2HE0A

Crystal structure of a human notch1 ankyrin domain mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
HNQTDRTGATALHLAAAYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Notch1 preproprotein variant
publication title Crystal structure of a human Notch1 ankyrin domain mutant
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 69
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2he0A00
1AWCB 3V2OA 5FIOA 3T8KA 4BSZB 3EHRA 3J5PA 3NBNB 4J8YA 3ZUVB 3ZU7B 5ENRD 2JABA 3Q9NC 3TWVA 2F37A 1WG0A 4U96D 2L6BA 3NOCD 1WDYA 2ETAA 2XEHA 4C48B 3EHQA 4YDWA 3KEAA 4DUIA 2BKKB 1D9SA 4LSZE 4N5QA 3HG0D 2DWZA 2QC9A 2Y0BG 5EIDA 4A63B 2F8XK 1YCSB 4CZ2D 5EYPF 5ENTD 4B93B 1DCQA 4F1PA 2ZGGA 1MYOA 2RFAA 1N0QA 4U8YD 4NIKA 2FO1E 5ENQD 1QYMA 5AARA 5AQ7A 4OAUC 2BKGA 1BLXB 4HI8A 5EILA 3TWXA 5KNHD 3ZNGA 5CBNA 1BD8A 3F6QA 1OY3D 4O1PA 5AQBA 1K1AA 4LNUD 2B0OE 4DX5D 5CBOA 1DC2A 3JUEA 4ATZD 3IXEA 1NFIE 4LG6A 1A5EA 1G3NB 1SW6A 4U8VD 4QQIA 5HRYA 2AJAA 4GMRA 3V2XA 5FINA 2XENA 1UOHA 4G8LA 2DZOA 2ZGDA 4UUCA 4DX2A 3LJNA 2ETCA 5AN8A 3UXGA 3Q9UC 5HS0A 3J5QB 2VGEA 5JA4D 4HNAD 4ZHBA 5AAOA 2A5EA 5CEDB 2HE0A 4TUMA 5AQ9A 1K1BA 3UI2A 5CECB 1BI8B 5BXOA 2QYJA 4Z68A 3C5RA 4K5AB 3B95A 4YDYA 5EYLA 3UTMA 4F6RD 4HBDA 3V30A 3V79K 2ETBA 3AJIA 5ENPD 1MX2A 1N11A 3W9FA 1MX6A 5JMND 3DEOA 4JB8P 5AQAA 5CERB 5CEAA 1K3ZD 5ITZF 3TWSA 1MX4A 3TWWA 1BU9A 2PNNA 1AP7A 1N0RA 2V4HC 3TWTA 2XEEA 2J8SD 4CYMD 2F8YA 4BEPA 4DRXE 2V5QC 2DVWA 3ZKJA 3AAAC 3W9GA 3DEPA 3JXJA 4HRMB 5ENOD 5D66A 5KNGA 2DZNA 4HRNA 4DX1A 4HLLA 2KBXA 3B7BA 4K5CA 4J7WA 3JXIA 4HB5A 2NYJA 5KWDA 3TWUA 2Y1LE 4HQDA 1BI7B 1TR4A 2XZTG 1IXVA 3SO8A 4G8KA 4QFVA 5KBAA 3T9KA 1IHBA 2MYOA 2KXPC 5EN5D 3V31A 4O1OA 4ZFHA 2P2CP 3TWRA 1OT8A 1IKND 3NOGD 1SVXA 4K5BA 4BESA 3HRAA 4GPMA 4DX7D 1S70B 4HI9A 2XZDG 5HKPA 5BXUA 5EIBE 4BERA 1YYHA 1YMPA 4U95D 4OAVB 4HRLA 4O60A 4DX6D 5ENSD 4RLYA 3D9HA 4BETA 1MJ0A 3EU9A 3TWQA 2RFMA
chains in the Genus database with same CATH superfamily
3MKQA 4ANXA 3HIZA 3ABKE 2PM7A 3PE3A 5KJNA 3UQ3A 1QQEA 4TV3A 3U64A 2XPIA 2UY1A 5EIDA 2FO1E 4A55A 3GZSA 3TWXA 5KNHD 2ILRA 3AG1E 3PH0C 3SFYA 3C3RA 3S7JA 2BF0X 3IBEA 3G2WA 3PDNA 1G3NB 3CK9A 1JCQA 2WXHA 1DVPA 5HRYA 4GMRA 1KT1A 3IHVA 2DZOA 4I6GA 3UIPC 2IONA 5AN8A 2LNIA 3J5QB 2IY0C 2P9SG 4YDYA 4HBDA 2NSZA 1FT2A 3CQCB 1H0AA 4N3BA 3E33A 5BV0A 4XI0A 3TWWA 2GRLA 2C0MA 3TWTA 2H6GA 2R5SA 3NF1A 1SA4A 1N94A 3DRAA 4HRNA 4GCOA 5ENNA 1ELKA 3OXLA 3PS6A 3ISMC 5KBAA 3LPZA 3RJVA 4TUUA 4LERA 3TWRA 1JCSA 2KCVA 2WXJA 2LXLA 1S70B 5HKPA 4FLBA 1SZAA 5BW8C 4K0RA 4FLHA 3PNLB 4AIFA 4GA0A 2VGXB 3R7QA 1SQMA 3ML8A 1JWFA 4WUYA 4GTRA 4C48B 4PS3A 3MEKA 3G2TA 3NQPA 4EBAA 3FTSA 5AJDA 3CEQA 1H2UA 2WQ7A 4HI8A 2VSXE 3ZEFA 4JA7A 1K1AA 3MA5A 1A5EA 3MX3A 4KXKB 3TJPA 4GZ3A 1XNFA 3ULEG 3LJNA 3ZGQA 1OCRE 2ETCA 1O1RA 2L0IA 2VGEA 4BSXA 1NZNA 4F3VA 4Z68A 2GW1A 2L0TB 3ZYKA 4U0SA 3ASFA 5JMND 4A1SA 4LUNU 2WB2A 3D9IA 1BPOA 1Z3XA 1AP7A 2XRYA 1E8WA 2GRMA 3IHYA 3DEPA 2J9QA 1KT0A 5G04C 3DSXA 1A17A 4R7LA 4UWGA 2WXPA 1SVXA 3ZFWA 1S63A 4I2WA 1NA0A 3FUKA 3IEGA 5BXUA 3BQOA 3CKBA 3G2VA 3L9TA 1KZOA 1MJ0A 3CVNA 4A3TA 5A6CA 2IQCA 3UINC 3DSUA 2R05A 4HFGA 4YDOA 1HG2A 3QWPA 3U4TA 4F1SA 2JEKA 2IO2C 4G26A 1HXIA 2XGOA 3Q49B 4J8FA 5ENQD 1MQSA 5EILA 2YQ8A 4I9EA 3QJZA 3UX4A 2V0PA 3UIOC 4U8VD 5JJ6A 2X6FA 3V2XA 1X5BA 1ZBPA 4XKBA 2IFUA 2Y4TA 4GB9A 3UM0A 4I6JA 5ENPD 3AJIA 4DLOA 4LNGA 5G05C 5AQAA 4L9PA 2PNNA 1MHQA 3S7BA 4B8AA 4UWFA 3SHFA 2V8SE 1ELWA 4DPRA 2FBNA 4DX1A 1Z5SC 3ZRHA 3HXDA 2NYJA 3C3OA 3FTUA 4QFVA 2LSVA 5AIJA 1OWNA 2MYOA 3Q5MA 4CRWA 5G04J 1MZCA 3PE4A 4DX7D 3EIJA 4HI9A 3MZLB 3G2UA 1YMPA 3PEUB 2EINE 3CK7A 5A7DB 3CHSA 1WG0A 5T8IA 2H6FA 4EBAG 2P9KG 2ETAA 3O4ZA 2FULA 5FZSA 2DWZA 3LVRE 1EYHA 3PZ2A 4N2SA 5EYPF 3BUAA 2VTBB 2WXKA 3RAUA 3JCKC 5AARA 5AQ7A 4LNBA 4D10C 4Q69A 1BD8A 3F6QA 4ILHB 1IHGA 1Z6TA 4KMOA 4CGWA 4N3AA 4GTQA 4RQIA 3VLDA 4DX2A 3FU0A 3D9LA 1E7VA 1OWMA 5LOZA 3KSQA 5AAOA 2HYZA 3EJNA 5ARFA 3CHRA 3E37A 2J4BA 2QYJA 2EIJE 5ANRA 4EQFA 4F6RD 4OVVA 2MHKA 3W9FA 2I1JA 1K3ZD 1OWPA 3NZUA 1FT1A 4DI3A 3AG4E 3GW4A 5G05J 2KZTB 2B6CA 4EZKA 3RKVA 4ANUA 5FT9A 1LD7A 3T9KA 3I4RB 4MBGA 2KCKA 4OVUA 4GA2A 4BY6A 3KAEA 4M7CA 2R02A 5DIZA 3D9HA 3CHOA 3GZ2A 1JUQA 4G2VA 1OUVA 3T8KA 2J49A 1U3DA 3J5PA 5AYWD 3E30A 1GW6A 1V54E 3HXEA 1Y6IA 3UPVA 3U66A 2FF4A 3KEAA 1N4SA 2QC9A 2WVIA 3B7TA 4KBQA 2C0LA 3MKQB 2YNQA 3LY7A 4U8YD 4ILIA 3FUHA 2VSYA 3KS2A 3C72A 3QAQA 2B0OE 4F53A 3LCAA 4DLQA 3CVXA 4W9RA 5JJ7A 3ML9A 3ZN3A 2UY1B 2KM4A 3L82A 1HZ4A 2Y3AA 3PZ1A 3VTXA 3Q78A 1ELRA 1TNOA 3FUIA 4FU3A 2AVPA 4MLPA 2HE0A 1BI8B 2Y4UA 3Q7AA 2V5FA 1N11A 4AY6A 2EILE 4YDEA 4HOTA 2BUGA 4PH4B 3OAWA 4GAAA 1QNFA 2WQHA 2CG2A 3OXFA 5EX3A 3CK8A 4L23A 5BUZA 2YHCA 4RSYA 4IN3B 1X81A 4U07A 3SBSA 4HLLA 3B7BA 4A3VA 3PZDA 3AU4A 2PZIA 2ZISA 2DIWA 2C2LA 4ANWA 3QOUA 4XI9A 4FHKA 3LEWA 3CIAA 2LAHA 3CV0A 3PUJA 4BSZB 3T5VA 3EHRA 3JQ1A 4LCTA 2JLBA 3ZYLA 1UW4B 1TYQG 1H6OA 5CMYA 3B7RL 1O1TA 4CZ2D 2NC9A 5ENTD 4NQ0A 4GPKA 4G25A 3U3WA 4GTVA 2AXUA 4NACA 3ZIMA 2WMOA 3FTYA 3FEXA 4G11A 4N5CA 3B13A 4H7XA 2WPVA 2ZGDA 3CVUA 3Q9UC 2R17C 5FQ6A 5JA4D 4HNAD 3EUVA 3CKCA 3U9WA 3SY2A 2X6KA 1EDUA 2PL2A 5EYLA 3VLFA 4GMLA 4JW1A 1TEZA 4J8DA 3TG4A 1EF1C 3FY4A 5CEAA 4FULA 1KPSB 2VJ8A 3IKOB 1N95A 3D9NA 4GA1A 3RRUA 2H6HA 3L54A 3LYAA 1U2VG 4TXRA 5J08A 3KEZA 1H2VC 3AG2E 4JC8A 2XHEA 3FTZA 4RG6A 4Y6CA 1TJCA 4TXPA 4U95D 3ZXPA 4V3IA 2RKKA 3SZ7A 4BX9A 2F0YA 2RFMA 2GRQB 4ACKA 3L17A 3ZXSA 2F37A 4PS8A 1WDYA 1OWLA 4HOUA 1KLXA 1Z3YA 3UMVA 2WXFA 1WY6A 4B93B 5BT1A 4B89A 3SBTB 3ZVVA 2P9LG 3LY8A 2AXVA 3FFLA 3S7FA 4ATZD 3RRMB 2KATA 4HOQA 4G23A 4UQYA 4CDRA 2CHZA 1UG3A 2PQRA 3LY9A 2AWIA 3QWWA 3RO3A 1K1BA 3FUFA 3C5RA 4CDMA 4K5AB 4WNDA 3SGHA 1N9AA 2WXGA 3KSLA 3OTNA 1Y8MA 3TXNA 2IO3C 3TWSA 3JQ0A 4WWOA 2RD0A 1H2TC 3K9IA 1IYGA 3AAAC 2AXZA 1N4RA 2GRRB 2L6JA 1E8ZA 4U8HA 3ZYQA 4JHKA 2Y1LE 2HO1A 4CCAA 5HQ8A 2XS1A 3RU0A 2X38A 4AP2A 3Q75A 5EN5D 1HH8A 4U0UA 4BESA 2Y69E 3EHNA 2IF4A 5FZRA 4ANVA 2MRIA 4IRUA 4RLYA 2ZIRA 1TN8A 3E4BA 2DYRE 3C98A 2I2OA 1TNUA 3UUXA 3EHQA 3LXUX 4BTBA 2BKKB 4C9BB 3JYSA 1NA3A 2F8XK 4WAFA 3ZPJA 2ZGGA 1OXJA 3FTVA 4JXTA 4OAUC 1NP7A 4N39A 3QB2A 4Q96A 1S0PA 1HS6A 5CCMA 1SW6A 1HX8A 2P58C 5FINA 3CR3A 3HDXA 3R7RA 1WAO1 5HS0A 3E34A 3QK0A 3FU6A 4X8QA 2MOWA 2DCPA 1N4PA 2QZAA 5KJMA 3FUNA 3RIBA 3L08A 4APOA 3RSEG 3APFA 1N0RA 2A4ZA 2J8SD 5C2YA 4GTSA 1YA0A 4NURA 3KD7A 3CHMA 5D66A 3APDA 2CFUA 5KNGA 3ULQA 3DBSA 4BX8A 3BG1B 4KYOB 3ONKA 3Q73A 3AG3E 2XPZA 3L6AA 2LO6A 4FHJA 1FVFA 4HRLA 3ASOE 2VYIA 4J8SA 3UT8A 3IV0A 4AXHA 3DSSA 3CVVA 2BTDA 3HG0D 5E75A 4DI4A 4A63B 4F1PA 1N0QA 3NB2A 3ZHEA 4J0UA 3Q15A 5AQBA 4GYOA 2L9BA 1DC2A 3JUEA 2EIME 1NFIE 4LG6A 3MV3B 2GRNB 4C0MA 2LSUA 5JHAA 4G8LA 4U0ZA 4KVOA 4AVXA 3B7SA 5ARGA 3ASHA 5H7PA 4KZCA 4APFA 5BXOA 3CVLA 5KJKA 4MS6A 1QZ2A 2WQ6A 3HVEA 2IEJA 4PUCA 3CGHA 1MX4A 4XKCA 5C1DA 5HI7A 3I3NA 2XEEA 3PRZA 2F8YA 1LD8A 2HR2A 2XEVA 1TJFA 4HS2A 4EPZA 1OCOE 4G1TA 3TWUA 3JUIA 4KT6B 4YNDA 3V31A 4ZFHA 1JWGA 3UKUG 2VSOE 2IOSA 3NOGD 2YINA 1YYHA 4OAVB 1ZU2A 4O60A 3X2QE 2I1KA 2XS8A 3FU3A 2IU1A 5FIOA 2GRPB 3TWVA 2WM9A 4CT0A 3NOCD 4MKTA 4H7YA 3EU5A 2J08A 2OV8A 5FQ8A 1D9SA 4LSZE 3GYZA 4L2YA 2HM8A 5KCMA 5CBNA 3MKRA 3DPYA 3UM2A 3T8MA 3IXEA 5E76A 4JA9A 4M3OA 4I1MA 5B3SE 1UN8A 5BPPA 4UWKA 5LP0A 3CVWA 2DBAA 5EDSA 2WXIA 3FTXA 2ETBA 2LXMA 1UJKA 1E8XA 1DCEA 3FDHA 3MJWA 4PS7A 1U3CA 4JB8P 5CERB 2OVBA 2ZU6B 5IY5E 2IJGX 3FHEA 1D8EA 1KZPA 3EDTB 5LCWC 3R9MA 4UI9C 2CG3A 1HF8A 1H6KA 4O1OA 3PZ3A 4U04A 4GZ6A 4BWRA 3LJ3A 3HRAA 5T4YA 2R59A 3D3MA 5EIBE 4BERA 3C3QA 4UQXA 1N52A 3SI5A 4BETA 3EU9A 3PZ4A 5AJLA 3CVQA 3D9OA 4BFRA 4GZDA 4U96D 2L6BA 4EZLA 3BEEA 3ASDA 5CHEE 5B1BE 2X6HA 4GZ5A 1PAQA 1YCSB 3UKRG 2RG8A 3Q79A 4NIKA 1QYMA 4BT8A 1BLXB 3RRNB 4N3CA 1SA5A 1D8DA 4E6HA 1EPUA 2R2LA 5FQ4A 3TL5A 3PNTB 4XEIG 3VLEA 3TGOA 2WXQA 3ABLE 5CMWA 4JPSA 2XENA 4UUCA 1K8KG 3ASGA 1JCRA 3DPDA 3S2AA 1TNZA 5AQ9A 3CSFA 3SNXA 1MX2A 3FEYA 1OCZE 3HYMB 3DEOA 3LDZA 5JJTA 5D0OD 3Q47B 1BU9A 4EECA 1HFAA 1P5QA 4HLEA 4GZCA 3T5XA 3DXMG 3JXIA 5LFAA 5KWDA 4FJZA 2GGFA 1TR4A 3RO2A 1HG5A 4BT9A 1FCHA 2P2CP 5LCWJ 1OT8A 4K5BA 4HXIA 2Q7FA 4UI9J 3ONLA 4GCNA 1V55E 3TG5A 1DNPA 2CHXA 4DX6D 3TWQA 1IQRA 2OCCE 2WXMA 3FULA 4I9CA 3V2OA 3ZUVB 2JABA 3Q9NC 1VDYA 5FWQA 4TRQA 4J6IA 1PC2A 4DUIA 2Y0BG 3EHMA 4HORA 3CVPA 1E7UA 3ASNE 3PEVB 2X6IA 3Q4AB 3I5PA 2PQNA 2YHEA 3R9AB 5CBOA 4CT4A 2VGYA 4AEZC 2KCLA 1JPLA 4G24A 1OWOA 4WWPA 3LKUA 3UXGA 2CFZA 4AY5A 4ZHBA 1NI1A 3UI2A 2XGMA 4F7AA 3DSVA 3V79K 1W3BA 3CVYA 4AM9A 3CQGB 3UM3A 2GROB 2WXOA 2J07A 4E85A 2V4HC 3L22A 3MYVA 4BEPA 2V5QC 2DVWA 1UN9A 4IYPA 4JL0A 4JEUA 3BG0B 3D9KA 4I17A 2KBXA 3ULYA 3CHQA 1IXVA 3SO8A 1IHBA 3CHPA 5BNWA 2I6HA 1PY1A 4ACLA 5KJLA 2M63A 4GYWA 4UI9K 4GTOA 3NZSA 4J8YA 5FTPA 4I43A 2J4DA 3FUJA 2FI7A 3LVQE 3FP3A 3RK6A 2WXRA 2DYSE 1DCQA 3L16A 2P9NG 5G55A 5AENA 5J90A 1OY3D 1LTXA 3N71A 4QQIA 1TNYA 4JD2G 4GYYA 4GTMA 3ZHEB 2XCBA 2P9UG 3PREA 1HO8A 1MX6A 3WG7E 1FVHA 5ITZF 4CDNA 2XGSA 4JVSA 2QYUA 3QDNA 1UJJA 1E90A 2X6JA 3HVEB 5BV1A 1BI7B 4XIFA 2VGXA 4ILGA 4FADA 4L1BA 4XZ4A 3QARA 4L7TA 4UWHA 4BTAA 2XZDG 2I9CA 4U7EB 1LF8A 4J8EA 4CEMA 3APCA 1L5JA 2EIKE 5FQ7A 4I2ZA 4TXQA 3ZU7B 5ENRD 1IQUA 3ESKA 3FH7A 4YDWA 4CGVA 4PDXA 4JHJA 5LX8A 2VSNA 2V4LA 3AS5A 4GTPA 1MYOA 2UWJG 1B89A 4I1AA 3ZNGA 2XPYA 4P29A 1SZ9A 4B94A 4DX5D 3SD5A 4YVOA 3TXMA 1Q2ZA 4IULA 2IOLA 4JZYA 1TN7A 3HXFA 2WMNA 2P9IG 3SFXA 2A5EA 5CEDB 2KC7A 4TUMA 5EX0A 3P1UA 2EQXA 3B95A 3AS4A 2OEVA 5T3RA 1INZA 3FTWA 4EHMA 1TNBA 4I1OB 4CYMD 2ZXWE 3HXCA 3OXGA 3ZKJA 3ZYMA 3W9GA 3UM1A 4GMJA 2P9PG 2XQ0A 1H19A 2XZTG 3LS8A 3CLJA 2NXPA 5G2NA 1FPPA 4B8CB 4GPMA 2R03A 4K03A 3QC1A 4URKA 2FO7A 3Q7FA 5D0QD 5CRVA 3UT7A 4NRHB 2QFCA 4DJAA 4KVMA 3FU5A 3D9JA 4N5QA 1RW2A 5FJYA 4O6FA 1O1SA 3DXKG 5A23A 4UQZA 2RFAA 3VTYA 3MCXA 2BKGA 2E2EA 4ATGA 3FUEA 3FH5A 3CSTA 4UWLA 4LEUA 4WNGA 3ESLA 1E96B 2AJAA 3QWVA 3MV2B 4JEHA 3PVLA 3EIQC 3ZW3A 3SFZA 2OOEA 5CECB 3V30A 3AU5A 3NAWA 4FJYA 2WXLA 3G2SA 3DSTA 4Y6WA 3ABME 4XX5A 4WWNA 2XCCA 3GZ1A 3QKYA 3FUDA 1NL4A 4A1GA 5CCLA 2DZNA 5M72A 4K5CA 3I4GA 3SF4A 4MRUA 5FZQA 4HQDA 3O48A 3B7UX 4G8KA 4Q94A 2KXPC 4L2LA 4HOSA 4WNFA 1N54A 3D9MA 1OCCE 1IKND 2PM6A 3FUMA 2OEWA 4LRZA 2CHWA 4GTTA 4AJWA 4AOFA 1TN6A 4GU5A 4XE0A 4OYSA 1AWCB 3HHMA 1HE8A 4U63A 1HU3A 2VTBA 3NBNB 5DBKA 2XEHA 3S7DA 1RZ4A 4RVBA 2LAIA 4DK5A 4B0ZA 1ZB1A 3MGBA 4KZ0A 1H6PA 2ONDA 4ME2A 3D9PA 4I6EA 4FC8A 4ABNA 4O1PA 3WXXA 4LNUD 1WM5A 3E32A 2A5UA 1E8YA 3FH8A 1UOHA 5B1AE 2J09A 3PUKA 1S64A 4YVQC 2X3MA 2FEZA 4JHRA 4C0EA 4AV7A 3URZA 4HVBA 5ANLA 1QBQA 5CRUA 5D2MC 3UTMA 1N4QA 3QNKA 2LUHA 3ENEA 2KZTA 2VQ2A 2BEDA 2OVFA 4WNEA 3BU8A 3DWLG 4N2QA 3L13A 4DRXE 3JXJA 4HRMB 2E0IA 4RG9A 5ENOD 4EZJA 2H6IA 1O5MA 4J7WA 4HB5A 4FP7A 3UT4A 3DSWA 2XRZA 3P2BA 3HXBA 2QY7A 3FWVA 3SQVA 1XGWA 2WXNA 2AW6A 3TAXA 4FA6A 3AS8A 5JHBA 5ENSD 5EKQD
chains in the Genus database with same CATH topology
1AWCB 3V2OA 5FIOA 3T8KA 4BSZB 3EHRA 3J5PA 3NBNB 4J8YA 3ZUVB 3ZU7B 5ENRD 2JABA 3Q9NC 3TWVA 2F37A 1WG0A 4U96D 2L6BA 3NOCD 1WDYA 2ETAA 2XEHA 4C48B 3EHQA 4YDWA 3KEAA 4DUIA 2BKKB 1D9SA 4LSZE 4N5QA 3HG0D 2DWZA 2QC9A 2Y0BG 5EIDA 4A63B 2F8XK 1YCSB 4CZ2D 5EYPF 5ENTD 4B93B 1DCQA 4F1PA 2ZGGA 1MYOA 2RFAA 1N0QA 4U8YD 4NIKA 2FO1E 5ENQD 1QYMA 5AARA 5AQ7A 4OAUC 2BKGA 1BLXB 4HI8A 5EILA 3TWXA 5KNHD 3ZNGA 5CBNA 1BD8A 3F6QA 1OY3D 4O1PA 5AQBA 1K1AA 4LNUD 2B0OE 4DX5D 5CBOA 1DC2A 3JUEA 4ATZD 3IXEA 1NFIE 4LG6A 1A5EA 1G3NB 1SW6A 4U8VD 4QQIA 5HRYA 2AJAA 4GMRA 3V2XA 5FINA 2XENA 1UOHA 4G8LA 2DZOA 2ZGDA 4UUCA 4DX2A 3LJNA 2ETCA 5AN8A 3UXGA 3Q9UC 5HS0A 3J5QB 2VGEA 5JA4D 4HNAD 4ZHBA 5AAOA 2A5EA 5CEDB 2HE0A 4TUMA 5AQ9A 1K1BA 3UI2A 5CECB 1BI8B 5BXOA 2QYJA 4Z68A 3C5RA 4K5AB 3B95A 4YDYA 5EYLA 3UTMA 4F6RD 4HBDA 3V30A 3V79K 2ETBA 3AJIA 5ENPD 1MX2A 1N11A 3W9FA 1MX6A 5JMND 3DEOA 4JB8P 5AQAA 5CERB 5CEAA 1K3ZD 5ITZF 3TWSA 1MX4A 3TWWA 1BU9A 2PNNA 1AP7A 1N0RA 2V4HC 3TWTA 2XEEA 2J8SD 4CYMD 2F8YA 4BEPA 4DRXE 2V5QC 2DVWA 3ZKJA 3AAAC 3W9GA 3DEPA 3JXJA 4HRMB 5ENOD 5D66A 5KNGA 2DZNA 4HRNA 4DX1A 4HLLA 2KBXA 3B7BA 4K5CA 4J7WA 3JXIA 4HB5A 2NYJA 5KWDA 3TWUA 2Y1LE 4HQDA 1BI7B 1TR4A 2XZTG 1IXVA 3SO8A 4G8KA 4QFVA 5KBAA 3T9KA 1IHBA 2MYOA 2KXPC 5EN5D 3V31A 4O1OA 4ZFHA 2P2CP 3TWRA 1OT8A 1IKND 3NOGD 1SVXA 4K5BA 4BESA 3HRAA 4GPMA 4DX7D 1S70B 4HI9A 2XZDG 5HKPA 5BXUA 5EIBE 4BERA 1YYHA 1YMPA 4U95D 4OAVB 4HRLA 4O60A 4DX6D 5ENSD 4RLYA 3D9HA 4BETA 1MJ0A 3EU9A 3TWQA 2RFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWC B;  3V2O A;  5FIO A;  3T8K A;  4BSZ B;  3EHR A;  3J5P A;  3NBN B;  4J8Y A;  3ZUV B;  3ZU7 B;  5ENR D;  2JAB A;  3Q9N C;  3TWV A;  2F37 A;  1WG0 A;  4U96 D;  2L6B A;  3NOC D;  1WDY A;  2ETA A;  2XEH A;  4C48 B;  3EHQ A;  4YDW A;  3KEA A;  4DUI A;  2BKK B;  1D9S A;  4LSZ E;  4N5Q A;  3HG0 D;  2DWZ A;  2QC9 A;  2Y0B G;  5EID A;  4A63 B;  2F8X K;  1YCS B;  4CZ2 D;  5EYP F;  5ENT D;  4B93 B;  1DCQ A;  4F1P A;  2ZGG A;  1MYO A;  2RFA A;  1N0Q A;  4U8Y D;  4NIK A;  2FO1 E;  5ENQ D;  1QYM A;  5AAR A;  5AQ7 A;  4OAU C;  2BKG A;  1BLX B;  4HI8 A;  5EIL A;  3TWX A;  5KNH D;  3ZNG A;  5CBN A;  1BD8 A;  3F6Q A;  1OY3 D;  4O1P A;  5AQB A;  1K1A A;  4LNU D;  2B0O E;  4DX5 D;  5CBO A;  1DC2 A;  3JUE A;  4ATZ D;  3IXE A;  1NFI E;  4LG6 A;  1A5E A;  1G3N B;  1SW6 A;  4U8V D;  4QQI A;  5HRY A;  2AJA A;  4GMR A;  3V2X A;  5FIN A;  2XEN A;  1UOH A;  4G8L A;  2DZO A;  2ZGD A;  4UUC A;  4DX2 A;  3LJN A;  2ETC A;  5AN8 A;  3UXG A;  3Q9U C;  5HS0 A;  3J5Q B;  2VGE A;  5JA4 D;  4HNA D;  4ZHB A;  5AAO A;  2A5E A;  5CED B;  2HE0 A;  4TUM A;  5AQ9 A;  1K1B A;  3UI2 A;  5CEC B;  1BI8 B;  5BXO A;  2QYJ A;  4Z68 A;  3C5R A;  4K5A B;  3B95 A;  4YDY A;  5EYL A;  3UTM A;  4F6R D;  4HBD A;  3V30 A;  3V79 K;  2ETB A;  3AJI A;  5ENP D;  1MX2 A;  1N11 A;  3W9F A;  1MX6 A;  5JMN D;  3DEO A;  4JB8 P;  5AQA A;  5CER B;  5CEA A;  1K3Z D;  5ITZ F;  3TWS A;  1MX4 A;  3TWW A;  1BU9 A;  2PNN A;  1AP7 A;  1N0R A;  2V4H C;  3TWT A;  2XEE A;  2J8S D;  4CYM D;  2F8Y A;  4BEP A;  4DRX E;  2V5Q C;  2DVW A;  3ZKJ A;  3AAA C;  3W9G A;  3DEP A;  3JXJ A;  4HRM B;  5ENO D;  5D66 A;  5KNG A;  2DZN A;  4HRN A;  4DX1 A;  4HLL A;  2KBX A;  3B7B A;  4K5C A;  4J7W A;  3JXI A;  4HB5 A;  2NYJ A;  5KWD A;  3TWU A;  2Y1L E;  4HQD A;  1BI7 B;  1TR4 A;  2XZT G;  1IXV A;  3SO8 A;  4G8K A;  4QFV A;  5KBA A;  3T9K A;  1IHB A;  2MYO A;  2KXP C;  5EN5 D;  3V31 A;  4O1O A;  4ZFH A;  2P2C P;  3TWR A;  1OT8 A;  1IKN D;  3NOG D;  1SVX A;  4K5B A;  4BES A;  3HRA A;  4GPM A;  4DX7 D;  1S70 B;  4HI9 A;  2XZD G;  5HKP A;  5BXU A;  5EIB E;  4BER A;  1YYH A;  1YMP A;  4U95 D;  4OAV B;  4HRL A;  4O60 A;  4DX6 D;  5ENS D;  4RLY A;  3D9H A;  4BET A;  1MJ0 A;  3EU9 A;  3TWQ A;  2RFM A; 
#chains in the Genus database with same CATH topology
 3MKQ A;  4ANX A;  3HIZ A;  3ABK E;  2PM7 A;  3PE3 A;  5KJN A;  3UQ3 A;  1QQE A;  4TV3 A;  3U64 A;  2XPI A;  2UY1 A;  5EID A;  2FO1 E;  4A55 A;  3GZS A;  3TWX A;  5KNH D;  2ILR A;  3AG1 E;  3PH0 C;  3SFY A;  3C3R A;  3S7J A;  2BF0 X;  3IBE A;  3G2W A;  3PDN A;  1G3N B;  3CK9 A;  1JCQ A;  2WXH A;  1DVP A;  5HRY A;  4GMR A;  1KT1 A;  3IHV A;  2DZO A;  4I6G A;  3UIP C;  2ION A;  5AN8 A;  2LNI A;  3J5Q B;  2IY0 C;  2P9S G;  4YDY A;  4HBD A;  2NSZ A;  1FT2 A;  3CQC B;  1H0A A;  4N3B A;  3E33 A;  5BV0 A;  4XI0 A;  3TWW A;  2GRL A;  2C0M A;  3TWT A;  2H6G A;  2R5S A;  3NF1 A;  1SA4 A;  1N94 A;  3DRA A;  4HRN A;  4GCO A;  5ENN A;  1ELK A;  3OXL A;  3PS6 A;  3ISM C;  5KBA A;  3LPZ A;  3RJV A;  4TUU A;  4LER A;  3TWR A;  1JCS A;  2KCV A;  2WXJ A;  2LXL A;  1S70 B;  5HKP A;  4FLB A;  1SZA A;  5BW8 C;  4K0R A;  4FLH A;  3PNL B;  4AIF A;  4GA0 A;  2VGX B;  3R7Q A;  1SQM A;  3ML8 A;  1JWF A;  4WUY A;  4GTR A;  4C48 B;  4PS3 A;  3MEK A;  3G2T A;  3NQP A;  4EBA A;  3FTS A;  5AJD A;  3CEQ A;  1H2U A;  2WQ7 A;  4HI8 A;  2VSX E;  3ZEF A;  4JA7 A;  1K1A A;  3MA5 A;  1A5E A;  3MX3 A;  4KXK B;  3TJP A;  4GZ3 A;  1XNF A;  3ULE G;  3LJN A;  3ZGQ A;  1OCR E;  2ETC A;  1O1R A;  2L0I A;  2VGE A;  4BSX A;  1NZN A;  4F3V A;  4Z68 A;  2GW1 A;  2L0T B;  3ZYK A;  4U0S A;  3ASF A;  5JMN D;  4A1S A;  4LUN U;  2WB2 A;  3D9I A;  1BPO A;  1Z3X A;  1AP7 A;  2XRY A;  1E8W A;  2GRM A;  3IHY A;  3DEP A;  2J9Q A;  1KT0 A;  5G04 C;  3DSX A;  1A17 A;  4R7L A;  4UWG A;  2WXP A;  1SVX A;  3ZFW A;  1S63 A;  4I2W A;  1NA0 A;  3FUK A;  3IEG A;  5BXU A;  3BQO A;  3CKB A;  3G2V A;  3L9T A;  1KZO A;  1MJ0 A;  3CVN A;  4A3T A;  5A6C A;  2IQC A;  3UIN C;  3DSU A;  2R05 A;  4HFG A;  4YDO A;  1HG2 A;  3QWP A;  3U4T A;  4F1S A;  2JEK A;  2IO2 C;  4G26 A;  1HXI A;  2XGO A;  3Q49 B;  4J8F A;  5ENQ D;  1MQS A;  5EIL A;  2YQ8 A;  4I9E A;  3QJZ A;  3UX4 A;  2V0P A;  3UIO C;  4U8V D;  5JJ6 A;  2X6F A;  3V2X A;  1X5B A;  1ZBP A;  4XKB A;  2IFU A;  2Y4T A;  4GB9 A;  3UM0 A;  4I6J A;  5ENP D;  3AJI A;  4DLO A;  4LNG A;  5G05 C;  5AQA A;  4L9P A;  2PNN A;  1MHQ A;  3S7B A;  4B8A A;  4UWF A;  3SHF A;  2V8S E;  1ELW A;  4DPR A;  2FBN A;  4DX1 A;  1Z5S C;  3ZRH A;  3HXD A;  2NYJ A;  3C3O A;  3FTU A;  4QFV A;  2LSV A;  5AIJ A;  1OWN A;  2MYO A;  3Q5M A;  4CRW A;  5G04 J;  1MZC A;  3PE4 A;  4DX7 D;  3EIJ A;  4HI9 A;  3MZL B;  3G2U A;  1YMP A;  3PEU B;  2EIN E;  3CK7 A;  5A7D B;  3CHS A;  1WG0 A;  5T8I A;  2H6F A;  4EBA G;  2P9K G;  2ETA A;  3O4Z A;  2FUL A;  5FZS A;  2DWZ A;  3LVR E;  1EYH A;  3PZ2 A;  4N2S A;  5EYP F;  3BUA A;  2VTB B;  2WXK A;  3RAU A;  3JCK C;  5AAR A;  5AQ7 A;  4LNB A;  4D10 C;  4Q69 A;  1BD8 A;  3F6Q A;  4ILH B;  1IHG A;  1Z6T A;  4KMO A;  4CGW A;  4N3A A;  4GTQ A;  4RQI A;  3VLD A;  4DX2 A;  3FU0 A;  3D9L A;  1E7V A;  1OWM A;  5LOZ A;  3KSQ A;  5AAO A;  2HYZ A;  3EJN A;  5ARF A;  3CHR A;  3E37 A;  2J4B A;  2QYJ A;  2EIJ E;  5ANR A;  4EQF A;  4F6R D;  4OVV A;  2MHK A;  3W9F A;  2I1J A;  1K3Z D;  1OWP A;  3NZU A;  1FT1 A;  4DI3 A;  3AG4 E;  3GW4 A;  5G05 J;  2KZT B;  2B6C A;  4EZK A;  3RKV A;  4ANU A;  5FT9 A;  1LD7 A;  3T9K A;  3I4R B;  4MBG A;  2KCK A;  4OVU A;  4GA2 A;  4BY6 A;  3KAE A;  4M7C A;  2R02 A;  5DIZ A;  3D9H A;  3CHO A;  3GZ2 A;  1JUQ A;  4G2V A;  1OUV A;  3T8K A;  2J49 A;  1U3D A;  3J5P A;  5AYW D;  3E30 A;  1GW6 A;  1V54 E;  3HXE A;  1Y6I A;  3UPV A;  3U66 A;  2FF4 A;  3KEA A;  1N4S A;  2QC9 A;  2WVI A;  3B7T A;  4KBQ A;  2C0L A;  3MKQ B;  2YNQ A;  3LY7 A;  4U8Y D;  4ILI A;  3FUH A;  2VSY A;  3KS2 A;  3C72 A;  3QAQ A;  2B0O E;  4F53 A;  3LCA A;  4DLQ A;  3CVX A;  4W9R A;  5JJ7 A;  3ML9 A;  3ZN3 A;  2UY1 B;  2KM4 A;  3L82 A;  1HZ4 A;  2Y3A A;  3PZ1 A;  3VTX A;  3Q78 A;  1ELR A;  1TNO A;  3FUI A;  4FU3 A;  2AVP A;  4MLP A;  2HE0 A;  1BI8 B;  2Y4U A;  3Q7A A;  2V5F A;  1N11 A;  4AY6 A;  2EIL E;  4YDE A;  4HOT A;  2BUG A;  4PH4 B;  3OAW A;  4GAA A;  1QNF A;  2WQH A;  2CG2 A;  3OXF A;  5EX3 A;  3CK8 A;  4L23 A;  5BUZ A;  2YHC A;  4RSY A;  4IN3 B;  1X81 A;  4U07 A;  3SBS A;  4HLL A;  3B7B A;  4A3V A;  3PZD A;  3AU4 A;  2PZI A;  2ZIS A;  2DIW A;  2C2L A;  4ANW A;  3QOU A;  4XI9 A;  4FHK A;  3LEW A;  3CIA A;  2LAH A;  3CV0 A;  3PUJ A;  4BSZ B;  3T5V A;  3EHR A;  3JQ1 A;  4LCT A;  2JLB A;  3ZYL A;  1UW4 B;  1TYQ G;  1H6O A;  5CMY A;  3B7R L;  1O1T A;  4CZ2 D;  2NC9 A;  5ENT D;  4NQ0 A;  4GPK A;  4G25 A;  3U3W A;  4GTV A;  2AXU A;  4NAC A;  3ZIM A;  2WMO A;  3FTY A;  3FEX A;  4G11 A;  4N5C A;  3B13 A;  4H7X A;  2WPV A;  2ZGD A;  3CVU A;  3Q9U C;  2R17 C;  5FQ6 A;  5JA4 D;  4HNA D;  3EUV A;  3CKC A;  3U9W A;  3SY2 A;  2X6K A;  1EDU A;  2PL2 A;  5EYL A;  3VLF A;  4GML A;  4JW1 A;  1TEZ A;  4J8D A;  3TG4 A;  1EF1 C;  3FY4 A;  5CEA A;  4FUL A;  1KPS B;  2VJ8 A;  3IKO B;  1N95 A;  3D9N A;  4GA1 A;  3RRU A;  2H6H A;  3L54 A;  3LYA A;  1U2V G;  4TXR A;  5J08 A;  3KEZ A;  1H2V C;  3AG2 E;  4JC8 A;  2XHE A;  3FTZ A;  4RG6 A;  4Y6C A;  1TJC A;  4TXP A;  4U95 D;  3ZXP A;  4V3I A;  2RKK A;  3SZ7 A;  4BX9 A;  2F0Y A;  2RFM A;  2GRQ B;  4ACK A;  3L17 A;  3ZXS A;  2F37 A;  4PS8 A;  1WDY A;  1OWL A;  4HOU A;  1KLX A;  1Z3Y A;  3UMV A;  2WXF A;  1WY6 A;  4B93 B;  5BT1 A;  4B89 A;  3SBT B;  3ZVV A;  2P9L G;  3LY8 A;  2AXV A;  3FFL A;  3S7F A;  4ATZ D;  3RRM B;  2KAT A;  4HOQ A;  4G23 A;  4UQY A;  4CDR A;  2CHZ A;  1UG3 A;  2PQR A;  3LY9 A;  2AWI A;  3QWW A;  3RO3 A;  1K1B A;  3FUF A;  3C5R A;  4CDM A;  4K5A B;  4WND A;  3SGH A;  1N9A A;  2WXG A;  3KSL A;  3OTN A;  1Y8M A;  3TXN A;  2IO3 C;  3TWS A;  3JQ0 A;  4WWO A;  2RD0 A;  1H2T C;  3K9I A;  1IYG A;  3AAA C;  2AXZ A;  1N4R A;  2GRR B;  2L6J A;  1E8Z A;  4U8H A;  3ZYQ A;  4JHK A;  2Y1L E;  2HO1 A;  4CCA A;  5HQ8 A;  2XS1 A;  3RU0 A;  2X38 A;  4AP2 A;  3Q75 A;  5EN5 D;  1HH8 A;  4U0U A;  4BES A;  2Y69 E;  3EHN A;  2IF4 A;  5FZR A;  4ANV A;  2MRI A;  4IRU A;  4RLY A;  2ZIR A;  1TN8 A;  3E4B A;  2DYR E;  3C98 A;  2I2O A;  1TNU A;  3UUX A;  3EHQ A;  3LXU X;  4BTB A;  2BKK B;  4C9B B;  3JYS A;  1NA3 A;  2F8X K;  4WAF A;  3ZPJ A;  2ZGG A;  1OXJ A;  3FTV A;  4JXT A;  4OAU C;  1NP7 A;  4N39 A;  3QB2 A;  4Q96 A;  1S0P A;  1HS6 A;  5CCM A;  1SW6 A;  1HX8 A;  2P58 C;  5FIN A;  3CR3 A;  3HDX A;  3R7R A;  1WAO 1;  5HS0 A;  3E34 A;  3QK0 A;  3FU6 A;  4X8Q A;  2MOW A;  2DCP A;  1N4P A;  2QZA A;  5KJM A;  3FUN A;  3RIB A;  3L08 A;  4APO A;  3RSE G;  3APF A;  1N0R A;  2A4Z A;  2J8S D;  5C2Y A;  4GTS A;  1YA0 A;  4NUR A;  3KD7 A;  3CHM A;  5D66 A;  3APD A;  2CFU A;  5KNG A;  3ULQ A;  3DBS A;  4BX8 A;  3BG1 B;  4KYO B;  3ONK A;  3Q73 A;  3AG3 E;  2XPZ A;  3L6A A;  2LO6 A;  4FHJ A;  1FVF A;  4HRL A;  3ASO E;  2VYI A;  4J8S A;  3UT8 A;  3IV0 A;  4AXH A;  3DSS A;  3CVV A;  2BTD A;  3HG0 D;  5E75 A;  4DI4 A;  4A63 B;  4F1P A;  1N0Q A;  3NB2 A;  3ZHE A;  4J0U A;  3Q15 A;  5AQB A;  4GYO A;  2L9B A;  1DC2 A;  3JUE A;  2EIM E;  1NFI E;  4LG6 A;  3MV3 B;  2GRN B;  4C0M A;  2LSU A;  5JHA A;  4G8L A;  4U0Z A;  4KVO A;  4AVX A;  3B7S A;  5ARG A;  3ASH A;  5H7P A;  4KZC A;  4APF A;  5BXO A;  3CVL A;  5KJK A;  4MS6 A;  1QZ2 A;  2WQ6 A;  3HVE A;  2IEJ A;  4PUC A;  3CGH A;  1MX4 A;  4XKC A;  5C1D A;  5HI7 A;  3I3N A;  2XEE A;  3PRZ A;  2F8Y A;  1LD8 A;  2HR2 A;  2XEV A;  1TJF A;  4HS2 A;  4EPZ A;  1OCO E;  4G1T A;  3TWU A;  3JUI A;  4KT6 B;  4YND A;  3V31 A;  4ZFH A;  1JWG A;  3UKU G;  2VSO E;  2IOS A;  3NOG D;  2YIN A;  1YYH A;  4OAV B;  1ZU2 A;  4O60 A;  3X2Q E;  2I1K A;  2XS8 A;  3FU3 A;  2IU1 A;  5FIO A;  2GRP B;  3TWV A;  2WM9 A;  4CT0 A;  3NOC D;  4MKT A;  4H7Y A;  3EU5 A;  2J08 A;  2OV8 A;  5FQ8 A;  1D9S A;  4LSZ E;  3GYZ A;  4L2Y A;  2HM8 A;  5KCM A;  5CBN A;  3MKR A;  3DPY A;  3UM2 A;  3T8M A;  3IXE A;  5E76 A;  4JA9 A;  4M3O A;  4I1M A;  5B3S E;  1UN8 A;  5BPP A;  4UWK A;  5LP0 A;  3CVW A;  2DBA A;  5EDS A;  2WXI A;  3FTX A;  2ETB A;  2LXM A;  1UJK A;  1E8X A;  1DCE A;  3FDH A;  3MJW A;  4PS7 A;  1U3C A;  4JB8 P;  5CER B;  2OVB A;  2ZU6 B;  5IY5 E;  2IJG X;  3FHE A;  1D8E A;  1KZP A;  3EDT B;  5LCW C;  3R9M A;  4UI9 C;  2CG3 A;  1HF8 A;  1H6K A;  4O1O A;  3PZ3 A;  4U04 A;  4GZ6 A;  4BWR A;  3LJ3 A;  3HRA A;  5T4Y A;  2R59 A;  3D3M A;  5EIB E;  4BER A;  3C3Q A;  4UQX A;  1N52 A;  3SI5 A;  4BET A;  3EU9 A;  3PZ4 A;  5AJL A;  3CVQ A;  3D9O A;  4BFR A;  4GZD A;  4U96 D;  2L6B A;  4EZL A;  3BEE A;  3ASD A;  5CHE E;  5B1B E;  2X6H A;  4GZ5 A;  1PAQ A;  1YCS B;  3UKR G;  2RG8 A;  3Q79 A;  4NIK A;  1QYM A;  4BT8 A;  1BLX B;  3RRN B;  4N3C A;  1SA5 A;  1D8D A;  4E6H A;  1EPU A;  2R2L A;  5FQ4 A;  3TL5 A;  3PNT B;  4XEI G;  3VLE A;  3TGO A;  2WXQ A;  3ABL E;  5CMW A;  4JPS A;  2XEN A;  4UUC A;  1K8K G;  3ASG A;  1JCR A;  3DPD A;  3S2A A;  1TNZ A;  5AQ9 A;  3CSF A;  3SNX A;  1MX2 A;  3FEY A;  1OCZ E;  3HYM B;  3DEO A;  3LDZ A;  5JJT A;  5D0O D;  3Q47 B;  1BU9 A;  4EEC A;  1HFA A;  1P5Q A;  4HLE A;  4GZC A;  3T5X A;  3DXM G;  3JXI A;  5LFA A;  5KWD A;  4FJZ A;  2GGF A;  1TR4 A;  3RO2 A;  1HG5 A;  4BT9 A;  1FCH A;  2P2C P;  5LCW J;  1OT8 A;  4K5B A;  4HXI A;  2Q7F A;  4UI9 J;  3ONL A;  4GCN A;  1V55 E;  3TG5 A;  1DNP A;  2CHX A;  4DX6 D;  3TWQ A;  1IQR A;  2OCC E;  2WXM A;  3FUL A;  4I9C A;  3V2O A;  3ZUV B;  2JAB A;  3Q9N C;  1VDY A;  5FWQ A;  4TRQ A;  4J6I A;  1PC2 A;  4DUI A;  2Y0B G;  3EHM A;  4HOR A;  3CVP A;  1E7U A;  3ASN E;  3PEV B;  2X6I A;  3Q4A B;  3I5P A;  2PQN A;  2YHE A;  3R9A B;  5CBO A;  4CT4 A;  2VGY A;  4AEZ C;  2KCL A;  1JPL A;  4G24 A;  1OWO A;  4WWP A;  3LKU A;  3UXG A;  2CFZ A;  4AY5 A;  4ZHB A;  1NI1 A;  3UI2 A;  2XGM A;  4F7A A;  3DSV A;  3V79 K;  1W3B A;  3CVY A;  4AM9 A;  3CQG B;  3UM3 A;  2GRO B;  2WXO A;  2J07 A;  4E85 A;  2V4H C;  3L22 A;  3MYV A;  4BEP A;  2V5Q C;  2DVW A;  1UN9 A;  4IYP A;  4JL0 A;  4JEU A;  3BG0 B;  3D9K A;  4I17 A;  2KBX A;  3ULY A;  3CHQ A;  1IXV A;  3SO8 A;  1IHB A;  3CHP A;  5BNW A;  2I6H A;  1PY1 A;  4ACL A;  5KJL A;  2M63 A;  4GYW A;  4UI9 K;  4GTO A;  3NZS A;  4J8Y A;  5FTP A;  4I43 A;  2J4D A;  3FUJ A;  2FI7 A;  3LVQ E;  3FP3 A;  3RK6 A;  2WXR A;  2DYS E;  1DCQ A;  3L16 A;  2P9N G;  5G55 A;  5AEN A;  5J90 A;  1OY3 D;  1LTX A;  3N71 A;  4QQI A;  1TNY A;  4JD2 G;  4GYY A;  4GTM A;  3ZHE B;  2XCB A;  2P9U G;  3PRE A;  1HO8 A;  1MX6 A;  3WG7 E;  1FVH A;  5ITZ F;  4CDN A;  2XGS A;  4JVS A;  2QYU A;  3QDN A;  1UJJ A;  1E90 A;  2X6J A;  3HVE B;  5BV1 A;  1BI7 B;  4XIF A;  2VGX A;  4ILG A;  4FAD A;  4L1B A;  4XZ4 A;  3QAR A;  4L7T A;  4UWH A;  4BTA A;  2XZD G;  2I9C A;  4U7E B;  1LF8 A;  4J8E A;  4CEM A;  3APC A;  1L5J A;  2EIK E;  5FQ7 A;  4I2Z A;  4TXQ A;  3ZU7 B;  5ENR D;  1IQU A;  3ESK A;  3FH7 A;  4YDW A;  4CGV A;  4PDX A;  4JHJ A;  5LX8 A;  2VSN A;  2V4L A;  3AS5 A;  4GTP A;  1MYO A;  2UWJ G;  1B89 A;  4I1A A;  3ZNG A;  2XPY A;  4P29 A;  1SZ9 A;  4B94 A;  4DX5 D;  3SD5 A;  4YVO A;  3TXM A;  1Q2Z A;  4IUL A;  2IOL A;  4JZY A;  1TN7 A;  3HXF A;  2WMN A;  2P9I G;  3SFX A;  2A5E A;  5CED B;  2KC7 A;  4TUM A;  5EX0 A;  3P1U A;  2EQX A;  3B95 A;  3AS4 A;  2OEV A;  5T3R A;  1INZ A;  3FTW A;  4EHM A;  1TNB A;  4I1O B;  4CYM D;  2ZXW E;  3HXC A;  3OXG A;  3ZKJ A;  3ZYM A;  3W9G A;  3UM1 A;  4GMJ A;  2P9P G;  2XQ0 A;  1H19 A;  2XZT G;  3LS8 A;  3CLJ A;  2NXP A;  5G2N A;  1FPP A;  4B8C B;  4GPM A;  2R03 A;  4K03 A;  3QC1 A;  4URK A;  2FO7 A;  3Q7F A;  5D0Q D;  5CRV A;  3UT7 A;  4NRH B;  2QFC A;  4DJA A;  4KVM A;  3FU5 A;  3D9J A;  4N5Q A;  1RW2 A;  5FJY A;  4O6F A;  1O1S A;  3DXK G;  5A23 A;  4UQZ A;  2RFA A;  3VTY A;  3MCX A;  2BKG A;  2E2E A;  4ATG A;  3FUE A;  3FH5 A;  3CST A;  4UWL A;  4LEU A;  4WNG A;  3ESL A;  1E96 B;  2AJA A;  3QWV A;  3MV2 B;  4JEH A;  3PVL A;  3EIQ C;  3ZW3 A;  3SFZ A;  2OOE A;  5CEC B;  3V30 A;  3AU5 A;  3NAW A;  4FJY A;  2WXL A;  3G2S A;  3DST A;  4Y6W A;  3ABM E;  4XX5 A;  4WWN A;  2XCC A;  3GZ1 A;  3QKY A;  3FUD A;  1NL4 A;  4A1G A;  5CCL A;  2DZN A;  5M72 A;  4K5C A;  3I4G A;  3SF4 A;  4MRU A;  5FZQ A;  4HQD A;  3O48 A;  3B7U X;  4G8K A;  4Q94 A;  2KXP C;  4L2L A;  4HOS A;  4WNF A;  1N54 A;  3D9M A;  1OCC E;  1IKN D;  2PM6 A;  3FUM A;  2OEW A;  4LRZ A;  2CHW A;  4GTT A;  4AJW A;  4AOF A;  1TN6 A;  4GU5 A;  4XE0 A;  4OYS A;  1AWC B;  3HHM A;  1HE8 A;  4U63 A;  1HU3 A;  2VTB A;  3NBN B;  5DBK A;  2XEH A;  3S7D A;  1RZ4 A;  4RVB A;  2LAI A;  4DK5 A;  4B0Z A;  1ZB1 A;  3MGB A;  4KZ0 A;  1H6P A;  2OND A;  4ME2 A;  3D9P A;  4I6E A;  4FC8 A;  4ABN A;  4O1P A;  3WXX A;  4LNU D;  1WM5 A;  3E32 A;  2A5U A;  1E8Y A;  3FH8 A;  1UOH A;  5B1A E;  2J09 A;  3PUK A;  1S64 A;  4YVQ C;  2X3M A;  2FEZ A;  4JHR A;  4C0E A;  4AV7 A;  3URZ A;  4HVB A;  5ANL A;  1QBQ A;  5CRU A;  5D2M C;  3UTM A;  1N4Q A;  3QNK A;  2LUH A;  3ENE A;  2KZT A;  2VQ2 A;  2BED A;  2OVF A;  4WNE A;  3BU8 A;  3DWL G;  4N2Q A;  3L13 A;  4DRX E;  3JXJ A;  4HRM B;  2E0I A;  4RG9 A;  5ENO D;  4EZJ A;  2H6I A;  1O5M A;  4J7W A;  4HB5 A;  4FP7 A;  3UT4 A;  3DSW A;  2XRZ A;  3P2B A;  3HXB A;  2QY7 A;  3FWV A;  3SQV A;  1XGW A;  2WXN A;  2AW6 A;  3TAX A;  4FA6 A;  3AS8 A;  5JHB A;  5ENS D;  5EKQ D; 
#chains in the Genus database with same CATH homology
 1AWC B;  3V2O A;  5FIO A;  3T8K A;  4BSZ B;  3EHR A;  3J5P A;  3NBN B;  4J8Y A;  3ZUV B;  3ZU7 B;  5ENR D;  2JAB A;  3Q9N C;  3TWV A;  2F37 A;  1WG0 A;  4U96 D;  2L6B A;  3NOC D;  1WDY A;  2ETA A;  2XEH A;  4C48 B;  3EHQ A;  4YDW A;  3KEA A;  4DUI A;  2BKK B;  1D9S A;  4LSZ E;  4N5Q A;  3HG0 D;  2DWZ A;  2QC9 A;  2Y0B G;  5EID A;  4A63 B;  2F8X K;  1YCS B;  4CZ2 D;  5EYP F;  5ENT D;  4B93 B;  1DCQ A;  4F1P A;  2ZGG A;  1MYO A;  2RFA A;  1N0Q A;  4U8Y D;  4NIK A;  2FO1 E;  5ENQ D;  1QYM A;  5AAR A;  5AQ7 A;  4OAU C;  2BKG A;  1BLX B;  4HI8 A;  5EIL A;  3TWX A;  5KNH D;  3ZNG A;  5CBN A;  1BD8 A;  3F6Q A;  1OY3 D;  4O1P A;  5AQB A;  1K1A A;  4LNU D;  2B0O E;  4DX5 D;  5CBO A;  1DC2 A;  3JUE A;  4ATZ D;  3IXE A;  1NFI E;  4LG6 A;  1A5E A;  1G3N B;  1SW6 A;  4U8V D;  4QQI A;  5HRY A;  2AJA A;  4GMR A;  3V2X A;  5FIN A;  2XEN A;  1UOH A;  4G8L A;  2DZO A;  2ZGD A;  4UUC A;  4DX2 A;  3LJN A;  2ETC A;  5AN8 A;  3UXG A;  3Q9U C;  5HS0 A;  3J5Q B;  2VGE A;  5JA4 D;  4HNA D;  4ZHB A;  5AAO A;  2A5E A;  5CED B;  2HE0 A;  4TUM A;  5AQ9 A;  1K1B A;  3UI2 A;  5CEC B;  1BI8 B;  5BXO A;  2QYJ A;  4Z68 A;  3C5R A;  4K5A B;  3B95 A;  4YDY A;  5EYL A;  3UTM A;  4F6R D;  4HBD A;  3V30 A;  3V79 K;  2ETB A;  3AJI A;  5ENP D;  1MX2 A;  1N11 A;  3W9F A;  1MX6 A;  5JMN D;  3DEO A;  4JB8 P;  5AQA A;  5CER B;  5CEA A;  1K3Z D;  5ITZ F;  3TWS A;  1MX4 A;  3TWW A;  1BU9 A;  2PNN A;  1AP7 A;  1N0R A;  2V4H C;  3TWT A;  2XEE A;  2J8S D;  4CYM D;  2F8Y A;  4BEP A;  4DRX E;  2V5Q C;  2DVW A;  3ZKJ A;  3AAA C;  3W9G A;  3DEP A;  3JXJ A;  4HRM B;  5ENO D;  5D66 A;  5KNG A;  2DZN A;  4HRN A;  4DX1 A;  4HLL A;  2KBX A;  3B7B A;  4K5C A;  4J7W A;  3JXI A;  4HB5 A;  2NYJ A;  5KWD A;  3TWU A;  2Y1L E;  4HQD A;  1BI7 B;  1TR4 A;  2XZT G;  1IXV A;  3SO8 A;  4G8K A;  4QFV A;  5KBA A;  3T9K A;  1IHB A;  2MYO A;  2KXP C;  5EN5 D;  3V31 A;  4O1O A;  4ZFH A;  2P2C P;  3TWR A;  1OT8 A;  1IKN D;  3NOG D;  1SVX A;  4K5B A;  4BES A;  3HRA A;  4GPM A;  4DX7 D;  1S70 B;  4HI9 A;  2XZD G;  5HKP A;  5BXU A;  5EIB E;  4BER A;  1YYH A;  1YMP A;  4U95 D;  4OAV B;  4HRL A;  4O60 A;  4DX6 D;  5ENS D;  4RLY A;  3D9H A;  4BET A;  1MJ0 A;  3EU9 A;  3TWQ A;  2RFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...