2HEGA

Phospho-aspartyl intermediate analogue of apha class b acid phosphatase/phosphotransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
211
structure length
210
Chain Sequence
SPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B acid phosphatase
publication title The First Structure of a Bacterial Class B Acid Phosphatase Reveals Further Structural Heterogeneity Among Phosphatases of Haloacid Deahalogenase Fold
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 75
structure length 210
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hegA00
3L0CA 4Y2RA 1XVIA 1O08A 3FZQA 3L7YA 3ZI4A 2GHQA 4YIHA 5ALGA 4Y2PA 1LVHA 2WHEA 2I34A 3QUTA 4GXTA 4UASA 3OTQA 5A3SA 3WKCA 4CF4A 2GHTA 5IT0A 5AM4A 1YMQA 4EENA 3I28A 3VAYA 4CF3A 2FEAA 3B8EA 4HYTA 5AVVA 2HO4A 4KYTA 3RFUA 3M9LA 5ALHA 2YBDA 1S2OA 5AI0A 3EF1A 3SD7A 2ZBDA 1JUDA 4UW9A 1VFPA 3B9RA 1Q91A 2Q4RA 1U7PA 4DW8A 2WF8A 3UMBA 5AKEA 4AS3A 5AIBA 4GIBA 2ZBGA 4ZEWA 3L0BA 4NV0A 2ODAA 4G9BA 3B9BA 3E58A 3FPBA 1SWVA 1K1EA 2B8JA 2G06A 3ET5A 4KN8A 2WFAA 1QYIA 4QJBA 3BA6A 4BNDA 1FEZA 1ZOLA 1Z4QA 2AMYA 1EK1A 3QU2A 4FE3A 4ZEXA 3NASA 2C8KA 5AKLA 3WKDA 1ZRMA 2P9JA 3QXGA 4XE5A 1LTQA 3WK6A 3N5KA 1Y8AA 2G1AA 5ALLA 2YMQA 4PNHA 3NUQA 1F5SA 1TJ3A 3E81A 2ZBFA 1L6RA 1RKVA 2FPRA 2HOQA 1WZCA 4UARA 4IFTA 3WK5A 1ZD5A 2Q5EA 3U19A 5AVYA 2FI1A 1TJ4A 2NO5A 3A1EA 1RC8A 3ESQA 1YS9A 3EWIA 3ESRA 4C4SA 4QQFA 5AM3A 3WK8A 5AIAA 3CZ4A 4FFDA 3A1CA 4C4RA 1L7MA 1T5TA 2EARA 2IOFK 5AI8A 4YGYA 4EX6A 1L7NA 4L6AA 2YY6A 1ZJJA 1J97A 5AHXA 5ALWA 3L8HA 5AVQA 1RMYA 2AGVA 3L0YA 2ZXEA 4OFZA 3U7EB 3L1VA 4DCCA 5ALXA 5AVZA 2DQSA 3ET4A 3SHQA 2CN1A 1T9ZA 4KX3A 5AW5A 3UMCA 4L6CA 1Z4PX 2HEGA 4EZEA 2I7DA 2C88A 2YN4A 3WKBA 1CQZA 1RLTA 2P69A 3WKEA 4NFLA 2G80A 2O2XA 5AM2A 1YV9A 4YIKA 3WK9A 4NWIA 2WF9A 4XOUA 4KNVA 1RKQA 1YDFA 3N1UA 1U2TA 4DWOA 5ALPA 3U13A 3M1YA 3D6JA 4BNDB 1RLMA 4XQ0A 5ALUA 2C4NA 5ALEA 2HI0A 2YJ6A 2NYVA 2NO4A 1RKUA 1Q92A 5AVSA 5ALNA 5ALYA 3QU9A 5AKHA 3ZTYA 5ALSA 3SKYA 3UMGA 3MC1A 5AVWA 3NANA 3NAMA 5ALQA 2QLTA 4HGNA 2JAOA 5FP0A 2GO7A 2R8YA 1U2SA 2HHLA 2YJ4A 3U7GA 2FUCA 3R09A 2FPWA 2D2VA 3QX7A 5IS2A 5AW9A 2B8EA 3DDHA 4BYGA 5ALJA 2B82A 1QQ7A 4EELA 1L8LA 3PGLA 3HYCA 1L8OA 2B1QA 2YMLA 5ALRA 1L7OA 4Y2TA 2C9MA 3OCZA 1ZS9A 4EX7A 1ZD3A 4I9FA 2O9JA 4UMVA 2CFTA 1IWOA 5AI6A 5AICA 5ALVA 5AM0A 3R4CA 4DFDA 5AKIA 4CF5A 4C4TA 4YCLA 5ALMA 3FGOA 3QGMA 5AW0A 3K1ZA 5AI4A 4BEVA 5ALKA 1YJ5A 2HSZA 3AR2A 1Z4KA 2FPXA 3KBBA 3RF6A 3KZXA 1QH9A 4UU0A 1Z4JA 1KYTA 1N8NA 3AR8A 1TE2A 1QQ5A 3AR9A 3OCYA 1RLOA 5ALTA 3ZVMA 3I1YA 4YCNA 4UAUA 4ZEVA 3KDPA 2P27A 1WVIA 2Q4TA 1RQLA 3J7TA 2OBBA 2WF6A 4J2TA 1Z4IA 1Z4LA 4UM7A 5AI5A 2ZOSA 3I76A 2YJ5A 3W5BA 3QU7A 2EATA 3ZWKA 3ONNA 5AVXA 3ZTWA 4AS2A 4CE6A 1RMTA 3L8GA 2G09A 4EEKA 3WK7A 2JAWA 1TJ5A 3IB6A 4YCMA 3BWVA 4BBJA 5AKXA 2OA0A 2AUTA 2I54A 5AK4A 1YNSA 4KX5A 3AR7A 5AVTA 5T41A 5AKJA 2ZG6A 5AW4A 2W4MA 1QQ6A 2HX1A 2HCFA 2R8EA 5AVRA 1ZD2P 2AH5A 2RBKA 4UU1A 4G63A 1XPJA 2GFHA 2RAVA 2GMWA 3FVVA 4HGOA 5AKYA 1RRCA 3ZX4A 3SKXA 4BKMA 5AW1A 5AW2A 2BY4A 1U02A 3KC2A 2FPUA 3U7HB 5IT4A 4F71A 4F72A 2JAUA 2G07A 3HLTA 1WR8A 3E84A 3QUBA 2BDUA 5ALDA 2I33A 2G0AA 3ZX5A 1Z5GA 4JB3A 1VJRA 4XPZA 2W43A 4BEWA 1Z4MA 4UMFA 3PGVA 4NAVA 2FPSA 3DV9A 3W5DA 2WF5A 3U26A 1RQNA 3SF0A 3QUCA 2YMPA 2MU1A 3N8GA 5AK6A 2X4DA 3AR5A 3PCTA 2I55A 2R8XA 3MN1A 4HGQA 4Y2JA 3I6BA 1ZD4A 1ZRNA 4E88A 1L7PA 4UM5A 1Z5UA 2IYEA 4FYPA 3DNPA 2WM8A 3S6JA 3GYGA 4H1WA 3ZWDA 3N28A 3QNMA 3MPOA 3A3YA 3WGVA 1MH9A 1CR6A 3QU5A 4YH1A 3OPXA 2B30A 1TA0A 5AW3A 2JARA 4O8CA 5AW8A 3MMZA 4L57A 4KNWA 5AM1A 1WPGA 3KD3A 5E0OA 3SLRA 2FDRA 3SMVA 1X42A 3TLMA 2WF7A 4Y3UA 5AESA 5ALIA 3IRUA 5AM5A 1T5SA 2HF7A 5AW6A 3ZVNA 1NRWA 3U7FB 3QU4A 3W5CA 1SWWA 3AR4A 3OCWA 2W11A 4OD0A 4UMDA 4Y2QA 2HDOA 4HGPA 3OCVA 2BDEA 4UAVA 3L8EA 3ZVLA 1U7OA 4BX2A 2G08A 5JJBA 1O03A 2PKEA 4BX3A 3WK4A 2OM6A 4J03A 2FUEA 4Y2XA 5AW7A 3WGUA 4HGRA 2I6XA 3OCXA 1NF2A 1RDFA 5AKGA 4NABA 3ZU6A 1NNLA 2PQ0A 2B0CA 3L5KA 5ALFA 1RMQA 2PR7A 3KOOA 3DAOA 1EK2A 3FM9A 3QYPA 3ED5A 2CFRA 4Y2UA 1N9KA 3AR3A 3W5AA 1VJ5A 2C8LA 4AP9A 5AKKA 2MSNA 2HF2A 2IOHA 4BX0A 5A3QA 2ZBEA 3ZUPA 3QLEA 1RPZA 4RETA 2EAUA 4UATA 3F9RA 1Z88A 4I9GA 3N07A 2RB5A 3OCUA 2YFYA 5AVUA 3ZW7A 3UM9A 3E8MA 1XP5A 1AQ6A 4CNQA 3EF0A 3R9KA 3NIWA 1PW5A 2JGAA 5AKZA 2CFSA 3A1DA 2IA5A 4Y2VA 3IJ5A 2RARA 3CNHA 1S8OA 2IOFA 2YMMA 3AR6A 3NRJA 3QUQA 4UMEA 5AK5A 2YJ3A 3FPSA 4OHFA 1J8DA 4Y2YA 4HAIA 3EPRA 3L1UA 1Z4NA 5ALZA 1Z4OA 3WKAA 5AI9A 4MWOA 3PDWA 3L8FA 4RESA 2OYCA 1SU4A 4JDPA 2P11A 3NALA 4B6JA 2B1RA 3P96A 5AK3A 4Y2SA 2R8ZA 2QYHA 5A3RA 5ALOA 2VKQA 4IG4A 4OCZA 4MUMA
chains in the Genus database with same CATH superfamily
1FLDA 2OFPA 4R2MA 3L0CA 3IAS6 3MUNA 1O08A 2JC3A 2XXBA 4YMSA 4JMPA 4ZQFA 1P19A 1OC2A 3QXSA 2Q4OA 4ZANA 2CL5A 3SVZA 4H17A 1CJCA 4FZJA 3OQOA 1USGA 5BRNA 5KVSA 1RXUA 2J46A 4YRBA 2Q5JA 3N2IA 5GY7A 3WBBA 2HJ9A 5LD2B 3SBXA 2QWXA 1OFVA 3X1XA 1I7DA 2QRZA 1BJRE 3LPAA 4EENA 3NYRA 3ZQUA 4K05A 4LNAA 4LZZA 4GWLA 4Z7QB 4F4CA 3BB4A 2X4LA 3HB5X 3HXPA 4OX9B 3PIRA 3CSSA 1ULUA 1PR3A 1W5EA 1WMAA 4GNKA 1N6RA 5AH0A 4IY1A 2QQEA 2OHXA 3G02A 1NQAO 4DLXA 4HWRA 5LM3A 3M9LA 2O48X 1QH1A 3DC7A 1UOQA 2AFHA 2C61A 3C4JA 3FIJA 4N41A 3GFPA 3WYGA 2WYIA 2AQKA 4NZOA 2GHIA 3S1AA 3PT5A 1M34B 5DBIA 2MYPA 3IXMA 3N53A 1YXMA 4Z2YA 2NOAA 2TMGA 2D3WA 1NXOA 1HLDA 5J47A 3L1HA 4J1QA 4HUQA 4I36A 3EQ8A 2C77A 4LJ8A 4L8LA 3GDHA 3UQYS 5JSUA 3TG8A 2EP7A 1G59A 1P7PA 3W4JA 1CR0A 3ENKA 4GIBA 1U2GA 1U0RA 1XNGA 2PTHA 1N34B 3VBCA 1V5WA 4F11A 2AKEA 4MMYB 4L9RA 5ES3A 4A0HA 2O3QA 1TRHA 2JI9A 2NW6A 3TQIA 1WHTA 3KOYA 5EZYF 2R6AA 2J3HA 3JQBA 1G64A 3EC7A 1SVMA 1TUGA 2RC6A 3LBHA 1CIVA 4MLPA 1O4VA 2CHEA 4I5GA 2A4KA 2AMVA 2DC1A 4PQFA 2Q6VA 3BC1A 5F2OA 3WNDA 1F1BA 5TSDA 2WUVA 3M6FA 4LOJA 3TE7A 3VZPA 3PNBA 3OZ7A 4G1VA 3ZLBA 3DBVO 3P4XA 4IVPA 1JLSA 3AY6A 3EE6A 3OY7A 1NYTA 2DVMA 1M0EA 4F3CA 1JU4A 3AH8A 4RA6A 5JRJA 4NG5A 1XAIA 2VUSA 4Q3CA 4I3GA 4FDMA 4BP1A 5JCOC 3DXFA 5I4CA 5DX1A 4B85A 2WEKA 4AU1A 5HRAA 5AI6A 4QNMA 3JVDA 3KJQA 5DLDA 4YP7A 3LYAA 1TYBE 4M8SA 2IZ7A 3SI7A 1Y6GA 5EEGA 5B2FA 1D2MA 3A4VA 3FNBA 3FZEA 1VKZA 2RC5A 2G9ZA 5C8DA 1J8MF 3KPUA 3JQ8A 4H1VA 5K2OA 4BO1A 3P4UA 4KE7A 2O6LA 1PLLA 4QLBA 1QIFA 3VO9A 1T8RA 2ZBFA 3FF1A 3LQ1A 3QVJA 4I4TF 1NP7A 3PG5A 1S8FA 3A14A 5JC8A 3R5JA 3T9EA 5D85A 2AR0A 3FI0A 1L4EA 1Q1EA 2WMOB 1R64A 4XGKA 2K4MA 3TPZA 5DTRA 1LLUA 5AXAA 1AK1A 3SC3A 1R2QA 1EEHA 1J0DA 1JG6A 3G0DA 4N0PA 2EARA 5AHRA 5K0TA 2RGBA 1TJPB 2VXBA 1XZNA 4WLEA 1S89A 2WMDA 1MCZA 3D7MA 4L8VA 3I05A 3EXIA 2C57A 2WSLA 1HV8A 3JQDA 2AGVA 2PMCA 1RBQA 4PO1A 5LQAA 3K0FA 2HJSA 2Z4TA 2ATCA 4GBED 1M1NA 3H5AA 3CZCA 5F3DA 2W48A 3U0BA 3ET4A 4PRKA 3T06B 2YZ7A 3ZHVA 4NTZA 2VBCA 3D2AA 3U3OA 4R8LA 3T1TA 3RHZA 1TKBA 2HEGA 1ZCZA 3ZK7A 3T7SA 1SHJA 1CQZA 4OSEA 5E4YA 4P1ZA 3NKFA 4KLCA 4XDGA 4ACAA 3R7WA 3GFSA 1TF2A 4NHEA 4ZC1A 5CXUA 4QD3A 4NQRA 1NQXA 3UXHA 1A9YA 3MIZA 4XKJA 4D9IA 4KRFA 4NATA 4M55A 2N3ZA 5FPPA 1XVAA 4UHCA 3TSAA 3AHFA 2DOKA 3BIJA 4TZKA 4N7JA 3GA0A 1GQ2A 1JPVA 1MP0A 2OHJA 1VIDA 2C07A 2VP0A 3U4IA 4MPPA 4DN6A 1HH4A 1I30A 3JQ9A 3PWKA 3TZCA 1TQ2A 2X7XA 2CW5A 3U13A 1M2JA 2BIFA 4RPGA 4X64B 3ZHRA 1PL8A 1VI5A 3N6XA 4MR8A 3K70B 2QRGA 1RLMA 3QXXA 4V0OA 4FCWA 4P08A 4RNCA 1S3FA 2JFZA 2YCBA 2QIPA 4N3AA 3B3GA 4R1OA 4RKEA 4QEDA 5CK5A 4R9RA 1DT5A 1GFWA 5D6OA 3IQZA 2LCIA 3PFBA 5BNZA 5AVSA 1LWNA 1RJGA 1CERA 1W5SA 4GMKA 1NMSA 2F3PA 1P1CA 1WS6A 1TIPA 4G2TA 4JEMA 3R5HA 4QSMA 3NVDA 4MEBA 2AMLA 1WUTA 1UMBA 2DR0A 3A9TA 3ANXA 3KYJB 3MC1A 5G1OA 2EX0A 3ZD9A 1BIFA 4ZOLB 4ZA2A 3NAMA 4HGNA 5B3JA 2NAPA 3IIIA 1X13A 3WS7A 2ZFUA 1UDCA 1VHLA 2C7GA 2QRVA 2CJFA 4U2CA 2RJOA 4U8GA 1KZ9A 1VDMA 2HHLA 3FY4A 1V1MB 3HBFA 3QMWA 5LU9A 1R00A 1U7DA 1ZVVA 1ZN8A 1GAXA 3VNQA 4RD0A 2HA2A 4X93A 1R7RA 4EH1A 5BUQA 5ICMA 2POCA 1L7EA 4G5OA 4NMLA 3RAPR 3BBLA 4A0SA 2QBYB 1T6BY 2OCDA 4ITUA 5DBGA 2Y1FA 3FTCA 3UWSA 5JSFA 5C35A 1USIA 3PGLA 2CF5A 2CMHA 4IX9A 1N2CE 4U3JB 1QGZA 4PE5B 5B6JA 2B1QA 5GJWC 1OROA 3TZEA 2CNNA 3T38A 1K75A 1ZMXA 2DR2A 4WBXC 2V4ZA 5CT5A 4U1RA 4PFJA 4L8GA 1U1IA 2ZM5A 2HC9A 4A3SA 4Q4AB 3V2GA 4BL5A 4Q4CA 3LBFA 2QUZA 4ISBA 3I9MA 5LB2A 3WZLA 4MA5A 2BSQA 1M2GA 1Q3TA 2ZQZA 3CVJA 3PUIA 3UJ3X 5K0CA 1Z7BA 1DC7A 3IDSA 3K2EA 1MC4A 3BIWA 3G89A 1RAIA 1VJGA 2JJQA 4JBYA 4ZVOA 2JGRA 3KCQA 4KQWA 3QX9A 5FFMA 3DEYX 1UQRA 4CIDA 1ID8A 3JD4A 1RIFA 1N57A 1UFQA 3K9CA 3TSWA 2C4WA 2A5GA 3DTNA 1Q20A 5BW8A 5ICSA 3HRHA 2DETA 1QM5A 1ZMRA 2VR1A 5G53C 1USUA 2VDOB 2P2CA 5GJBA 2GK7A 3BWXA 1Z4JA 1C0EA 4J75A 3LO5A 4H6WA 5JAHA 2A57A 1NXQA 2VUTA 3ZXXA 5C5CA 2FN4A 1QQ5A 3S0JA 3QHQA 4Q1AA 3K73O 1P5HA 3PF9A 5FOSA 3SJUA 9GPBA 2C0PA 5KBYA 1X2EA 4HDMB 1V2GA 2ETXA 4TLLB 1NXVA 1CQJA 2ZPTX 5KQPA 4D3DA 2HLDA 3FSEA 1A8IA 1JHRA 2EVWX 4YT5A 4LHVA 4GOMD 2Z09A 3EVZA 1U0EA 1GA1A 3U4GA 4EFLA 3Q3JB 3DONA 4IKEA 4MWBA 1F2DA 4PXSA 5A0VA 1JKXA 5FPTA 4DMLA 3QKWA 1P0FA 2FP4A 3HBJA 5KJFA 1TQ8A 3BD6A 4UBNA 2I8AA 4NFYA 5FBRB 5JAQA 3UN1A 4CJXA 5LQUA 4CN8A 4UD2A 1GYRA 4PC1A 2PQMA 3QPAA 2HQOA 1EFPA 3HN7A 5JE8A 2ZAOA 4AN1A 5KYKA 2B83A 4LDNA 3E9CA 1NJ8A 4LC9A 3DDZX 5UKDA 4BLTA 3CG4A 3PHCA 3AUTA 1M2EA 1EWYA 3EMKA 2NUAA 1YIOA 1TVMA 3KAQA 1ZIDA 4QGHA 3CINA 5J40A 1SIOA 4N4AA 2YHIA 3LVFO 3DOHA 5B53A 4E2XA 1UBRS 1V5FA 2AUTA 2I3BA 4MUXA 3PL5A 4ZVMA 4BWFB 4F93B 5I9IA 3AVOA 1DINA 3CJRA 1PR0A 2R2GA 3MTGA 4GM0A 1DADA 4J6EA 3MBIA 4N8DA 4G1EB 3NVMB 4LRXA 2D06A 4NZ9A 4YJ2F 4OQFA 5DTEA 4AD8A 5C46F 2Z1NA 1QHNA 1TOAA 3K0BA 3RQSA 2F17A 1UXOA 1M2KA 3H1BA 5F9HA 1H2EA 2NXWA 2O20A 4KK3A 4NFSA 5B4VA 1XDDA 3RQIA 1M2VB 3IXLA 3JZAA 4LHYA 2FG5A 2H3HA 3K1AA 1DBIA 4MW0A 4U02A 5BSRA 4COOA 4HVCA 4DNOA 5IULC 4L28A 1GRQA 2UZ1A 3BIOA 1QZXA 2JIQA 3GUUA 3UAOA 2OBYA 3ICCA 5EIAA 2RGCA 2V5VA 3W2TA 2HLDD 3B6EA 1A7KA 2FPUA 1ZH4A 3CF2A 2AFHE 4RF4A 2VXCA 2I4TA 1JL3A 1RKXA 4CPDA 5A02A 3H9QA 3L41A 3JAMA 4QHTA 4ZCSA 5C1BA 3QXCA 5GONF 4WN9A 1EGQA 1B8PA 2I33A 2QP3A 3ICWA 3ROMA 2XGGA 1ZMBA 4IZIA 1UBJS 1RXWA 1E6CA 2IE8A 2VRBA 1E6WA 1UBOS 1XZ8A 1MORA 3QZUA 1WNFA 1CLUA 1U4OA 4TMVA 3VR6H 3WWYA 4C7BA 4BEWA 1WSDA 3T1OA 2R6GA 4MS3A 1BHO1 1RQNA 2QYSA 5COBA 4FXPA 5JD4A 1Q0LA 3ESYA 3B1JA 3G9XA 1QKJA 1WTAA 4ZDWA 2IBTA 1GPJA 4HLQB 3W1EA 1N9GA 4UPEA 1DQSA 1Z73A 3OZIA 3RUHA 1T15A 4KPUA 1LPOA 1AGPA 3I6BA 3WFIA 5F76A 2B6HA 2QS9A 3HB1A 4RJKA 721PA 3Q1KA 3QXHA 1KJWA 3GH1A 2J6IA 3L7IA 3VMFA 1MNQA 1SVNA 4EYGA 1A9XB 2G72A 4PNPA 2H0AA 2PAAA 4KLZA 4YH1A 3PQ8A 1U4SA 5BQ3A 2LP4Y 2OXTA 3SC6A 1ZAKA 3SEAA 2H1IA 4GVXA 3VSBA 1CNMA 4YMLA 1SZCA 3U9LA 3BHNA 1WUHS 1DQZA 2EP8A 4D5GA 5KJ6A 2DKNA 4JASB 5EKSA 5IWAB 3COVA 1NI5A 1XMOB 3RS0A 1W94A 2OBMA 4BVJA 1ZEJA 1M0SA 4NOJA 1G6KA 5P8WA 4DCJA 2FDCA 5KNBH 1FCJA 4JC5A 1M6NA 1X80B 3C3YA 1FYXA 3MT0A 1V6AA 4DILA 3VGJA 3WL5A 3GXBA 1E2KA 2VPPA 5TGZA 1SIWA 1MIHA 3LQQA 2B69A 4U9HS 1X1RA 1KXJA 2ZITA 3GEHA 4TGLA 3KSDO 4UC0A 1BFDA 2ZSEA 5TQ2B 3O93A 4CODB 5JALA 1N7JA 3IMKA 2IIVA 2QQGA 3P0JA 5CU7A 3V3TA 2XUFA 1EDDA 4AJKA 1CD5A 4J03A 2N46A 4XTCS 1OLXB 1VHDA 1IRXA 3QTLA 1EFKA 3IUNA 4MGEA 3LT0A 5G0TA 4BMXA 3WGUA 1NVWQ 4F5ZA 4POOA 1NW3A 3RVRA 1RDFA 1T6XA 5E6UB 5JJCA 2EKLA 3WIOA 4EG0A 5TJHA 1A88A 1BE1A 3BTSA 4BNWA 4FIDA 1T1EA 2XDQB 4ASUA 1OB5A 3H1PA 4CHGA 1IJEA 2PR7A 3KOOA 3MRTA 4LY0A 4OHRA 4DDKA 2D5CA 3PC4A 4Z9FA 2GYWA 3KZNA 5EKTA 1I3MA 1QVVA 1QYWA 1QB7A 3ILXA 1E5DA 1RIIA 1CUEA 4W9NC 1JEOA 2OOSA 5KDOA 2YFHA 1VBMA 3F5FA 4CKXA 3CBQA 2Q5OA 2KB0A 3W5AA 3CEJA 1OTYA 3VU9A 1X14A 3ZUPA 4Z9AA 1XROA 5E1BA 1N1EA 3GNLA 3AVVA 1JG1A 2XX3A 4R98A 1RPZA 4DDHA 3LPLA 3WISA 4YCJA 5GTDA 2H4HA 1JECA 5DM70 3EUAA 4G1UC 4GI1A 2A2ZA 4S12A 3MCUA 3G2MA 1D4FA 1KY2A 1TMKA 4R71A 1KI1A 1RT9A 1T2CA 2QRLA 4BNVA 4EVRA 1JJIA 2IS1A 5F21A 5ABPA 2WHPA 2RAPA 3AF5A 2ZRFA 4N54A 4ERNA 1MG0A 2CNBA 4X60A 5TVKA 1QUEA 3RS3A 2HIGA 4Y0AA 3ZIDA 4D4IA 1OAOC 3WI7A 1CUUA 1Z6GA 2FWMX 4WECA 5B6PA 1VYTA 4X6LA 7REQA 3FGZA 1Z2CA 2QNRA 1UQTA 4ZOBA 3KZKA 4JI8B 1J8DA 1LFAA 2JK1A 4P7BA 3V7NA 4HAIA 5K3OA 1V5GA 3C3MA 1X94A 4XIFA 3H2IA 4RKFA 1U7HA 2QAIA 1AO0A 1AGYA 3AW9A 4DR6B 3F3YA 4MQMA 4Y9RA 3SAJA 2O2DA 2YNMA 2IU4A 2PBFA 4MI1A 4YQZA 4IDNA 1IU9A 1G60A 1N1MA 2PZJA 3BGOS 3LOPA 3DUWA 2QVZX 3B60A 3A06A 3K2IA 3OO0A 1W4ZA 1DX9A 2ZTSA 2Y76A 3DTYA 3NALA 4BLWA 4DC9A 4DDVA 4MRMB 2JGDA 3NNNA 5AK3A 1QIEA 5FT9A 1RXEA 4NVRA 4M76B 4RK1A 5GWXA 1GGNA 1KKMA 3B6IA 4BVAA 4ASUD 1KEWA 2ZTLA 3K4HA 3HO1A 2VO1A 2VXOA 4YCBA 4M8KA 1Y48E 3LHSA 1KK3A 3SIRA 2WC1A 2XXAA 5DCLA 4L08A 2QK4A 2DQ4A 2EL7A 3A1SA 1TA4A 2AQIA 2GBPA 2H00A 3L49A 4P3PA 5DRYA 1FJGB 3CE9A 1Y1TA 2WHEA 3QE3A 5HCUA 3SBDA 1A8QA 1NKTA 4HNQA 5U9CA 3OD1A 1KJQA 1KIMA 1T2DA 2O8VA 3PT9A 3H6GA 3I92A 4TS1A 4WK6A 5JMOA 3S8YA 2J9RA 1J2EA 3EGWA 4MLDA 5FWDA 4DSZA 5C18A 5EIEA 3EPKA 3BD7A 4RY0A 4DM7A 1GRVA 1KU0A 2EOAA 2FG6C 4R9VA 4EK9A 3G2HA 3V6LA 3OT1B 4FBLA 3EYWA 2NO9A 4P3KA 1RYEA 1QYXA 4ZMSA 2WV9A 3GRKA 1DMSA 5AOVA 1U81A 3GELA 1PK8A 2WPNA 3BWEA 2UDPA 1J1UA 1YRHA 1V7PC 3L6BA 1RZUA 1LX7A 3KNZA 3QM1A 8OHMA 1C1XB 2UYCA 3VPGA 2X0KA 1U3VA 1GYPA 4OREX 1SKQA 3M6VA 4Q3BA 3GVXA 4JA0A 2YXPX 1K5HA 2HPHA 2G36A 4I81A 4X9XA 2XIJA 2FWPA 3T1VA 4V1CA 1N5DA 2WILA 2J07A 3GFFA 3GJ4A 1JI0A 1RQPA 2PX2A 3LWZA 4CL2A 2DFTA 2DSNA 3FVTA 4IUDS 2CZGA 4IUYA 5FI0B 3SE7A 4DW8A 1LK7A 2YNMD 1J06A 5DHSA 4D81A 2SKEA 3F9CA 4B35A 1Q1AA 2NIPA 2XADA 3HYTA 5AWFC 4NV0A 3ML1A 1PKXA 1KDYA 5JDCA 3Q8MA 2VJKA 2ZUEA 1ZW1A 2QTHA 1AK9A 1PJRA 1ESNA 1Y4ZA 3LC2O 1NIPA 3ZHYA 2HJHA 4XX0A 4AJOA 4GSKA 1T91A 4URFA 2O1XA 1AC5A 4D0NA 4JLPA 2H0QA 3NOOA 3DWFA 3GL9A 1P5FA 2CMGA 3D6HA 2GJ9A 1YB4A 3G2QA 4RM3A 2PBLA 3SEZA 4LJRA 4FNMA 3FA2A 1EFVB 3T54A 2R5NA 1U8EA 2Q3EA 1QANA 2PO5A 2FMIA 1Z4QA 4OYRA 1NASA 5FI3A 3ZJVA 3VQTA 4EYEA 4RYDA 1DBRA 4MV6A 2Z6UA 5IJ0B 4PEVA 2NZYA 3N87A 3P2OA 3BL5A 4U63A 3ZEAA 5KUTA 2IL1A 1PD1A 2JZOA 1W47A 4UKDA 1A77A 2HU7A 4JFAA 4E22A 2VQSA 2VPQA 1F6DA 4R4JA 4MUKA 1XD8A 4IM7A 2B92A 4M4SA 3L04A 5DYYA 3WWEA 4JLMA 1P81A 4EA8A 5CDTA 1NWCA 4QASA 4FE4A 3HY3A 1VLVA 1QHGA 1E3DA 1FQKA 2PCLA 4HO1X 2FQQA 1OA0A 3GLFA 2C2WA 5BWMA 2IH2A 4FXOA 1K27A 2EXXA 4LXUA 1AQYA 3NPMA 5DTIA 4YMWA 1VMKA 2JJ8A 4YLYA 4ROSA 3DL2A 1JJAA 5BN4B 3K8ZA 4N5NA 1AMOA 4PX9A 1MLDA 1MAVA 3KE9A 2MR5A 4Y6LA 3DDCA 4X54A 5LQMA 2OXCA 1VM6A 4MDHA 5AIAA 2H4XA 1MG5A 2BEUB 3CZ4A 3EQ7A 2G25A 1A8UA 1MJNA 1UWVA 2JI7A 3EQ6A 2BD0A 2WIBA 2FSVC 1LGYA 2X58A 3FIUA 4LJSA 1KDPA 4MQLA 2VTEA 3NYQA 2YYZA 4YGYA 3VR6A 3OCJA 1I36A 2DCUA 4ECAA 3ECSA 3SIXA 4D9KA 4EUKA 2DXIA 1ZJJA 2KQUA 3U37A 1XB2A 1P1KA 2VT2A 1R6DA 1ZUNB 3C24A 4JHLA 4JQZA 4EQ6B 4QEKA 5ISMA 2GJAA 5SYMA 3CLTC 1YZTA 5TS3A 4FPXA 2O8EB 1D8TA 3RIHA 4OQMA 3NP7A 4ZI5A 5KTOA 1W30A 5A4KA 5LL6P 5ELXA 3B1YA 4BVEA 2PRIA 3A4TA 1LS6A 2DQSA 3AM5A 5HDQA 1WW2A 5HQJA 1KP2A 4FFWA 2ORWA 5FUWA 1L7AA 1GU7A 1L3BA 1D4AA 1T9GR 2Q1YA 4ALKA 1W6RA 3DBHA 4ZYVA 2NU8B 1ZDMA 2CKDA 3WKEA 4F21A 4H4DA 2JH9A 4IEIA 4JNKA 2JGKA 2V3WA 4ZV9A 1H6DA 3RUDA 3TD6A 1FNCA 2R1TA 4YXWA 1G19A 1LA2A 1MT0A 1PSWA 2X9GA 3UT5B 3NG1A 4HS4A 2D5AA 1EGHA 3ABRB 4LOHA 4XOUA 4AO7A 4AKGA 3KUDA 3TNLA 5I3CA 3G2KA 3U6KA 4NH4A 1QWOA 2VP5A 2PSDA 3TTYA 2V74B 4UNPA 1B2LA 1DBWA 1V3TA 3DMTC 3MG9A 5L51A 5EXTA 1M33A 2YOHA 1QZTA 4UHHA 5BYBA 4LDAA 3C15C 1KORA 3H9GA 2ZM6B 4JB0A 2RIRA 2LKCA 2QW0X 1VXOA 3BERA 2LXNA 2RGXA 3JQGB 4J0JA 4V3BA 5KC8A 1NLUA 1A9RA 2NYVA 5DZSA 1FP1D 5ARDA 3C3KA 5D51S 3FOEC 4CV0A 3HBAA 2PKCA 4D4LA 1XMPA 3GGOA 3GIDA 2WWXA 4E15A 2RHJA 1D2GA 1NF9A 3HU2A 4S1WA 1B0AA 3DV0A 3LNCA 1OCEA 2UYGA 2IRWA 3LS2A 1WQ4A 1MIOB 4DLRA 1UKYA 2VTBB 3G8AA 4CI9A 2HA0A 3VR6D 4FHDA 4XVCA 1QYCA 1XYVA 1IZYA 5FP0A 4Q9HA 1SCBA 4QTUB 4LDJA 2J41A 2Z5VA 4GM1A 4KIJA 4IG9A 2FUCA 2G9VA 2I3GA 4OAQA 1HDYA 4JJEA 4LYGA 4N3CA 4QTXA 2D2VA 2XKAA 3U3RA 1N36B 2BV3A 1JR4A 1RCUA 3Q2OA 4JCOA 4JFRA 5KJEA 4DDUA 1WUJS 2MINA 4OMDA 4OI0A 1ESMA 1J8VA 1RPNA 3HYCA 3R8CA 2OV2A 4F4IA 4Q47A 3V8QA 3GDOA 1JHUA 1GXSB 3L0SA 2JHCA 3WRXA 3ZNQA 3ICEA 1YB7A 3BCSA 1NE7A 5WRFA 3D7LA 2G8NA 4YXWD 3BK7A 4QPPA 1V48A 3LRPA 2QMZA 1TUBB 4JJIA 4R9NA 3UAWA 3U40A 4CU5A 5HK8A 3NTOA 2GRJA 4EECA 5ES4B 4C4AA 1E9DA 2CHUA 4TXNA 2E9SA 5IZCC 5DNCA 1T2VA 3IJEB 4B3MB 2ROQA 1SKYB 1WUYA 2C0CA 2I7XA 3KKKA 4MB6A 3TLCA 3I12A 3HM9A 1XZHA 1P1RA 3H87A 2VEOA 3LXXA 2ZYIA 3QGMA 2ZIZA 3QMVA 3NHPA 2JBHA 4GXNA 4YJ3F 1A96A 2VJMA 5ALKA 3DUFA 3L6UA 4MAFA 5BVHA 3I1IA 5I3ZA 1QKIA 4DLZA 4P5DA 4KUEA 4KI7A 1NN1A 1HL7A 4MW1A 1XVUA 5CK4A 1VRVA 4IGKA 1I1QB 4YREA 3VVBA 3UK6A 2NU6B 4QVKA 1XZJA 2REOA 2W4IA 3ILVA 2HW8A 3DEIA 4JLVA 2VYFA 5DU2A 3VKUA 1UT5A 5BURA 4RXUA 4DR2B 4F4UA 3HDQA 2BE9A 3PPWA 3GZTB 1F0YA 2YWRA 4NRDA 4ZTBA 5KYGA 2YOFA 1TVCA 1VCIA 2Z5GA 2QVLA 1KI9A 2BGMA 4JSRA 5KOIA 2H4ZA 1E5LA 4KO4S 3K30A 3A6PC 2WF6A 4HMOA 1RC0A 1Z4IA 2P9FA 4XDZA 2QVGA 1W1IA 2VQ6A 3DE2X 4D26A 4RKQA 2NGRA 2YW9A 3CUSA 1DXYA 4ZO6A 3JYHA 1E9CA 5AVXA 2XBUA 3NDJA 4M9UA 3I2HA 2GPAA 3P0FA 3GJXC 1A2BA 1FDIA 4FEAA 4X7MA 4C20A 4QG3A 2JCVA 2W8BA 3P9ZA 2VYCA 1GWNA 4I1IA 4JJ6A 4OMFG 1LH0A 4XM1A 4CUKA 1ULBA 2VNHA 4KAJA 4W5NA 3LLUA 4ACBA 1PGOA 1ZW6A 2A5YB 2I2WA 2QR5A 2XB4A 4LWPA 1H3NA 1MX5A 2GHRA 4JKOA 1TJ5A 1FLNA 5GOTA 2FUG1 5HTKA 1IB6A 3HDVA 1XCJA 3PEUA 3EZLA 1PO7A 4IJUA 5J2TB 1W5AA 3TLYA 2AMFA 2QLBA 1Q1QA 1RQ2A 2R1UA 2FPIB 4HLDA 2W6NA 5G02A 2HSGA 3JZDA 3DTTA 4KN9S 1H2RS 1HFJA 4YRZA 4HR7A 4JUFA 3D1VA 5FQOA 4CQNA 4HVAA 4NBLA 3RNOA 1DCMA 1E4VA 3AETA 1NR1A 3DT6A 3ZI0A 4EABA 3HWSA 1FYFA 4YP1A 1Z6ZA 1O95A 3EX7C 1HF3A 4WXMA 3FBWA 4P0QB 2ZATA 4CCYB 2AG0A 1KI3A 2FMFA 4WA8A 4XOIA 1UK9A 2V59A 2WT4A 4TMXA 2XUHA 1N2ZA 3LYHA 4FZRA 3X0DA 4R0VA 1RRCA 2ZR9A 1KH3A 2Y05A 2OGWA 4QPCA 5A05A 4I6EA 1U02A 3AJ9A 2FPPA 3IERA 4FSHA 2GCEA 3UKJA 5ILOA 3OZAA 3ND8A 2ZI9A 4UFPA 1PBNA 2ZRKA 1B23P 2O8FB 1KSFX 4IUBS 5EUMA 6NULA 4WBNB 2FMUA 3HRKA 5TT1A 5TXGA 4YWHA 4M99A 4A2QA 1PS9A 1NUQA 2Z4RA 3WYBA 4Q7MB 1DIAA 4II7A 4YUXA 3FOCA 1SBCA 4LYHA 1AS0A 1DOZA 1N2JA 1G5TA 3BB1A 4EJSB 7ADHA 4K6GA 5D1HA 4OGWA 2CVHA 4X94A 1LNSA 1N3IA 3OEEA 2H7CA 2BKLA 3FSGA 3E9MA 4G1MB 3ETNA 3E1GA 5A03A 1FX1A 2KMLA 4ETWA 2OCKA 1EPUA 4N39A 3FVWA 1M6VB 1Y6ZA 2B2XA 2VJLA 4PYIA 1Z63A 1B4DA 1OXUA 3ZK9A 5K05A 1X38A 1ZHOA 5FNVB 1C2TA 5FOWA 4B6FA 2C2BA 4QJ3A 8AT1A 2QAGA 3DNPA 3FWZA 4BBZA 3TGLA 4TLBA 1T2FA 4Z0HO 3LFTA 1QLJA 4Q9IA 3ZWXA 2FA9A 5MHTA 3NDBB 5FUQA 3CJTA 5AR1A 4OF4A 1Z5ZA 1KMQA 3PC8A 1O95D 1M67A 3SS9X 4NPAA 1ZCAA 4DA7A 4H3HB 2CVFA 1JH9A 3BICA 2HRQA 2I9KA 4TMWA 4NHOA 2P68A 3MEQA 4EFDA 4DR5B 1YQDA 1X87A 2VK1A 1NLYA 2M1XA 4EHKA 2IHBA 3IP5A 4INOA 1GRNA 3HNRA 3LGAA 1WQ1R 2B61A 2YWEA 1ORHA 1EFDN 2A92A 2SKDA 3PHIA 4V03A 4XQCA 2R6HA 3GFQA 4OQXA 5ALIA 4JLKA 3AEUA 3VPBA 4ENUA 1V8FA 3SZGA 2HV8A 1GTMA 2V96A 3I53A 1KOJA 3R40A 2GF9A 1YBVA 2JEZA 4ISCA 4CN9A 1N33B 2G5CA 2WJAA 1K63A 1GGJA 1ANKA 2ZSFA 3HFJA 3KQTA 5ICFA 2WT9A 4NJEA 3DE5X 3NJ4A 3GLFE 4UCXA 5EP4A 3LV8A 4L85A 5E9JA 4OQEA 3LPNA 5F73A 4N49A 4C4OA 3R9IA 4EKIA 1M8JA 3GPCA 4C06A 1NA5A 5JAMA 4EL5A 4M1YA 3OEED 1AUXA 4XB6B 1D2NA 3AK4A 4PINA 3VU3A 3DCJA 3FSGD 4BGIA 2FB9A 2GZHA 3FRHA 3S99A 3ETCA 3UWOA 3BMNB 3IIKA 1NVGA 4GAEA 3DMNA 4EHNA 1J7JA 5CBPB 1PR5A 1JVNA 3DHNA 1PFKA 3FKJA 3OZRA 1AQNA 4AYTA 3NIBA 3QYPA 2E5WA 4BN0A 4F4HA 3MLBA 3M83A 1DNPA 4EGQA 1RBMA 4QBGB 5U4XA 3SGLA 2BGJA 3BFVA 3ETDA 2A7QA 4MVJF 3T1NA 3EZFA 4N9WA 5EPEA 4PLYA 5DASA 4K6KA 2OMKA 4AP9A 3VKHA 4KMSA 3VNUA 1KP3A 2VOEA 5KU7A 3TAXA 3HE3A 1PJBA 1B0ZA 2E4VA 4C2AA 1KMCA 2YASA 1Z34A 3CGWA 4DZZA 5JZOA 3FMOB 3HVHA 2ZYAA 2WI8A 2J09A 2EZ8A 2ZBVA 1CPYA 1AQ6A 1BMTA 1CBUA 1JTVA 1RAFA 3C6ZA 3KT6A 3KYCB 3GP5A 4LPSA 1MPXA 3SLKA 2CD7A 3ZWYA 2D4HA 2ZI4A 3INNA 2GZSA 1T8TA 3RUCA 1GDHA 4ZIRA 2WFZA 5L4LA 5A9RA 3E3AA 4HDSB 2ZJAA 4ID9A 4MHOA 5J3JA 4BWGA 3ST7A 4FWIB 3GD5A 3TLGA 3O8LA 4REOA 4R2KA 1FSPA 3PNYA 1U8TA 5G0UA 3SQLA 5HM6A 1H6BA 2JIDA 4Q9JA 2C92A 1MO6A 4FMCB 4CCAA 3PQ7A 4Y0VA 5HE8A 2B94A 4NONA 4K6CA 1UAGA 1AVTA 5HILA 5DGTA 2ZQYA 5FBLB 3V1KA 1DKPA 2Z1MA 3G2LA 1PTJC 1UPBA 4R7ZA 5C1OA 2G4CA 2G1KA 3MJVA 3T7EA 2YZGA 2O2HA 3W2IA 1WMSA 1JJBA 5C3MA 4M0UA 2J0QA 1G21E 4MYHA 1JWAB 2QYHA 3EFHA 3W6PA 2H2WA 1P4SA 2Q46A 1DBPA 3AP2A 3D7RA 3LFHA 4MWCA 4XYEA 5DK6A 4HBGA 5ALOA 1ATZA 5DBHX 5EXSA 4DA9A 1XJCA 3KVOA 1XZIA 4KPYA 5F64A 2FRDC 4K9RA 4OCZA 1N2SA 1R4NA 1Z5PA 2GWHA 4BBAA 5TGDA 2W2TA 4J7AA 4Y1EA 5F3WB 4KMMA 4WCDA 3HBNA 2Z8XA 1QHXA 1E59A 3FYUB 1E1LA 1LVHA 4JP8A 1AXRA 4PZZA 3H11A 2NUTA 3LLSA 5HPYB 3TQHA 1VA5A 2NSYA 5E6SA 1E5TA 1ZR4A 1JILA 1WL8A 3RCBA 5CFNA 4ILKA 3ZGZA 2PGJA 1JB9A 2R8RA 3JZFA 4MV5A 4HYTA 4MI3A 3ZW9A 5FWAA 1V4NA 4AN4A 4CM3A 2B1GA 4B17A 5LUAA 2WQ7A 5C52B 1K6XA 3Q6MA 3IC5A 3TRIA 3PWTA 1M83A 1RHQA 1VGRA 3PQDA 3QVMA 3ESZA 1QFSA 1LQ2A 3R3JA 1PS0A 2OHVA 4AAYA 1TU0A 2V6BA 4J2HA 4D8TA 2QVXX 2XA9A 2QTRA 3GJTA 4XD2A 2GVNA 4DJFC 2P6PA 5M2QA 1KY4A 2Q5LA 3NHWA 1A5BB 4CVNA 4YROA 1DC6A 3I39X 1BYIA 2GK4A 4B0OA 3FHTA 3EASA 4LF5B 1IZ8A 1KOLA 5I7OA 2NQ8A 3CLHA 2IW1A 1NKSA 3JSXA 5JW6A 1U7PA 2QGNA 4C0LA 1PDVA 1D5CA 1K4KA 1P7YA 2EJTA 4H60A 4RH0A 5AKEA 4V1CI 4DA8A 3H04A 4L5BA 4JWTA 1A69A 2HA4A 2R84A 4FDLA 5CLIA 2YX1A 5CB0A 3EC1A 1IPEA 5ERXA 1G5QA 2R25B 4LXXA 3B9BA 4TQGA 2JPDA 1S9HA 1AKWA 4LRTB 1ZXXA 1E3IA 3HSKA 4IZHA 4V0MA 5J59A 3W7BA 1PQYA 4FLMA 4BB0A 1G0OA 5EKXA 5EXXA 1TAHA 4D9GA 4E70A 2CXTA 3G79A 1M66A 4BZWA 2PWZA 2VOJA 3WLRA 1E9EA 3I9V1 4UUOA 2NNWB 3VH3A 3NFRA 4L4SA 2GESA 1A5TA 4CM9A 4I8DA 1PVVA 3R0VA 2FW9A 1PX0A 3DOEA 1RAHA 2I8CA 1LWOA 4WXRA 4EHBA 1NTRA 4LZNA 3I8OA 3V2UA 2I1WA 1YASA 3ETHA 1EWVA 5A0FA 4CKYA 1WUIS 3HO6A 2DYKA 2WG1A 4HB3A 1QNLA 2NTJA 4MV4A 3K0SA 2GASA 5HF9A 2B4TO 1H2XA 1F17A 3N8NA 1CRZA 4HX9A 2IWHA 5CH3A 3AIKA 4MW9A 3RE1A 5DI3B 4GGPA 4YAIA 2AG1A 5MN5A 4PYKA 3ECCA 3KXIA 3I4CA 5KVAA 1HY3A 4XWYA 4K28A 1NULA 1YQGA 2GK6A 1Y8AA 3EYAA 2Q45A 4GYYA 2RD2A 1EWQA 2B4KA 4RDIA 2DAPA 1A9SA 5F98A 4I4IA 2FPRA 2HOQA 4BZPA 1AV6A 2WSSA 4L3WA 1ZD5A 1X9IA 2ZUSA 3DG9A 4HNAA 2EKZA 4G26A 1XG5A 3LZ6A 4L4YA 4S0ZA 4ZT5A 3KVRA 1KR2A 3SXUA 1NRIA 3LHKA 4M1SA 1Z2DA 3TIIA 3OX4A 4ZI3A 4FB5A 1G0NA 2C9CA 2UYYA 2ZB7A 3FKQA 1FY2A 3M5PA 4NBNA 5G1PA 1SKAA 1WCWA 3LLMA 1T5TA 2ZUDA 3HR8A 3REQB 4A91A 1NU6A 1T8UA 1M2HA 5CA0B 4TKLA 4YRGA 1FVOA 3H6KA 5LZ2A 2YICA 4MIYA 1MAUA 2ZSIA 2YUTA 3UCFA 1J97A 4I1UA 4DMHA 3A7EA 4EYKA 1R37A 3RIGA 5JI2E 1Q1NA 1G21B 2ZR7A 2VYNA 3B9PA 1WCIB 2ZSBA 1P6QA 4TT8A 3VI3B 4RVNA 3EZXA 1OILA 3U7EB 2V6JA 4CM9D 3H99A 1J56A 1BXGB 3HJAA 2AI1A 2XHZA 3KTAB 1Y42X 5EAIA 5SY4A 3U3JA 3D6FA 4KRYA 4LOAA 4TV9F 4CKEB 4DIOA 5CDSA 1DDOA 1T9ZA 3NYIA 1E1KA 4Q34A 4GPD1 1H69A 1XA0A 1H2YA 2BZGA 3CR7A 4MROA 3TTTA 4EZEA 2BM9A 5C37A 3BDIA 3HCAA 3K0KA 3N6VA 5K3AA 2VNKA 4GFDA 4KOAA 2LTAA 4I1OA 2NM0A 1GDDA 4DMGA 1ML3A 5F2EA 3WK9A 3MOIA 2RHRA 2WF9A 3RSFA 4XAQA 1TAGA 4ZRNA 2UUBB 3EXHA 2QT9A 4JI5B 3EPLA 2ZI5A 3PD7A 4LWQA 1RQRA 3KELA 3QHPA 4DT1A 3T1YB 6LDHA 1TCVA 5REQB 1H9CA 3D02A 4DC1A 2OG2A 4O4LF 4CQJA 4XPIA 1MB9A 2B4QA 2DJ5A 3N58A 4G2NA 3TMKA 3WRYC 5JWOA 4AMBA 2H1OA 2W70A 4D3SA 3CVYA 4DJTA 3IP9A 4MAAA 3PD1A 4RPCA 3KSUA 4P4LA 5ALEA 2QL5A 2C5FA 2WSSD 3QWHA 2H65A 1U5BA 3USES 1QGOA 1XD9A 3CVUA 1F7UA 2KI5A 4BMDA 4Z8YA 4YJFB 4G24A 2NUPB 3V3KA 1EQUA 1LF0A 5HEKA 4A82A 4ND1A 2JJYA 3L40A 3L7BA 3ORHA 1GNLA 1POXA 2QLNA 4TN5A 4TWIA 2D5IA 5ALSA 1DCFA 3JQAB 4JYZA 3PBKA 4ZWNA 3T9FA 1KO1A 1XEWY 5F1YA 3KB6A 4FFOA 4W7SA 1FP4B 4XI9A 2B99A 3O38A 3QVGA 1U3TA 2X86A 1F14A 3CLSC 3CX4A 3LRXA 3BAFA 5DDIP 4WINA 3WQHA 1CRQA 1AQLA 1V25A 4ZHQB 1O94C 1XVVA 3IUEA 4QBIA 2VYND 3PCRB 4YRNA 2DFDA 4MS1A 1ZOPA 1ZWKA 3BFPA 3H5TA 1SXGA 4R69A 2K7ZA 4URYR 1XL1A 4RVCA 3WYEA 3ZH9B 1HDEA 3I34X 5HDBB 5BYAA 2HUNA 1UBGA 4NBWA 3HCFA 2MMCA 2RJ3A 2XVMA 2CJWA 2H11A 3KKZA 3AT1A 4Y6OA 9LDTA 1H0RA 2Y1LA 3M6IA 4WVLA 2FX2A 4W1PA 4MDFA 3WO1A 1K5GA 4R1NA 5KYWA 2F64A 2EFJA 2RBEA 4ZQGA 2OOKA 4X20B 5AJVB 4DQXA 4Z6KA 1A50B 4NCNA 4XH9B 4NV1A 2FMTA 1QR6A 2HXGA 1U28A 3K16A 4ZQBA 2WQZA 4P92A 1ZM7A 4UJ5A 2X0RA 5LSAA 5KJ1A 1TL7C 1IN7A 2BFOA 1GNQA 1WD5A 1MDFA 3FNRA 3UOGA 1W73A 4XXHA 3UCEA 4DV5B 2DT8A 3AEZA 3DFMA 4IIFA 2Y99A 4ZT6A 1BGVA 1KI6A 1J7KA 4HWOA 4I55A 4QHSA 1BEUB 2Q28A 4UU8A 3NETA 3ESCA 3F98A 4BLQA 1A04A 5FUMA 4DWVA 4O4JF 2XWQA 1F0NA 1XVLA 3K9BA 4GI2A 4H59A 5TPWB 4FQ8A 4F7WA 4UU0A 3UXYA 4KACA 2EJBA 1QH8B 5IJXA 1VHQA 4RXMA 3K1TA 1USVA 2G04A 1TE2A 2FPGA 2V7PA 3AR9A 5AHOA 3BMCB 3NOQA 1XFDA 3BX1A 5F2KA 2NSDA 3RT7A 3U4CA 3V8NA 4EJMA 1RVV1 4CU2A 3HUEA 2HMUA 1KRWA 3T5MA 1TCCA 1UJBA 1SCUB 3ZLTA 3AC0A 1QAQA 1TLLA 1EYZA 3L4BC 3PXXA 4D44A 3K70C 3EY9A 1CZOA 5DCUA 2W2XA 1ENZA 3IUSA 3AI1A 3MS2A 2OBBA 5KWVA 2XAUA 1LBSA 3I04M 3H65A 5AI5A 2WYHA 4OBEA 1EX6A 2FEXA 1WUKS 2BFEB 2BFNA 3WLTA 5EIXA 3A9CA 2CVPA 3E3OA 3F4LA 3I5MA 3L7KA 3TCKA 2AC4A 4QZVA 3D4IA 3RKUA 5FWXB 2R87A 3EZ9A 3R76A 2WU0A 3H8JA 4AUMA 1H9BA 4TYMA 4EF4A 1RMTA 4PNEA 5L8VA 1M2FA 4BN5A 1Q0HA 2OGUA 2D13A 4ZAWA 4ED9A 1ZNWA 4D4JA 1DOHA 1ST2A 2V7TA 3FDZA 4W8OA 1RW4A 3W6ZA 2I3DA 2O2JA 4M7PA 1BWQA 1GPH1 3B3AA 3QEMA 4JYMA 1H0KA 4KLAA 4PGHA 1Z36A 4X92A 5ITZA 4E7PA 1K7YA 1XCPA 4Y7CA 1OHHA 2O3RA 4C6TB 3OPQA 1D1PA 1EG7A 1ZK4A 1B6TA 2I54A 1ZKDA 1QKKA 2PZLA 3M4YA 3PYMA 3S2UA 4DEYA 3I62A 4CG1A 3SSMA 5JO9A 2ZB3A 4TXLA 3H2BA 5T67A 1L1FA 2EKPA 2BGKA 1U3GA 3M70A 5AW4A 4YRQA 4ZAVA 1P39A 1QC5B 1WPQA 3B7PA 2QD2A 1EAYA 3EXFA 4WVFA 4M1EA 2V6MA 5D00A 4RV5A 1GPLA 1MKYA 2GSWA 3OFJA 3KJZA 2PGIA 4ESEA 2JIRA 1SQGA 3B9QA 3T1QA 4BB5A 1DDIA 3D2CA 4LF8B 2BTQB 2R65A 5FL7A 4QVGA 1QYRA 1I7PA 1YAJA 3IOCA 2QGFA 5C3UA 3GVCA 1JIUA 2COKA 2ZULA 4TX1A 3C87A 3SKXA 2W8ZA 4TRJA 1EX9A 2BY4A 4OUDA 3O9VA 3KC2A 4ZJYA 5C8ZA 1CULC 3M5CA 1PWYE 5JVDF 1FFSA 1ZVMA 2ZWIA 3A26A 2YRWA 4X84A 4GOLD 2PWBA 2WKSA 3DSRA 3T5BA 2Y1CA 4IWYA 3U81A 3F46A 4WESA 5BW5A 1EKXA 5JASA 4DXAA 1YCDA 4RZHA 1JMYA 4XUDA 1USKA 6PFKA 5EGNA 3JVEA 1JKFA 4UE2A 1DKOA 3CH6A 3JYLA 3EG9A 2IF0A 1FBTA 4WDQA 3Q2KA 1SCAA 3B5IA 1S9DA 3BIFA 3P2YA 3INRA 5KINB 4LRWA 1YR8A 3GFVA 3TL2A 3GCXA 1VG8A 2Q6LA 2AG5A 1XTIA 4QSHA 2OTCA 3C70A 2R11A 2YIMA 2MU1A 3DZGA 2DE0X 4H6VA 1XN1A 1XUOA 1Z0AA 4AB1A 3OH8A 5KYYA 1DTWB 2GAIA 5I4BA 3RNLA 1JVBA 2DWUA 2YFKA 4LGMA 4YUAA 1G41A 2I55A 3E0XA 1S2DA 4MK4A 2PYZA 1OHHD 2H7VA 5CA1A 4S05A 1UPXA 4GECA 3S2EA 3QEBZ 4CMEA 5IEJA 1YFJA 2QE7A 2W90A 4FYPA 3ZCPA 1TKRA 1GA4A 2EF1A 4HT3B 4H7PA 4XIIA 3HB7A 1IVSA 5FV4A 1U80A 3GA5A 3I9NA 4OH1A 4R9UC 1UEIA 3ZTTA 1Y89A 2AJBA 2D1YA 1QP0A 1YVPA 4ND2A 1UUFA 2I62A 2ZLBA 4BQNA 2I7TA 2W6IA 4YI5A 1YNOA 1SK8A 2GZRA 1NFFA 4JJKA 5AW3A 5LZ9A 2ALJA 3C43A 4DCPA 2W2PA 3UGKA 3OPYA 5FL7D 2NO6A 4Q48A 3FYDA 2Z5FA 4LOLA 2DLNA 3JPWA 4ARSA 3BZUA 2NXCA 4AUKA 5KTYA 1Q14A 2HAEA 2HIMA 5IAGA 1NFRA 4J0CA 2X5JO 3Q88A 2O4CA 5C0OE 4YAGA 2XKJE 1KOFA 4MAMA 4LQ4A 3N2GB 2AHOA 1RTTA 5FBQB 1QAMA 5CAEA 4JI6B 3TEFA 1XKXA 2UU9B 4TTPA 3EXG2 4H3KB 1QVRA 1T8YA 3RYTC 1R0LA 3I9KA 1K2VN 1QGED 2E4YA 5FAXA 3TEJA 5BRJA 2CY0A 3B1FA 5KNDH 4FD3A 3U80A 3A9WA 5F77A 5E7IA 1FX0B 5H5JA 4UAVA 2YRXA 3MJFA 1UIRA 2V03A 3HEMA 4C9BA 1JXMA 1O03A 2BFFA 2J0UB 3FNFA 3IV6A 3M33A 1L5QA 5H9WA 5HIAA 2AUNA 1I2BA 3PFNA 4YRSA 5KQSA 2W2OA 1G5PA 5DCWA 4MCHA 2YXEA 5JAOA 1OTHA 1JV2B 3ORSA 4I8XA 3S8EA 1ZCJA 4KAAA 4F46A 3TUZC 4PGGA 4JT8A 2DLDA 1XMJA 4NJMA 4Q3DA 1ZMOA 3F6CA 2PGOA 1ARZA 1FP6A 3OJ0A 4MLCA 3D8BA 2JGFA 2PQ0A 3L5KA 3OQNA 1RMQA 2FZLA 2PIAA 1AZLA 3A4LA 3WLSA 1BS1A 1PK9A 2G9RA 2RMKA 2Z83A 2QE7D 4QUAA 2OCGA 4TOIA 2XI4A 2X2PA 1P4HA 1R5JA 4H7EA 4OSPA 5LP1A 1XZGA 2C5BA 4CM4B 4YJKA 5HHTA 1C0LA 3C3DA 1KGSA 2VSXA 3ZHSA 2I6SA 3QOYA 5DWQA 1VBFA 4LFCB 2W6ID 1RZ3A 3ZDEA 5IN4A 1W44A 3WLMA 2VSOA 4AM8A 2V1UA 1OIWA 4GE3A 3O74A 4Y0NA 5AVUA 3IGFA 2B8NA 1JFTA 1DKUA 4MGZR 2HV9A 1OF1A 4R8SA 2A9PA 4GP9A 2GLUA 1P31A 3RK0A 3S1LA 1SCDA 4DLKA 4HNTA 2PMKA 4L0QA 3FPEA 1PEYA 3FSRA 4XVHA 4DREA 3D3JA 1T3HA 2JAQA 3V8MA 3EPJA 4QELA 2AZTA 4BNUA 1BJTA 2RJNA 3N2KA 3PDHA 4LK2A 1IHXA 1TIKA 3KQMA 4EYQA 3AVQA 3SR3A 5C51B 2F1HA 3DLIA 1L4MA 2P5SA 1T0HB 2QTVA 5KDDA 1TM1E 3V9PA 2P5UA 2V45A 4JT9A 3PGJA 5DISB 2GDZA 2E21A 1L5ZA 3CEAA 1ES9A 1UKEA 5IKXA 3M8KA 2DUWA 2IK8A 3L02A 3NUZA 2P6UA 5LFAA 3QTTA 5I9MA 2D7CA 4RFSA 5FQNA 5A6SA 2ZIFA 3EZ6A 4R1TA 1U7UA 4KFUA 1YRAA 3HGQA 4HWGA 2C1ZA 2FX3A 5INTA 5M34A 3ONVA 3JYQA 5KWIA 1NNUA 4LNUA 1YI8A 1OX5A 4X6YA 5CYPA 1JAZA 2XTJA 1X7WB 3C6MA 3URKA 1L6IA 3THWB 4RPKA 2CV1A 2VZLA 3IUJA 4IIGA 3TQFA 2RBGA 3UHPA 2ZAMA 5ER9A 1HE2A 1VBKA 2FR8A 2Q2WA 4Z7JA 3PICA 2EIHA 1ZSNA 1YS2X 3M2TA 5DM0A 3UUEA 2IUUA 4YIHA 1LSJA 2I2CA 4MKGA 1V8DA 1QO9A 1TQHA 3EVDA 1JTFA 3T61A 4NFHA 4PYRA 2CEKA 5KDLA 4MH0R 1GTRA 2ZVQX 4RABA 1IEXA 2GN1A 4PBTA 4YRAA 2FEAA 4DJJA 1TMGE 1IM2A 5A4IS 1J90A 3VOBA 2WTNA 2R1ZA 4RJIA 3HSSA 1I33A 2I4LA 1PR2A 4AK9A 1ZOIA 2H4JA 1Z75A 4P2BA 2APJA 3LZCA 4O0LA 3H42B 2FAXA 3UHOA 2NVOA 4AY5A 1QS0A 4BGVA 5LJLA 3DM5A 4YUWA 2BFPA 1SXJA 5CYOA 5C1IA 1RD4A 1YU6A 3QKRA 3GB9A 4RQAA 1N1GA 5B57C 1N6PA 2WZCA 3VU8A 3VR2A 1UP7A 3DD5A 3MRSA 4IYRA 4KFRA 2YV3A 1EAMA 3JVUA 2PD3A 4LSZA 3OSZA 3WMFA 2J31A 2HR1A 1H1TA 1Q95A 3KJHA 3NYWA 4MMZB 4BDTA 1CK4A 3JW8A 2V9CA 2YVAA 3KZVA 4FK8A 4D96A 2N1BA 5LXTA 2A0YA 4ZVKA 5BOSA 3DVAB 5JZ9A 4K2HA 1VPWA 1P72A 1RRPA 2C2HA 4FI3C 5GP1A 3V1NA 1U0GA 2FGKA 2REXB 3MK31 2DHDA 5DW0A 4C14A 1V16A 3ZZ0A 1PWZA 4W5RA 4O3FA 4OYYA 3EUEA 1JEJA 3PUJA 4RADA 2IYVA 2ZB8A 4TKUB 2EL9A 2ZI6A 4NENB 4X1YA 4ND5A 4RIHA 1SG0A 1Y63A 4BNDA 1WSWA 4ME6A 4AYWA 1YI0A 3MAJA 1WF3A 3Q0IA 3MOGA 4N0QA 1LFDB 4TV8A 2TECE 3G82C 2WZBA 4ZEWA 4HLUA 1B6GA 5TQ0A 5KVCA 4AZ3B 2Z9BA 1E2UA 2DWCA 3HKEB 4ZEXA 4U2GA 1L9KA 3GC6A 2JLXA 3FG9A 1MB3A 4B73A 2BKEA 3NAQA 1DAIA 5KQMA 5L3VA 2F1KA 2P9JA 3C5VA 3RF7A 4FE7A 4A8JB 3WIDA 3ADBA 3EIQA 4O1MA 4ROTA 1R6BX 5CFMA 1YZQA 3KR0A 2IV7A 4CG0A 4MWDA 1SUPA 1RPJA 2MSEB 2YMQA 5ALLA 5EFZA 3DLAA 4LSWA 2JI8A 4C43A 1KHTA 2BT4A 5LIPA 1ZRSA 2EC5A 2OCXA 3PDUA 1SXJD 5CGQB 4Z9XA 5LDGA 2Z95A 4URHA 1I0IA 4LKOA 3CISA 4FGSA 1YR6A 2FI1A 3EGDB 2WWGA 3VR2D 1GGHA 1NDUA 1R1DA 3IPLA 4DG8A 4WH0A 3UK2A 3HYLA 4K8RB 3OBIA 3GV0A 1MQ8B 1WEHA 2B4RO 4B3FX 3FGPA 3AY7A 2A1TS 5AM3A 1Z37A 5FFNA 1F4PA 2HA6A 3U61B 4ZU3A 2ZUTA 1H4QA 3QV2A 1L7MA 4INJA 1FB5A 3GMDA 3K0AB 1W4LA 4R1SA 4EB6A 2IEDA 4JLBA 3R75A 4Q12A 1PJAA 4P86A 2LW7A 3NFYA 3S2YA 2QL9A 1SC4A 5AP9A 3IP3A 5ALWA 1Y7TA 2OO3A 3L8HA 3HXOA 4OXXA 2IUEA 3A2KA 1QQTA 2PXHA 3UFBA 3C6BA 4BCBA 1Z15A 3D59A 2PH7A 3HP4A 1ZM2A 4OXKA 5AOBA 3RIXA 3Q3IA 3A58B 1G4HA 2QPLA 4M0MA 5AW5A 3V8VA 5CBKA 4TTSA 5C32A 1Q1GA 4KAFA 2V7GA 3O1LA 3HXQA 2JKYA 1WY5A 5BOVA 4ZGWA 5BNIA 4Y98A 1P3DA 1ZFNA 1QYVA 1KJNA 2DPMA 3P4YA 4FWBA 4N18A 4ZK2A 3MA0A 4K9KA 4MCAA 1SZDA 5KTKA 4LMRA 1F48A 1O58A 3TRJA 2G6BA 2WU8A 4IMRA 2G5TA 1BWPA 4U7TB 4WY2A 5K1ZA 4DVJA 1X7XB 1ZXLA 3QXJA 1C4KA 3ZV5A 2CLEB 3W05A 3RJZA 3VKGA 1FXWF 5FPSA 2YS6A 3E5MA 3V7WA 3G2PA 3KQPA 4D82A 1BS2A 4HDKB 3TSZA 4K9MA 5KYTA 3NIGB 4IIXA 1QHFA 5LMNB 2DZDA 2W6ZA 5FHRA 1QHHB 5B1SA 1F3LA 2XECA 4ZQEA 5B2ZA 5GQSA 5LUBA 2WVAA 3G7UA 2EQAA 3D6MA 1NVXQ 3RW9A 5BSUA 1G6Q1 1B6RA 3DCIA 3F9IA 5JJLA 1Y82A 4NE9A 1SJ9A 3VZSA 3ZJ4A 1YRLA 1Q22A 1Z3IX 1J2TA 2MSKA 2CLHB 3ORRA 1YVEI 1WZNA 3DH0A 4JR0A 2ZIVB 3QG1A 4IVQA 5KNDA 3CT6A 5F5XA 2IZZA 1JU9A 3TQSA 3LD9A 3FDJA 2D8MA 4IH4A 2JAOA 4I9UA 4UDXX 4GEGA 4HVLA 4IQ4A 2OVBA 1WTCA 4HDNB 2ZCJA 4Q9NA 2PVSA 4GI3A 2Y0CA 2VP4A 4DSNA 3T99A 3H4MA 3H7IA 4ER3A 5KQLA 3K0CA 1THZA 4FN5A 2OK7A 4LJ6A 2PWPA 2PO7A 3K1JA 2ZIUB 3FCEA 3N05A 3O03A 2VPWA 4RMHA 2A9FA 2JCGA 1F2TB 1Z8HA 4WNAB 2BONA 5AVKA 3QY0A 1A2KC 4JEIA 3RSCA 3GAZA 5FB3A 5CM2Z 4PBSA 3WJAA 1X7ZB 5K3CA 2B25A 5L3SB 2UVDA 2V0CA 3EIEA 5EHZA 2ZRQA 4JLJA 2PX6A 1I4TD 5H68A 2VHJA 4ZQCB 3FZGA 4IHAA 2WTBA 4RD1A 4TKVA 4C7MA 1RFLA 3PEFA 3UG7A 3H86A 4YFYA 1PT7A 1SU8A 3QE4A 4BLUA 2G70A 2JLAA 2B8WA 2O9JA 3IV9A 4JHXA 3TL3A 2VRNA 1U8FO 2B5OA 1SIUA 1YDEA 1Z28A 2BUAA 5JXIA 4C0KA 1UBNA 4QYIA 3VHXB 4OP3A 3PFIA 3NBYC 2QLJA 4ZCRA 1ISHA 1KSGA 3ZE7A 4NYMQ 2O57A 4YY3B 1IUKA 4BMYA 4EG4A 3WG9A 3K1ZA 2GXAA 4O63O 4YBZA 4KR7A 3FX2A 3VNVA 1G9TA 1F60A 1FQWA 1ZVJA 3AR2A 4LSGA 2GD6A 2AE2A 1L3CA 3GGJA 4Q4LA 4EO4A 3GF4A 2ZBRA 3FLAA 3H9JA 2KPOA 1E9AA 3DAPA 1SG9A 9MHTA 2ZRPA 2X4IA 1KYTA 1WKVA 2XEDA 4XWGA 4M0PA 3AR8A 4X7BA 1XXLA 5KNDD 5E8RA 4ER5A 3ZHUA 1U2ZA 1QIMA 2O3UA 4EKYA 1QQBA 1PNVA 1DUIA 1PGPA 4ZEVA 4BLVA 3EHDA 1UK8A 1ORTA 4F5YA 2P1DA 4CGYA 1ONOA 3K6JA 1JHPA 5JY1A 2Q4TA 3P9NA 5B36A 3A31A 3EOAI 1ONSA 2E85A 3DDWA 1XEXB 4FDUA 2UUOA 4YMIA 3SS7X 2XCLA 1JEDA 2ZOSA 1NJ5A 3R6LA 1MD9A 2NO1A 3UV6A 1YJCA 5A4FS 5LKRA 4XVUA 1G6HA 2EATA 3K70D 4OGFA 5B30A 3O8BA 1H1LA 5JT1A 4V39A 3DNMA 1PU2A 5CITA 4B6QA 4FMPA 5EGSA 4KQ9A 3U4MA 5DNUA 1E7RA 3KL4A 4V0QA 1Y6RA 5HYVA 2VSQA 4AG3A 1SRRA 1G8FA 4QPJC 1BHSA 1Z38A 1JE1A 3H2HA 1X92A 1EFUA 2J48A 3HWX1 5B7QA 3F3SA 3VSDA 4JX8A 2X8AA 3I30X 3ITEA 3EUFA 3UENA 2IQ5A 1RYMA 3RVKA 2CVQA 4YPFA 4TTTS 1Y8CA 4FDTA 2EFCB 2ZKLA 3G49A 3IOMA 3Q15C 3QFHA 4H7JA 3AEQA 2ADFA 1ZITA 3REGA 1OXXK 1V5EA 1YDHA 1U7TA 3TRKA 4B4DA 4EMUA 5F35A 3ZZ1A 1Z0UA 4R1PA 2WFLA 3W1WA 5K8TA 4R2WA 1DEHA 3QWIA 3WXMA 5F12A 3V1YA 2BJWA 3EPPA 3ZQ6A 2YWCA 2QVBA 1URPA 3AP1A 3IQDB 1N0HA 3SDZA 3U3MA 1AZWA 2Q0SA 5L4SA 4TVSA 3BGSA 3GG9A 1ZH6A 1UXGA 2ECPA 1N0VC 1N3YA 4PXAA 1XZBA 1TU3A 1CEQA 5DYGA 1YE8A 4F71A 4AROA 5MN4A 4F72A 1Q1ZA 5IDXA 1E60A 1J0BA 3F6SA 4XFJA 4DUPA 6GPBA 5IVPA 1Z39A 4CCWA 3QKSA 4F5WA 2DMRA 5HRUA 1SXJE 4D3XA 1OBOA 2BDUA 3WWDA 4MZXA 4WY5A 3RAFC 4CMAA 3SNHA 1N32B 4BE4A 2RHOA 3LPMA 1BGXT 4XPZA 2NV2B 2ZT7A 4FNGA 3TSYA 4B9EA 1XTUA 5ADVA 3B1XA 2QNIA 2FPSA 3KLBA 1MC5A 2BM8A 3DV9A 4NAVA 5K03A 2VTDA 5CB6A 3ZKWA 1VB3A 2PUWA 4DQ0A 2C7OA 3A04A 3CVOA 3UICA 3S1SA 2GOYA 3VYVA 1WHSB 2FZCA 2ZYDA 4GKBA 1KDVA 4RVDA 1AGRA 2AFIE 3HYRA 3OX2A 2B1IA 4E5NA 5CIQA 3GA7A 4B2LA 2A88A 4HGQA 3LHDA 2C83A 2Q5QA 4B74A 1W36C 1BRMA 1L7PA 3I1JA 3T7KA 5TF0A 2AOUB 3TXYA 1ZJ6A 3VR0A 4EUNA 2C7QA 3Q9UA 2E6KA 1PFYA 5FYQA 3NH9A 4O5AA 3MPOA 1TM4E 4OAPA 4TXMA 5KJCA 1UFKA 2UUPA 3D3WB 1E1YA 3OJEA 1E9BA 4UQPA 1E4OA 2VUIB 4J3JA 4P84A 1JHMA 4Z4CA 3FDFA 4R68A 4KR3A 2Y9PB 1BFUA 1C3LA 3U4QA 3FWHA 2Y71A 3OZEA 3U7RA 2XNDA 3BORA 2QF7A 2ANCA 4RF3A 2PGXA 1JDBB 1Z62A 3WLPA 2BLLA 3H8SA 5JCOA 4MUEA 5IDQA 4K81B 1K6IA 3HO8A 4Y3UA 1DKRA 4BNLA 4U7DA 5H7XA 4D1YA 3OPYI 5AM5A 2HF7A 2NP7A 1VIVA 5AW6A 4BIIA 2E5LB 2EJUA 1TXGA 4AG6A 1XXHA 2GARA 4RAQA 5DULA 2E4AA 3WA7A 3LECA 4RF5A 1DRWA 1SWWA 1P2UA 3T5CA 1OC4A 1TM7E 2FZ5A 1GCUA 1H6CA 1XKQA 2HDOA 2PANA 3HB9A 3D6VA 5AYVA 2UXDB 4DV6B 3HHPA 4OLJA 1Q7RA 2CUKA 2KJQA 4GMHA 3GPLA 3OFSA 3R0IA 1OPRA 2J5QA 4LTNA 4Z9BA 5C8YB 2FUEA 2IIQA 3KRTA 3I4FA 1ZA1A 1TEVA 3FJOA 1LU9A 2R68A 1V96A 3F6YA 3FYHA 4DBLE 2KE5A 4OY3A 1F4LA 4I5FA 3RUEA 3GPDG 3JQFC 4RIEA 4TWBA 2R4TA 2IZ1A 3E03A 3SQOA 1P6UA 2ORIA 3E15A 3SYMA 1NNLA 3IQGX 1LLQA 3NZEA 3G5UA 3AZPA 2B78A 3R3ZA 2Y1GA 3SX4A 4TPKA 1N5OX 4AICA 3DAOA 4AJJA 4COKA 2ZZMA 1I3KA 1WDMA 2HNAA 5HS6A 1QPZA 3AIIA 3WGGA 1CW2B 5BWCA 1P2TA 4Y2UA 2Y66A 3UJAA 2WSMA 2GYVA 3FNEA 2HMSA 3EVGA 2X0NA 1YQEA 1G66A 1NX6A 3LI2A 5FO0A 4EJSC 2V7VA 3A6DA 4TUYB 4UBJA 3QLEA 2PT6A 1I10A 1OXMA 2VDNB 3A2LA 5I4KA 1OTXA 5KYXB 1P2SA 2NXEA 1FC0A 2QLLA 2XNDD 4WNYA 3RR2A 1MJGA 3TB6A 1O6BA 3SR4A 1QIKA 3FBTA 5EJ7A 1PJ4A 2BGLA 5JIBA 4RE5A 4GDFA 4JI7B 5AOCA 5F9MA 1FNMA 2WWRA 1H4VB 2R4QA 3R9KA 1W88A 1L5FA 2J59A 3LKDA 1XTPA 5ELMA 4G4GA 4X24A 1S4MA 5FD8A 2V58A 1IK6A 1F8GA 1T8WA 2HU8A 4PTLA 1U6IA 3EIXA 1Z5WA 3GLKA 1E2EA 4ND4A 4IGIA 4EFNA 1KJ8A 4X8LA 3FPSA 5BT9A 1G8KA 4GPEA 1GDTA 3DDSA 2RHDA 1OZAA 5EUQB 4MVJP 2JH3A 4IMIB 4PZLA 2QRNA 4X71A 5BSKA 4E5VA 1CIJA 4D4HA 3U44A 1NAHA 4F3KA 2PL1A 2VA9A 1G5HA 3DE7X 5DXAA 2HK9A 5GV7A 3NHJA 3SYNA 1J21A 1U31A 2WFMA 2ZIAA 3OFNA 4CDRA 1L7VC 4C5BA 1LQUA 1TTPB 2FJUA 2B1RA 2M98A 2VK4A 3F74A 3IIMA 4HRAA 1TZBA 3U3ZA 5KAMA 4PZPA 4MTCA 1HT1E 4DIBA 1U65A 4KP7A 3VOTA 3AUUA 5EI5A 2FSPA 4AP5A 4Q19A 1KK1A 3IEIA 3DFUA 5E4JA 5EIOA 3RT9A 3TN7A 5BV8A 1BKSB 2FFBA 1I3OA 2AFIB 4L5IA 1YIDA 3FKSA 2QDXA 1BYUA 4HDOB 2JIZA 1DT3A 3RV4A 4YWJA 1FVHA 1GL6A 1LI4A 2XF2A 4ZVLA 3P7MA 1U7ZA 3BBPA 3GI1A 2ZTUA 4C0HA 4D98A 2WUFA 5I7FA 4R2JA 5JZSA 5T4EA 4ZVTA 1MOQA 4LRQA 3CU5A 3ZDAA 3PNQA 5CT9A 1EK5A 4X6UA 2H5IA 1SVIA 4L50A 3F6RA 3RKRA 4AQDA 4MR7B 1DLIA 3E27A 5ECGC 4X0EA 2VF5X 3N8IA 4CM8A 2P35A 3O73A 1VP9A 2OO7A 1UAAA 3M5WA 1X8JA 3A11A 4KCGA 4B2IA 3CRZA 4IXWA 2XWSA 5J4VA 2YQ5A 1QVWA 2GKOA 3NEJA 3GNTA 3DV2A 4L74A 1K7EB 4LOKA 3ZDFA 5HOQA 1RLJA 4MW5A 2JB9A 4HWKA 3IMCA 1NF8A 3GAMA 4BMZA 4AQ7A 1PZXA 3ZR4B 3ILHA 2R4UA 5I47A 4ZTZB 1P2BA 1CZNA 2NU7A 5CDHA 2E1PA 2I91A 4O33A 2YWFA 2X1HA 1EWTA 4NCKA 4DM4A 2BGRA 1NUSA 4IXMA 3SD7A 1PCXA 2W42A 2XMSA 3F47A 4ZI7A 1C0PA 5IP5A 3AUYA 1QO0D 1CB0A 3MD9A 4KH1A 4Q6WA 4RLQA 3UKOA 4X1KA 2AK2A 4MR9A 3GLGB 1TO2E 1IOLA 2JIMA 2XB2A 3LNTA 2HCTA 1GIAA 2QX9A 3OFND 2P9TA 4W6ZA 2ET6A 2EKBA 3OFVA 4W5HA 1EGAA 2ODAA 3LY9A 3B52X 2DT5A 1GL3A 3BVPA 4PG6A 4URZR 3F97A 1R0RE 3X1ZA 2PY6A 4KQXA 3IRVA 3W6OA 4KO3S 3B12A 2AK3A 1X3SA 1RWWA 5CPBA 4IHQA 4BASA 4P7JA 2C3YA 3BL6A 3FKSD 4LBVA 4UJ3A 1BZYA 1IXRC 2JIZD 3N39C 2CLSA 3MTDA 4QLAA 3C3JA 1E2NA 3M6AA 2BBTA 4TTQA 5CMLA 5JQGB 3EAGA 3X1WA 4K40A 2XE6A 4HH1A 3SPXA 1XD2B 4Q0MA 4M9SA 2OK8A 5EPOA 2RCNA 3RRBA 2PBZA 4MO2A 2J9XB 1TNDA 1HDRA 4P5PA 2PMWB 5F4ZA 4BO6A 4D9MA 4XB2A 4BQIA 5LNK6 3U09A 1P0QA 2OFWA 4O2AF 4P4TA 1YBHA 5E4TA 4ZAZA 3LMKA 5B55A 1LBQA 3WAGA 3PDIA 1OIVA 4UHDA 3VOSA 4XVQA 2YR0A 3C3WA 1WEKA 3GEPA 3WDMA 1NW7A 1PV4A 1XQXA 1PUIA 1E8DA 2VDPB 4AUNA 1KDOA 2EYQA 1GZUA 4FIZA 2PSFA 5M29A 4DIUA 1EVLA 2SBTA 3NBZC 3DHWC 1EUDB 1TF7A 3IMEA 1K8XB 3N0RA 1UKCA 4J3NA 3TQCA 1TJ3A 4Z4EA 3AG5A 3FUVA 3FYUC 5H3LA 2W5UA 1JR3E 4MV0A 4Y9DA 3RS9A 3I73A 3HWWA 1RRFA 1A97A 5KX5B 1REQA 2GRUA 3EJWA 2A94A 1T1GA 5EINA 1L5HB 1B3BA 3PKJA 2C94A 1YZNA 2DG2A 2Q8QA 3ESRA 4EZBA 1GG5A 2Y68A 3IBCA 3L6EA 2NN3C 5JNTA 5IFLA 3A1CA 5EIBC 4ZDJA 5C9ZA 1E3WB 1NBEA 1FA9A 2PYDA 1HFKA 2FLVA 4XARA 3HUDA 3O6VA 2VJDA 1ZSYA 1HG1A 3HN6A 4BGDA 1ZK2A 1K8QA 4PC3A 1F5NA 4QO8A 5D5QA 1GTZA 2FQWA 3THYB 3DE3X 5KOHB 4NZYA 3W2GA 2H1WA 4I50F 5CLFA 2YZMA 2FP3A 4TXHA 1YZFA 2LNDA 1ZJWA 5JG7A 2DULA 3KX2A 2FF5A 4B82A 3UPUA 1US8A 4NOLA 2UZ0A 3N8DA 4LYEA 3CZ9A 4XYGA 4DDWA 1AHIA 3OJXA 5LLSA 1YTLA 2WHRA 2YN4A 3VPAA 2FFHA 1V35A 3EQZA 2WTUA 4MINA 4ND8B 4YHHB 2BE7A 3CKLA 4J16A 3CSDA 3WB1A 1SELA 3Q2IA 1WVGA 4P4SA 5A71A 2OAP1 4OHYA 4ECEA 5H4HA 4CKCB 1JN0A 3SDBA 4A1FA 1EJ2A 2X0IA 2AN5A 1RKQA 1ZO8A 4C3UA 1JRLA 1JQAA 4Q5IA 5IHXA 3PEWA 3FR7A 3PU6A 2VQ3A 4LW8A 2BHNA 5JS2A 1OH7A 2AOTB 1VCMA 1TW2A 1JMVA 4ZRDA 3P2KA 2KBFA 3ZS9A 1FXSA 4JQSA 4AUEA 3UEOA 5IKEA 4FYYA 4I5IA 1L5KA 4X90A 2QUAA 1PI3A 1TECE 2PZFA 2XUZA 2EEZA 1QZUA 3L4SO 3LXMA 1LC0A 4NE7A 4YV7A 3IDZA 4EHAA 4FEGA 1E7SA 4W9MC 4FLEA 1Q92A 2AEMA 4TN1A 4BJ3A 5IBCA 5JLAA 1M1UA 2YC4C 5EWLA 1PT5A 1ZKMA 2I4OA 1XFAA 3LWNA 3RUFA 2BTEA 4BRZA 5JEDA 4O2BF 1UOEA 4PYOA 1TZ2A 4IVNA 4OAOA 3NANA 4LGVA 4PS0A 2ID9A 3WGYA 5KWSA 4HDCA 5CXSA 5IZ4A 1PYDA 1TJYA 1F9AA 1JIVA 1T1SA 1UM9B 2IDJA 4JBNA 1L8AA 1PNOA 4GRDA 3AUFA 3KB1A 3U5TA 2ZXUA 1IJBA 3TWOA 1GPMA 3DO8A 4OTZA 1PQWA 2JRCA 5KI6A 5DTMA 4X1IA 1T3GA 1QCZA 3A6GA 1ADCA 3R7BA 5IS2A 1WCYA 3TM4A 1Z16A 3QELA 1SUEA 5HA5A 3ACBA 2J4FA 3E0QA 3TG2A 2VT7A 3CZAA 2GCNA 4R6WA 2A7XA 1I1NA 1U1GA 2V4MA 4OJKA 3FFTA 4RACA 4C30A 3WGLA 5A06A 1PIWA 5EY5B 1UZUA 2XD4A 4F45A 4DUYB 3CRVA 4EX7A 2KLHA 3PLNA 3TK1A 1EEXB 4F2WA 1Q15A 4KL8S 4X1OA 1SR8A 2XWJI 2RAUA 4OOEA 5GIPE 2L69A 2C2KA 4J43A 2OVFA 4U39A 1XE3A 4M21A 5EL0A 3AXSA 3OU2A 6REQB 1O87A 3BXFA 4CTKA 5K4GA 1YB1A 5LOVB 1CLEA 2FW7A 4ZU1X 2VN8A 3ADOA 4QQKA 4GWGA 2O0KA 1TVKA 5EFOA 1G6OA 3M4ZA 4H3VA 3ZCSA 1JZTA 1E0JA 2E48A 2FFRA 3EW9A 3FW1A 3PUWA 4U2BA 3IO3A 5AI4A 4D4GA 5IM4A 1YJ5A 4JP3A 4II2A 2JFPA 2VNAA 4GQAA 3RC2A 3VH4A 4HLCA 1E3QA 3UKDA 3O0DA 1K08A 1M0WA 2D1QA 4R5MA 2JGDB 3V34A 3O7MA 3GFOA 4ZPXA 3NBQA 4ODIA 3Q6IA 4FBMA 2B2NA 5L7YA 1YHYA 3AI3A 2H54A 4RVSA 1ODKA 3U5ZB 2I2FA 3LPCA 4ZRMA 5ALTA 1JLKA 1JFFB 4ZCMA 3VV2A 4TLDA 3CUYA 1LSUA 3NIDB 3P5SA 4HAZA 4YO7A 3BD8A 1ODCA 1NP6A 3PQ3A 4IS3A 4JU9A 1IN1A 4KYUA 4M2LA 4X97A 3TTWA 3EDYA 2CYAA 2I2AA 3GNQA 3K6KA 3OM8A 3WTBA 3FCCA 5LQKA 1SXQA 3NBMA 4P4UA 4AN0A 4ZOEA 2PRYA 1OWOA 2VJYA 1W5FA 3G3EA 3IV7A 2VK8A 4H7HA 1OA1A 5HKOA 3THOA 5EJGA 5IYZA 1TC2A 2IYFA 4WI1A 1K3FA 3KM0A 3VPFA 2WBLC 2YH2A 3DO5A 4Y6GB 2XCTB 1A9PA 2H8GA 1KS9A 5SZIA 1BMDA 4WGFA 1S2MA 4PFQA 3CBGA 4YAFA 3O8QA 2EZUA 1Y7LA 4MS4A 3ZIUA 4Q00A 2QUBA 3HXMA 3VO1A 5IAJA 4G25A 3Q3CA 5A5DA 1RRGA 5CDUA 5MFPA 2JJ2A 3PJEA 5AKXA 4YS6A 4ADSG 4EG5A 4P9NA 4Q1VA 1JIQA 2Q41A 2FFJA 2ZZNA 3Q7IA 1YNSA 3F49S 4N0EA 1RXIA 1C81A 1XJWA 1SUSA 5DTJA 4DARA 2WJVA 2WR8A 3M4JA 3OA0A 4LCBA 1KWGA 3UGJA 4L1KA 1JDSA 5D7NA 1T6YA 2ZIXB 1MX3A 2HWUA 2W83A 3MUEA 4MWGA 5CH8A 5ALMA 1QQ6A 2I6FA 2YZKA 2IEZA 2Z57A 3EGXB 3K0EA 1PQ4A 3GZ4A 4JKYA 3X43A 2WIJA 4IDDA 5DNEA 1M3SA 5CLHA 4UU1A 3T9DA 4UUMA 2F8TA 3WV4A 3HA7A 4PHGA 5G40A 5AKYA 3KEFA 3MT9A 4QPNA 1J0CA 2II6A 3ZE6A 4Q7KA 1LB1B 4HEA6 4FMBB 4IIVA 1UWKA 4MGIR 2FWNA 4GX5A 3I72A 5T5QA 1L7XA 2BAGA 2LVBA 1VSBA 2Y1EA 1P74A 2AOXA 3DHYA 3LX5A 1NF3A 3OZCA 2WSBA 1V4VA 1DC3A 1TDJA 4UTXA 5F7JA 2R60A 3L7CA 4V2IA 3HR7A 5BYJA 1WBDA 4EYSA 2PL3A 1E3LA 1F8XA 2R00C 1VQ1A 2RCYA 4QOHA 2A78A 1I32A 5CLLA 4L22A 1UM8A 1G7RA 1XKLA 4Q3KA 1KBQA 3AESA 1C3OB 2HHAA 1A71A 3E18A 1IBCA 3Q12A 5EMJA 5FI1B 4RZ2A 3QNWA 1C4OA 2P9HA 3W2HA 1XRLA 1W4RA 2XA2A 4TVKA 2V6FA 4L76A 2V7UA