2HE0A

Crystal structure of a human notch1 ankyrin domain mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
b'HNQTDRTGATALHLAAAYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Notch1 preproprotein variant
publication title Crystal structure of a human Notch1 ankyrin domain mutant
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 69
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2he0A00
3JXIA 5AQAA 1AWCB 5EN5D 4HI9A 4BERA 4F1PA 1K1AA 4O1OA 4ZFHA 1BD8A 1MX6A 3B95A 4K5BA 3V31A 5EIBE 4BSZB 5KNGA 3V30A 3D9HA 4U8YD 3ZKJA 4JB8P 2ETAA 2DZOA 3SO8A 5D66A 2Y0BG 4HRLA 5HS0A 5KNHD 3EU9A 5ENPD 5CBNA 3TWUA 2F37A 2V5QC 3TWQA 4UUCA 5FINA 4DX2A 5EILA 4GMRA 2RFAA 4HQDA 3DEPA 2F8YA 3T9KA 1K1BA 3TWSA 3TWTA 3Q9NC 3ZUVB 5CECB 3TWXA 4QQIA 1G3NB 1TR4A 1BU9A 1MJ0A 5AQBA 2KBXA 5BXOA 3TWWA 2ZGGA 4OAUC 5FIOA 4K5CA 1YCSB 4LNUD 5ENTD 1DC2A 1IHBA 1S70B 4DX6D 3W9FA 1BI8B 5EYLA 1WDYA 2J8SD 4ZHBA 1IKND 1BLXB 2RFMA 2ETBA 2XZDG 3HRAA 1SVXA 4DUIA 1YMPA 1YYHA 2P2CP 5CEDB 1BI7B 4F6RD 2DWZA 3LJNA 2DVWA 4YDYA 4OAVB 4HRMB 3V2XA 1K3ZD 2ZGDA 4HB5A 1SW6A 4HI8A 1OY3D 2XEHA 3F6QA 4ATZD 5AN8A 2FO1E 2NYJA 3V2OA 3AJIA 4U95D 4HBDA 3ZNGA 1AP7A 3NOGD 5HKPA 4CZ2D 5KWDA 5BXUA 5CERB 5AQ7A 3J5PA 1MYOA 1DCQA 1N0RA 2MYOA 3AAAC 4N5QA 4O60A 4RLYA 5EIDA 4J8YA 5ENSD 4LG6A 5AQ9A 1NFIE 3T8KA 3UI2A 5EYPF 4DX5D 4K5AB 2QYJA 4O1PA 4BETA 4GPMA 2VGEA 3EHQA 3J5QB 2XZTG 5CBOA 5ITZF 1MX2A 4Z68A 1IXVA 2B0OE 3B7BA 3C5RA 1OT8A 4J7WA 2XENA 5AAOA 5JA4D 5CEAA 3DEOA 2KXPC 4DX1A 4QFVA 2QC9A 2PNNA 1N11A 3JUEA 1N0QA 4BEPA 5ENRD 5HRYA 3UXGA 1D9SA 2DZNA 4YDWA 4G8KA 4LSZE 4TUMA 5ENOD 4DX7D 4HLLA 4A63B 3NBNB 4C48B 3KEAA 5JMND 3TWVA 4HNAD 2F8XK 3EHRA 5AARA 2V4HC 4G8LA 4CYMD 2HE0A 4NIKA 2BKKB 2Y1LE 2JABA 3JXJA 4B93B 5KBAA 3IXEA 1WG0A 4U8VD 4DRXE 2XEEA 3V79K 3W9GA 1A5EA 2AJAA 4BESA 3UTMA 2A5EA 2L6BA 1QYMA 3NOCD 4HRNA 1UOHA 4U96D 3TWRA 5ENQD 3ZU7B 1MX4A 2ETCA 3Q9UC 2BKGA 3HG0D
chains in the Genus database with same CATH superfamily
4GZ3A 3GW4A 1ELRA 1QQEA 2VYIA 4DK5A 4M7CA 3I4GA 3FWVA 2ZU6B 3ZKJA 3NZUA 2KCLA 5HS0A 4U04A 2RFAA 3TG4A 1TEZA 4UI9J 3FP3A 1OWPA 4A1GA 3PNLB 3B7RL 4LNUD 3E33A 4HOUA 2A4ZA 1NP7A 3PEVB 1ELWA 5FZSA 1OXJA 4ILHB 2XGOA 4J8FA 1SVXA 2QYUA 3ZGQA 2J9QA 1YYHA 4JA9A 4E85A 4WNDA 3FTXA 4GTTA 2XRYA 2H6HA 4LNGA 2H6FA 2HR2A 3BUAA 5CBOA 2FO7A 1TNYA 2C0MA 2XQ0A 4Z68A 4ANWA 2NC9A 4JD2G 2OEWA 4FC8A 3CVYA 3QWPA 4GZ5A 3U3WA 4BEPA 5HRYA 3UXGA 5ENOD 2XS8A 4HNAD 1E8YA 1KT0A 4DRXE 2XEEA 1IYGA 3APFA 1EPUA 5J08A 2BEDA 1MX6A 3ASFA 2M63A 4PS7A 1MHQA 3Q75A 3LVRE 4U0SA 4BX9A 2C0LA 3DRAA 5KBAA 5CECB 3CVXA 1MJ0A 4A1SA 5EX3A 4MKTA 2YINA 5CRVA 3DSTA 1JUQA 1PAQA 4UWFA 2EIME 1VDYA 3RJVA 1JWFA 5FQ4A 3BQOA 3FTWA 2P9KG 2DIWA 3SD5A 3CSTA 5DBKA 2XZDG 5BUZA 1D8DA 3HRAA 4L2LA 3ML8A 4HRMB 2ONDA 4GZCA 3MV3B 3D9IA 2GRQB 4CZ2D 2OVFA 5BXUA 2J4BA 2R59A 4NQ0A 2X6HA 3IHYA 3ULQA 3CQGB 3CVNA 1LD7A 1HG2A 2QC9A 3QWWA 2EIKE 4ABNA 3CHSA 4N2SA 3DWLG 5ENRD 2R02A 3BEEA 1D9SA 2DZNA 4I9EA 2WXLA 4A63B 2LNIA 3TG5A 1X81A 5AARA 4L9PA 4CYMD 4NIKA 4BTAA 3LY9A 1HF8A 2L6BA 4HOQA 2PM7A 3SQVA 2CFUA 2KATA 5G2NA 3FH5A 3V31A 2LXLA 1INZA 3OXLA 3EU9A 4D10C 4GMRA 1NA3A 4HOSA 3FTZA 3ESLA 3T8MA 1ZU2A 4OAUC 3AS5A 1DC2A 1IHBA 5EDSA 4DX6D 3EU5A 5KJLA 3Q73A 5CMYA 1WDYA 3ESKA 4U63A 1UJJA 4HORA 4KZ0A 3FDHA 5T4YA 4UWLA 2R2LA 4HLEA 3ZVVA 2DVWA 3D9KA 3L13A 1SW6A 3QJZA 3QAQA 2CFZA 1TYQG 2FO1E 3SFXA 3V2OA 2WB2A 3PUKA 3QK0A 2EIJE 2L0IA 2OVBA 4K5AB 1KZPA 1PY1A 3C3QA 4BETA 2VGEA 4H7YA 4YDEA 1IXVA 3SFZA 2XENA 3HIZA 1Z3XA 5JJTA 3OTNA 4DI3A 3ZYKA 2X6IA 2KZTB 3AU5A 1QZ2A 3U66A 3KEAA 4FADA 5E76A 4PS3A 2LXMA 1EDUA 2KZTA 3UMVA 3NOCD 3APDA 3RO2A 1SA5A 3MX3A 4JHRA 3HG0D 2XS1A 2GGFA 3HXBA 3QNKA 1ZB1A 5LP0A 5G05J 3HXDA 1KLXA 4U7EB 3EUVA 1ZBPA 5FQ7A 3PUJA 2CG3A 5M72A 3PNTB 3UKRG 3FUJA 2HO1A 1LF8A 3ZPJA 3FU0A 3DSVA 3CHPA 1JPLA 4GCNA 4WWPA 3EDTB 1H6OA 3JUIA 3APCA 3ISMC 4JC8A 3ZXPA 1E7UA 1GW6A 4R7LA 3MGBA 4ANXA 3FY4A 4ILIA 4JVSA 1W3BA 2OCCE 2OOEA 5A23A 5AN8A 4BT8A 4EZLA 4EECA 2C2LA 5D0OD 1HZ4A 4TXRA 2XPZA 4KXKB 3D9LA 3VTXA 5AQ9A 4DX5D 4GPMA 4J7WA 5CEAA 3TJPA 3L6AA 2PNNA 4XEIG 5LOZA 3HXCA 5FTPA 2I6HA 4APFA 2J09A 3E37A 1HE8A 1U2VG 3HXEA 4G8LA 3JXJA 4I9CA 1JCRA 3R9MA 3MJWA 4UQYA 2Y69E 1MX4A 2ETCA 2VSXE 3MEKA 2X6KA 4UI9K 3NF1A 4WWNA 2XCCA 2RG8A 2LSVA 3VLEA 3TAXA 1BPOA 4I6GA 5H7PA 3IEGA 3S7JA 3AS4A 5KNHD 5A7DB 3ZN3A 2UY1B 2V5QC 3L9TA 4DX2A 2F8YA 1G3NB 3RO3A 4FJZA 4G11A 2VTBB 1E8WA 1E7VA 3KSQA 2AVPA 2WXFA 4GTPA 3S2AA 3PEUB 5FWQA 3LCAA 2PL2A 4C0MA 3CQCB 4IN3B 4XI0A 4CDRA 5FQ8A 2XEHA 4KZCA 4I1OB 3AJIA 2WQ6A 2P9PG 2XHEA 1MYOA 4N5QA 4RLYA 4LG6A 3UM1A 2AWIA 4TXPA 3RAUA 3B7BA 1OT8A 3Q47B 1TN7A 3FUIA 3OXFA 3IBEA 5EKQD 3CK7A 4JA7A 3FFLA 4DI4A 3P1UA 1DVPA 3FH7A 1UG3A 4LSZE 2QY7A 2R05A 4TUMA 3GYZA 4W9RA 4CCAA 3OXGA 3U64A 3ENEA 4CDMA 2QFCA 5BNWA 3CVQA 1Z3YA 4FHJA 5KCMA 5HQ8A 3GZ2A 3C3OA 3BG1B 1MQSA 4KVOA 1MZCA 2A5UA 2CHZA 4BWRA 2R03A 1FVHA 1TJFA 3L08A 4HFGA 2FEZA 4BX8A 1E96B 1K1BA 5B3SE 3I5PA 1SA4A 3TGOA 3SF4A 3PH0C 1V55E 5ENNA 3ABME 1IQRA 4GZ6A 3DPDA 3CVWA 3IV0A 2I1JA 3UUXA 1H6PA 4YDOA 4B0ZA 3RKVA 2IY0C 2LUHA 1TJCA 4I2ZA 2WMNA 5CRUA 2BUGA 1NI1A 3CVPA 5ARFA 1E8ZA 2B0OE 4Q96A 4NRHB 4RQIA 5JHAA 4JHKA 3L17A 3FTYA 4DX1A 4CT0A 1EF1C 4WWOA 1K8KG 3SGHA 2V5FA 1LTXA 3ZRHA 3TWVA 4GA0A 4GAAA 4O6FA 3D9JA 2J08A 4AY6A 1WG0A 1OCOE 4DLOA 2A5EA 1S63A 5C2YA 2J07A 1L5JA 3JXIA 5EN5D 2P9SG 2CG2A 1JCQA 3ABKE 3RU0A 4ACLA 1OWOA 3KSLA 5FZQA 3DBSA 5D66A 4HRLA 1TNBA 3T9KA 3DEPA 3D9MA 1O1SA 5BXOA 4J8DA 1N4QA 3D3MA 4K5CA 1YCSB 2VQ2A 5C1DA 2WXGA 2RKKA 1FVFA 4PH4B 3TXMA 4J6IA 1SZ9A 4YDYA 3IKOB 2I1KA 4HB5A 1OUVA 3ZHEB 1QBQA 3FU6A 5AYWD 3FTUA 2MRIA 3IHVA 4BSXA 4U95D 4LERA 4GZDA 5CERB 2X38A 3ZXSA 2MYOA 5EIDA 2EQXA 1DNPA 3ASGA 3GZ1A 3FH8A 4HXIA 4O1PA 2XCBA 3RK6A 5FT9A 5T8IA 4YVOA 5LCWJ 1N0QA 1TN8A 4MBGA 2GRMA 3ZYLA 5BV0A 4RG6A 3ASNE 3Q7FA 2PZIA 5AJLA 3ASDA 4WAFA 2Y1LE 3LEWA 2PM6A 3K9IA 2XPYA 3L82A 3RSEG 2J49A 5ENQD 3ZU7B 4UWGA 4HOTA 4EBAA 4JW1A 2ZIRA 3HXFA 2CHWA 3Q7AA 3ML9A 3O4ZA 4U8YD 2ETAA 4GMLA 2KCVA 2F37A 3UIPC 5FINA 4G23A 5EILA 3HDXA 4GA2A 3R9AB 4QQIA 3NAWA 3B13A 5KJKA 2XRZA 3PRZA 2IJGX 3G2TA 2RFMA 4ME2A 3EIQC 2IU1A 1A17A 2KCKA 5B1BE 3AS8A 3DSXA 4JEHA 2FBNA 2NYJA 3PE4A 3Q78A 4JHJA 3KAEA 1O1RA 1AP7A 3DXKG 1H0AA 1U3DA 4N3BA 3DPYA 3D9NA 2NXPA 2L0TB 1MX2A 3U4TA 5CMWA 4N5CA 2P9NG 3QKYA 5D0QD 4XE0A 4P29A 3SBSA 3L54A 1O5MA 3FULA 2IONA 4UI9C 3UIOC 3D9OA 2F8XK 4ANVA 5DIZA 2WXMA 3QOUA 4CGVA 4J8EA 4I1AA 3W9GA 3UTMA 4AP2A 4HRNA 5G04J 1AWCB 3Q79A 2V0PA 4N3CA 5G55A 3ONKA 4FLHA 3G2WA 4IRUA 4ZFHA 3L16A 4K5BA 5EIBE 4V3IA 4I43A 4AIFA 1UJKA 4RVBA 2IOLA 3UX4A 3E30A 4ACKA 4I6JA 2GRLA 3FHEA 1HS6A 2Y4TA 4G2VA 5T3RA 3ZUVB 3TWXA 4GB9A 1OCZE 4EBAG 2ZGGA 3JQ0A 3CVLA 3KD7A 2J4DA 2HYZA 5ENTD 4GYOA 4RSYA 4F3VA 4GA1A 2X3MA 1QNFA 4XX5A 3U9WA 4FJYA 4F6RD 4AEZC 2Q7FA 5AIJA 3BU8A 1H2VC 4GCOA 2VSOE 4M3OA 3MKRA 4NACA 3B7SA 5BT1A 4A3TA 3CVUA 5AQ7A 4GYYA 3T8KA 3ZFWA 2WXNA 2V4LA 4G1TA 3HHMA 4FP7A 2XGSA 4FULA 1DCEA 4HS2A 2WXHA 3ONLA 3S7BA 4UQZA 3JUEA 3LS8A 4U0ZA 3CSFA 2VGXB 4J8SA 4JZYA 4DX7D 2P9UG 4C48B 2AW6A 4AJWA 3EIJA 2X6FA 4IYPA 3S7DA 4LEUA 4U8VD 1N4PA 4TUUA 2LAHA 1Z6TA 1QYMA 5EX0A 4BERA 4AOFA 1K1AA 3BG0B 3ZIMA 3FEYA 2GW1A 4GTQA 3RRNB 4AXHA 3SO8A 4Y6WA 1NL4A 4UUCA 1UW4B 4UWKA 2DYRE 5FZRA 5KJMA 3QC1A 1TR4A 2F0YA 3FUHA 2AXUA 3W9FA 2IFUA 3ZYQA 1TN6A 3FUNA 4OYSA 4CT4A 5CEDB 3UT4A 3V2XA 3LVQE 4TXQA 1OY3D 3G2VA 3LY7A 4ATZD 2UY1A 3ZNGA 1SQMA 5FQ6A 4O60A 1DCQA 3AAAC 1N95A 3UM0A 5D2MC 2VTBA 2YQ8A 4EQFA 2KXPC 5E75A 5KJNA 2WXIA 4RG9A 4LNBA 2PQNA 2JEKA 2RD0A 2JABA 3MCXA 1RZ4A 3SHFA 1RW2A 1JCSA 4GTSA 2IOSA 3LPZA 2AXZA 3NB2A 2ZISA 5AQAA 3MKQB 2WXQA 3CHOA 3EJNA 4GMJA 3B95A 4BSZB 3AU4A 3V30A 1FPPA 4PDXA 4FU3A 1OWLA 3PVLA 3G2SA 5ENPD 4XZ4A 3TWQA 3ASOE 3FU3A 2R5SA 3VLDA 3PZ3A 3JQ1A 3Q4AB 3ULEG 3PE3A 4FHKA 3UT8A 4AVXA 3LDZA 4LUNU 3OAWA 5ANRA 4G25A 1NZNA 2GRPB 3E4BA 3VTYA 3QDNA 5ARGA 5KWDA 2PQRA 2E0IA 3CLJA 3FU5A 2V8SE 3EHQA 3J5QB 3E32A 3FTSA 3HVEB 1N54A 2OV8A 3RRMB 4LCTA 5G05C 1FCHA 4GTVA 1N11A 4Y6CA 3HVEA 3GZSA 3DSWA 3SFYA 3NZSA 1HH8A 4DLQA 4G8KA 2MHKA 1Q2ZA 1N4RA 2V4HC 4B93B 1OCCE 4C0EA 1A5EA 1KPSB 1Z5SC 2BKGA 4HI9A 4F1PA 3FUDA 2I2OA 4L1BA 2I9CA 4JB8P 2VSNA 2DCPA 4EZKA 3TWUA 3LJ3A 4URKA 4HQDA 1OWMA 4Q94A 1FT2A 1S64A 4AY5A 3Q5MA 3ZEFA 3CHQA 4OVVA 1FT1A 1IKND 3QB2A 5BW8C 3EHNA 3FTVA 3URZA 3CV0A 3LXUX 4L7TA 3B7UX 2QZAA 3B7TA 1OWNA 2GROB 2ZGDA 2VJ8A 2MOWA 1U3CA 4N39A 2Y4UA 2NSZA 1E90A 4KVMA 2IF4A 4JL0A 4KYOB 4QFVA 1YA0A 3FEXA 4G26A 4GU5A 1HX8A 4UWHA 4WNEA 2UWJG 4HVBA 4EPZA 4L23A 3C72A 3ASHA 3FUMA 3ZHEA 3UT7A 2HE0A 2WXPA 4JEUA 4I6EA 2WVIA 4N3AA 3AG4E 3UM3A 2AJAA 4G24A 3S7FA 3C3RA 5AENA 3ABLE 2P9LG 2AXVA 4O1OA 4PS8A 2KC7A 1TNOA 3Q15A 3E34A 4B8CB 1NA0A 4WNGA 4UQXA 2R17C 1X5BA 3TWTA 3TWSA 3X2QE 2XEVA 5JJ6A 2GRNB 1H6KA 3UQ3A 2ILRA 4CEMA 4A55A 5FIOA 4AM9A 5LX8A 3CVVA 5EYLA 3MA5A 4YVQC 3CEQA 3PDNA 4OAVB 2L6JA 3CK9A 2YHCA 2L9BA 3R7RA 3JCKC 2X6JA 4K0RA 3UM2A 4I17A 5ENSD 2XGMA 2QYJA 4Q69A 5ITZF 1WM5A 2E2EA 3PZ4A 2XPIA 4LRZA 4JXTA 2YHEA 1IHGA 1HU3A 3UPVA 3ZW3A 4DJAA 4KT6B 5JJ7A 2P58C 1HG5A 4GTOA 5JMND 4APOA 5A6CA 3IXEA 2FF4A 3V79K 3R7QA 4KMOA 1UOHA 4U96D 4GTMA 3I4RB 4AV7A 2YNQA 1BD8A 1EYHA 3AG3E 3PZDA 1LD8A 3CHMA 3PZ1A 2EINE 1H19A 4E6HA 2DYSE 3SBTB 3RRUA 1S0PA 2P9IG 4N2QA 1BU9A 1Y6IA 1JWGA 1XNFA 1P5QA 1S70B 3JYSA 3SZ7A 3KEZA 1HFAA 3HYMB 1BLXB 1KZOA 1OCRE 3SI5A 2P2CP 4B94A 4F53A 3CGHA 1Y8MA 1ELKA 5IY5E 1D8EA 3MZLB 2KM4A 4B8AA 4CDNA 1N9AA 3NOGD 5HKPA 2WPVA 4MRUA 3T5VA 1N0RA 1TNZA 4J8YA 2WXJA 2IEJA 4OVUA 4IULA 4I2WA 1B89A 3T5XA 5AAOA 5JA4D 4XKBA 2IO2C 2LO6A 1E8XA 4BY6A 4ATGA 4DPRA 4L2YA 4ANUA 3D9PA 2WXKA 3EHMA 4XI9A 3PZ2A 4GPKA 4C9BB 1TNUA 4BTBA 4BESA 2Y3AA 4TRQA 5AJDA 1H2UA 3QWVA 1H2TC 4GTRA 2GRRB 1V54E 5CCMA 5KNGA 3Q49B 1O1TA 3VLFA 2DZOA 2Y0BG 2VGXA 3SY2A 1HO8A 5AQBA 2CHXA 2KBXA 5CCLA 3AG2E 4U8HA 2WXOA 3AG1E 4TV3A 3CKBA 4JPSA 1UN8A 1BI8B 5LCWC 2J8SD 4ILGA 3UKUG 4B89A 1SZAA 2JLBA 5ANLA 4DUIA 1BI7B 3LJNA 2WXRA 3ULYA 4PUCA 1K3ZD 4HI8A 3LY8A 3F6QA 3RIBA 3NQPA 3CK8A 4HBDA 2HM8A 4XIFA 4FLBA 5FJYA 3FUKA 2EILE 3N71A 3WG7E 1UN9A 3TXNA 2ZXWE 2LSUA 1NFIE 4NURA 5EYPF 2WMOA 4YNDA 5HI7A 3C5RA 2DBAA 4I1MA 5J90A 3DEOA 3L22A 3PREA 4F7AA 4YDWA 4HLLA 4F1SA 4K03A 2FULA 1N4SA 2H6IA 3EHRA 4A3VA 4BT9A 5LFAA 2BF0X 2WQHA 2FI7A 3UINC 1N52A 3CIAA 3D9HA 3MV2B 4EHMA 5BV1A 5CBNA 3TL5A 3C98A 2WM9A 2IQCA 4XKCA 1KT1A 5BPPA 3FUFA 3Q9NC 2OEVA 3DSUA 4WUYA 2VSYA 3TWWA 3WXXA 3G2UA 3KS2A 2BTDA 3LKUA 1N94A 4KBQA 3O48A 2WQ7A 1PC2A 1IQUA 1WY6A 2B6CA 4ZHBA 5JHBA 2ETBA 3MKQA 1WAO1 4H7XA 1YMPA 4CRWA 2DWZA 2VGYA 4MS6A 3QARA 3CR3A 4U0UA 3MYVA 2LAIA 4EZJA 5B1AE 3J5PA 3PS6A 4X8QA 3UI2A 4J0UA 5G04C 3ZYMA 2H6GA 2XZTG 3P2BA 1XGWA 3CHRA 4U07A 3I3NA 4WNFA 3DXMG 4FA6A 2IO3C 3LYAA 4CGWA 4MLPA 3NBNB 3FUEA 1HXIA 4BFRA 3SNXA 2BKKB 3CKCA 5CHEE 3TWRA 3DSSA 4GYWA 3Q9UC
chains in the Genus database with same CATH topology
3JXIA 5AQAA 1AWCB 5EN5D 4HI9A 4BERA 4F1PA 1K1AA 4O1OA 4ZFHA 1BD8A 1MX6A 3B95A 4K5BA 3V31A 5EIBE 4BSZB 5KNGA 3V30A 3D9HA 4U8YD 3ZKJA 4JB8P 2ETAA 2DZOA 3SO8A 5D66A 2Y0BG 4HRLA 5HS0A 5KNHD 3EU9A 5ENPD 5CBNA 3TWUA 2F37A 2V5QC 3TWQA 4UUCA 5FINA 4DX2A 5EILA 4GMRA 2RFAA 4HQDA 3DEPA 2F8YA 3T9KA 1K1BA 3TWSA 3TWTA 3Q9NC 3ZUVB 5CECB 3TWXA 4QQIA 1G3NB 1TR4A 1BU9A 1MJ0A 5AQBA 2KBXA 5BXOA 3TWWA 2ZGGA 4OAUC 5FIOA 4K5CA 1YCSB 4LNUD 5ENTD 1DC2A 1IHBA 1S70B 4DX6D 3W9FA 1BI8B 5EYLA 1WDYA 2J8SD 4ZHBA 1IKND 1BLXB 2RFMA 2ETBA 2XZDG 3HRAA 1SVXA 4DUIA 1YMPA 1YYHA 2P2CP 5CEDB 1BI7B 4F6RD 2DWZA 3LJNA 2DVWA 4YDYA 4OAVB 4HRMB 3V2XA 1K3ZD 2ZGDA 4HB5A 1SW6A 4HI8A 1OY3D 2XEHA 3F6QA 4ATZD 5AN8A 2FO1E 2NYJA 3V2OA 3AJIA 4U95D 4HBDA 3ZNGA 1AP7A 3NOGD 5HKPA 4CZ2D 5KWDA 5BXUA 5CERB 5AQ7A 3J5PA 1MYOA 1DCQA 1N0RA 2MYOA 3AAAC 4N5QA 4O60A 4RLYA 5EIDA 4J8YA 5ENSD 4LG6A 5AQ9A 1NFIE 3T8KA 3UI2A 5EYPF 4DX5D 4K5AB 2QYJA 4O1PA 4BETA 4GPMA 2VGEA 3EHQA 3J5QB 2XZTG 5CBOA 5ITZF 1MX2A 4Z68A 1IXVA 2B0OE 3B7BA 3C5RA 1OT8A 4J7WA 2XENA 5AAOA 5JA4D 5CEAA 3DEOA 2KXPC 4DX1A 4QFVA 2QC9A 2PNNA 1N11A 3JUEA 1N0QA 4BEPA 5ENRD 5HRYA 3UXGA 1D9SA 2DZNA 4YDWA 4G8KA 4LSZE 4TUMA 5ENOD 4DX7D 4HLLA 4A63B 3NBNB 4C48B 3KEAA 5JMND 3TWVA 4HNAD 2F8XK 3EHRA 5AARA 2V4HC 4G8LA 4CYMD 2HE0A 4NIKA 2BKKB 2Y1LE 2JABA 3JXJA 4B93B 5KBAA 3IXEA 1WG0A 4U8VD 4DRXE 2XEEA 3V79K 3W9GA 1A5EA 2AJAA 4BESA 3UTMA 2A5EA 2L6BA 1QYMA 3NOCD 4HRNA 1UOHA 4U96D 3TWRA 5ENQD 3ZU7B 1MX4A 2ETCA 3Q9UC 2BKGA 3HG0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXI A;  5AQA A;  1AWC B;  5EN5 D;  4HI9 A;  4BER A;  4F1P A;  1K1A A;  4O1O A;  4ZFH A;  1BD8 A;  1MX6 A;  3B95 A;  4K5B A;  3V31 A;  5EIB E;  4BSZ B;  5KNG A;  3V30 A;  3D9H A;  4U8Y D;  3ZKJ A;  4JB8 P;  2ETA A;  2DZO A;  3SO8 A;  5D66 A;  2Y0B G;  4HRL A;  5HS0 A;  5KNH D;  3EU9 A;  5ENP D;  5CBN A;  3TWU A;  2F37 A;  2V5Q C;  3TWQ A;  4UUC A;  5FIN A;  4DX2 A;  5EIL A;  4GMR A;  2RFA A;  4HQD A;  3DEP A;  2F8Y A;  3T9K A;  1K1B A;  3TWS A;  3TWT A;  3Q9N C;  3ZUV B;  5CEC B;  3TWX A;  4QQI A;  1G3N B;  1TR4 A;  1BU9 A;  1MJ0 A;  5AQB A;  2KBX A;  5BXO A;  3TWW A;  2ZGG A;  4OAU C;  5FIO A;  4K5C A;  1YCS B;  4LNU D;  5ENT D;  1DC2 A;  1IHB A;  1S70 B;  4DX6 D;  3W9F A;  1BI8 B;  5EYL A;  1WDY A;  2J8S D;  4ZHB A;  1IKN D;  1BLX B;  2RFM A;  2ETB A;  2XZD G;  3HRA A;  1SVX A;  4DUI A;  1YMP A;  1YYH A;  2P2C P;  5CED B;  1BI7 B;  4F6R D;  2DWZ A;  3LJN A;  2DVW A;  4YDY A;  4OAV B;  4HRM B;  3V2X A;  1K3Z D;  2ZGD A;  4HB5 A;  1SW6 A;  4HI8 A;  1OY3 D;  2XEH A;  3F6Q A;  4ATZ D;  5AN8 A;  2FO1 E;  2NYJ A;  3V2O A;  3AJI A;  4U95 D;  4HBD A;  3ZNG A;  1AP7 A;  3NOG D;  5HKP A;  4CZ2 D;  5KWD A;  5BXU A;  5CER B;  5AQ7 A;  3J5P A;  1MYO A;  1DCQ A;  1N0R A;  2MYO A;  3AAA C;  4N5Q A;  4O60 A;  4RLY A;  5EID A;  4J8Y A;  5ENS D;  4LG6 A;  5AQ9 A;  1NFI E;  3T8K A;  3UI2 A;  5EYP F;  4DX5 D;  4K5A B;  2QYJ A;  4O1P A;  4BET A;  4GPM A;  2VGE A;  3EHQ A;  3J5Q B;  2XZT G;  5CBO A;  5ITZ F;  1MX2 A;  4Z68 A;  1IXV A;  2B0O E;  3B7B A;  3C5R A;  1OT8 A;  4J7W A;  2XEN A;  5AAO A;  5JA4 D;  5CEA A;  3DEO A;  2KXP C;  4DX1 A;  4QFV A;  2QC9 A;  2PNN A;  1N11 A;  3JUE A;  1N0Q A;  4BEP A;  5ENR D;  5HRY A;  3UXG A;  1D9S A;  2DZN A;  4YDW A;  4G8K A;  4LSZ E;  4TUM A;  5ENO D;  4DX7 D;  4HLL A;  4A63 B;  3NBN B;  4C48 B;  3KEA A;  5JMN D;  3TWV A;  4HNA D;  2F8X K;  3EHR A;  5AAR A;  2V4H C;  4G8L A;  4CYM D;  2HE0 A;  4NIK A;  2BKK B;  2Y1L E;  2JAB A;  3JXJ A;  4B93 B;  5KBA A;  3IXE A;  1WG0 A;  4U8V D;  4DRX E;  2XEE A;  3V79 K;  3W9G A;  1A5E A;  2AJA A;  4BES A;  3UTM A;  2A5E A;  2L6B A;  1QYM A;  3NOC D;  4HRN A;  1UOH A;  4U96 D;  3TWR A;  5ENQ D;  3ZU7 B;  1MX4 A;  2ETC A;  3Q9U C;  2BKG A;  3HG0 D; 
#chains in the Genus database with same CATH topology
 4GZ3 A;  3GW4 A;  1ELR A;  1QQE A;  2VYI A;  4DK5 A;  4M7C A;  3I4G A;  3FWV A;  2ZU6 B;  3ZKJ A;  3NZU A;  2KCL A;  5HS0 A;  4U04 A;  2RFA A;  3TG4 A;  1TEZ A;  4UI9 J;  3FP3 A;  1OWP A;  4A1G A;  3PNL B;  3B7R L;  4LNU D;  3E33 A;  4HOU A;  2A4Z A;  1NP7 A;  3PEV B;  1ELW A;  5FZS A;  1OXJ A;  4ILH B;  2XGO A;  4J8F A;  1SVX A;  2QYU A;  3ZGQ A;  2J9Q A;  1YYH A;  4JA9 A;  4E85 A;  4WND A;  3FTX A;  4GTT A;  2XRY A;  2H6H A;  4LNG A;  2H6F A;  2HR2 A;  3BUA A;  5CBO A;  2FO7 A;  1TNY A;  2C0M A;  2XQ0 A;  4Z68 A;  4ANW A;  2NC9 A;  4JD2 G;  2OEW A;  4FC8 A;  3CVY A;  3QWP A;  4GZ5 A;  3U3W A;  4BEP A;  5HRY A;  3UXG A;  5ENO D;  2XS8 A;  4HNA D;  1E8Y A;  1KT0 A;  4DRX E;  2XEE A;  1IYG A;  3APF A;  1EPU A;  5J08 A;  2BED A;  1MX6 A;  3ASF A;  2M63 A;  4PS7 A;  1MHQ A;  3Q75 A;  3LVR E;  4U0S A;  4BX9 A;  2C0L A;  3DRA A;  5KBA A;  5CEC B;  3CVX A;  1MJ0 A;  4A1S A;  5EX3 A;  4MKT A;  2YIN A;  5CRV A;  3DST A;  1JUQ A;  1PAQ A;  4UWF A;  2EIM E;  1VDY A;  3RJV A;  1JWF A;  5FQ4 A;  3BQO A;  3FTW A;  2P9K G;  2DIW A;  3SD5 A;  3CST A;  5DBK A;  2XZD G;  5BUZ A;  1D8D A;  3HRA A;  4L2L A;  3ML8 A;  4HRM B;  2OND A;  4GZC A;  3MV3 B;  3D9I A;  2GRQ B;  4CZ2 D;  2OVF A;  5BXU A;  2J4B A;  2R59 A;  4NQ0 A;  2X6H A;  3IHY A;  3ULQ A;  3CQG B;  3CVN A;  1LD7 A;  1HG2 A;  2QC9 A;  3QWW A;  2EIK E;  4ABN A;  3CHS A;  4N2S A;  3DWL G;  5ENR D;  2R02 A;  3BEE A;  1D9S A;  2DZN A;  4I9E A;  2WXL A;  4A63 B;  2LNI A;  3TG5 A;  1X81 A;  5AAR A;  4L9P A;  4CYM D;  4NIK A;  4BTA A;  3LY9 A;  1HF8 A;  2L6B A;  4HOQ A;  2PM7 A;  3SQV A;  2CFU A;  2KAT A;  5G2N A;  3FH5 A;  3V31 A;  2LXL A;  1INZ A;  3OXL A;  3EU9 A;  4D10 C;  4GMR A;  1NA3 A;  4HOS A;  3FTZ A;  3ESL A;  3T8M A;  1ZU2 A;  4OAU C;  3AS5 A;  1DC2 A;  1IHB A;  5EDS A;  4DX6 D;  3EU5 A;  5KJL A;  3Q73 A;  5CMY A;  1WDY A;  3ESK A;  4U63 A;  1UJJ A;  4HOR A;  4KZ0 A;  3FDH A;  5T4Y A;  4UWL A;  2R2L A;  4HLE A;  3ZVV A;  2DVW A;  3D9K A;  3L13 A;  1SW6 A;  3QJZ A;  3QAQ A;  2CFZ A;  1TYQ G;  2FO1 E;  3SFX A;  3V2O A;  2WB2 A;  3PUK A;  3QK0 A;  2EIJ E;  2L0I A;  2OVB A;  4K5A B;  1KZP A;  1PY1 A;  3C3Q A;  4BET A;  2VGE A;  4H7Y A;  4YDE A;  1IXV A;  3SFZ A;  2XEN A;  3HIZ A;  1Z3X A;  5JJT A;  3OTN A;  4DI3 A;  3ZYK A;  2X6I A;  2KZT B;  3AU5 A;  1QZ2 A;  3U66 A;  3KEA A;  4FAD A;  5E76 A;  4PS3 A;  2LXM A;  1EDU A;  2KZT A;  3UMV A;  3NOC D;  3APD A;  3RO2 A;  1SA5 A;  3MX3 A;  4JHR A;  3HG0 D;  2XS1 A;  2GGF A;  3HXB A;  3QNK A;  1ZB1 A;  5LP0 A;  5G05 J;  3HXD A;  1KLX A;  4U7E B;  3EUV A;  1ZBP A;  5FQ7 A;  3PUJ A;  2CG3 A;  5M72 A;  3PNT B;  3UKR G;  3FUJ A;  2HO1 A;  1LF8 A;  3ZPJ A;  3FU0 A;  3DSV A;  3CHP A;  1JPL A;  4GCN A;  4WWP A;  3EDT B;  1H6O A;  3JUI A;  3APC A;  3ISM C;  4JC8 A;  3ZXP A;  1E7U A;  1GW6 A;  4R7L A;  3MGB A;  4ANX A;  3FY4 A;  4ILI A;  4JVS A;  1W3B A;  2OCC E;  2OOE A;  5A23 A;  5AN8 A;  4BT8 A;  4EZL A;  4EEC A;  2C2L A;  5D0O D;  1HZ4 A;  4TXR A;  2XPZ A;  4KXK B;  3D9L A;  3VTX A;  5AQ9 A;  4DX5 D;  4GPM A;  4J7W A;  5CEA A;  3TJP A;  3L6A A;  2PNN A;  4XEI G;  5LOZ A;  3HXC A;  5FTP A;  2I6H A;  4APF A;  2J09 A;  3E37 A;  1HE8 A;  1U2V G;  3HXE A;  4G8L A;  3JXJ A;  4I9C A;  1JCR A;  3R9M A;  3MJW A;  4UQY A;  2Y69 E;  1MX4 A;  2ETC A;  2VSX E;  3MEK A;  2X6K A;  4UI9 K;  3NF1 A;  4WWN A;  2XCC A;  2RG8 A;  2LSV A;  3VLE A;  3TAX A;  1BPO A;  4I6G A;  5H7P A;  3IEG A;  3S7J A;  3AS4 A;  5KNH D;  5A7D B;  3ZN3 A;  2UY1 B;  2V5Q C;  3L9T A;  4DX2 A;  2F8Y A;  1G3N B;  3RO3 A;  4FJZ A;  4G11 A;  2VTB B;  1E8W A;  1E7V A;  3KSQ A;  2AVP A;  2WXF A;  4GTP A;  3S2A A;  3PEU B;  5FWQ A;  3LCA A;  2PL2 A;  4C0M A;  3CQC B;  4IN3 B;  4XI0 A;  4CDR A;  5FQ8 A;  2XEH A;  4KZC A;  4I1O B;  3AJI A;  2WQ6 A;  2P9P G;  2XHE A;  1MYO A;  4N5Q A;  4RLY A;  4LG6 A;  3UM1 A;  2AWI A;  4TXP A;  3RAU A;  3B7B A;  1OT8 A;  3Q47 B;  1TN7 A;  3FUI A;  3OXF A;  3IBE A;  5EKQ D;  3CK7 A;  4JA7 A;  3FFL A;  4DI4 A;  3P1U A;  1DVP A;  3FH7 A;  1UG3 A;  4LSZ E;  2QY7 A;  2R05 A;  4TUM A;  3GYZ A;  4W9R A;  4CCA A;  3OXG A;  3U64 A;  3ENE A;  4CDM A;  2QFC A;  5BNW A;  3CVQ A;  1Z3Y A;  4FHJ A;  5KCM A;  5HQ8 A;  3GZ2 A;  3C3O A;  3BG1 B;  1MQS A;  4KVO A;  1MZC A;  2A5U A;  2CHZ A;  4BWR A;  2R03 A;  1FVH A;  1TJF A;  3L08 A;  4HFG A;  2FEZ A;  4BX8 A;  1E96 B;  1K1B A;  5B3S E;  3I5P A;  1SA4 A;  3TGO A;  3SF4 A;  3PH0 C;  1V55 E;  5ENN A;  3ABM E;  1IQR A;  4GZ6 A;  3DPD A;  3CVW A;  3IV0 A;  2I1J A;  3UUX A;  1H6P A;  4YDO A;  4B0Z A;  3RKV A;  2IY0 C;  2LUH A;  1TJC A;  4I2Z A;  2WMN A;  5CRU A;  2BUG A;  1NI1 A;  3CVP A;  5ARF A;  1E8Z A;  2B0O E;  4Q96 A;  4NRH B;  4RQI A;  5JHA A;  4JHK A;  3L17 A;  3FTY A;  4DX1 A;  4CT0 A;  1EF1 C;  4WWO A;  1K8K G;  3SGH A;  2V5F A;  1LTX A;  3ZRH A;  3TWV A;  4GA0 A;  4GAA A;  4O6F A;  3D9J A;  2J08 A;  4AY6 A;  1WG0 A;  1OCO E;  4DLO A;  2A5E A;  1S63 A;  5C2Y A;  2J07 A;  1L5J A;  3JXI A;  5EN5 D;  2P9S G;  2CG2 A;  1JCQ A;  3ABK E;  3RU0 A;  4ACL A;  1OWO A;  3KSL A;  5FZQ A;  3DBS A;  5D66 A;  4HRL A;  1TNB A;  3T9K A;  3DEP A;  3D9M A;  1O1S A;  5BXO A;  4J8D A;  1N4Q A;  3D3M A;  4K5C A;  1YCS B;  2VQ2 A;  5C1D A;  2WXG A;  2RKK A;  1FVF A;  4PH4 B;  3TXM A;  4J6I A;  1SZ9 A;  4YDY A;  3IKO B;  2I1K A;  4HB5 A;  1OUV A;  3ZHE B;  1QBQ A;  3FU6 A;  5AYW D;  3FTU A;  2MRI A;  3IHV A;  4BSX A;  4U95 D;  4LER A;  4GZD A;  5CER B;  2X38 A;  3ZXS A;  2MYO A;  5EID A;  2EQX A;  1DNP A;  3ASG A;  3GZ1 A;  3FH8 A;  4HXI A;  4O1P A;  2XCB A;  3RK6 A;  5FT9 A;  5T8I A;  4YVO A;  5LCW J;  1N0Q A;  1TN8 A;  4MBG A;  2GRM A;  3ZYL A;  5BV0 A;  4RG6 A;  3ASN E;  3Q7F A;  2PZI A;  5AJL A;  3ASD A;  4WAF A;  2Y1L E;  3LEW A;  2PM6 A;  3K9I A;  2XPY A;  3L82 A;  3RSE G;  2J49 A;  5ENQ D;  3ZU7 B;  4UWG A;  4HOT A;  4EBA A;  4JW1 A;  2ZIR A;  3HXF A;  2CHW A;  3Q7A A;  3ML9 A;  3O4Z A;  4U8Y D;  2ETA A;  4GML A;  2KCV A;  2F37 A;  3UIP C;  5FIN A;  4G23 A;  5EIL A;  3HDX A;  4GA2 A;  3R9A B;  4QQI A;  3NAW A;  3B13 A;  5KJK A;  2XRZ A;  3PRZ A;  2IJG X;  3G2T A;  2RFM A;  4ME2 A;  3EIQ C;  2IU1 A;  1A17 A;  2KCK A;  5B1B E;  3AS8 A;  3DSX A;  4JEH A;  2FBN A;  2NYJ A;  3PE4 A;  3Q78 A;  4JHJ A;  3KAE A;  1O1R A;  1AP7 A;  3DXK G;  1H0A A;  1U3D A;  4N3B A;  3DPY A;  3D9N A;  2NXP A;  2L0T B;  1MX2 A;  3U4T A;  5CMW A;  4N5C A;  2P9N G;  3QKY A;  5D0Q D;  4XE0 A;  4P29 A;  3SBS A;  3L54 A;  1O5M A;  3FUL A;  2ION A;  4UI9 C;  3UIO C;  3D9O A;  2F8X K;  4ANV A;  5DIZ A;  2WXM A;  3QOU A;  4CGV A;  4J8E A;  4I1A A;  3W9G A;  3UTM A;  4AP2 A;  4HRN A;  5G04 J;  1AWC B;  3Q79 A;  2V0P A;  4N3C A;  5G55 A;  3ONK A;  4FLH A;  3G2W A;  4IRU A;  4ZFH A;  3L16 A;  4K5B A;  5EIB E;  4V3I A;  4I43 A;  4AIF A;  1UJK A;  4RVB A;  2IOL A;  3UX4 A;  3E30 A;  4ACK A;  4I6J A;  2GRL A;  3FHE A;  1HS6 A;  2Y4T A;  4G2V A;  5T3R A;  3ZUV B;  3TWX A;  4GB9 A;  1OCZ E;  4EBA G;  2ZGG A;  3JQ0 A;  3CVL A;  3KD7 A;  2J4D A;  2HYZ A;  5ENT D;  4GYO A;  4RSY A;  4F3V A;  4GA1 A;  2X3M A;  1QNF A;  4XX5 A;  3U9W A;  4FJY A;  4F6R D;  4AEZ C;  2Q7F A;  5AIJ A;  3BU8 A;  1H2V C;  4GCO A;  2VSO E;  4M3O A;  3MKR A;  4NAC A;  3B7S A;  5BT1 A;  4A3T A;  3CVU A;  5AQ7 A;  4GYY A;  3T8K A;  3ZFW A;  2WXN A;  2V4L A;  4G1T A;  3HHM A;  4FP7 A;  2XGS A;  4FUL A;  1DCE A;  4HS2 A;  2WXH A;  3ONL A;  3S7B A;  4UQZ A;  3JUE A;  3LS8 A;  4U0Z A;  3CSF A;  2VGX B;  4J8S A;  4JZY A;  4DX7 D;  2P9U G;  4C48 B;  2AW6 A;  4AJW A;  3EIJ A;  2X6F A;  4IYP A;  3S7D A;  4LEU A;  4U8V D;  1N4P A;  4TUU A;  2LAH A;  1Z6T A;  1QYM A;  5EX0 A;  4BER A;  4AOF A;  1K1A A;  3BG0 B;  3ZIM A;  3FEY A;  2GW1 A;  4GTQ A;  3RRN B;  4AXH A;  3SO8 A;  4Y6W A;  1NL4 A;  4UUC A;  1UW4 B;  4UWK A;  2DYR E;  5FZR A;  5KJM A;  3QC1 A;  1TR4 A;  2F0Y A;  3FUH A;  2AXU A;  3W9F A;  2IFU A;  3ZYQ A;  1TN6 A;  3FUN A;  4OYS A;  4CT4 A;  5CED B;  3UT4 A;  3V2X A;  3LVQ E;  4TXQ A;  1OY3 D;  3G2V A;  3LY7 A;  4ATZ D;  2UY1 A;  3ZNG A;  1SQM A;  5FQ6 A;  4O60 A;  1DCQ A;  3AAA C;  1N95 A;  3UM0 A;  5D2M C;  2VTB A;  2YQ8 A;  4EQF A;  2KXP C;  5E75 A;  5KJN A;  2WXI A;  4RG9 A;  4LNB A;  2PQN A;  2JEK A;  2RD0 A;  2JAB A;  3MCX A;  1RZ4 A;  3SHF A;  1RW2 A;  1JCS A;  4GTS A;  2IOS A;  3LPZ A;  2AXZ A;  3NB2 A;  2ZIS A;  5AQA A;  3MKQ B;  2WXQ A;  3CHO A;  3EJN A;  4GMJ A;  3B95 A;  4BSZ B;  3AU4 A;  3V30 A;  1FPP A;  4PDX A;  4FU3 A;  1OWL A;  3PVL A;  3G2S A;  5ENP D;  4XZ4 A;  3TWQ A;  3ASO E;  3FU3 A;  2R5S A;  3VLD A;  3PZ3 A;  3JQ1 A;  3Q4A B;  3ULE G;  3PE3 A;  4FHK A;  3UT8 A;  4AVX A;  3LDZ A;  4LUN U;  3OAW A;  5ANR A;  4G25 A;  1NZN A;  2GRP B;  3E4B A;  3VTY A;  3QDN A;  5ARG A;  5KWD A;  2PQR A;  2E0I A;  3CLJ A;  3FU5 A;  2V8S E;  3EHQ A;  3J5Q B;  3E32 A;  3FTS A;  3HVE B;  1N54 A;  2OV8 A;  3RRM B;  4LCT A;  5G05 C;  1FCH A;  4GTV A;  1N11 A;  4Y6C A;  3HVE A;  3GZS A;  3DSW A;  3SFY A;  3NZS A;  1HH8 A;  4DLQ A;  4G8K A;  2MHK A;  1Q2Z A;  1N4R A;  2V4H C;  4B93 B;  1OCC E;  4C0E A;  1A5E A;  1KPS B;  1Z5S C;  2BKG A;  4HI9 A;  4F1P A;  3FUD A;  2I2O A;  4L1B A;  2I9C A;  4JB8 P;  2VSN A;  2DCP A;  4EZK A;  3TWU A;  3LJ3 A;  4URK A;  4HQD A;  1OWM A;  4Q94 A;  1FT2 A;  1S64 A;  4AY5 A;  3Q5M A;  3ZEF A;  3CHQ A;  4OVV A;  1FT1 A;  1IKN D;  3QB2 A;  5BW8 C;  3EHN A;  3FTV A;  3URZ A;  3CV0 A;  3LXU X;  4L7T A;  3B7U X;  2QZA A;  3B7T A;  1OWN A;  2GRO B;  2ZGD A;  2VJ8 A;  2MOW A;  1U3C A;  4N39 A;  2Y4U A;  2NSZ A;  1E90 A;  4KVM A;  2IF4 A;  4JL0 A;  4KYO B;  4QFV A;  1YA0 A;  3FEX A;  4G26 A;  4GU5 A;  1HX8 A;  4UWH A;  4WNE A;  2UWJ G;  4HVB A;  4EPZ A;  4L23 A;  3C72 A;  3ASH A;  3FUM A;  3ZHE A;  3UT7 A;  2HE0 A;  2WXP A;  4JEU A;  4I6E A;  2WVI A;  4N3A A;  3AG4 E;  3UM3 A;  2AJA A;  4G24 A;  3S7F A;  3C3R A;  5AEN A;  3ABL E;  2P9L G;  2AXV A;  4O1O A;  4PS8 A;  2KC7 A;  1TNO A;  3Q15 A;  3E34 A;  4B8C B;  1NA0 A;  4WNG A;  4UQX A;  2R17 C;  1X5B A;  3TWT A;  3TWS A;  3X2Q E;  2XEV A;  5JJ6 A;  2GRN B;  1H6K A;  3UQ3 A;  2ILR A;  4CEM A;  4A55 A;  5FIO A;  4AM9 A;  5LX8 A;  3CVV A;  5EYL A;  3MA5 A;  4YVQ C;  3CEQ A;  3PDN A;  4OAV B;  2L6J A;  3CK9 A;  2YHC A;  2L9B A;  3R7R A;  3JCK C;  2X6J A;  4K0R A;  3UM2 A;  4I17 A;  5ENS D;  2XGM A;  2QYJ A;  4Q69 A;  5ITZ F;  1WM5 A;  2E2E A;  3PZ4 A;  2XPI A;  4LRZ A;  4JXT A;  2YHE A;  1IHG A;  1HU3 A;  3UPV A;  3ZW3 A;  4DJA A;  4KT6 B;  5JJ7 A;  2P58 C;  1HG5 A;  4GTO A;  5JMN D;  4APO A;  5A6C A;  3IXE A;  2FF4 A;  3V79 K;  3R7Q A;  4KMO A;  1UOH A;  4U96 D;  4GTM A;  3I4R B;  4AV7 A;  2YNQ A;  1BD8 A;  1EYH A;  3AG3 E;  3PZD A;  1LD8 A;  3CHM A;  3PZ1 A;  2EIN E;  1H19 A;  4E6H A;  2DYS E;  3SBT B;  3RRU A;  1S0P A;  2P9I G;  4N2Q A;  1BU9 A;  1Y6I A;  1JWG A;  1XNF A;  1P5Q A;  1S70 B;  3JYS A;  3SZ7 A;  3KEZ A;  1HFA A;  3HYM B;  1BLX B;  1KZO A;  1OCR E;  3SI5 A;  2P2C P;  4B94 A;  4F53 A;  3CGH A;  1Y8M A;  1ELK A;  5IY5 E;  1D8E A;  3MZL B;  2KM4 A;  4B8A A;  4CDN A;  1N9A A;  3NOG D;  5HKP A;  2WPV A;  4MRU A;  3T5V A;  1N0R A;  1TNZ A;  4J8Y A;  2WXJ A;  2IEJ A;  4OVU A;  4IUL A;  4I2W A;  1B89 A;  3T5X A;  5AAO A;  5JA4 D;  4XKB A;  2IO2 C;  2LO6 A;  1E8X A;  4BY6 A;  4ATG A;  4DPR A;  4L2Y A;  4ANU A;  3D9P A;  2WXK A;  3EHM A;  4XI9 A;  3PZ2 A;  4GPK A;  4C9B B;  1TNU A;  4BTB A;  4BES A;  2Y3A A;  4TRQ A;  5AJD A;  1H2U A;  3QWV A;  1H2T C;  4GTR A;  2GRR B;  1V54 E;  5CCM A;  5KNG A;  3Q49 B;  1O1T A;  3VLF A;  2DZO A;  2Y0B G;  2VGX A;  3SY2 A;  1HO8 A;  5AQB A;  2CHX A;  2KBX A;  5CCL A;  3AG2 E;  4U8H A;  2WXO A;  3AG1 E;  4TV3 A;  3CKB A;  4JPS A;  1UN8 A;  1BI8 B;  5LCW C;  2J8S D;  4ILG A;  3UKU G;  4B89 A;  1SZA A;  2JLB A;  5ANL A;  4DUI A;  1BI7 B;  3LJN A;  2WXR A;  3ULY A;  4PUC A;  1K3Z D;  4HI8 A;  3LY8 A;  3F6Q A;  3RIB A;  3NQP A;  3CK8 A;  4HBD A;  2HM8 A;  4XIF A;  4FLB A;  5FJY A;  3FUK A;  2EIL E;  3N71 A;  3WG7 E;  1UN9 A;  3TXN A;  2ZXW E;  2LSU A;  1NFI E;  4NUR A;  5EYP F;  2WMO A;  4YND A;  5HI7 A;  3C5R A;  2DBA A;  4I1M A;  5J90 A;  3DEO A;  3L22 A;  3PRE A;  4F7A A;  4YDW A;  4HLL A;  4F1S A;  4K03 A;  2FUL A;  1N4S A;  2H6I A;  3EHR A;  4A3V A;  4BT9 A;  5LFA A;  2BF0 X;  2WQH A;  2FI7 A;  3UIN C;  1N52 A;  3CIA A;  3D9H A;  3MV2 B;  4EHM A;  5BV1 A;  5CBN A;  3TL5 A;  3C98 A;  2WM9 A;  2IQC A;  4XKC A;  1KT1 A;  5BPP A;  3FUF A;  3Q9N C;  2OEV A;  3DSU A;  4WUY A;  2VSY A;  3TWW A;  3WXX A;  3G2U A;  3KS2 A;  2BTD A;  3LKU A;  1N94 A;  4KBQ A;  3O48 A;  2WQ7 A;  1PC2 A;  1IQU A;  1WY6 A;  2B6C A;  4ZHB A;  5JHB A;  2ETB A;  3MKQ A;  1WAO 1;  4H7X A;  1YMP A;  4CRW A;  2DWZ A;  2VGY A;  4MS6 A;  3QAR A;  3CR3 A;  4U0U A;  3MYV A;  2LAI A;  4EZJ A;  5B1A E;  3J5P A;  3PS6 A;  4X8Q A;  3UI2 A;  4J0U A;  5G04 C;  3ZYM A;  2H6G A;  2XZT G;  3P2B A;  1XGW A;  3CHR A;  4U07 A;  3I3N A;  4WNF A;  3DXM G;  4FA6 A;  2IO3 C;  3LYA A;  4CGW A;  4MLP A;  3NBN B;  3FUE A;  1HXI A;  4BFR A;  3SNX A;  2BKK B;  3CKC A;  5CHE E;  3TWR A;  3DSS A;  4GYW A;  3Q9U C; 
#chains in the Genus database with same CATH homology
 3JXI A;  5AQA A;  1AWC B;  5EN5 D;  4HI9 A;  4BER A;  4F1P A;  1K1A A;  4O1O A;  4ZFH A;  1BD8 A;  1MX6 A;  3B95 A;  4K5B A;  3V31 A;  5EIB E;  4BSZ B;  5KNG A;  3V30 A;  3D9H A;  4U8Y D;  3ZKJ A;  4JB8 P;  2ETA A;  2DZO A;  3SO8 A;  5D66 A;  2Y0B G;  4HRL A;  5HS0 A;  5KNH D;  3EU9 A;  5ENP D;  5CBN A;  3TWU A;  2F37 A;  2V5Q C;  3TWQ A;  4UUC A;  5FIN A;  4DX2 A;  5EIL A;  4GMR A;  2RFA A;  4HQD A;  3DEP A;  2F8Y A;  3T9K A;  1K1B A;  3TWS A;  3TWT A;  3Q9N C;  3ZUV B;  5CEC B;  3TWX A;  4QQI A;  1G3N B;  1TR4 A;  1BU9 A;  1MJ0 A;  5AQB A;  2KBX A;  5BXO A;  3TWW A;  2ZGG A;  4OAU C;  5FIO A;  4K5C A;  1YCS B;  4LNU D;  5ENT D;  1DC2 A;  1IHB A;  1S70 B;  4DX6 D;  3W9F A;  1BI8 B;  5EYL A;  1WDY A;  2J8S D;  4ZHB A;  1IKN D;  1BLX B;  2RFM A;  2ETB A;  2XZD G;  3HRA A;  1SVX A;  4DUI A;  1YMP A;  1YYH A;  2P2C P;  5CED B;  1BI7 B;  4F6R D;  2DWZ A;  3LJN A;  2DVW A;  4YDY A;  4OAV B;  4HRM B;  3V2X A;  1K3Z D;  2ZGD A;  4HB5 A;  1SW6 A;  4HI8 A;  1OY3 D;  2XEH A;  3F6Q A;  4ATZ D;  5AN8 A;  2FO1 E;  2NYJ A;  3V2O A;  3AJI A;  4U95 D;  4HBD A;  3ZNG A;  1AP7 A;  3NOG D;  5HKP A;  4CZ2 D;  5KWD A;  5BXU A;  5CER B;  5AQ7 A;  3J5P A;  1MYO A;  1DCQ A;  1N0R A;  2MYO A;  3AAA C;  4N5Q A;  4O60 A;  4RLY A;  5EID A;  4J8Y A;  5ENS D;  4LG6 A;  5AQ9 A;  1NFI E;  3T8K A;  3UI2 A;  5EYP F;  4DX5 D;  4K5A B;  2QYJ A;  4O1P A;  4BET A;  4GPM A;  2VGE A;  3EHQ A;  3J5Q B;  2XZT G;  5CBO A;  5ITZ F;  1MX2 A;  4Z68 A;  1IXV A;  2B0O E;  3B7B A;  3C5R A;  1OT8 A;  4J7W A;  2XEN A;  5AAO A;  5JA4 D;  5CEA A;  3DEO A;  2KXP C;  4DX1 A;  4QFV A;  2QC9 A;  2PNN A;  1N11 A;  3JUE A;  1N0Q A;  4BEP A;  5ENR D;  5HRY A;  3UXG A;  1D9S A;  2DZN A;  4YDW A;  4G8K A;  4LSZ E;  4TUM A;  5ENO D;  4DX7 D;  4HLL A;  4A63 B;  3NBN B;  4C48 B;  3KEA A;  5JMN D;  3TWV A;  4HNA D;  2F8X K;  3EHR A;  5AAR A;  2V4H C;  4G8L A;  4CYM D;  2HE0 A;  4NIK A;  2BKK B;  2Y1L E;  2JAB A;  3JXJ A;  4B93 B;  5KBA A;  3IXE A;  1WG0 A;  4U8V D;  4DRX E;  2XEE A;  3V79 K;  3W9G A;  1A5E A;  2AJA A;  4BES A;  3UTM A;  2A5E A;  2L6B A;  1QYM A;  3NOC D;  4HRN A;  1UOH A;  4U96 D;  3TWR A;  5ENQ D;  3ZU7 B;  1MX4 A;  2ETC A;  3Q9U C;  2BKG A;  3HG0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...