTU A;  1KT1 A;  3U64 A;  3G2V A;  3CVX A;  5BPP A;  2P9U G;  4H7X A;  2IEJ A;  2R03 A;  1FVH A;  3E4B A;  2KZT A;  2P2C P;  4WWN A;  4Q69 A;  4B93 B;  4EBA G;  3APF A;  4BER A;  3UUX A;  2LO6 A;  3AG3 E;  1DC2 A;  5ANR A;  3CHM A;  2WQ6 A;  4JHR A;  4CT0 A;  2J4D A;  1HFA A;  3HG0 D;  4V3I A;  2DIW A;  3PH0 C;  4HOS A;  5CRU A;  1H6K A;  3PNL B;  3FUE A;  4OAV B;  2IU1 A;  2XZT G;  3FUM A;  1V54 E;  1A17 A;  5C2Y A;  2WM9 A;  4KT6 B;  4N5Q A;  4AJW A;  4HLL A;  1JWF A;  3V2X A;  3LY7 A;  2WXR A;  5D0Q D;  5CMY A;  1BD8 A;  5JMN D;  2RFM A;  4XX5 A;  2FO7 A;  4A3V A;  4FC8 A;  4DK5 A;  1N11 A;  2XPY A;  5C1D A;  3PEV B;  2IOL A;  4N3C A;  4EZL A;  4XI0 A;  3C98 A;  3KD7 A;  5EID A;  1OUV A;  5AJL A;  2HM8 A;  2VGE A;  1SQM A;  4PUC A;  2H6I A;  2WMO A;  4FUL A;  2XRZ A;  3W9G A;  4C9B B;  5CBO A;  3C72 A;  1DVP A;  2XGM A;  3UKR G;  3D9N A;  4NQ0 A;  3FTS A;  5JA4 D;  3DXM G;  4U07 A;  4C48 B;  1H6O A;  1U2V G;  3SFZ A;  3HHM A;  4GYW A;  5G2N A;  4JL0 A;  1E7V A;  1FT1 A;  3L6A A;  4BSX A;  3RO3 A;  3U66 A;  4M3O A;  3OXG A;  4ILG A;  2J07 A;  3V31 A;  1B89 A;  2LSU A;  4EZK A;  5EN5 D;  3DSX A;  1BI8 B;  2Y4T A;  4G8K A;  1KLX A;  1IHG A;  1K1B A;  4GML A;  3SHF A;  3JUI A;  1N0Q A;  4GTQ A;  4G24 A;  5LFA A;  3JUE A;  3T5X A;  4OVU A;  3Q47 B;  4I17 A;  3CHR A;  1E8Y A;  1QQE A;  3OXL A;  3E33 A;  3AAA C;  2AXV A;  3BG0 B;  1LTX A;  2ZGD A;  3CK8 A;  3CR3 A;  2XEN A;  4U0U A;  5CRV A;  3AU5 A;  3CHO A;  3LY9 A;  2ZGG A;  4AM9 A;  4BY6 A;  2CFZ A;  3FTZ A;  4KXK B;  4F6R D;  2PM7 A;  2XCB A;  5EYP F;  3QAR A;  4BES A;  3MA5 A;  4G25 A;  4AP2 A;  2VYI A;  2ETC A;  4KMO A;  4GYO A;  3I4G A;  3LJ3 A;  4DPR A;  1FT2 A;  2VGY A;  1FCH A;  2QYU A;  3VTX A;  4OYS A;  3PS6 A;  4TV3 A;  4YND A;  1WY6 A;  1Z5S C;  4URK A;  2Y1L E;  2KCL A;  5JJ6 A;  1WDY A;  1UOH A;  4UWG A;  3FFL A;  1H19 A;  3D3M A;  2A5E A;  3HXE A;  3T5V A;  5FZR A;  3I3N A;  3G2S A;  1UN8 A;  3ULY A;  4UWH A;  4KZC A;  5T3R A;  1X5B A;  4HLE A;  4GMR A;  2KCK A;  4QQI A;  2MOW A;  3TWR A;  5B1B E;  4BSZ B;  3EU5 A;  3ZXS A;  3SGH A;  4BFR A;  2ZIR A;  2DZO A;  2UY1 B;  3ONK A;  4U7E B;  4K03 A;  3HYM B;  2OOE A;  2FBN A;  3SD5 A;  3GW4 A;  3DPY A;  4QFV A;  4JA7 A;  1IYG A;  4NAC A;  1OCO E;  4KVM A;  3L13 A;  3FUN A;  2GW1 A;  2XPI A;  3KAE A;  4WUY A;  3RRM B;  1VDY A;  2IY0 C;  5JJT A;  3ULE G;  4HRL A;  3DSW A;  4M7C A;  4Q94 A;  4GMJ A;  3ZGQ A;  4B89 A;  3E34 A;  4MS6 A;  3BUA A;  5LOZ A;  4ATZ D;  3UIN C;  3RRU A;  2XEE A;  2WXJ A;  4I6J A;  4J0U A;  1HZ4 A;  3OTN A;  3CGH A;  3MV3 B;  2VGX B;  3ASN E;  2WMN A;  3AS4 A;  3G2W A;  5DBK A;  4YDY A;  1H2T C;  1TEZ A;  2QY7 A;  2ILR A;  4AY6 A;  3PRZ A;  2KAT A;  1NL4 A;  4HRM B;  2X6I A;  2I9C A;  2C2L A;  4UI9 C;  3B7B A;  4NIK A;  1OWN A;  2B6C A;  2R05 A;  4GZD A;  3C3O A;  3PE3 A;  3S2A A;  4ANV A;  4BT8 A;  4CDM A;  4XI9 A;  3FH8 A;  5KBA A;  2NYJ A;  1O5M A;  4J8F A;  2R59 A;  3SI5 A;  2EIK E;  3CQC B;  4UWK A;  4G1T A;  3BU8 A;  1UJJ A;  2XEH A;  3FP3 A;  2J08 A;  4Q96 A;  2CFU A;  5BV0 A;  1KZO A;  4XZ4 A;  3SFY A;  4LNB A;  4LER A;  3QDN A;  1O1R A;  4YDW A;  2Y69 E;  3FTX A;  3FHE A;  1O1T A;  4GB9 A;  5FT9 A;  2GRR B;  3ESL A;  2DVW A;  4BEP A;  2UWJ G;  5H7P A;  2EIN E;  5AIJ A;  3FUK A;  5FQ8 A;  1EYH A;  4HOU A;  4BWR A;  3QJZ A;  2BF0 X;  3TXM A;  4EBA A;  3D9K A;  4P29 A;  3TWT A;  3L17 A;  5A7D B;  5AQB A;  4D10 C;  1OT8 A;  4CCA A;  2DCP A;  2QYJ A;  2AVP A;  2GRQ B;  3UM1 A;  1NP7 A;  5BV1 A;  3JQ0 A;  2F8X K;  4FHK A;  1FPP A;  3SNX A;  5BT1 A;  1N94 A;  4TXR A;  4HOT A;  4L9P A;  4ZHB A;  3PUK A;  2ZXW E;  3U3W A;  3TL5 A;  4UI9 J;  3ULQ A;  4KBQ A;  1EPU A;  3EIQ C;  1U3C A;  3CVY A;  4B8C B;  1MYO A;  2VTB B;  1U3D A;  4G23 A;  3UT4 A;  4BT9 A;  2VSN A;  3T8K A;  2UY1 A;  3ZKJ A;  3RSE G;  4GZ5 A;  3RU0 A;  2X6H A;  3CV0 A;  4GA0 A;  1ZU2 A;  3LVR E;  4CDN A;  2LAI A;  5G04 J;  3FUI A;  5CER B;  3I5P A;  1H6P A;  5HQ8 A;  5M72 A;  2AXZ A;  4I9C A;  5AQ9 A;  3AG4 E;  4GTS A;  2QZA A;  5T8I A;  2FF4 A;  1JCQ A;  2H6G A;  3JXJ A;  2YIN A;  2NXP A;  3B7S A;  3FEX A;  4RVB A;  5CMW A;  3Q49 B;  5ENP D;  4J8D A;  3SFX A;  2EQX A;  3AS8 A;  3O4Z A;  3TAX A;  1TN6 A;  3EHM A;  2MRI A;  1TR4 A;  3SBS A;  2PQN A;  3PUJ A;  3AG2 E;  1E8W A;  5CED B;  1Y8M A;  3ASO E;  1SA4 A;  1OY3 D;  3GZS A;  4CGW A;  3ABL E;  2KCV A;  3V2O A;  3EUV A;  3FU5 A;  4L7T A;  2L6J A;  2OVB A;  1QZ2 A;  3CEQ A;  1AWC B;  3ZNG A;  2E2E A;  5J08 A;  3OAW A;  4I2Z A;  4GPK A;  2AJA A;  4J6I A;  2YNQ A;  5EX0 A;  1KPS B;  4J8E A;  4I9E A;  3ZFW A;  4ME2 A;  3ASD A;  4GTV A;  3FU3 A;  3Q73 A;  4WNE A;  4GZC A;  2QC9 A;  2E0I A;  5JHB A;  4YDE A;  2EIM E;  3Q4A B;  2IO2 C;  3T9K A;  3PZ4 A;  5KWD A;  4AIF A;  3D9I A;  4JZY A;  4N3B A;  3PZ2 A;  3APC A;  3LEW A;  4MLP A;  3FH5 A;  3ISM C;  4APO A;  2IJG X;  1HF8 A;  3FUD A;  1N52 A;  2VSX E;  3ASG A;  3ZEF A;  3ZYM A;  1NFI E;  1PC2 A;  2XGS A;  1NA0 A;  5HKP A;  2YQ8 A;  1HXI A;  5D0O D;  4HI8 A;  5HI7 A;  1OWP A;  4ACK A;  5B1A E;  3ZW3 A;  1XNF A;  3QWV A;  4CDR A;  2P9N G;  4ACL A;  3UM2 A;  3EJN A;  2XZD G;  3CLJ A;  4XKC A;  1MZC A;  2P58 C;  4F1S A;  5AEN A;  4WWP A;  3L9T A;  1BU9 A;  1Z3X A;  2BKG A;  1K3Z D;  2HE0 A;  4WWO A;  2LNI A;  3ZN3 A;  4JPS A;  3EDT B;  3WXX A;  4JEU A;  4ANU A;  1LD8 A;  2BKK B;  4DI4 A;  4N2S A;  5KCM A;  3QB2 A;  2IO3 C;  2V5F A;  1IQU A;  4I1O B;  1INZ A;  3MKQ B;  3AJI A;  3Q75 A;  3EHN A;  1L5J A;  3ENE A;  2IOS A;  4MKT A;  2JAB A;  4DX2 A;  1UG3 A;  2J4B A;  2FUL A;  3MZL B;  3NF1 A;  3PZD A;  4Y6C A;  3SY2 A;  2A4Z A;  3JXI A;  3QOU A;  3URZ A;  4U0S A;  4JB8 P;  4A1G A;  1BPO A;  4CZ2 D;  5BUZ A;  4HI9 A;  4E85 A;  3CQG B;  5CCM A;  2OND A;  2VTB A;  1KT0 A;  4RG9 A;  3N71 A;  4U96 D;  3E37 A;  3JQ1 A;  2DYS E;  4JD2 G;  2X3M A;  1G3N B;  1X81 A;  4ABN A;  2WXM A;  4E6H A;  3LCA A;  2I2O A;  3JCK C;  3KEA A;  5LCW J;  3BG1 B;  1UJK A;  1S63 A;  4DX7 D;  3KEZ A;  1MX2 A;  1N4P A;  2P9I G;  3LS8 A;  2OEV A;  5IY5 E;  3R9A B;  3ZRH A;  3QC1 A;  2ETA A;  3K9I A;  4U8V D;  2VSY A;  1WAO 1;  3MJW A;  4LCT A;  4Y6W A;  4C0M A;  3C3R A;  4XKB A;  2L6B A;  1IHB A;  1PAQ A;  5AAO A;  5FZQ A;  5HS0 A;  4N3A A;  4K0R A;  4GTP A;  3LVQ E;  4DRX E;  3TWX A;  3ML8 A;  4LRZ A;  5ENR D;  3DBS A;  4MRU A;  2XEV A;  3AU4 A;  1HU3 A;  3D9H A;  5CHE E;  2WB2 A;  2WXH A;  4HOR A;  3NAW A;  3V79 K;  4AVX A;  1BLX B;  1IQR A;  4BX9 A;  2JLB A;  2XS8 A;  3B7T A;  5G55 A;  1ELR A;  4I2W A;  1OWO A;  4EQF A;  2R17 C;  2OV8 A;  3P2B A;  3LKU A;  1TNY A;  2P9P G;  5BXO A;  3CHS A;  4CGV A;  4LNU D;  1DCE A;  4RSY A;  3L22 A;  1TN8 A;  3DSU A;  3LYA A;  3IEG A;  2P9L G;  1TN7 A;  2X6F A;  1ELW A;  3CVU A;  1RW2 A;  2IF4 A;  5JHA A;  4BTB A;  4DX1 A;  2VQ2 A;  2KC7 A;  2R02 A;  4K5B A;  5ENO D;  3HVE A;  3PEU B;  3VTY A;  4G2V A;  3MKQ A;  1N0R A;  3CVP A;  4TXP A;  1N95 A;  4B0Z A;  2WXI A;  2B0O E;  2GRO B;  4PS8 A;  1H2U A;  4ILI A;  1S0P A;  3UPV A;  4K5A B;  5FQ6 A;  2WVI A;  4UQY A;  3OXF A;  3HXF A;  4HRN A;  2CHW A;  3KS2 A;  4WNG A;  3KSL A;  3RRN B;  3FY4 A;  2MHK A;  2DZN A;  3AS5 A;  5EYL A;  2PZI A;  3IXE A;  4X8Q A;  3RKV A;  1OWL A;  3FTV A;  4FLB A;  1OWM A;  1Y6I A;  3FEY A;  1TYQ G;  1TJF A;  3TWW A;  4UUC A;  1HX8 A;  4PS3 A;  5CEA A;  5FIN A;  1MQS A;  3G2U A;  5BXU A;  5JJ7 A;  1IKN D;  1UN9 A;  2AW6 A;  4A55 A;  3TG5 A;  1DCQ A;  1TNU A;  2XQ0 A;  4FJY A;  3R7Q A;  5FTP A;  2PM6 A;  5B3S E;  3ONL A;  4JC8 A;  2GRM A;  3IHY A;  4LNG A;  1D9S A;  2CG2 A;  1D8D A;  2YHE A;  5BNW A;  2FI7 A;  2J9Q A;  5ENT D;  1ZB1 A;  2YHC A;  3S7B A;  4U8H A;  4O1P A;  2GGF A;  5ENN A;  3MKR A;  3Q5M A;  1E8X A;  4L2Y A;  1NI1 A;  3CK9 A;  4U8Y D;  5LX8 A;  4K5C A;  4I6G A;  2RD0 A;  1N4Q A;  2RG8 A;  2EIL E;  3EHR A;  5FZS A;  4Z68 A;  4PH4 B;  3FUF A;  1TNB A;  4GYY A;  5ARF A;  2DWZ A;  2PQR A;  4GZ6 A;  3SQV A;  4GU5 A;  5FIO A;  2MYO A;  1HO8 A;  3LJN A;  3J5P A;  1K8K G;  4GTR A;  4H7Y A;  1JUQ A;  1N4R A;  1WM5 A;  3Q15 A;  5LCW C;  4G11 A;  4U95 D;  5KNG A;  3FUJ A;  3HVE B;  3SF4 A;  3ZIM A;  5FWQ A;  2VGX A;  4XIF A;  4CRW A;  4YDO A;  3FU6 A;  2I1J A;  2P9S G;  2BED A;  4BET A;  2WQ7 A;  1ELK A;  3LPZ A;  3UT8 A;  3FTW A;  3TG4 A;  3UI2 A;  2BUG A;  3BQO A;  3E32 A;  3ZYK A;  4LSZ E;  4UQX A;  4O1O A;  5EIL A;  1OXJ A;  3VLD A;  4O6F A;  1TNO A;  3UMV A;  2JEK A;  4CEM A;  4JVS A;  5ENS D;  5EKQ D;  3NBN B;  3L82 A;  2L9B A;  4U0Z A;  2OVF A;  4AOF A;  5DIZ A;  4IN3 B;  3IV0 A;  4F53 A;  4J8S A;  1JCS A;  3R7R A;  3CHP A;  2DYR E;  3C5R A;  3S7F A;  1JCR A;  4TRQ A;  4EEC A;  1RZ4 A;  5EDS A;  3LXU X;  4EPZ A;  5ANL A;  1FVF A;  5E76 A;  1N4S A;  3KSQ A;  2ETB A;  4HXI A;  3RAU A;  3ZUV B;  2WXL A;  2CHX A;  4LG6 A;  3L16 A;  2X38 A;  3JYS A;  2P9K G;  1MJ0 A;  4ANW A;  4JHJ A;  2EIJ E;  3CVV A;  3ZHE A;  2CG3 A;  4JXT A;  1EF1 C;  5KJN A;  2AXU A;  1OCC E;  4KZ0 A;  3HIZ A;  3T8M A;  3DWL G;  3UT7 A;  2OEW A;  1LD7 A;  3TGO A;  1QNF A;  2NC9 A;  3UXG A;  4GCO A;  1MX4 A;  1OCZ E;  2LXM A;  4APF A;  4N39 A;  3IHV A;  5ARG A;  3P1U A; 
#chains in the Genus database with same CATH homology
 3V31 A;  1WDY A;  1YCS B;  5AQ7 A;  1K1A A;  1IHB A;  1UOH A;  5EN5 D;  5EIB E;  1BI8 B;  4LSZ E;  4G8K A;  5AAO A;  2AJA A;  4DX5 D;  2F8X K;  3AJI A;  1D9S A;  1K1B A;  2B0O E;  5HS0 A;  5ITZ F;  4OAV B;  4YDY A;  1SW6 A;  1N0Q A;  2A5E A;  4O1O A;  2XZT G;  3B95 A;  3W9F A;  5EIL A;  1SVX A;  3TWX A;  4DRX E;  2JAB A;  4DX2 A;  4ZHB A;  2QC9 A;  5AN8 A;  5ENR D;  1AP7 A;  2F37 A;  2KXP C;  5ENT D;  4HRM B;  2PNN A;  4N5Q A;  3T9K A;  3HRA A;  3J5Q B;  3JUE A;  4HLL A;  5D66 A;  5ENS D;  3V2X A;  3D9H A;  4K5A B;  4O1P A;  4DX6 D;  5KWD A;  3NBN B;  4GMR A;  1MYO A;  3JXI A;  4QQI A;  4HRN A;  3B7B A;  4NIK A;  4JB8 P;  5AQA A;  1BD8 A;  3T8K A;  5JMN D;  3V79 K;  2FO1 E;  1BI7 B;  3TWR A;  3ZKJ A;  4CZ2 D;  1BLX B;  4U8Y D;  2RFM A;  4HI9 A;  4BSZ B;  3AAA C;  1A5E A;  3Q9N C;  5KNH D;  5KBA A;  2NYJ A;  3C5R A;  3Q9U C;  4F1P A;  2ZGD A;  4HNA D;  2DZN A;  2F8Y A;  4K5C A;  2DZO A;  5EYL A;  5CBN A;  2KBX A;  1IXV A;  2XEN A;  4U96 D;  1N11 A;  5CER B;  3IXE A;  3NOC D;  2Y0B G;  4HBD A;  3ZU7 B;  4HQD A;  5CEC B;  3EHR A;  1YYH A;  4Z68 A;  1NFI E;  2XEH A;  3F6Q A;  5ENQ D;  1G3N B;  4GPM A;  5AQ9 A;  1YMP A;  3TWU A;  5BXO A;  5HKP A;  4QFV A;  3DEP A;  5EID A;  2ZGG A;  4HI8 A;  2DWZ A;  2ETB A;  3ZUV B;  2VGE A;  3JXJ A;  1QYM A;  4LNU D;  4OAU C;  5FIO A;  2MYO A;  4LG6 A;  3TWW A;  3EU9 A;  3KEA A;  4YDW A;  4UUC A;  4J8Y A;  5ENP D;  3LJN A;  3TWV A;  5CEA A;  1MJ0 A;  4F6R D;  4DX7 D;  3W9G A;  3J5P A;  1MX2 A;  5CBO A;  3NOG D;  5EYP F;  4RLY A;  5AAR A;  4BES A;  2XZD G;  5FIN A;  3EHQ A;  4U95 D;  5KNG A;  4O60 A;  4HRL A;  2ETC A;  4TUM A;  5BXU A;  1TR4 A;  3DEO A;  4DX1 A;  1BU9 A;  1IKN D;  5JA4 D;  2DVW A;  4BEP A;  2BKG A;  4C48 B;  4J7W A;  4K5B A;  1WG0 A;  2P2C P;  1K3Z D;  2HE0 A;  2V4H C;  4G8L A;  5ENO D;  1DCQ A;  5CED B;  4B93 B;  2ETA A;  5HRY A;  4A63 B;  4DUI A;  1OY3 D;  4BER A;  3TWQ A;  1S70 B;  4U8V D;  4CYM D;  1DC2 A;  3UXG A;  3TWT A;  3V2O A;  3SO8 A;  1MX6 A;  3V30 A;  1MX4 A;  2BKK B;  2RFA A;  3TWS A;  4ATZ D;  2V5Q C;  4BET A;  2XEE A;  5AQB A;  2J8S D;  1N0R A;  1OT8 A;  3HG0 D;  3UI2 A;  2Y1L E;  3UTM A;  4ZFH A;  2L6B A;  1AWC B;  4HB5 A;  2QYJ A;  3ZNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...