2HE0A

Crystal structure of a human notch1 ankyrin domain mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
HNQTDRTGATALHLAAAYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a human Notch1 ankyrin domain mutant
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Notch1 preproprotein variant
total genus 69
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2he0A00
4J7WA 1D9SA 5FINA 5D66A 1MYOA 4U96D 3V30A 3V2XA 2BKKB 3B7BA 5HKPA 5JMND 3ZUVB 4DUIA 4DX7D 5EN5D 2FO1E 3D9HA 2RFAA 3TWVA 4G8LA 4K5AB 5CEDB 2V4HC 2KXPC 2Y0BG 3TWRA 1BU9A 5CERB 5AQ9A 2XZTG 5KNGA 1BI7B 3EU9A 5ENQD 4DX1A 5BXOA 3IXEA 1DC2A 2BKGA 2QC9A 5HRYA 4UUCA 5ITZF 5ENPD 3JXJA 5ENRD 1BI8B 2ETBA 3C5RA 1TR4A 3Q9NC 4HRMB 4B93B 2A5EA 2F37A 3ZU7B 4TUMA 1N11A 2ETAA 1WG0A 5ENOD 4ZHBA 3DEOA 3V2OA 4QQIA 4HQDA 2NYJA 4LSZE 5EYLA 4CZ2D 3J5PA 2HE0A 3J5QB 2P2CP 5ENSD 3EHQA 4HRNA 1S70B 2ZGDA 4LG6A 5KNHD 4C48B 3ZKJA 1AP7A 4YDWA 1K1AA 1K3ZD 2QYJA 2L6BA 2RFMA 1MX6A 4HNAD 5EILA 1N0QA 2XZDG 3UTMA 5KWDA 4RLYA 3T8KA 4GMRA 4U95D 3W9GA 4BEPA 1NFIE 3JXIA 3TWTA 2F8XK 3Q9UC 3UI2A 1OY3D 2VGEA 3DEPA 3V79K 1WDYA 2DWZA 3W9FA 4BESA 4ZFHA 3AAAC 4HB5A 5AQBA 4QFVA 5CECB 5CBOA 4N5QA 4F6RD 1OT8A 2V5QC 2DZOA 5JA4D 3B95A 4U8VD 1DCQA 3EHRA 5CBNA 3NOCD 3KEAA 1G3NB 4GPMA 2ETCA 3V31A 4O60A 1YMPA 4DX5D 1MX4A 4Z68A 5KBAA 5BXUA 3TWXA 4BSZB 4CYMD 5FIOA 4K5BA 3T9KA 4G8KA 3LJNA 3NOGD 1YCSB 2AJAA 5AARA 4F1PA 3AJIA 2ZGGA 3SO8A 5EIDA 4YDYA 2XEHA 5HS0A 4HLLA 4OAUC 3HG0D 3TWWA 1YYHA 1IHBA 3HRAA 2B0OE 2XENA 1MJ0A 2KBXA 4A63B 4O1PA 2Y1LE 4U8YD 4JB8P 2XEEA 2DVWA 5AQ7A 1UOHA 1IXVA 4HI9A 4DX6D 5EYPF 4O1OA 1K1BA 5AQAA 3UXGA 3F6QA 2PNNA 4HRLA 4J8YA 4DRXE 1MX2A 2DZNA 5ENTD 1SW6A 1SVXA 3ZNGA 4ATZD 1QYMA 2J8SD 2JABA 3TWUA 5EIBE 1AWCB 4OAVB 1IKND 4BETA 2F8YA 3TWSA 3JUEA 4DX2A 3NBNB 4K5CA 4BERA 4HI8A 1A5EA 5CEAA 2MYOA 5AAOA 4NIKA 5AN8A 1BD8A 4HBDA 3TWQA 1BLXB 4LNUD 1N0RA
chains in the Genus database with same CATH superfamily
4JD2G 2WVIA 3V30A 1ELKA 3TWVA 1HX8A 4OVUA 4UI9J 1LTXA 2Y0BG 2WB2A 3ZXSA 1BU9A 4U0UA 3Q75A 3DXKG 3UT7A 5HRYA 2ZIRA 3TG4A 2KCVA 2PQNA 1XNFA 2ETAA 3KAEA 4KYOB 4LSZE 2IOSA 4A1SA 4L7TA 1X5BA 4C48B 4YDWA 4BX9A 5E76A 3PVLA 3LY8A 1NFIE 2L0TB 3KSQA 4JA9A 5KJLA 4PS3A 3D9LA 4RSYA 4GPKA 2CHZA 5A23A 3CVWA 2C0MA 4U8VD 1V55E 1G3NB 3MKRA 5G55A 1WY6A 2AJAA 5AARA 3OXGA 3Q47B 1NA3A 3VLEA 4J0UA 2LXMA 4N3AA 4AIFA 5FWQA 4V3IA 5AQAA 1QZ2A 5KJNA 3APFA 3U64A 4OVVA 3CGHA 3MX3A 5EKQD 4OAVB 3APCA 5EIBE 3UT4A 1AWCB 4UWKA 4DLOA 3SHFA 4J7WA 3LY7A 4HOQA 2XRZA 3D9HA 1E7UA 2XGOA 1E8YA 4P29A 3ESLA 3UM3A 4UUCA 3JXJA 5BPPA 2ETBA 4N5CA 4B94A 1UJJA 2F37A 4UWHA 5FTPA 5JHBA 4IN3B 3FH7A 3J5QB 4FP7A 1B89A 2ZGDA 4L2YA 5D0QD 4MS6A 4JEHA 3E33A 3T8KA 1WAO1 2LSVA 4UI9K 2VGEA 4LERA 3RAUA 2VJ8A 2WXQA 1N94A 3S7FA 1DCQA 1Y6IA 3EHRA 4JW1A 5FZRA 5ANRA 2J9QA 4TUUA 3TWXA 3ZRHA 5FIOA 4GA0A 5FT9A 3ISMC 4CRWA 4FC8A 4XKCA 2WXMA 3I4GA 3HXCA 3LJ3A 1HF8A 3D9OA 4ANWA 2XENA 1VDYA 4U8YD 4JB8P 3D9NA 1E8WA 5EYPF 4GA2A 2I2OA 1HFAA 3P1UA 3DSSA 3O4ZA 3AG3E 4ACLA 3LY9A 4FLBA 1N0RA 2Y69E 2EIME 3AS8A 5D66A 4XIFA 2HR2A 2R5SA 1U3CA 5EN5D 4NACA 3ZFWA 5ANLA 5KNGA 2X6KA 2KATA 2PM6A 4N39A 4LCTA 5ITZF 2WQ6A 3NB2A 1E7VA 3PS6A 3FTSA 3FUJA 3X2QE 3J5PA 2KC7A 3EHMA 3RIBA 2AXVA 3ZYLA 1N0QA 4I9EA 3Q9UC 3UI2A 3QOUA 4GB9A 2AWIA 1ELWA 4GZ3A 5CBOA 4F6RD 3I5PA 1LD8A 3MJWA 3D9PA 5KBAA 1SZAA 1TEZA 3SQVA 3FUNA 3PZ3A 4M3OA 2WMOA 1TJFA 3GZ2A 4N3CA 4J8YA 2I1KA 3KEZA 4JXTA 1IKND 2C0LA 3GZSA 3FTUA 5BNWA 5IY5E 1BLXB 1N9AA 4C9BB 5BT1A 5EX0A 4DUIA 3VLDA 4I17A 3R7QA 2EIKE 1HO8A 3S7DA 4CGVA 3ZGQA 1BI8B 4JEUA 1BPOA 3Q9NC 4HRMB 4KZCA 3RO2A 3U4TA 5ENOD 5AENA 2WXHA 4QQIA 4CZ2D 3DSUA 2QYUA 3QDNA 3OTNA 4UQYA 4HLEA 3PRZA 4FLHA 4EZLA 3FH8A 4LNBA 1MX6A 5A7DB 4FU3A 5KWDA 2FF4A 1UG3A 3FUHA 3PZ4A 3QKYA 1FT1A 3S7JA 4QFVA 2P9IG 5J90A 2VSOE 4I9CA 4ABNA 4DX5D 1OWLA 3B7SA 2ZGGA 3MA5A 4ANXA 5H7PA 4IRUA 2XCCA 1NZNA 2GRMA 5J08A 3PUKA 1SW6A 1UW4B 1Z3XA 4M7CA 3U66A 5AJLA 3PEUB 2XQ0A 3HIZA 3U9WA 4HI8A 1N95A 1O1RA 2CHWA 4N5QA 5FQ8A 4H7YA 1H2VC 3ZUVB 3ZYQA 2L9BA 5AQ9A 1BI7B 4N2QA 3WG7E 3ASHA 3AU5A 4TRQA 1X81A 5FZQA 3ZHEA 2WXJA 4I1MA 4MLPA 4L9PA 4JHKA 5JJ6A 1O5MA 2FBNA 2UWJG 2XRYA 3RSEG 4MKTA 4J8DA 4WUYA 3JYSA 2F0YA 4WWPA 3LVRE 3B7TA 3GW4A 2IO3C 3DSXA 3KS2A 5AIJA 4J8SA 2X6HA 4UI9C 2R05A 3FEXA 4DI4A 2R17C 5LX8A 3N71A 2J08A 2XS1A 2E0IA 2PZIA 2L6JA 3ENEA 2VSYA 3CVYA 4JC8A 1YYHA 1IHBA 4A63B 3MKQA 4Q96A 2DVWA 4UWLA 2QY7A 4HRLA 1GW6A 5LOZA 1FVHA 4A3TA 3D9KA 2R03A 3EJNA 4DX2A 1A5EA 5AAOA 3C3QA 3TWQA 2CG3A 4LUNU 5KCMA 4WNFA 3CSFA 3CEQA 4TXPA 2RFAA 3L6AA 4MRUA 3CVXA 1TJCA 2WXOA 3EU9A 5FQ7A 3ASOE 1E8ZA 3TL5A 3UINC 3ZU7B 1TNBA 3QAQA 2BEDA 3E37A 3LDZA 4CT4A 3CHMA 1TYQG 2FEZA 4I6EA 3ZEFA 2RFMA 1DVPA 3SZ7A 3CVPA 3W9GA 2V5FA 3DPDA 3RK6A 3O48A 4FADA 5DIZA 2V5QC 3FHEA 4FHKA 3C3RA 4GPMA 4O60A 3QB2A 2VGXB 3TG5A 2LO6A 2OCCE 4AEZC 4HFGA 2Y3AA 4F1PA 3DSTA 1OCOE 4YDYA 4TV3A 4KBQA 3PH0C 3ZYMA 4XKBA 5ENNA 2XEEA 1TNOA 3KSLA 4G24A 1A17A 2IF4A 3CSTA 3L82A 2NXPA 2KM4A 3PREA 4EECA 3JUEA 3CQCB 3ZIMA 3LCAA 3G2WA 4L23A 4NIKA 4TXRA 3E32A 1ZU2A 3KD7A 2XGMA 2VTBB 3V2XA 1MYOA 3B7BA 3G2TA 3DBSA 2DBAA 1TNUA 4GZ5A 1MZCA 1JPLA 5B3SE 3CHSA 2ZISA 2Y4TA 2WXRA 4KT6B 3UIOC 4HVBA 4LRZA 5ENRD 3URZA 4AV7A 3IBEA 4R7LA 2X6IA 3BQOA 1UN8A 3DEOA 2PL2A 3G2SA 3FUDA 5JJTA 2YHEA 3R7RA 1KZOA 4HOSA 4GCNA 1ELRA 2AXZA 1MHQA 1AP7A 2YINA 4XI0A 3QJZA 2EINE 5B1AE 3LYAA 4J8FA 2LAIA 2VGYA 3FTZA 3DEPA 4WNDA 3FU5A 4CDRA 4U0SA 3HYMB 2X38A 1PC2A 4BTBA 3FU0A 2ETCA 3OXLA 1MX4A 2H6FA 3JUIA 1MQSA 3CVNA 2J4DA 1NL4A 2LNIA 3AJIA 3CHRA 3ABME 5ARFA 2EILE 2Y1LE 3QWWA 4GZDA 5AQ7A 3UPVA 4G25A 3HXEA 2I9CA 1S64A 2JABA 2DCPA 5FQ6A 3NBNB 2XPIA 3IV0A 5EX3A 4BY6A 3SD5A 4LEUA 3EHNA 4GAAA 1JCRA 4YVQC 5FZSA 4J6IA 2BKGA 3ZXPA 4WWNA 3TGOA 3C5RA 2A5EA 2ZU6B 1N11A 2QFCA 5EDSA 2WXIA 3CVLA 2IQCA 4KZ0A 4UQZA 3T5XA 3L9TA 3MGBA 2LAHA 3TWTA 2F8XK 4EZKA 1P5QA 4F7AA 2KZTB 5CCLA 5G05C 1OT8A 1KT0A 2I1JA 1INZA 4JHRA 4X8QA 2NC9A 3UM1A 1N52A 1HZ4A 3PZDA 1YCSB 4GTQA 3UT8A 3TWWA 2B0OE 4K03A 2KZTA 3CKCA 2V8SE 2RKKA 3Q7FA 3PNTB 3LEWA 1SVXA 2XPYA 3ZNGA 1QYMA 2MHKA 2J09A 4BETA 4I1AA 3S7BA 5LFAA 2MYOA 5AN8A 1BD8A 2MRIA 5AJDA 4XEIG 2I6HA 3T5VA 2ILRA 2H6IA 3ZN3A 2X6JA 3SFYA 2VSXE 5G04C 3DXMG 3PUJA 2M63A 4U7EB 5FQ4A 1KZPA 4WNEA 4EPZA 2YNQA 4HQDA 5EYLA 3FULA 2GRQB 4I2ZA 5T4YA 5ENSD 1OCRE 3UM0A 3CHPA 3DRAA 2QYJA 5KJKA 5C2YA 4HNAD 3PZ1A 1WM5A 3BU8A 3SBTB 4DK5A 4ILIA 1WDYA 5E75A 3UMVA 3OAWA 1KLXA 3CQGB 5JA4D 3SI5A 2WPVA 4ATGA 1SA4A 4DI3A 4ILGA 4AXHA 3ULEG 4K0RA 2EQXA 4BSZB 3MEKA 4U0ZA 3UKRG 3CVUA 3HVEB 3CK7A 1UJKA 2XEHA 4HORA 4OAUC 3JCKC 1OWOA 1H19A 2LSUA 1IYGA 3NZSA 1H6KA 3FP3A 1MX2A 5BV0A 3AU4A 4APOA 5C1DA 4BT8A 4BT9A 1OCCE 3HXFA 2GGFA 4F3VA 4HBDA 2R2LA 1OWMA 4YDOA 5HKPA 4WNGA 2V4HC 2P9SG 4F53A 4U8HA 2LUHA 3L22A 3PEVB 5BXOA 3IXEA 2R02A 2QC9A 1TN6A 3PZ2A 5JJ7A 1H6PA 2DYSE 3FFLA 3ULQA 3UIPC 5CCMA 4Y6WA 1Z3YA 3Q49B 2HE0A 3EHQA 2P9UG 4NRHB 3CLJA 1EDUA 3DPYA 2ZXWE 3BEEA 4JHJA 2L6BA 1D8DA 1EF1C 3MV3B 2FULA 1N4RA 5CHEE 3HDXA 2KCLA 4BFRA 1JCQA 3HHMA 3UM2A 3QNKA 5BXUA 1L5JA 4TXQA 3PE3A 3UKUG 3ZYKA 1TNYA 4G8KA 4CEMA 2VQ2A 2V4LA 4JVSA 3L17A 2P58C 3TAXA 3FY4A 4WWOA 3HG0D 2WXFA 3MV2B 2P9LG 4XE0A 2AVPA 3ZW3A 3FTYA 1K1BA 4GYOA 5ENTD 1V54E 3RO3A 2HO1A 1JWGA 4AJWA 3U3WA 2JLBA 1JCSA 3CIAA 1NP7A 4YVOA 3SNXA 4B8CB 3D3MA 3ASNE 4HOUA 4GZ6A 3BG0B 3ULYA 3CK8A 4DX7D 4GZCA 2FO1E 1O1TA 1D8EA 3S2AA 4G8LA 2MOWA 4B89A 4L1BA 3QWPA 2YQ8A 2WM9A 4B93B 2DYRE 4I43A 3Q15A 1FPPA 3ONKA 5KJMA 3V2OA 2P9PG 3EIQC 3CVVA 4AVXA 4HRNA 1EYHA 2Y4UA 2JEKA 1K1AA 4BX8A 3CV0A 4NURA 3LKUA 3L16A 2WXPA 5T8IA 3V79K 1OWPA 4BESA 5DBKA 3LXUX 3IHYA 3Q7AA 5AYWD 3ML9A 2X3MA 3P2BA 2DZOA 1E96B 3ONLA 3LVQE 3AG4E 3V31A 1Y8MA 1YMPA 1RW2A 4CYMD 3DWLG 3RRUA 3LJNA 4F1SA 1S0PA 3FTVA 3PDNA 4FJZA 1RZ4A 4HLLA 3WXXA 1HS6A 4CDNA 3NQPA 3NF1A 4GTMA 4GTRA 1E8XA 5BUZA 4PH4B 5LP0A 4Q94A 3BG1B 2FO7A 2F8YA 4EQFA 2NSZA 4GTOA 4BERA 3EIJA 5G05J 2VYIA 3T8MA 4GU5A 1H2UA 4K5AB 4GTVA 3NZUA 4ACKA 3TWRA 1NI1A 3FUKA 4RVBA 4L2LA 3ASFA 1DCEA 3Q73A 4G23A 2YHCA 3RKVA 3B13A 2X6FA 3FU3A 2WXLA 4W9RA 1TN7A 3G2VA 1U2VG 1S70B 4Q69A 4AM9A 1QQEA 4N3BA 2J49A 3I4RB 1HE8A 1HXIA 5EILA 4XX5A 4RLYA 4GMRA 4BEPA 5LCWC 1HG5A 1SZ9A 3W9FA 4XZ4A 2IFUA 2CHXA 2VSNA 4PS8A 3NOCD 3VTYA 3MYVA 2IO2C 4G11A 4URKA 4K5BA 3T9KA 1Q2ZA 4E85A 3VTXA 4UWFA 1IQRA 3ZHEB 2CG2A 5EIDA 2GW1A 1MJ0A 3LS8A 1QNFA 1H2TC 2H6GA 1IXVA 1PAQA 3OXFA 3UXGA 4U63A 2DZNA 2GRNB 3EU5A 1ZBPA 1N54A 3HXDA 4K5CA 4MBGA 4DJAA 2RG8A 1D9SA 4FJYA 3FWVA 2EIJE 5FINA 4U96D 3Q4AB 3FU6A 5CEDB 2KXPC 4RQIA 1SQMA 1OWNA 2V0PA 4Y6CA 4DX1A 2XPZA 1HH8A 5BW8C 5JHAA 2DIWA 4TUMA 3IEGA 5HI7A 1UN9A 2L0IA 4I6JA 4JL0A 3SF4A 1Z6TA 3C3OA 2AW6A 4A3VA 4JZYA 3RU0A 3C72A 4PUCA 4GCOA 4I1OB 1OY3D 5B1BE 5AQBA 2E2EA 5M72A 3K9IA 5CBNA 3DSWA 4AY6A 3D9JA 4GA1A 4U07A 3MZLB 3R9MA 3TXNA 1E90A 1O1SA 3CHQA 1QBQA 3APDA 1UOHA 4A1GA 4HI9A 2Q7FA 4C0MA 3RRNB 3E34A 4YDEA 2GRLA 1SA5A 4PS7A 4O6FA 4ATZD 2J8SD 4KVOA 3L54A 2HYZA 3GYZA 1LD7A 3FUMA 2XHEA 4ME2A 1OXJA 3FTWA 2BKKB 3RRMB 4B0ZA 2VTBA 1ZB1A 5LCWJ 4EBAA 3G2UA 4CT0A 2VGXA 1IQUA 3SFZA 2LXLA 5ENQD 4U04A 2OV8A 3TJPA 3FEYA 3CVQA 1TR4A 1Z5SC 3UQ3A 5CMYA 2WQHA 4EZJA 3MKQB 3Q5MA 1WG0A 4EHMA 3HXBA 2IONA 4ANUA 2IY0C 2NYJA 4GMJA 3QK0A 2PM7A 2H6HA 2PQRA 2XS8A 4UQXA 2CFUA 3ZVVA 1K3ZD 4N2SA 1N4QA 3UTMA 4U95D 2A4ZA 5CMWA 1KPSB 4IYPA 4ZFHA 5FJYA 2OVFA 2P9NG 5D2MC 3SY2A 3ESKA 4CDMA 4UWGA 2XCBA 3CK9A 5A6CA 4A55A 4ANVA 4C0EA 2GROB 2A5UA 2CFZA 3FDHA 1YA0A 3ASDA 1NA0A 1DNPA 3ML8A 5HS0A 2AXUA 1H6OA 2C2LA 5HQ8A 5D0OD 1S63A 2KCKA 3NAWA 4E6HA 5CRVA 4GTPA 3F6QA 5T3RA 4DRXE 4GTSA 3AS5A 3EDTB 1N4SA 3AS4A 2XEVA 3D9IA 3TWSA 3FH5A 1OUVA 3IHVA 3TWUA 3PNLB 4LNUD 1JWFA 1KT1A 5JMND 3CHOA 2P9KG 3SGHA 3PE4A 2IOLA 4KMOA 5CERB 3R9AB 4GMLA 3LPZA 1PY1A 1DC2A 2J4BA 2R59A 3L13A 2OEVA 4BWRA 3E4BA 3JQ0A 2IEJA 4G1TA 2OEWA 2WMNA 4GTTA 3QARA 4AY5A 3ABLE 4NQ0A 4D10C 4RG6A 3FUIA 4LG6A 3MCXA 5KNHD 3ZKJA 4FA6A 2WQ7A 2GRRB 3D9MA 3AG1E 3BUAA 3B7RL 3UX4A 1OCZE 2IJGX 4HXIA 3JXIA 1TN8A 1W3BA 2HM8A 4IULA 3AAAC 4HB5A 4KXKB 4XI9A 5CECB 1XGWA 3B95A 3KEAA 5G04J 2FI7A 2XGSA 3I3NA 3Q79A 3NOGD 3GZ1A 2IU1A 4CCAA 1FT2A 3HRAA 2WXGA 4O1PA 4G26A 4AP2A 4HOTA 4OYSA 5G2NA 3Q78A 3QWVA 5BV1A 3ZPJA 4O1OA 1JUQA 2RD0A 3EUVA 3QC1A 3VLFA 3IKOB 4FHJA 1IHGA 3ABKE 1H0AA 2OVBA 4GYYA 4DLQA 3CR3A 2QZAA 2XZTG 3FUFA 2BF0X 4I2WA 4JPSA 4RG9A 4ILHB 5ENPD 4GYWA 2BUGA 3FTXA 4ZHBA 2WXKA 2P2CP 1HG2A 1HU3A 4CGWA 4KVMA 4YNDA 2J07A 2OOEA 4PDXA 4DPRA 2GRPB 4BSXA 2XZDG 4FULA 1LF8A 1K8KG 3UUXA 3AG2E 2DWZA 3C98A 3DSVA 3CKBA 3B7UX 4J8EA 4APFA 5CRUA 2WXNA 1EPUA 3FUEA 4Z68A 4JA7A 4EBAG 3SBSA 4AOFA 2UY1A 2B6CA 3E30A 3HVEA 5ARGA 3TXMA 3SO8A 4B8AA 4LNGA 2KBXA 1TNZA 2BTDA 1FCHA 4HS2A 4BTAA 4DX6D 1N4PA 2PNNA 4WAFA 1FVFA 4G2VA 2UY1B 3ASGA 3L08A 3SFXA 4H7XA 3RJVA 1U3DA 5CEAA 3JQ1A 2ONDA 4I6GA
chains in the Genus database with same CATH topology
4J7WA 1D9SA 5FINA 5D66A 1MYOA 4U96D 3V30A 3V2XA 2BKKB 3B7BA 5HKPA 5JMND 3ZUVB 4DUIA 4DX7D 5EN5D 2FO1E 3D9HA 2RFAA 3TWVA 4G8LA 4K5AB 5CEDB 2V4HC 2KXPC 2Y0BG 3TWRA 1BU9A 5CERB 5AQ9A 2XZTG 5KNGA 1BI7B 3EU9A 5ENQD 4DX1A 5BXOA 3IXEA 1DC2A 2BKGA 2QC9A 5HRYA 4UUCA 5ITZF 5ENPD 3JXJA 5ENRD 1BI8B 2ETBA 3C5RA 1TR4A 3Q9NC 4HRMB 4B93B 2A5EA 2F37A 3ZU7B 4TUMA 1N11A 2ETAA 1WG0A 5ENOD 4ZHBA 3DEOA 3V2OA 4QQIA 4HQDA 2NYJA 4LSZE 5EYLA 4CZ2D 3J5PA 2HE0A 3J5QB 2P2CP 5ENSD 3EHQA 4HRNA 1S70B 2ZGDA 4LG6A 5KNHD 4C48B 3ZKJA 1AP7A 4YDWA 1K1AA 1K3ZD 2QYJA 2L6BA 2RFMA 1MX6A 4HNAD 5EILA 1N0QA 2XZDG 3UTMA 5KWDA 4RLYA 3T8KA 4GMRA 4U95D 3W9GA 4BEPA 1NFIE 3JXIA 3TWTA 2F8XK 3Q9UC 3UI2A 1OY3D 2VGEA 3DEPA 3V79K 1WDYA 2DWZA 3W9FA 4BESA 4ZFHA 3AAAC 4HB5A 5AQBA 4QFVA 5CECB 5CBOA 4N5QA 4F6RD 1OT8A 2V5QC 2DZOA 5JA4D 3B95A 4U8VD 1DCQA 3EHRA 5CBNA 3NOCD 3KEAA 1G3NB 4GPMA 2ETCA 3V31A 4O60A 1YMPA 4DX5D 1MX4A 4Z68A 5KBAA 5BXUA 3TWXA 4BSZB 4CYMD 5FIOA 4K5BA 3T9KA 4G8KA 3LJNA 3NOGD 1YCSB 2AJAA 5AARA 4F1PA 3AJIA 2ZGGA 3SO8A 5EIDA 4YDYA 2XEHA 5HS0A 4HLLA 4OAUC 3HG0D 3TWWA 1YYHA 1IHBA 3HRAA 2B0OE 2XENA 1MJ0A 2KBXA 4A63B 4O1PA 2Y1LE 4U8YD 4JB8P 2XEEA 2DVWA 5AQ7A 1UOHA 1IXVA 4HI9A 4DX6D 5EYPF 4O1OA 1K1BA 5AQAA 3UXGA 3F6QA 2PNNA 4HRLA 4J8YA 4DRXE 1MX2A 2DZNA 5ENTD 1SW6A 1SVXA 3ZNGA 4ATZD 1QYMA 2J8SD 2JABA 3TWUA 5EIBE 1AWCB 4OAVB 1IKND 4BETA 2F8YA 3TWSA 3JUEA 4DX2A 3NBNB 4K5CA 4BERA 4HI8A 1A5EA 5CEAA 2MYOA 5AAOA 4NIKA 5AN8A 1BD8A 4HBDA 3TWQA 1BLXB 4LNUD 1N0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7W A;  1D9S A;  5FIN A;  5D66 A;  1MYO A;  4U96 D;  3V30 A;  3V2X A;  2BKK B;  3B7B A;  5HKP A;  5JMN D;  3ZUV B;  4DUI A;  4DX7 D;  5EN5 D;  2FO1 E;  3D9H A;  2RFA A;  3TWV A;  4G8L A;  4K5A B;  5CED B;  2V4H C;  2KXP C;  2Y0B G;  3TWR A;  1BU9 A;  5CER B;  5AQ9 A;  2XZT G;  5KNG A;  1BI7 B;  3EU9 A;  5ENQ D;  4DX1 A;  5BXO A;  3IXE A;  1DC2 A;  2BKG A;  2QC9 A;  5HRY A;  4UUC A;  5ITZ F;  5ENP D;  3JXJ A;  5ENR D;  1BI8 B;  2ETB A;  3C5R A;  1TR4 A;  3Q9N C;  4HRM B;  4B93 B;  2A5E A;  2F37 A;  3ZU7 B;  4TUM A;  1N11 A;  2ETA A;  1WG0 A;  5ENO D;  4ZHB A;  3DEO A;  3V2O A;  4QQI A;  4HQD A;  2NYJ A;  4LSZ E;  5EYL A;  4CZ2 D;  3J5P A;  2HE0 A;  3J5Q B;  2P2C P;  5ENS D;  3EHQ A;  4HRN A;  1S70 B;  2ZGD A;  4LG6 A;  5KNH D;  4C48 B;  3ZKJ A;  1AP7 A;  4YDW A;  1K1A A;  1K3Z D;  2QYJ A;  2L6B A;  2RFM A;  1MX6 A;  4HNA D;  5EIL A;  1N0Q A;  2XZD G;  3UTM A;  5KWD A;  4RLY A;  3T8K A;  4GMR A;  4U95 D;  3W9G A;  4BEP A;  1NFI E;  3JXI A;  3TWT A;  2F8X K;  3Q9U C;  3UI2 A;  1OY3 D;  2VGE A;  3DEP A;  3V79 K;  1WDY A;  2DWZ A;  3W9F A;  4BES A;  4ZFH A;  3AAA C;  4HB5 A;  5AQB A;  4QFV A;  5CEC B;  5CBO A;  4N5Q A;  4F6R D;  1OT8 A;  2V5Q C;  2DZO A;  5JA4 D;  3B95 A;  4U8V D;  1DCQ A;  3EHR A;  5CBN A;  3NOC D;  3KEA A;  1G3N B;  4GPM A;  2ETC A;  3V31 A;  4O60 A;  1YMP A;  4DX5 D;  1MX4 A;  4Z68 A;  5KBA A;  5BXU A;  3TWX A;  4BSZ B;  4CYM D;  5FIO A;  4K5B A;  3T9K A;  4G8K A;  3LJN A;  3NOG D;  1YCS B;  2AJA A;  5AAR A;  4F1P A;  3AJI A;  2ZGG A;  3SO8 A;  5EID A;  4YDY A;  2XEH A;  5HS0 A;  4HLL A;  4OAU C;  3HG0 D;  3TWW A;  1YYH A;  1IHB A;  3HRA A;  2B0O E;  2XEN A;  1MJ0 A;  2KBX A;  4A63 B;  4O1P A;  2Y1L E;  4U8Y D;  4JB8 P;  2XEE A;  2DVW A;  5AQ7 A;  1UOH A;  1IXV A;  4HI9 A;  4DX6 D;  5EYP F;  4O1O A;  1K1B A;  5AQA A;  3UXG A;  3F6Q A;  2PNN A;  4HRL A;  4J8Y A;  4DRX E;  1MX2 A;  2DZN A;  5ENT D;  1SW6 A;  1SVX A;  3ZNG A;  4ATZ D;  1QYM A;  2J8S D;  2JAB A;  3TWU A;  5EIB E;  1AWC B;  4OAV B;  1IKN D;  4BET A;  2F8Y A;  3TWS A;  3JUE A;  4DX2 A;  3NBN B;  4K5C A;  4BER A;  4HI8 A;  1A5E A;  5CEA A;  2MYO A;  5AAO A;  4NIK A;  5AN8 A;  1BD8 A;  4HBD A;  3TWQ A;  1BLX B;  4LNU D;  1N0R A; 
#chains in the Genus database with same CATH topology
 4JD2 G;  2WVI A;  3V30 A;  1ELK A;  3TWV A;  1HX8 A;  4OVU A;  4UI9 J;  1LTX A;  2Y0B G;  2WB2 A;  3ZXS A;  1BU9 A;  4U0U A;  3Q75 A;  3DXK G;  3UT7 A;  5HRY A;  2ZIR A;  3TG4 A;  2KCV A;  2PQN A;  1XNF A;  2ETA A;  3KAE A;  4KYO B;  4LSZ E;  2IOS A;  4A1S A;  4L7T A;  1X5B A;  4C48 B;  4YDW A;  4BX9 A;  5E76 A;  3PVL A;  3LY8 A;  1NFI E;  2L0T B;  3KSQ A;  4JA9 A;  5KJL A;  4PS3 A;  3D9L A;  4RSY A;  4GPK A;  2CHZ A;  5A23 A;  3CVW A;  2C0M A;  4U8V D;  1V55 E;  1G3N B;  3MKR A;  5G55 A;  1WY6 A;  2AJA A;  5AAR A;  3OXG A;  3Q47 B;  1NA3 A;  3VLE A;  4J0U A;  2LXM A;  4N3A A;  4AIF A;  5FWQ A;  4V3I A;  5AQA A;  1QZ2 A;  5KJN A;  3APF A;  3U64 A;  4OVV A;  3CGH A;  3MX3 A;  5EKQ D;  4OAV B;  3APC A;  5EIB E;  3UT4 A;  1AWC B;  4UWK A;  4DLO A;  3SHF A;  4J7W A;  3LY7 A;  4HOQ A;  2XRZ A;  3D9H A;  1E7U A;  2XGO A;  1E8Y A;  4P29 A;  3ESL A;  3UM3 A;  4UUC A;  3JXJ A;  5BPP A;  2ETB A;  4N5C A;  4B94 A;  1UJJ A;  2F37 A;  4UWH A;  5FTP A;  5JHB A;  4IN3 B;  3FH7 A;  3J5Q B;  4FP7 A;  1B89 A;  2ZGD A;  4L2Y A;  5D0Q D;  4MS6 A;  4JEH A;  3E33 A;  3T8K A;  1WAO 1;  2LSV A;  4UI9 K;  2VGE A;  4LER A;  3RAU A;  2VJ8 A;  2WXQ A;  1N94 A;  3S7F A;  1DCQ A;  1Y6I A;  3EHR A;  4JW1 A;  5FZR A;  5ANR A;  2J9Q A;  4TUU A;  3TWX A;  3ZRH A;  5FIO A;  4GA0 A;  5FT9 A;  3ISM C;  4CRW A;  4FC8 A;  4XKC A;  2WXM A;  3I4G A;  3HXC A;  3LJ3 A;  1HF8 A;  3D9O A;  4ANW A;  2XEN A;  1VDY A;  4U8Y D;  4JB8 P;  3D9N A;  1E8W A;  5EYP F;  4GA2 A;  2I2O A;  1HFA A;  3P1U A;  3DSS A;  3O4Z A;  3AG3 E;  4ACL A;  3LY9 A;  4FLB A;  1N0R A;  2Y69 E;  2EIM E;  3AS8 A;  5D66 A;  4XIF A;  2HR2 A;  2R5S A;  1U3C A;  5EN5 D;  4NAC A;  3ZFW A;  5ANL A;  5KNG A;  2X6K A;  2KAT A;  2PM6 A;  4N39 A;  4LCT A;  5ITZ F;  2WQ6 A;  3NB2 A;  1E7V A;  3PS6 A;  3FTS A;  3FUJ A;  3X2Q E;  3J5P A;  2KC7 A;  3EHM A;  3RIB A;  2AXV A;  3ZYL A;  1N0Q A;  4I9E A;  3Q9U C;  3UI2 A;  3QOU A;  4GB9 A;  2AWI A;  1ELW A;  4GZ3 A;  5CBO A;  4F6R D;  3I5P A;  1LD8 A;  3MJW A;  3D9P A;  5KBA A;  1SZA A;  1TEZ A;  3SQV A;  3FUN A;  3PZ3 A;  4M3O A;  2WMO A;  1TJF A;  3GZ2 A;  4N3C A;  4J8Y A;  2I1K A;  3KEZ A;  4JXT A;  1IKN D;  2C0L A;  3GZS A;  3FTU A;  5BNW A;  5IY5 E;  1BLX B;  1N9A A;  4C9B B;  5BT1 A;  5EX0 A;  4DUI A;  3VLD A;  4I17 A;  3R7Q A;  2EIK E;  1HO8 A;  3S7D A;  4CGV A;  3ZGQ A;  1BI8 B;  4JEU A;  1BPO A;  3Q9N C;  4HRM B;  4KZC A;  3RO2 A;  3U4T A;  5ENO D;  5AEN A;  2WXH A;  4QQI A;  4CZ2 D;  3DSU A;  2QYU A;  3QDN A;  3OTN A;  4UQY A;  4HLE A;  3PRZ A;  4FLH A;  4EZL A;  3FH8 A;  4LNB A;  1MX6 A;  5A7D B;  4FU3 A;  5KWD A;  2FF4 A;  1UG3 A;  3FUH A;  3PZ4 A;  3QKY A;  1FT1 A;  3S7J A;  4QFV A;  2P9I G;  5J90 A;  2VSO E;  4I9C A;  4ABN A;  4DX5 D;  1OWL A;  3B7S A;  2ZGG A;  3MA5 A;  4ANX A;  5H7P A;  4IRU A;  2XCC A;  1NZN A;  2GRM A;  5J08 A;  3PUK A;  1SW6 A;  1UW4 B;  1Z3X A;  4M7C A;  3U66 A;  5AJL A;  3PEU B;  2XQ0 A;  3HIZ A;  3U9W A;  4HI8 A;  1N95 A;  1O1R A;  2CHW A;  4N5Q A;  5FQ8 A;  4H7Y A;  1H2V C;  3ZUV B;  3ZYQ A;  2L9B A;  5AQ9 A;  1BI7 B;  4N2Q A;  3WG7 E;  3ASH A;  3AU5 A;  4TRQ A;  1X81 A;  5FZQ A;  3ZHE A;  2WXJ A;  4I1M A;  4MLP A;  4L9P A;  4JHK A;  5JJ6 A;  1O5M A;  2FBN A;  2UWJ G;  2XRY A;  3RSE G;  4MKT A;  4J8D A;  4WUY A;  3JYS A;  2F0Y A;  4WWP A;  3LVR E;  3B7T A;  3GW4 A;  2IO3 C;  3DSX A;  3KS2 A;  5AIJ A;  4J8S A;  2X6H A;  4UI9 C;  2R05 A;  3FEX A;  4DI4 A;  2R17 C;  5LX8 A;  3N71 A;  2J08 A;  2XS1 A;  2E0I A;  2PZI A;  2L6J A;  3ENE A;  2VSY A;  3CVY A;  4JC8 A;  1YYH A;  1IHB A;  4A63 B;  3MKQ A;  4Q96 A;  2DVW A;  4UWL A;  2QY7 A;  4HRL A;  1GW6 A;  5LOZ A;  1FVH A;  4A3T A;  3D9K A;  2R03 A;  3EJN A;  4DX2 A;  1A5E A;  5AAO A;  3C3Q A;  3TWQ A;  2CG3 A;  4LUN U;  5KCM A;  4WNF A;  3CSF A;  3CEQ A;  4TXP A;  2RFA A;  3L6A A;  4MRU A;  3CVX A;  1TJC A;  2WXO A;  3EU9 A;  5FQ7 A;  3ASO E;  1E8Z A;  3TL5 A;  3UIN C;  3ZU7 B;  1TNB A;  3QAQ A;  2BED A;  3E37 A;  3LDZ A;  4CT4 A;  3CHM A;  1TYQ G;  2FEZ A;  4I6E A;  3ZEF A;  2RFM A;  1DVP A;  3SZ7 A;  3CVP A;  3W9G A;  2V5F A;  3DPD A;  3RK6 A;  3O48 A;  4FAD A;  5DIZ A;  2V5Q C;  3FHE A;  4FHK A;  3C3R A;  4GPM A;  4O60 A;  3QB2 A;  2VGX B;  3TG5 A;  2LO6 A;  2OCC E;  4AEZ C;  4HFG A;  2Y3A A;  4F1P A;  3DST A;  1OCO E;  4YDY A;  4TV3 A;  4KBQ A;  3PH0 C;  3ZYM A;  4XKB A;  5ENN A;  2XEE A;  1TNO A;  3KSL A;  4G24 A;  1A17 A;  2IF4 A;  3CST A;  3L82 A;  2NXP A;  2KM4 A;  3PRE A;  4EEC A;  3JUE A;  3CQC B;  3ZIM A;  3LCA A;  3G2W A;  4L23 A;  4NIK A;  4TXR A;  3E32 A;  1ZU2 A;  3KD7 A;  2XGM A;  2VTB B;  3V2X A;  1MYO A;  3B7B A;  3G2T A;  3DBS A;  2DBA A;  1TNU A;  4GZ5 A;  1MZC A;  1JPL A;  5B3S E;  3CHS A;  2ZIS A;  2Y4T A;  2WXR A;  4KT6 B;  3UIO C;  4HVB A;  4LRZ A;  5ENR D;  3URZ A;  4AV7 A;  3IBE A;  4R7L A;  2X6I A;  3BQO A;  1UN8 A;  3DEO A;  2PL2 A;  3G2S A;  3FUD A;  5JJT A;  2YHE A;  3R7R A;  1KZO A;  4HOS A;  4GCN A;  1ELR A;  2AXZ A;  1MHQ A;  1AP7 A;  2YIN A;  4XI0 A;  3QJZ A;  2EIN E;  5B1A E;  3LYA A;  4J8F A;  2LAI A;  2VGY A;  3FTZ A;  3DEP A;  4WND A;  3FU5 A;  4CDR A;  4U0S A;  3HYM B;  2X38 A;  1PC2 A;  4BTB A;  3FU0 A;  2ETC A;  3OXL A;  1MX4 A;  2H6F A;  3JUI A;  1MQS A;  3CVN A;  2J4D A;  1NL4 A;  2LNI A;  3AJI A;  3CHR A;  3ABM E;  5ARF A;  2EIL E;  2Y1L E;  3QWW A;  4GZD A;  5AQ7 A;  3UPV A;  4G25 A;  3HXE A;  2I9C A;  1S64 A;  2JAB A;  2DCP A;  5FQ6 A;  3NBN B;  2XPI A;  3IV0 A;  5EX3 A;  4BY6 A;  3SD5 A;  4LEU A;  3EHN A;  4GAA A;  1JCR A;  4YVQ C;  5FZS A;  4J6I A;  2BKG A;  3ZXP A;  4WWN A;  3TGO A;  3C5R A;  2A5E A;  2ZU6 B;  1N11 A;  2QFC A;  5EDS A;  2WXI A;  3CVL A;  2IQC A;  4KZ0 A;  4UQZ A;  3T5X A;  3L9T A;  3MGB A;  2LAH A;  3TWT A;  2F8X K;  4EZK A;  1P5Q A;  4F7A A;  2KZT B;  5CCL A;  5G05 C;  1OT8 A;  1KT0 A;  2I1J A;  1INZ A;  4JHR A;  4X8Q A;  2NC9 A;  3UM1 A;  1N52 A;  1HZ4 A;  3PZD A;  1YCS B;  4GTQ A;  3UT8 A;  3TWW A;  2B0O E;  4K03 A;  2KZT A;  3CKC A;  2V8S E;  2RKK A;  3Q7F A;  3PNT B;  3LEW A;  1SVX A;  2XPY A;  3ZNG A;  1QYM A;  2MHK A;  2J09 A;  4BET A;  4I1A A;  3S7B A;  5LFA A;  2MYO A;  5AN8 A;  1BD8 A;  2MRI A;  5AJD A;  4XEI G;  2I6H A;  3T5V A;  2ILR A;  2H6I A;  3ZN3 A;  2X6J A;  3SFY A;  2VSX E;  5G04 C;  3DXM G;  3PUJ A;  2M63 A;  4U7E B;  5FQ4 A;  1KZP A;  4WNE A;  4EPZ A;  2YNQ A;  4HQD A;  5EYL A;  3FUL A;  2GRQ B;  4I2Z A;  5T4Y A;  5ENS D;  1OCR E;  3UM0 A;  3CHP A;  3DRA A;  2QYJ A;  5KJK A;  5C2Y A;  4HNA D;  3PZ1 A;  1WM5 A;  3BU8 A;  3SBT B;  4DK5 A;  4ILI A;  1WDY A;  5E75 A;  3UMV A;  3OAW A;  1KLX A;  3CQG B;  5JA4 D;  3SI5 A;  2WPV A;  4ATG A;  1SA4 A;  4DI3 A;  4ILG A;  4AXH A;  3ULE G;  4K0R A;  2EQX A;  4BSZ B;  3MEK A;  4U0Z A;  3UKR G;  3CVU A;  3HVE B;  3CK7 A;  1UJK A;  2XEH A;  4HOR A;  4OAU C;  3JCK C;  1OWO A;  1H19 A;  2LSU A;  1IYG A;  3NZS A;  1H6K A;  3FP3 A;  1MX2 A;  5BV0 A;  3AU4 A;  4APO A;  5C1D A;  4BT8 A;  4BT9 A;  1OCC E;  3HXF A;  2GGF A;  4F3V A;  4HBD A;  2R2L A;  1OWM A;  4YDO A;  5HKP A;  4WNG A;  2V4H C;  2P9S G;  4F53 A;  4U8H A;  2LUH A;  3L22 A;  3PEV B;  5BXO A;  3IXE A;  2R02 A;  2QC9 A;  1TN6 A;  3PZ2 A;  5JJ7 A;  1H6P A;  2DYS E;  3FFL A;  3ULQ A;  3UIP C;  5CCM A;  4Y6W A;  1Z3Y A;  3Q49 B;  2HE0 A;  3EHQ A;  2P9U G;  4NRH B;  3CLJ A;  1EDU A;  3DPY A;  2ZXW E;  3BEE A;  4JHJ A;  2L6B A;  1D8D A;  1EF1 C;  3MV3 B;  2FUL A;  1N4R A;  5CHE E;  3HDX A;  2KCL A;  4BFR A;  1JCQ A;  3HHM A;  3UM2 A;  3QNK A;  5BXU A;  1L5J A;  4TXQ A;  3PE3 A;  3UKU G;  3ZYK A;  1TNY A;  4G8K A;  4CEM A;  2VQ2 A;  2V4L A;  4JVS A;  3L17 A;  2P58 C;  3TAX A;  3FY4 A;  4WWO A;  3HG0 D;  2WXF A;  3MV2 B;  2P9L G;  4XE0 A;  2AVP A;  3ZW3 A;  3FTY A;  1K1B A;  4GYO A;  5ENT D;  1V54 E;  3RO3 A;  2HO1 A;  1JWG A;  4AJW A;  3U3W A;  2JLB A;  1JCS A;  3CIA A;  1NP7 A;  4YVO A;  3SNX A;  4B8C B;  3D3M A;  3ASN E;  4HOU A;  4GZ6 A;  3BG0 B;  3ULY A;  3CK8 A;  4DX7 D;  4GZC A;  2FO1 E;  1O1T A;  1D8E A;  3S2A A;  4G8L A;  2MOW A;  4B89 A;  4L1B A;  3QWP A;  2YQ8 A;  2WM9 A;  4B93 B;  2DYR E;  4I43 A;  3Q15 A;  1FPP A;  3ONK A;  5KJM A;  3V2O A;  2P9P G;  3EIQ C;  3CVV A;  4AVX A;  4HRN A;  1EYH A;  2Y4U A;  2JEK A;  1K1A A;  4BX8 A;  3CV0 A;  4NUR A;  3LKU A;  3L16 A;  2WXP A;  5T8I A;  3V79 K;  1OWP A;  4BES A;  5DBK A;  3LXU X;  3IHY A;  3Q7A A;  5AYW D;  3ML9 A;  2X3M A;  3P2B A;  2DZO A;  1E96 B;  3ONL A;  3LVQ E;  3AG4 E;  3V31 A;  1Y8M A;  1YMP A;  1RW2 A;  4CYM D;  3DWL G;  3RRU A;  3LJN A;  4F1S A;  1S0P A;  3FTV A;  3PDN A;  4FJZ A;  1RZ4 A;  4HLL A;  3WXX A;  1HS6 A;  4CDN A;  3NQP A;  3NF1 A;  4GTM A;  4GTR A;  1E8X A;  5BUZ A;  4PH4 B;  5LP0 A;  4Q94 A;  3BG1 B;  2FO7 A;  2F8Y A;  4EQF A;  2NSZ A;  4GTO A;  4BER A;  3EIJ A;  5G05 J;  2VYI A;  3T8M A;  4GU5 A;  1H2U A;  4K5A B;  4GTV A;  3NZU A;  4ACK A;  3TWR A;  1NI1 A;  3FUK A;  4RVB A;  4L2L A;  3ASF A;  1DCE A;  3Q73 A;  4G23 A;  2YHC A;  3RKV A;  3B13 A;  2X6F A;  3FU3 A;  2WXL A;  4W9R A;  1TN7 A;  3G2V A;  1U2V G;  1S70 B;  4Q69 A;  4AM9 A;  1QQE A;  4N3B A;  2J49 A;  3I4R B;  1HE8 A;  1HXI A;  5EIL A;  4XX5 A;  4RLY A;  4GMR A;  4BEP A;  5LCW C;  1HG5 A;  1SZ9 A;  3W9F A;  4XZ4 A;  2IFU A;  2CHX A;  2VSN A;  4PS8 A;  3NOC D;  3VTY A;  3MYV A;  2IO2 C;  4G11 A;  4URK A;  4K5B A;  3T9K A;  1Q2Z A;  4E85 A;  3VTX A;  4UWF A;  1IQR A;  3ZHE B;  2CG2 A;  5EID A;  2GW1 A;  1MJ0 A;  3LS8 A;  1QNF A;  1H2T C;  2H6G A;  1IXV A;  1PAQ A;  3OXF A;  3UXG A;  4U63 A;  2DZN A;  2GRN B;  3EU5 A;  1ZBP A;  1N54 A;  3HXD A;  4K5C A;  4MBG A;  4DJA A;  2RG8 A;  1D9S A;  4FJY A;  3FWV A;  2EIJ E;  5FIN A;  4U96 D;  3Q4A B;  3FU6 A;  5CED B;  2KXP C;  4RQI A;  1SQM A;  1OWN A;  2V0P A;  4Y6C A;  4DX1 A;  2XPZ A;  1HH8 A;  5BW8 C;  5JHA A;  2DIW A;  4TUM A;  3IEG A;  5HI7 A;  1UN9 A;  2L0I A;  4I6J A;  4JL0 A;  3SF4 A;  1Z6T A;  3C3O A;  2AW6 A;  4A3V A;  4JZY A;  3RU0 A;  3C72 A;  4PUC A;  4GCO A;  4I1O B;  1OY3 D;  5B1B E;  5AQB A;  2E2E A;  5M72 A;  3K9I A;  5CBN A;  3DSW A;  4AY6 A;  3D9J A;  4GA1 A;  4U07 A;  3MZL B;  3R9M A;  3TXN A;  1E90 A;  1O1S A;  3CHQ A;  1QBQ A;  3APD A;  1UOH A;  4A1G A;  4HI9 A;  2Q7F A;  4C0M A;  3RRN B;  3E34 A;  4YDE A;  2GRL A;  1SA5 A;  4PS7 A;  4O6F A;  4ATZ D;  2J8S D;  4KVO A;  3L54 A;  2HYZ A;  3GYZ A;  1LD7 A;  3FUM A;  2XHE A;  4ME2 A;  1OXJ A;  3FTW A;  2BKK B;  3RRM B;  4B0Z A;  2VTB A;  1ZB1 A;  5LCW J;  4EBA A;  3G2U A;  4CT0 A;  2VGX A;  1IQU A;  3SFZ A;  2LXL A;  5ENQ D;  4U04 A;  2OV8 A;  3TJP A;  3FEY A;  3CVQ A;  1TR4 A;  1Z5S C;  3UQ3 A;  5CMY A;  2WQH A;  4EZJ A;  3MKQ B;  3Q5M A;  1WG0 A;  4EHM A;  3HXB A;  2ION A;  4ANU A;  2IY0 C;  2NYJ A;  4GMJ A;  3QK0 A;  2PM7 A;  2H6H A;  2PQR A;  2XS8 A;  4UQX A;  2CFU A;  3ZVV A;  1K3Z D;  4N2S A;  1N4Q A;  3UTM A;  4U95 D;  2A4Z A;  5CMW A;  1KPS B;  4IYP A;  4ZFH A;  5FJY A;  2OVF A;  2P9N G;  5D2M C;  3SY2 A;  3ESK A;  4CDM A;  4UWG A;  2XCB A;  3CK9 A;  5A6C A;  4A55 A;  4ANV A;  4C0E A;  2GRO B;  2A5U A;  2CFZ A;  3FDH A;  1YA0 A;  3ASD A;  1NA0 A;  1DNP A;  3ML8 A;  5HS0 A;  2AXU A;  1H6O A;  2C2L A;  5HQ8 A;  5D0O D;  1S63 A;  2KCK A;  3NAW A;  4E6H A;  5CRV A;  4GTP A;  3F6Q A;  5T3R A;  4DRX E;  4GTS A;  3AS5 A;  3EDT B;  1N4S A;  3AS4 A;  2XEV A;  3D9I A;  3TWS A;  3FH5 A;  1OUV A;  3IHV A;  3TWU A;  3PNL B;  4LNU D;  1JWF A;  1KT1 A;  5JMN D;  3CHO A;  2P9K G;  3SGH A;  3PE4 A;  2IOL A;  4KMO A;  5CER B;  3R9A B;  4GML A;  3LPZ A;  1PY1 A;  1DC2 A;  2J4B A;  2R59 A;  3L13 A;  2OEV A;  4BWR A;  3E4B A;  3JQ0 A;  2IEJ A;  4G1T A;  2OEW A;  2WMN A;  4GTT A;  3QAR A;  4AY5 A;  3ABL E;  4NQ0 A;  4D10 C;  4RG6 A;  3FUI A;  4LG6 A;  3MCX A;  5KNH D;  3ZKJ A;  4FA6 A;  2WQ7 A;  2GRR B;  3D9M A;  3AG1 E;  3BUA A;  3B7R L;  3UX4 A;  1OCZ E;  2IJG X;  4HXI A;  3JXI A;  1TN8 A;  1W3B A;  2HM8 A;  4IUL A;  3AAA C;  4HB5 A;  4KXK B;  4XI9 A;  5CEC B;  1XGW A;  3B95 A;  3KEA A;  5G04 J;  2FI7 A;  2XGS A;  3I3N A;  3Q79 A;  3NOG D;  3GZ1 A;  2IU1 A;  4CCA A;  1FT2 A;  3HRA A;  2WXG A;  4O1P A;  4G26 A;  4AP2 A;  4HOT A;  4OYS A;  5G2N A;  3Q78 A;  3QWV A;  5BV1 A;  3ZPJ A;  4O1O A;  1JUQ A;  2RD0 A;  3EUV A;  3QC1 A;  3VLF A;  3IKO B;  4FHJ A;  1IHG A;  3ABK E;  1H0A A;  2OVB A;  4GYY A;  4DLQ A;  3CR3 A;  2QZA A;  2XZT G;  3FUF A;  2BF0 X;  4I2W A;  4JPS A;  4RG9 A;  4ILH B;  5ENP D;  4GYW A;  2BUG A;  3FTX A;  4ZHB A;  2WXK A;  2P2C P;  1HG2 A;  1HU3 A;  4CGW A;  4KVM A;  4YND A;  2J07 A;  2OOE A;  4PDX A;  4DPR A;  2GRP B;  4BSX A;  2XZD G;  4FUL A;  1LF8 A;  1K8K G;  3UUX A;  3AG2 E;  2DWZ A;  3C98 A;  3DSV A;  3CKB A;  3B7U X;  4J8E A;  4APF A;  5CRU A;  2WXN A;  1EPU A;  3FUE A;  4Z68 A;  4JA7 A;  4EBA G;  3SBS A;  4AOF A;  2UY1 A;  2B6C A;  3E30 A;  3HVE A;  5ARG A;  3TXM A;  3SO8 A;  4B8A A;  4LNG A;  2KBX A;  1TNZ A;  2BTD A;  1FCH A;  4HS2 A;  4BTA A;  4DX6 D;  1N4P A;  2PNN A;  4WAF A;  1FVF A;  4G2V A;  2UY1 B;  3ASG A;  3L08 A;  3SFX A;  4H7X A;  3RJV A;  1U3D A;  5CEA A;  3JQ1 A;  2OND A;  4I6G A; 
#chains in the Genus database with same CATH homology
 4J7W A;  1D9S A;  5FIN A;  5D66 A;  1MYO A;  4U96 D;  3V30 A;  3V2X A;  2BKK B;  3B7B A;  5HKP A;  5JMN D;  3ZUV B;  4DUI A;  4DX7 D;  5EN5 D;  2FO1 E;  3D9H A;  2RFA A;  3TWV A;  4G8L A;  4K5A B;  5CED B;  2V4H C;  2KXP C;  2Y0B G;  3TWR A;  1BU9 A;  5CER B;  5AQ9 A;  2XZT G;  5KNG A;  1BI7 B;  3EU9 A;  5ENQ D;  4DX1 A;  5BXO A;  3IXE A;  1DC2 A;  2BKG A;  2QC9 A;  5HRY A;  4UUC A;  5ITZ F;  5ENP D;  3JXJ A;  5ENR D;  1BI8 B;  2ETB A;  3C5R A;  1TR4 A;  3Q9N C;  4HRM B;  4B93 B;  2A5E A;  2F37 A;  3ZU7 B;  4TUM A;  1N11 A;  2ETA A;  1WG0 A;  5ENO D;  4ZHB A;  3DEO A;  3V2O A;  4QQI A;  4HQD A;  2NYJ A;  4LSZ E;  5EYL A;  4CZ2 D;  3J5P A;  2HE0 A;  3J5Q B;  2P2C P;  5ENS D;  3EHQ A;  4HRN A;  1S70 B;  2ZGD A;  4LG6 A;  5KNH D;  4C48 B;  3ZKJ A;  1AP7 A;  4YDW A;  1K1A A;  1K3Z D;  2QYJ A;  2L6B A;  2RFM A;  1MX6 A;  4HNA D;  5EIL A;  1N0Q A;  2XZD G;  3UTM A;  5KWD A;  4RLY A;  3T8K A;  4GMR A;  4U95 D;  3W9G A;  4BEP A;  1NFI E;  3JXI A;  3TWT A;  2F8X K;  3Q9U C;  3UI2 A;  1OY3 D;  2VGE A;  3DEP A;  3V79 K;  1WDY A;  2DWZ A;  3W9F A;  4BES A;  4ZFH A;  3AAA C;  4HB5 A;  5AQB A;  4QFV A;  5CEC B;  5CBO A;  4N5Q A;  4F6R D;  1OT8 A;  2V5Q C;  2DZO A;  5JA4 D;  3B95 A;  4U8V D;  1DCQ A;  3EHR A;  5CBN A;  3NOC D;  3KEA A;  1G3N B;  4GPM A;  2ETC A;  3V31 A;  4O60 A;  1YMP A;  4DX5 D;  1MX4 A;  4Z68 A;  5KBA A;  5BXU A;  3TWX A;  4BSZ B;  4CYM D;  5FIO A;  4K5B A;  3T9K A;  4G8K A;  3LJN A;  3NOG D;  1YCS B;  2AJA A;  5AAR A;  4F1P A;  3AJI A;  2ZGG A;  3SO8 A;  5EID A;  4YDY A;  2XEH A;  5HS0 A;  4HLL A;  4OAU C;  3HG0 D;  3TWW A;  1YYH A;  1IHB A;  3HRA A;  2B0O E;  2XEN A;  1MJ0 A;  2KBX A;  4A63 B;  4O1P A;  2Y1L E;  4U8Y D;  4JB8 P;  2XEE A;  2DVW A;  5AQ7 A;  1UOH A;  1IXV A;  4HI9 A;  4DX6 D;  5EYP F;  4O1O A;  1K1B A;  5AQA A;  3UXG A;  3F6Q A;  2PNN A;  4HRL A;  4J8Y A;  4DRX E;  1MX2 A;  2DZN A;  5ENT D;  1SW6 A;  1SVX A;  3ZNG A;  4ATZ D;  1QYM A;  2J8S D;  2JAB A;  3TWU A;  5EIB E;  1AWC B;  4OAV B;  1IKN D;  4BET A;  2F8Y A;  3TWS A;  3JUE A;  4DX2 A;  3NBN B;  4K5C A;  4BER A;  4HI8 A;  1A5E A;  5CEA A;  2MYO A;  5AAO A;  4NIK A;  5AN8 A;  1BD8 A;  4HBD A;  3TWQ A;  1BLX B;  4LNU D;  1N0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...