2HEGA

Phospho-aspartyl intermediate analogue of apha class b acid phosphatase/phosphotransferase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
211
structure length
210
Chain Sequence
b'SPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B acid phosphatase
molecule tags Hydrolase
source organism Escherichia coli
publication title The First Structure of a Bacterial Class B Acid Phosphatase Reveals Further Structural Heterogeneity Among Phosphatases of Haloacid Deahalogenase Fold
rcsb
total genus 75
structure length 210
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hegA00
1S8OA 4NABA 3W5DA 3R09A 1Z4OA 2JAWA 5AK5A 5ALUA 2FI1A 2NO4A 3FGOA 4AS3A 2C8LA 3ESQA 4UAVA 4EX6A 4Y2QA 3F9RA 5ALMA 1EK2A 2CFSA 5AK3A 1TE2A 1Z4NA 3ED5A 2GO7A 1N8NA 2HCFA 4IFTA 1VJRA 1ZJJA 3A3YA 2WFAA 1T9ZA 3U7GA 2JARA 4HYTA 2ZBDA 4J2TA 2RBKA 2I7DA 3IB6A 3QU2A 5AHXA 3RF6A 3OTQA 4Y2TA 1T5SA 5AM0A 4YIKA 5AKGA 2GHQA 4KNVA 2W43A 2W4MA 2QYHA 1QQ6A 1J97A 2P69A 2FPUA 1ZRNA 2YY6A 5AK6A 3ZX5A 5AVQA 3NALA 3KDPA 4GXTA 2FPXA 5ALTA 3SD7A 5AVUA 5AM5A 1O08A 3EF0A 3QXGA 3I6BA 1L7NA 1Q92A 5AW4A 2X4DA 3QGMA 1Z4QA 2JAUA 3U19A 1QQ7A 4BYGA 3QU4A 3DDHA 2YMLA 1CR6A 2OBBA 2ZOSA 3U7FB 1Z4PX 2YFYA 3W5BA 1QYIA 3WK9A 1U7OA 4EZEA 2B0CA 3PCTA 2C4NA 3WGUA 1YV9A 1RC8A 3S6JA 3NAMA 4G63A 5ALHA 2ZBGA 4XQ0A 1ZD3A 3SMVA 3L0YA 3CZ4A 4E88A 1TJ4A 4PNHA 1ZD4A 3A1CA 4UMVA 1VFPA 1ZD5A 4FFDA 5AI6A 4KYTA 5AW9A 4Y2YA 1WZCA 3ZVMA 4JDPA 3ZI4A 2B8EA 3RFUA 5AW0A 1WR8A 1N9KA 3GYGA 2EARA 1U7PA 3FPBA 2I6XA 5AVRA 4I9FA 2FPRA 4C4TA 4YCLA 2HO4A 5AW5A 5AVZA 5ALPA 5AKEA 3SKYA 2GHTA 5AI4A 1L6RA 4MUMA 3QU9A 2C9MA 2IOHA 1Z88A 3HLTA 5AKZA 2OYCA 2HOQA 4UM7A 3ZW7A 4Y2JA 5AM1A 2I34A 3AR4A 4Y2VA 3ZWDA 4UU0A 1RQNA 4UMEA 5AVWA 1Q91A 2DQSA 1RLMA 5AI0A 1SWWA 3SLRA 4BX3A 2WF7A 4EENA 3PGLA 3N8GA 3QUTA 5ALKA 3OCZA 3OCVA 1RKQA 4Y2PA 1WVIA 1LTQA 3R4CA 5AVXA 2EATA 5ALDA 2AGVA 3EF1A 2B1QA 2P27A 4J03A 5ALJA 1FEZA 2B1RA 1PW5A 1RKVA 1RQLA 3ET5A 4XE5A 4C4SA 2BDEA 3IJ5A 1U02A 5ALLA 1Z5GA 5AW1A 2ODAA 4YIHA 3QLEA 1Z4IA 1O03A 1SU4A 1T5TA 5AW2A 2G08A 5ALRA 3W5CA 4OHFA 5AIBA 3AR6A 1YS9A 1U2SA 1AQ6A 4KX5A 3AR8A 4BX2A 2C8KA 3IRUA 3QU5A 4QQFA 4CE6A 5IT0A 3WGVA 2I54A 3SF0A 3KZXA 3L0BA 2G0AA 2YMMA 5AKLA 3QX7A 4NAVA 3VAYA 3E81A 3ESRA 3FVVA 3ET4A 5AVVA 3OPXA 2IYEA 4DFDA 2G06A 1QQ5A 4DWOA 4UMFA 1L7MA 1ZD2P 1TJ3A 2YJ4A 5JJBA 3DV9A 3B9BA 2Q4RA 3N5KA 5ALFA 2YJ5A 3A1DA 1KYTA 1S2OA 5ALGA 4AS2A 3L1UA 2EAUA 1CQZA 4BBJA 3N1UA 3OCUA 4B6JA 4ZEVA 3R9KA 4F71A 1Z4KA 2B8JA 4GIBA 2YMQA 3AR2A 3KC2A 3NUQA 4UU1A 5AVYA 2P11A 2W11A 2OM6A 2NO5A 3DAOA 5ALVA 3ZTWA 2IOFK 2FDRA 2AH5A 5FP0A 1Z4JA 3UMBA 3W5AA 4Y3UA 5AVSA 3SHQA 2HI0A 4O8CA 4UM5A 2GMWA 3AR7A 1F5SA 2RAVA 1RMQA 2PKEA 3N28A 4EEKA 5ALOA 1QH9A 3QUBA 1TA0A 1MH9A 4FYPA 2WF8A 2WHEA 1RLTA 4AP9A 1L8LA 2ZXEA 3M9LA 2WF9A 1RKUA 2NYVA 2R8XA 4I9GA 5AI5A 2HF7A 2PQ0A 4XOUA 1VJ5A 3UMCA 3WKAA 4H1WA 3E84A 1XP5A 3OCWA 3L8EA 2B82A 5IS2A 3WKEA 2D2VA 1IWOA 2B30A 3NRJA 2G07A 3U7EB 2AUTA 3NIWA 3OCXA 4C4RA 5AW3A 2WF6A 3MN1A 5ALNA 5AKHA 4NWIA 3L0CA 3OCYA 3D6JA 3ZWKA 1RMTA 4BEWA 3AR3A 4OD0A 5AM3A 4Y2XA 5AKYA 1Z4LA 2FEAA 4BNDB 4UARA 2R8ZA 5A3QA 3J7TA 5AW6A 2GFHA 2R8EA 3HYCA 2QLTA 3DNPA 5ALZA 3MMZA 3B8EA 4RETA 1Y8AA 2YJ6A 2HHLA 4ZEWA 3L8HA 2I33A 3A1EA 5AKXA 1SWVA 2RB5A 2RARA 2VKQA 3FPSA 3QUCA 3KOOA 4HGRA 3MPOA 2BY4A 2HEGA 4DCCA 1Z5UA 5ALXA 2OA0A 3U13A 3WKDA 5AI8A 3FZQA 5ALEA 1RLOA 1J8DA 3ZVNA 2MSNA 3L1VA 4KX3A 3ZX4A 5AESA 4BX0A 1L7OA 3QU7A 2ZG6A 2YJ3A 1NRWA 4EELA 3SKXA 5AW7A 1NF2A 2HF2A 4KN8A 4G9BA 5A3RA 4YCMA 3UMGA 4UASA 3UM9A 3WK8A 4CF5A 2JAOA 2FPWA 2R8YA 5A3SA 1K1EA 1TJ5A 4HGNA 4L6AA 4CNQA 4OCZA 5ALYA 3L8GA 5ALSA 1ZRMA 3K1ZA 2O2XA 3QNMA 5IT4A 3KD3A 3BA6A 4QJBA 5AKKA 1LVHA 2P9JA 4NV0A 2AMYA 4YH1A 2FUEA 3L5KA 2I55A 5AM2A 4JB3A 3WK7A 4HAIA 2IA5A 1YMQA 1YNSA 5AK4A 5AW8A 3I28A 2HDOA 5AIAA 4FE3A 1RPZA 1WPGA 5AVTA 3U7HB 4HGOA 2ZBEA 2ZBFA 4L57A 5T41A 1JUDA 4Y2SA 3TLMA 5AICA 4BKMA 4BNDA 3ZU6A 4CF4A 2PR7A 5AKIA 4EX7A 1RRCA 5ALIA 4NFLA 3KBBA 4Y2RA 5AM4A 3CNHA 3ONNA 5AKJA 2YN4A 2HX1A 2IOFA 1XVIA 4MWOA 3WKBA 3E58A 1NNLA 2C88A 3P96A 1XPJA 3WKCA 1YJ5A 3NASA 3M1YA 2WF5A 4ZEXA 2WM8A 1L7PA 4HGPA 2Q5EA 2G09A 3L8FA 4UAUA 3BWVA 3WK4A 3E8MA 4UMDA 1RMYA 2YMPA 4YCNA 3B9RA 1Z4MA 3EPRA 1YDFA 3MC1A 3PGVA 3ZTYA 2G80A 4OFZA 2G1AA 3I76A 3PDWA 5ALQA 1L8OA 4RESA 5AI9A 4UW9A 4KNWA 3AR5A 1ZOLA 2FPSA 4F72A 4DW8A 4IG4A 1RDFA 4HGQA 3N07A 2CFRA 4Y2UA 4YGYA 3ZVLA 2FUCA 2BDUA 2CFTA 2CN1A 3NANA 3L7YA 2MU1A 3WK6A 1X42A 5ALWA 3AR9A 4BEVA 3I1YA 1ZS9A 4CF3A 3FM9A 2Q4TA 1EK1A 5E0OA 3EWIA 2O9JA 3QUQA 2HSZA 4L6CA 1U2TA 3U26A 4UATA 3ZUPA 3WK5A 4XPZA 3QYPA 2YBDA 2JGAA
chains in the Genus database with same CATH superfamily
1YI0A 2ZP1A 3LPLA 3OE4A 3BBLA 3R09A 4QASA 3SN6A 2EFCB 2V97A 5JECA 3CW2A 1FQJA 4YT8A 1GILA 1RQ2A 1DFHA 3IT0A 4RMNA 2JASA 2C9BA 1QYXA 4E7OA 2QN1A 1S7GA 2NZJA 2OHJA 4Y2QA 4WMLA 4G5FA 4F3RA 5LNK1 4I50B 1WCXA 4QE3A 2ZM5A 2WBLC 2QQGA 4ADSG 2GPJA 2OG2A 4RY8A 4H6PA 3WQRA 2F59A 3VOSA 3CEJA 3I5XA 3FAZA 3TINA 1KMNA 4RIIA 1X0VA 3JR3A 1LI4A 3AB8A 3HR8A 3OIUA 4E12A 1YF3A 4TLDA 3JX9A 5H5JA 1N4AA 1Z35A 1FUYB 4KVGA 5A71A 4UVIA 3ZEIA 3KQYA 4Y2TA 2IIBA 5BP7A 4RH3A 1C3EA 2NW6A 3C7TA 3WYEA 2O52A 2AKYA 1BFKA 4MVWA 2F9MA 2OQVA 3LUJA 1UPUA 4Z0TA 1J99A 4CM1A 1MG5A 3BH7A 1FFXA 4P98A 1BIFA 2ZJAA 5E6SA 4U7WA 2IPLA 1CEQA 7ABPA 1N5IA 1E98A 1Z7BA 3O2NA 2YIDA 1RCUA 1UXOA 4PG5A 3RI3A 5D3QA 3F74A 3HSKA 3WWZA 1A9TA 5ALTA 2FNAA 4CR6A 4HYEA 4AJEA 1T0IA 4A73A 3H2IA 3FBTA 2H4YA 3JALB 3U60B 1SPXA 1V4NA 4EEXA 1JI3A 2QS9A 5LQRA 2Z2ZA 3QWBA 4IYRA 2VH5R 2J59A 2I2WA 3R0VA 1DQZA 4WXMA 3A1NA 3VH3A 1VRWA 3QTBA 1DUVG 2QL5A 1SXJD 3D43A 3I6YA 2BTOA 5CR9A 3WL3A 1YZFA 3PPVA 5BUSA 1A2BA 1F1JA 2HLHA 4MS4B 4B3CA 2GQ0A 4G4GA 4I36A 2HGZA 2H51A 4N65A 5CFPA 5EXEA 2BBOA 3AYZB 4HQ0A 1DBWA 1OPRA 3A11A 4U39A 4GX5A 3VYTB 5MGNA 5ICEA 2FHPA 4A6DA 1F2UA 1QF7A 1QAOA 1DE0A 1VIDA 2ZTSA 3OQVA 4KQ6A 4JITA 4ZT3A 5FPTA 3RRMA 3RT1A 2JLRA 3C0KA 4Q3BA 1NR7A 4XI9A 4HQLA 3WNQA 5KVCA 1QTRA 5CDUA 3IB3A 4J0EA 5BYKA 3KE9A 4JP3A 1FVOA 1NYRA 5B1DA 3DL2A 3RVRA 2IE8A 4JKIA 2R6R1 4CI0B 3O0DA 2G8LA 4MV6A 1XTTA 2C20A 4W9RA 1CY1A 1SHLA 3NHRA 3UHFA 4ZZIA 4ZMRA 3AL0C 2O2CA 3I9V6 2EJVA 3K1AA 3ZVMA 3OOEA 4IIXA 4JDPA 3NZEA 4LVUA 4PQEA 3V8QA 2L0XA 5FUQA 4JXKA 4IIHA 1E63A 1KSHA 2PV0A 1N6IA 3R9IA 3WL7A 2PUCA 2WFMA 3WIDA 4V0MA 1SRRA 1Y7IA 3I9MA 1EX7A 3FPBA 4PZLA 4HWKA 3RJ9A 1NLZA 5A4JA 3NV7A 1Q0UA 4OQXA 2B6NA 1NMEA 4BNGA 5C37A 2AZXA 4N41A 2D5IA 1NR5A 3K0AB 3R2JA 1XNJA 5DCWA 3U4QA 1C3VA 3ZN2A 2FPMA 4RVCA 4OKSA 1TZBA 5A0FA 1EH5A 1K89A 1UPXA 1NJ2A 1LK0A 5E9QA 5H3HA 2ZUTA 5AXDA 2WFLA 3TFOA 3WP0A 4QOSA 1QDEA 4FYIA 3H9UA 3F96A 1JB1A 1IUPA 2XMGA 3OP4A 5EEGA 3JWJA 1UIRA 2Z2IA 3OE7A 5GJVC 3TZCA 3VR5A 3E22A 2WUDA 4TQGA 4FKZA 2MINB 4F21A 1HKUA 1TT5B 1GPJA 2POCA 3BTUA 3N87A 1Z6QA 2UYYA 1N75A 4R5MA 2FK8A 2QMZA 4EHAA 1IM5A 2A0UA 4I4TB 4IXDA 1F2VA 1QKJA 4BE4A 5BQFA 5JO0A 4M8NE 2LXNA 4AY2A 1XALA 2OY0A 5E7MA 1T3HA 4DCVA 2DFLA 2YRFA 4MVJA 2PN1A 1O0SA 4MRNA 4YAUA 1K6EA 1U8EA 1V9LA 1SWWA 1FQKA 2BE7A 2J1LA 4MVXA 4EY4A 3TPCA 2P5SA 3QKRB 2W2PA 4J1TC 4KIJA 5LQMA 5KU7A 3ENWA 1JU9A 4NX2A 4IDFA 3VBEA 1U28A 1C9KA 3KQMA 4J91A 2DMRA 1GNLA 1L7EA 2XHEA 3EVCA 3F3MA 4PHCA 3V8NA 3MCTA 4MPTA 4CU5A 3EQ2A 2QZPA 1GPH1 5LP6C 2WKPA 4UZSA 4DC9A 1JPNA 4QU5A 4JIMA 1IOZA 2JNWA 3C87A 1J24A 2I2AA 5C53B 2WDPA 4Y9UA 2JFGA 1X1BA 2AV6A 1NTRA 2G72A 3LBYA 4M46A 1Z6ZA 2WSIA 4QBIA 4C6HA 3IJ5A 2YJZA 4H4CA 1RI3A 4HJRA 3PFNA 1PIWA 5ALLA 3VVBA 4MRAA 1VBNA 4JSRA 4MS3A 2DWCA 4O1MA 4A8HA 5B58C 5JWRA 3WJ7A 1N2OA 2FSVA 2GCOA 4UNPA 3UFXB 1A4IA 5JHGB 4QUHA 3IA7A 1HDEA 1NXWA 1W2HA 2FHSA 1T1GA 2G08A 2KYRA 3K92A 2VP2A 3MBKA 4RVGA 5TPZA 4BXOA 1YS9A 3L9XA 3SZRA 2XLCA 2JS7A 1F8YA 2BGUA 5BW8A 4HDSB 1XRJA 4ZI5A 4C0XA 3IUYA 3NGXA 3AUUA 2Q4OA 1BW9B 4D5GA 3I8OA 1ZZEA 2GOYA 1M6HA 1F9AA 3R20A 1EPUA 2DFTA 3MLEA 3KQLA 1VPTA 3AUJB 5C51B 1NF3A 1T4CB 2FRXA 1GHTA 4CIXA 2Q3JA 1NMXA 2VFAA 4NBRA 4QICA 3ST7A 1E2KA 1ZHOA 2F90A 2G40A 2VUTA 3L7JA 4PIPA 3SNKA 1YCGA 4UEWA 1DAPA 3DFIA 1NUTA 2YIJA 4WL0A 3LV8A 3S2SA 3T52A 5BY2A 3ERCA 3H65A 2Y1OA 4YRLA 2Y0CA 4FFMA 2H48A 4PYLA 4F4JA 2G63A 4O4LA 1KS2A 4C78A 2PCLA 5JO9A 2EYQA 3RS3A 2XWBF 2Y05A 2NN3C 2OGUA 1I6WA 1S2OA 1XCGB 1UKZA 2ODBA 2OGTA 3KUUA 2E1RA 4YRDA 2VQFB 4LC0A 4MKZA 2YZKA 1E3EA 5DM4A 4WEQA 1PFUA 3ZE6A 1KI4A 4BO7A 1K3TA 1CP2A 4N7JA 2WILA 4M21A 4NOLA 3V33A 3UT6A 1RJEA 3U09A 4W6ZA 1CUFA 1FW8A 1WKCA 1U7WA 2AQHA 3A6EA 4HB4A 4KLNA 4KWEA 1ODIA 4R8SA 1SCUA 4XARA 4DCNA 1LNSA 1V3QE 2PUAA 2NQ2C 3PJFA 4I55B 1IONA 2JVKA 3AL2A 3HUDA 5IJZA 2XYQA 2PA0A 3AJAA 1I6KA 7REQA 5J2UF 3HYRA 3A32A 1F3OA 2R9VA 3PXBA 1IK6A 3DC7A 4W8HA 4UM9B 1TT7A 1WDMA 2DFKB 5CT9A 3CKMA 3JATA 4MGZR 3TOCA 4LMRA 1OROA 2WHYA 3B1KA 2WJHA 1ISGA 3D4IA 3IUSA 1F5SA 1Z0KA 2RAVA 4UM5A 3QVGB 4MQ5A 2PKEA 4KXLA 1IXZA 5EIFA 2GKGA 3ZJ5A 2Q5OA 3BRWA 1LI5A 3GA7A 4B2PA 3GUHA 3ROQA 2O6HA 5KQGA 1MEJA 1KF0A 3JQBC 4H7HA 2XGJA 5CLGA 3CH4B 5IJXA 2JJQA 2P3OA 2G1KA 2C4WA 2NYVA 3VZSA 2NV6A 3LRXA 1G9TA 3DH0A 3PHGA 2IH2A 3WSWA 1X2BA 4URFA 4RCVA 4OLAA 1P1HA 4CT0A 4RPKA 4L4YA 4CV3A 1A9YA 1W5SA 2NZXA 1M9NA 1P2UA 2WK1A 3RC2A 4LJ4A 5CA0F 3OCWA 1XP5A 3VSAA 1FK8A 1Z18A 4FYKA 3UJCA 5COAA 3VPBA 2BC9A 3L93A 2P6RA 1SC9A 4QUAA 2ECKA 1HSOA 3FN4A 2GNAA 4FOLA 4FFOA 5CJPA 3DZJA 3V4FA 1Z38A 3T5BA 1LLFA 1YBFA 3FPFA 1H4VB 1H66A 3M70A 4Z51A 2FSGA 1RMTA 2QLJA 5EKUA 1YVPA 4KXUA 3T3OA 3BSYA 1F0NA 2FR8A 4JUFA 4GZ6A 4IP0A 4Y2XA 1QWSA 3FUCA 4KN6A 1PQ4A 2XOEA 4UVEA 2GN2A 3UJNA 2OXCA 2ZT8A 2HKIA 1VHTA 3COYA 3MYRA 3PUWA 3PXAA 4I8IA 4ZOBA 8LDHA 1IZ8A 3BMNB 4GRAA 1V37A 1K4MA 2VYQA 3EIEA 1XWIA 1KZ1A 4ASUD 1LC3A 4DIBA 4GI7A 2JAHA 3BPSA 5J40A 4S3MA 5C1IA 3ZV3A 3WNZA 3ZKWB 1P7CA 2H6EA 3GP8A 3G1TA 4FFNA 3QBDA 4MUIA 1YFLA 3AFMA 2OC4A 4Q34A 3H3JA 5BSGA 1E3MA 4HFRA 2RGCA 3VGPA 1VHLA 3JQEA 5EGNA 5DYGA 2O5EA 4B2YA 2KBFA 2QD4A 2DCUA 2Y1XA 5KYYA 1I9GA 3U13A 4EDFA 2W98A 5EE9A 3BA1A 1CE8A 2EKDA 1CJSA 4JBLA 1KIAA 1L9XA 3SQOA 3LYAA 5EZYB 2QW8A 1G0NA 2PM8A 2H7VA 3ZX4A 4V0OA 1FFCA 4O4LB 5K8LA 2ZQYA 2XMCA 5J4LA 2QI9F 3LBFA 5AW7A 5TGDA 4XIFA 4OH7A 3C43A 3CR3C 3SGLA 5T5QA 2NSHA 1FFXB 4KQKA 1P1CA 3EQ7A 3KV3O 3ONEA 4RSMA 2Z2JA 4AQDA 5CDHA 3SE7A 4RIHA 1OXMA 4P2GA 1EQAA 3EXHB 3VYRB 3X1KA 1VMEA 1W36D 1FTSA 3GF4A 1GGKA 1PFYA 1TGVA 2AF3C 4EPWA 2XVXA 2ZUUA 1K9VF 1XQWA 2IYQA 1HR0B 5KNDH 3KR2A 2XH8A 4EW3A 5HFJA 1TVMA 1E7RA 3L8GA 3MAAC 4EA9A 4EVQA 4F9FA 2OFPA 1RM3A 5HYVA 1VLQA 4ZGGA 3M6AA 2C78A 1WB9A 2WPNA 1C3OA 1WIWA 3OEHD 1VL8A 1W4BA 4KO2S 1RRKA 2VQ3A 4M0DA 2BM0A 2QLLA 4WXHA 1A5ZA 4G0MA 3EIQA 4I55F 1TCVA 3HFSA 3ODGA 1LVHA 2XT6A 1XP8A 1L5MA 5T64A 3K09A 1W25A 2AMYA 2SKCA 3C98A 5BQPA 1CCWA 3HVUA 3N53A 4Z6KA 5IANA 4UPVA 2DWUA 4PPFA 3NBQA 5IVDA 2G9ZA 4JH0A 3LSYA 4DLPA 1KSGA 3BCHA 2CXNA 4X95A 2YV3A 1JJBA 3NOXA 4J0QA 3DMDA 2LNDA 2FE1A 2QUJA 2QXYA 1FTNA 2OHFA 2WYVA 3VO2A 1MDFA 4GMXA 2DHQA 1QHXA 2Y77A 3DWFA 5AK4A 1I36A 1SFRA 1UFQA 5DX8A 2P4HX 3INNA 1KHHA 3EJ6A 4HQKA 1SBYA 4KQXA 1QP4A 1W1IA 5B5SA 1RD4A 1M2JA 4M1WA 5JASA 3G79A 4NRDA 1HFKA 2CDNA 4UD6A 3F67A 4QPNA 2P9FA 1JUDA 2CK3D 3OT5A 4IF6A 5AH0A 3RT9A 4EKYA 1Y48E 3OEYA 3NHBA 3P0FA 4ECEA 2QHXA 3NHSA 1Q2XA 2O05A 3K15A 4Q1BA 3TLMA 3WLJA 4AP6A 4DKJA 3AV3A 1PTJA 1WLYA 2JH3A 5GPBA 3MYYA 4GLLA 4V1CA 2GN9A 4L85A 3TSCA 4EYSA 1TKCA 2CB0A 2CLMB 4A0HA 4RA6B 5HS4A 2C2GA 2N42A 5DYWA 4W7HA 5GM2A 4HV4A 3ZZ1A 3HMKA 5IJ0B 2YIMA 1L1FA 1W1UA 3ONNA 1U3TA 3B1ZA 3HSSA 2RI1A 3OZBA 2I5PO 1O9GA 3GPCA 4IKPA 4F1JA 3LH5A 3GRFA 5GINE 1KKLA 5KTTA 4D8TA 1QIHA 3NATA 4GP6A 3KOZA 1GV1A 1OYYA 2OBLA 1DTWA 4GU5A 4ZVPA 4S1PA 2DX7A 4RANA 4Q00A 4YUWA 4I1PA 4HXGA 3T15A 4PC2A 3UHPA 4UKDA 4DMRA 1B15A 4ZDWA 5ENZA 2OOSA 3HBFA 1IWBB 1K7SN 3N05A 4URWR 3WMRA 3JAMA 2P4SA 2ZRNA 4EGQA 3LCCA 3E5MA 1NVKA 1E1LA 3O1LA 1DU4A 3AKYA 1GQQA 1RYDA 3H3XA 4FZRA 4HUQA 3W77A 1R6DA 4C30A 5B1EA 1A9XB 4DJ5X 4U9HS 1JG2A 1Z6GA 4G0OA 4O4IB 4MUFA 4OJQA 1HK7A 2VUHB 4R9SA 1YR3A 1R8SA 2HF8A 4J16A 4TTPA 1C30A 1FRNA 2C0QA 4GPIB 4PGHA 4RESA 1CP3A 2A9RA 3H75A 5ARDA 5F3RA 1Q7GA 3IDFA 3G8DA 4PSCA 5T67A 1DXQA 2IZZA 3LC2O 4RE5A 3VNRA 2FFHA 3GCGA 3JQAD 1HDZA 2AJ8A 1FS5A 4LCJA 1SXJC 5JZ9A 3HZOA 1JHUA 2MR6A 3QFFA 1G5QA 4RZHA 3G59A 3G0GA 4J75A 1O5OA 2E5FA 3BGDA 4KMRA 1JDZA 4LXTA 2PIDA 1UFVA 4WZAA 5IBQA 2GM4A 5JCJA 1N5DA 2FMKA 2PZEA 2BDUA 1OXXK 4M87A 3RFVA 1O5TA 2AN3A 1JDTA 2ENUA 3SC3A 4F56A 1GN9A 4Z3OA 3AI2A 3DMTA 4IRXA 5ICCA 2JJ1D 3QSGA 2YBDA 3EWIA 1AXRA 1XVUA 2O9JA 2INGX 3PLNA 2HRQA 1A9PA 2FQWA 3I12A 4MV8A 1U9IA 2R1VB 3G17A 3WTCA 1OLOA 1Q74A 3G5LA 2JGAA 2VPYA 1DC4A 2CFOA 1SB9A 2ZYWX 4XWGA 5EWJA 4AYWA 1TEHA 4LJLA 5AK5A 5ALUA 1L5SA 4TM7A 1JVNA 5TC4A 2FW8A 2WWXA 5E2AA 2MYUA 3N39C 3U7QB 2FUG6 1HT1E 2YDXA 3AKCA 4DXAA 4E13A 2JCVA 3NBZC 4EGSA 1C14A 3OQ6A 2QAGB 5HKBA 1M6WA 5MFZA 2V5AA 3HY3A 2QD3A 2P77A 1T5IA 1U0HC 3ES9A 1WZIA 1YJQA 4XWWA 3E2MA 4FWBA 4PVCA 3BSSA 1X94A 2FEXA 1MR3F 5MDHA 4GEGA 1B26A 4KQ9A 1NAIA 2Q5LA 3PHJA 2IZOA 4FZJA 3LQFA 2QQ5A 3U7GA 1ZCBA 2CHQA 1JHQA 1QYVA 2OYSA 2POQX 2WSMA 1FW6A 3DZKA 3LX5A 4P5DA 1DLJA 1U7UA 2I3GA 4GMFA 4PYQA 3AY6A 3ME5A 4Y9RA 4K9SA 1V71A 1OX4A 3ISVA 4ZAVA 3UMMA 2GHQA 1L7RA 3GFSA 3ITNA 3NBMA 1XL1A 4KHZA 4LRYA 1Y5LA 3IBGA 2EQ5A 1SUFA 1BYIA 2AB0A 4RIGA 3L18A 4WUTA 1OUMA 2W2MA 3AWIA 2CXXA 1V16B 4I4IA 1IN6A 1XXHB 2ZJ7A 3GT0A 2FPUA 1Z0DA 5AK6A 2JRLA 3RF7A 4F06A 3LWDA 3G5UA 3PFBA 1WW3A 1YOBA 2PYIA 2PGDA 2VHEA 2ZB4A 4EY3A 1XXHA 2ZR0A 4P3YA 4YDHB 4DARA 1D1TA 3ED1A 1Z2NX 2Q07A 3ZU5A 5K9ZA 1L7NA 1Q92A 4D25A 5HQTA 2WICA 1Z73A 1Z4QA 5I9MA 4BPRA 2I71A 2AN5A 5CX4A 1L3CA 3P2MA 4MWEA 5HJ7A 2GEVA 1UK8A 1N8KA 3AZQA 3BB4A 1WSBA 2BFMA 3DDHA 3L2OB 3RVQA 2PAFA 1U1CA 4D2IA 1OWPA 3GMTA 4MV0A 2ZYDA 5CT8A 4BKRA 3GFVA 3BSWA 4INAA 1ADFA 2VRNA 4M6WA 1IK4A 4BFCA 3VR3D 4YCDA 2C4NA 3SNHA 1I7LA 1WZNA 1PEYA 4DNPA 4K3UA 2QUAA 2XI4A 3JAKB 4BCBA 3T7TA 3MD9A 3OQIB 1Z6XA 1JTVA 5TEWA 1NQAO 5A4FS 1Z47A 3P4YA 3AJDA 3JQAA 3Q9LA 2R0QC 3GEEA 5FOWA 1A5TA 2R7AA 4PTZA 4EJMA 1ZD9A 5E7QA 2FMIA 3I0MA 5DF1A 1NJ8A 3MCWA 4ZCIA 3WRWA 5LKAA 1I8TA 4FFDA 3JD1A 1B93A 1JWAB 2CFIA 5BSHA 4DLAA 3WZ2A 2Q1UA 3VPFA 2G1PA 1TVKB 1XTZA 3NKVA 4IIYA 1W581 4YALA 4WRRA 5BWBA 3NIGB 4S35A 3WBJA 4L3WA 7MHTA 1BJKA 4MCJA 5IEJA 4FFPA 3PD1A 1L4GA 4H16A 2IZ0A 3RS5A 3COJA 1SKYB 2REQA 3AV0B 3UAOA 4AW9A 4FHZA 2I6XA 3NYWA 3HLYA 2GN0A 4BMDA 4IIJB 2ZSBA 5F73A 4TMKA 3U4GA 3HPRA 1CJUC 3DFMA 1P3JA 3NBYC 2VRWA 3RS0A 3SK0A 3QU9A 5DHFA 4KRGA 4MA5A 3DV2A 5AUPB 1VJ1A 4V0QA 1ESCA 3I37X 3AM3A 3RCBA 5D00A 1M1NB 1O87A 3QITA 4JJZA 1T0BA 3A3PA 4DIFA 2BRUA 2HSEA 5CA1B 1KU0A 3PXUA 4IQ8A 3BE4A 3VPHA 2BM9A 4RW0A 2FG5A 3PC4A 3HP1A 3DE4X 4FMCF 3RSGA 4CKCB 2CJFA 1YTLA 1F12A 2FLWA 4MVJM 4PHFA 2BBWA 1L5QA 2GO1A 4WWHA 5IJ0A 1ORDA 1JMYA 1UZMA 4EGCB 3MWEB 4KQIA 2D2IA 5KDOA 2ASEA 1P5ZB 2ZITA 2GJSA 1NV9A 1TECE 1IFXA 3B12A 1BXRB 2B3DA 4HTAA 4NCHA 1PG2A 1PHRA 4MOWA 2ZI4A 1P91A 4O4JB 3SI7A 5L3QB 1XNQB 1K75A 5IK2D 4GDMA 2ECOA 1VZ2A 1QR2A 1X9IA 2VHQA 4PPNA 1IBMB 4KBYA 2Y68A 4LDJA 1M8KA 5CFQA 3OCVA 3QIAA 2AGVA 3PFIA 1F0PA 2VO1A 1P6QA 4QT4A 1BU5A 3TLXA 1JZQA 3KKEA 3V46A 4DG8A 5JALA 4LRXA 1RE0A 1I5OA 2J3IA 3IDSA 4QDKA 2ZT7A 3PUKA 3L02A 5EJ2A 1IPFA 1OX6A 1NT4A 1CJMA 4JHLA 3RG2A 3T0IA 1PX0A 1SJ9A 2QVXX 2P9ZA 3H4IA 2D1YA 3MJEA 4K2AA 3T3PB 4LOKA 4ARZB 2AN9A 4YJDA 4ZZ0A 1N2GA 4HTFB 3IP1A 1U99A 3EGDB 5AW1A 3HCBA 2UDPA 5A4KA 2Z09A 4Q21A 4YMIA 1MO3A 4MQFB 2B7CA 3GFBA 3PNQA 3BERA 1HOXA 5F3DA 1YQWA 3L8YA 2JBAB 1GKYA 1NW9B 2OGZA 1UF9A 3BXEA 5AIBA 3PP8A 3C41J 2AXEA 2PJRA 4M60A 1QGDA 1MKYA 4KXXA 3FYDA 1AQ6A 4YJ3A 3WFIA 1RKXA 3WO1A 2O3TA 1KAQA 1EJBA 1KO1A 2G9VA 3T5MA 4UQLA 4MXDA 1GN8A 4GF5A 2L2QA 4HR7A 5I45A 3Q10A 1Z62A 5FWYA 2I54A 4LDZA 3M5WA 1JVSA 4Q9LA 3FUWA 2FY8A 1IATA 1PP4A 2WWFA 3PDCA 4Q48A 4X71A 1G8YA 3KWLA 3JYHA 5D1NA 5BYJA 5IK2A 4OA8A 1COWD 1TCCA 3QPUA 2W2QA 2ZJ5A 3RJZA 4CTKA 3FVVA 2IPXA 4YHBA 3FNIA 3TE6A 2OTCA 3GDHA 5KTPA 1OT5A 4KXFB 3U17A 1LEHA 4K9OA 5I4BA 2VA9A 1R4MA 3UIEA 2QTTA 1FX1A 4OYLA 5C1BA 1ZD2P 1JQDA 1QZTA 1E3JA 2OMKA 4RADA 1EDDA 4PN7A 4AMGA 1Z7WA 2D5AA 3NJ8A 4IKOA 1NWHA 2BFOA 5JC1A 1NQTA 3OZWA 1C2TA 3KJHA 5ESWA 5IT5A 5FOQA 2A0WA 3MTGA 1MVNA 1NFFA 1KDYA 1FPQA 2BUCA 3OF2A 3PD0A 1RHKA 2WY2D 4CDRA 4NAUA 1ZINA 1FS6A 3GN1A 2CMKA 3BQMB 1KAHA 1JB9A 3D4NA 2WNIA 3F71A 3H16A 4X6XA 5DNDA 1P5FA 3NNDA 2P11A 3PXGA 1ZI9A 4YA6A 1EVEA 3PFKA 3EGXB 3MHTA 1ILWA 4WBNB 1ZD1A 3AHFA 5IYZF 1BX3A 2PA3A 2WSLA 5JC8A 2P8SA 1FP1D 2XYRA 1ZHFA 4FX2A 4M1SA 5I7AA 3JAWB 1TPZA 5MHTA 2I4NA 4BVJA 4JI8B 3VJRA 3HCDA 4JGBA 3WYNA 1CJTC 1N5LA 1IEQA 3TL3A 1QH0A 1GAJA 4CTJA 2VPTA 1FRQA 2DKNA 3N28A 3JAWA 1NP7A 1FNNA 4M8KA 3CO0S 1AKRA 3G0HA 3QOYA 3CB2A 3FMPB 4GI5A 3ZC3A 1OOEA 4EL5A 4TQAA 5CVTA 1GAEO 4QWMA 1SU6A 2RCNA 5EUCA 5DK4A 2EP5A 2A30A 3PYXA 1Q57A 4WGFA 1XD8A 1RVDA 3EZFA 3K31A 4QFCA 4UHEA 4BP9A 2QNIA 2UXDB 3B52X 4POOA 5JS8A 2PRIA 1KAOA 1VJDA 3K8YA 2VF4X 4MW9A 4H1VA 5EY5B 3E3NA 4QXAA 1L1EA 3MB5A 2B82A 1OB2A 1YR2A 4IGIA 3WI7A 5LUAA 4F2PA 3F3SA 3AB7A 3QENA 4IY1A 4UTRA 4RM3A 2AUTA 1GUYA 5M5BA 3S2ZA 4P54A 4Z4HA 3GU3A 3GAMA 3K2BA 3OU6A 3HL0A 4XUDA 5BWLA 1IJKA 2NZUG 4KWCA 4BNDB 1KORA 5KJ6A 2E49A 2R8ZA 4BP3A 1QPBA 1M2EA 4NATA 4XWKA 4AU1A 1GQ2A 3AM5A 1B7GO 2O2YA 3ANNA 3G8YA 4ZVKA 1NW7A 3RK0A 1K8QA 4U7HA 1GQYA 1GVNB 5JMOA 1UBCA 4YAOA 3EFOB 1T4BA 2V58A 3AJ9A 2XUJA 1DELA 1UP6A 3N0RA 1NIPA 3QMWA 5LQAA 3EZYA 1JYFA 3FPSA 2W6QA 1OYOA 4L7QA 3WAKA 1QRTA 4DCTA 2AFVA 2WTBA 1XYGA 4HGRA 2P40A 1T2VA 2HN9A 2F55A 3KVNA 3EDCA 3KQWA 4P4TA 4XRGA 3K2IA 3OPVA 4UNNA 1NQUA 1OV4A 4M99A 4MP6A 5C5EA 2AUNA 1E1RA 3L7OA 1KJZA 2QTBA 4XVCA 4INZA 1SEVA 5FB3A 1UJ6A 3GRPA 4F4FA 1A9QA 1ADJA 4B3TB 3HCAA 3O9MA 2LRHA 3ZY6A 1H2BA 1CJBA 1RAGA 1SBNE 3OMLA 4IOJA 5D5QA 2QN2A 4EOGA 1XO1A 4B3DA 3HCRA 4UFNA 1KZGB 4JP8A 5T4HA 1EFRD 2JZOA 3DYVA 2B9EA 3B7GA 5FLXA 1GUAA 1EG2A 4RMGA 4U6QA 4Q9DA 1CDEA 2C42A 3KPUA 3LAWA 1YB4A 1Z0AA 2PYZA 4N39A 3M49A 1C7FA 3HJTA 4Q7KA 2RDMA 1R0RE 3CKKA 4Q0MA 5IABA 1IWPB 3UMGA 1TU0A 3MS7A 3UYLA 5DNUA 1FYFA 2BR4A 3W2HA 2ECQA 5H16A 2VP5A 1IE3A 1SA0A 3O3NB 1VRCA 4P82A 5JAOA 2QI9C 2QR3A 3W5SA 1L3BA 3DW1X 3FVQA 3L49A 1EB8A 1BVRA 4PLFA 4LXIA 5A5GA 4MZDA 2BSAA 4Q1VA 3SS8A 1NBAA 1CUHA 5ERGB 3G02A 3G85A 3OPNA 4PPGA 1NQVA 3G2LA 1VP3A 1WXEA 4ZRDA 5K4AA 5JNLA 4G5QA 3LOPA 5HBGA 4EUKA 1ADCA 4K88A 4EI7A 3K0CA 3KS9A 2ZZKA 4W7IA 2WFLB 3RIXA 1RHJA 4FYYA 3RVLA 3SVLA 1PNQA 3RIEA 3I0NA 4JB3A 4KH0A 3FTFA 3D6UA 4GZ5A 3IAM1 3JVDA 3ABOB 3KJZA 4GVXA 1SVIA 3JASB 4RKQA 3ESBA 4K6CA 2Q21A 5DV9A 1I7QB 1BMFA 2UUAB 3FVWA 2HA2A 4S0ZA 3OE1A 5EESA 1U1EA 3TJRA 1U3UA 3MOIA 3BAZA 2HA3A 4KFTA 5DU2A 4FINA 4BQFA 2I1WA 1CUWA 2IW3A 2VP6A 3WJ2A 3Q8KA 5D7NA 5AK0A 1OLUA 1H6AA 1XCOA 4JYBA 1IXRC 5TE9A 2ZBEA 4JOQA 3WRYA 2XDAA 2BJHA 2HXSA 4P6VF 3V5NA 2EJWA 2AQKA 4YCCA 2VSOA 1P0PA 1TKRA 4P7GA 2JIQA 1P4JA 5EJ5A 2WG2A 3B60A 2EJUA 2DTXA 2XVAA 2R86A 1V1MA 2ZIWB 4NMWA 5IAGA 1U94A 2G70A 5JXIA 3KYDB 1DINA 1DEXA 4G1EB 4L5CA 2XIQA 3EC1A 3GLHE 4L28A 4MNTA 4QBTA 4TXLA 3S8MA 4BNDA 5BORA 3TEMA 4IQ0A 3DMHA 1M75A 2YWGA 3JWPA 4H31A 3EWAA 1P5HA 2YHIA 1R15A 3NTRA 3KBBA 3PZRA 4DLNA 5JCOC 4Y2RA 5KSOA 5AM4A 2TRSB 3I3OA 2Y3IA 3QEJA 4JJGA 1S3GA 1J1ZA 3DVQX 1JI0A 1YONA 3GZTB 2P4UA 1QIDA 3RPEA 4WESB 4MRRA 2DEUA 4RAQA 4IIUA 4IMPA 5A5FA 2DQ4A 5AXCA 3OFVA 5J58A 1YVDA 3EAFA 1UUFA 3HFGA 4R98A 4DQVA 1SKMA 3SIXA 3UYKA 3DEYX 3P96A 2B36A 3GRUA 1HLFA 2CL7X 5EC8A 2XQJA 2ZRAA 4O25A 4PFJA 3L1HA 4FNGA 1FFEA 2V45A 5LA6F 2QEQA 2ZS8A 5E3JA 2C04A 1V5IA 3PDHA 5KJ1A 2HBRA 4JX9A 3FGZA 5U1PA 4O4JA 5L3QA 1CEEA 5IZCA 3PR3A 6Q21A 6AT1A 3K3PA 1ZYUA 1UMCA 2W6OA 3D6VA 4C3UA 2PXAA 1XTJA 3N2EA 3NS7A 1Z4MA 3PIIA 4KV7A 2GEJA 3C3AA 3PD7A 1PUXA 4QEZA 4RGYA 4AJ9A 3BGVA 3FRJA 3IIKA 2V0GA 1W5EA 4PSDA 3OJ0A 4R1MA 3OZXA 1L8OA 3RC8A 1XOIA 3IV6A 5H81A 2Y76A 4LNHA 1TEXA 2F3SA 4B6QA 1Q1AA 2CB9A 4F72A 1JAHA 4R81A 1JHAA 1CJCA 2YWBA 4BLUA 3CVXA 1L7BA 1L8AA 1FNSA 3M0EA 4Q24A 4MYTA 4P35A 1C8VB 4ZCTA 1JDPA 1JNYA 3AHJA 3CJQA 4OGKA 3MMSA 3TKLA 1RRPA 1T36A 1ZVQA 2CFRA 2R3SA 4CFSA 4RKYA 4UHDA 3N6RA 3DT6A 5FFMA 1XLUA 3HKCB 1KQPA 3TNFA 1MRZA 2D5LA 5IARA 1XTSA 2HQBA 1J0BA 2B2CA 2IXFA 2AXPA 2OV4A 3KXIA 4BE7B 1XU7A 1N33B 1LPBB 1VKHA 4YBRA 4B9EA 3WNDA 4CGYA 4NV1A 1KPGA 5IDYA 4NJEB 1NUAA 5T4FA 4XFKA 2XZDA 5CYPA 3ZUPA 2X0FA 4MWDA 1YDHA 4RTSA 1ILEA 1Q11A 4DLLA 2AMJA 3W5UA 2AEFA 3FY4A 4DMKA 4EB0A 1VA5A 3HV2A 1K3UB 1W5TA 1KE1A 3WIUA 3ZLUA 3CUSA 3EDQA 4HRVA 3DLBA 4UAVA 4DTIA 2R5FA 3B82A 4ZZ3A 1XKQA 4GR5A 1L5YA 1BDJA 2I7CA 1TC2A 1YBHA 4OAPA 4BMZA 2JAXA 2VP3A 5T8KA 4FSHA 4HYQA 3P27A 1PT9A 4D3XA 1Y4UA 5A4MS 4DMUB 4PCAA 5DTEA 2DT5A 5K0JA 3EGOA 3ZE7A 2J6IA 5KYUB 1F51E 5L3RA 3QE2A 2BFBB 4LC9A 1BE1A 5I9BA 1OASA 4JODA 4LE0A 2DBYA 4E5SA 3HB7A 2AG8A 4PAQA 3SS7X 4F4HA 5THXA 4QUGA 3AOEC 4FD3A 5HVNA 2FMHA 5KX5A 1M1ZA 5KPDA 1E1NA 1S9HA 4GP7A 3OJXA 1J7JA 3BIXA 3GMDA 1BQ4A 1OZGA 2HHHB 2W43A 3LPNA 5LA6A 1X39A 5TIIA 4G8JA 2Q3BA 2SCUB 2BI8A 2FR1A 1I4OA 5GP1A 3WRXA 4HSEA 5DNYB 2H16A 2ESRA 4FHDA 4GXTA 4QX6A 4WX2B 2RGUA 2CLLB 3EFHA 2A9PA 4KXVA 2D7DA 3FNFA 3HDHA 3Q5DA 1N2BA 3QXGA 4DEYA 2VWGA 1V1RB 1JEEA 2GJ8A 1LV8A 4NMXB 1QQ7A 5AJWA 4AMVA 4BO0A 2TMYA 4BYGA 4KPYA 1CUGA 4WCVA 1D6NA 2R6FA 4TWJA 1ENYA 2QZJA 2CHEA 1MO2A 1DKRA 2A5JA 4P36A 3VR6A 4C6RA 1J1UA 1BHO1 3KXPA 4DLBA 4U4AA 1OFUA 1UKYA 5F2OA 1GUDA 4JIGA 5KSPA 4KQMA 1O96B 2AE2A 2HSWA 1X8JA 4HAVA 5IBPA 3RG8A 3SC2A 1MB0A 1QONA 3WWPA 2B5WA 1TDJA 4OJNA 1VGRA 1BSVA 3TI7A 3WGLA 5J43A 5F9FA 2LDXA 4GR4A 3EIHA 4UUOA 1WW2A 1VE6A 3KZVA 4GD3Q 1CY4A 1NXPA 3D54D 4LISA 4C5BA 4EMBA 1MENA 4P3NA 1LY1A 1SQGA 1COZA 3CF0A 5GMOA 3R8XA 3U7RA 3U5ZB 4JI7B 2IEDA 4ZKEA 3BE8A 2FFJA 3O26A 3ZDEA 4GPBA 1ZRSA 3N8KA 4GLFA 5HG0A 3EA4A 3X1ZA 3C3JA 2BEVB 3QE4A 1NWCA 1YQGA 3U3KA 4CUZA 3I4LA 2ZJ0A 3R0QA 2OAEA 2N75A 1X7ZA 1D7OA 4Y2YA 3AC0A 3NTUA 5BV2P 4N5IX 3OA2A 2LE0A 4NH4A 1TAGA 2B8EA 5AW0A 2EW1A 3K0BA 1WNTA 4C6TA 3AKZA 1IG3A 1ZUNB 3OTGA 3DCJA 3OA0A 4Z4QA 1UINA 3EPLA 3PHCA 2X8LA 4XD2A 4RPLA 4R2MA 1W30A 4C6TB 4G86A 4YCLA 4Q4AA 3SPXA 2AIRA 1ESZA 4J0HA 4CIDA 3K6KA 1YSCA 3P2OA 5K5EA 3FHTA 3OKCA 3HEBA 1A7JA 2PUFA 3LY5A 2GZHA 1W4RA 2GYVA 1KWKA 3BB1A 3O8NA 3TFQA 4U5QA 4DLXA 1DCFA 2I3ZA 4WBNF 2J5QA 2BZ1A 3TQSA 4YAGA 2D5CA 2VHUA 4UM7A 4LF6B 1OBVA 4JUBA 5JMWA 5EZ6B 3IQIX 3KT6A 3RU2A 3SKVA 2BKEA 2IUEA 4JFAA 4MS4A 2ECPA 3MAJA 4Y2JA 4EY6A 3RSOA 2C1EA 3QJ5A 4J7XA 2HLPA 2JD1A 4YJ3B 4YDRA 1ZH4A 4ITRC 4IIDA 4RSRA 1UWCA 2OK8A 1YOVB 3CGGA 2OAP1 3LCJA 4GUDA 4HZUA 3VR6D 1QU2A 3QHAA 4PCUA 4E15A 2ERCA 2FRDA 4EZBA 3IEVA 2QW0X 5HJEA 1IVSA 3S29A 2BEKA 4EUEA 1NKSA 1USUA 5F1PA 1GZ5A 1PEKE 1SU8A 1XMJA 2PLRA 2VQSA 4LQDA 3TL6A 5F21A 4AP5A 1EEHA 1U2DA 4IIEA 5SZKB 3C5HA 3N6XA 2Y4OA 1RKQA 1TADA 3ZPXA 1TF7A 2FEWB 2M98A 5DM60 4CMHA 1GRRA 1W34A 4MX8A 5K03A 5JJ5A 4LDQA 3LP5A 3R23A 5IDXA 2PVPA 3F6EX 1DO0A 1UXHA 2VYCA 1W4LA 2KB0A 1XEFA 3GWZA 4FMDF 2EIXA 4B44A 2Q5CA 3RIMA 3BFVA 3B6JA 3HVKA 3U4QB 4OPMA 3RABA 1FZQA 3QWFA 5DM70 5BSWA 3DV0B 3E9YA 4LWQA 5ULLA 3W90A 1N2CB 5B12A 2NUPA 4L75A 1H0KA 1ZCJA 2GJ9A 1C1DB 3X2EA 2V7WA 1AV7A 3DVAB 2AMVA 1JS1X 4XH9B 4MCIA 1FVXA 1BO6A 3C6ZA 3Q9SA 4CN8A 2WTEA 4JJIA 3WGIA 3D6AA 4XFDA 2R6JA 3KOMA 2AZMA 2HNKA 3E4DA 4RA9B 2H1OA 1YS1X 4IDBA 1NDHA 3D6TB 2W42A 3A4YA 2J33A 2FSUA 1NN3A 4H3HB 3SF0A 4C4YA 4E5UA 3KSBC 3PQ8A 5C80A 4RORA 3JRWA 4TUYB 2PMEA 4LZLA 5LDHA 3UC9A 4PNEA 3FHJA 1TCBA 2I3BA 4FSDA 2YMMA 1LBIA 2TYSB 3ETJA 1C0IA 5IFLA 4ZAXA 3N2NA 3I9OA 2HLDD 3VAYA 2O7SA 2KWIA 2RC6A 4AN0A 2ENWA 4CMGA 3VHQA 1ZIYA 1KMIY 2PJZA 1SU7A 1EGQA 1JJAA 4E5DA 3SQDA 4DBVO 5BT9A 2EYUA 4KWHA 3M4YA 2B4RO 4QDZA 5F1KA 2P6OA 1U9JA 2RG7A 2VTVA 3DV9A 3L43A 4G3XA 4HYYA 5JI2E 1DAFA 1Y5MA 1PD1A 2YJ5A 2RGEA 1QOPB 2FFRA 4J0JA 2P9EA 3OCUA 4O33A 1G21E 3HDGA 1G7SA 2BEWA 2GCGA 3A14A 2HADA 3GPBA 4P5PA 2CJWA 3MOSA 4R0MA 4LHYA 4I3HA 2IDKA 3KC2A 5BYAA 5AVYA 3BORA 5EP2A 5K0GA 1AA6A 4O5OA 4WDQA 1TFRA 4UVHA 4HGZA 3NEYA 3FMFA 4GPTA 1OW3B 4G89A 3PKJA 2WZBA 4HDKB 3GH3A 2BMJA 4OQNA 1PDVA 3IP8A 3TZLA 5HQ3B 1B73A 1YZYA 4IXTA 3UWOA 1Q1QA 3P9YA 5IJ9B 3W5AA 2R1UA 2QSZA 3A2LA 5A7HA 4XYBA 4GKAA 4XSGA 5CXSA 5L3SB 4AZTA 2IP1A 4BZZA 1R4AA 2W4QA 2WNSA 2P3LA 3ZGLA 1NA5A 1NXSA 5LJIA 1GTL1 2D2FA 2JF0A 2QN3A 3M5PA 4HC4A 4BQOA 3A6KA 1RHUA 1AGPA 2O14A 2ON6A 3DWEX 4FUTA 4LRSB 1YU6A 5P21A 3ZHQA 3ZU4A 4B6PA 1K8ZB 2GZRA 4N6NA 5CDFA 3S55A 3R6WA 4WI1A 3ORQA 1F2TB 1L7AA 3FA2A 4AY6A 5TRTA 2D5BA 2AEMA 1US8A 2YVQA 2ATIA 4F6RA 4H1WA 1BGWA 3FPHA 4CLDA 3F3KA 2DUJA 1R37A 3BWXA 1XQXA 2GK7A 5IS2A 5AJYA 3PIDA 4CKEB 1OWLA 2C3PA 1OLSB 2DH6A 4R7ZA 5JAIA 1QYWA 1SBQA 5L51A 3K05A 5B6JA 2AFIE 1TMKA 1Z37A 1GA4A 4LWPA 4MLCA 2YRWA 1MT0A 2VCYA 3AIMA 4NWIA 4LE1A 3ROEA 4QKQA 2GPNA 4FYHA 5LFAA 2O0MA 5DBFA 3RRXA 4WECA 3MCZA 1OA0A 3IQWA 1C7EA 3JZIA 4TKUA 4RY2A 4W4TA 5C4GB 3W05A 4M53A 1JR4A 4L4SA 3NRBA 1QX4A 4E32A 1SUSA 3MMZA 2AQIA 3RU7A 1E96A 3G82C 3CTPA 4C7KA 4K6GA 1M34A 2FX2A 3PNMA 4JA0A 4EW2A 1YVUA 3T7JA 3BEDA 1NMSA 1W0CA 5K3DA 4QGFA 1XTKA 4M38A 4GWGA 3QUCA 4Y6SA 3R6GA 1U28C 2BZGA 1I3OA 1ONNA 3TTUA 4FYVA 1XZGA 1HG1A 4HAUA 1UWLA 3A4TA 3EOBI 1EUCA 1FP4B 1OZFA 1L8QA 4G1VA 4PGGA 2OORA 4AIIA 1L4UA 1WDLA 2PMKA 3T3MB 2UXBB 4FC7A 5DHQA 4X41A 3RVKA 2Z2XA 1E9DA 4A8JC 4B31A 1U3GA 2P67A 3FHOA 4NZOA 1AKVA 4LHVA 2IU0A 3RSHA 3HVJA 4OKNA 1ODCA 3CO5A 5T3UA 2FWJA 1JKIA 1FUUA 2ZYVX 3AVUA 1M2OB 4N3GA 4YX9A 1YHNA 2HWXA 4QDJA 5DCYA 1NPTO 1D0SA 2V3CC 4AT1A 3ITDA 1LSJA 2ZLBA 4TZKA 4I19A 3AZOA 2JJ2A 1NRWA 3SJCA 1A9ZA 1VJTA 3REOA 1WVMA 3HKDB 4JQOA 2Y9PB 3D1JA 3RK4A 2C5AA 2Q4DA 1EIWA 3OD5A 4PGMA 4DS3A 3M2PA 1AZWA 3H1AA 5F1YA 3B9QA 2WJIA 1NL3A 2IT1A 4OMFG 3B36A 4XFJA 3V1YA 4AF7A 3R3JA 5FUBA 4UJ3A 2QRUA 2XZTA 1UKVY 3IPRA 1K1EA 4X1OA 1U9ZA 2PT7A 3FPKA 1GKUB 5BSTA 2C1ZA 2QRHA 3DE7X 3N2YA 1X7DA 3IMKA 5TQ2B 2XZOA 1U0BB 2QMQA 3AEXA 2ZRDA 4RZSA 4YAFA 4C3OB 1IOWA 2EHJA 4DRYA 3DVLA 1AKWA 3KD3A 5GQSA 3GNTA 3P0HA 4RD6A 2P4QA 1Z6AA 4BRUA 2VH1A 3OWHA 4PM4A 1RSZA 2VZ9A 1VL5A 3ZKAA 4P4GA 2O8DA 1ID8A 3WMEA 1P72A 3JVVA 4CMJA 2QRPA 4XQ9A 4YJ2F 4EBFA 4B33A 1D6JA 2JFOA 2HDWA 1E7WA 1KEVA 2VDRB 4EG3A 4ZFNA 4B3GA 4QEDA 1UP7A 2I55A 1Z5OA 3C16C 5IM5A 4ZI7B 3IX7A 2ZRBA 1RIIA 4IDQA 4R3WA 4YP0A 4FFRA 3D7SA 1BWSA 1XVTA 1YJCA 3H84A 1KO7A 1YQEA 4LHZA 4M9CA 4GHWA 5EHIA 4PAOA 4GL2A 5E1DA 2UAGA 5D85A 4AMYA 1KYQA 1W49A 1Z12A 4KAAA 4CMEC 4LIPD 5AVTA 1E20A 1PO7A 4ZYTA 4YP5A 3N7UA 4NESA 2YHSA 4BNXA 3VFDA 1GUBA 2EFEB 4R1PA 1L1RA 1N5JA 3K1JA 3HB1A 2GKSA 3ABQB 3P7MA 4GBJA 3G2HA 4H7FA 1Z2AA 3MG9A 5JSZA 3ILVA 3KU1A 1U3WA 2O1EA 4LV8B 4CQLA 2OGWA 4TTSA 4Q02A 4EI8A 3TIVA 1L5HB 1SAYA 2B99A 1ZUHA 5CGZA 3V97A 3UZUA 3ZU6A 5JZOA 1YCFA 1TAUA 1C41A 2E9SA 5K8IA 1F1BA 4HATA 5T4BA 3UV3A 1MX1A 2C95A 4ENQA 3PT9A 3ZG6A 3RNOA 3RC3A 1KY2A 1QZZA 3ANMA 4NZMA 2C61A 2CJWB 2IOFA 4GW3A 4LMPA 5TJHA 4DPMA 4M0LA 3WKBA 2QRVA 4ZAYA 4R1LA 5CEJA 3ZE1B 1E59A 1KC3A 1L5WA 2WYUA 4MW4A 2F7SA 4CT4B 2Q49A 1GLVA 3LY9A 4BZPA 4IIVA 4UDNA 3CW9A 3WKCA 1AHNA 4QGSA 3NWJA 3KKQA 3QUAA 3P71T 4XUCA 1P6UA 2V55B 5HF9A 2O8CA 4W5RA 1VL0A 1FLNA 2SNIE 3IFSA 2NXEA 3MB8A 4FNAA 1QGUA 1KP3A 1YUBA 1V3UA 2WM8A 4KE6A 5DCUA 5KTMA 1W1WA 3GD5A 2HU8A 5AYVA 3CZMA 1GYQA 3FD8A 1SUDA 3S27A 2FR8C 1UEIA 1YUMA 1MV8A 3LXMA 2QAGA 1HC7A 1LBEA 3MBIA 4F92B 4M36A 1MC8A 1T26A 3EY4A 3DEFA 3LQQA 3A6DA 4U0JA 4EKGA 3L4BC 2OZLA 2DR3A 1WXIA 3OTIA 2G1AA 1ZGCA 3AEKA 2DERA 2D1TA 4FXOA 5ALQA 3DPSA 5LYJB 4A15A 2B8NA 5IXJA 3GRZA 1T4MA 3A06A 5A5EA 5EQFA 3EXHC 3DUWA 1ESDA 2HBZA 3VISA 4PLCA 3OZRA 3KIPA 1C7JA 1I1HA 1Z75A 1EHIA 3L6EA 2H18A 4MW7A 4LZNA 3PF9A 2CBGA 3PX2A 3U40A 3THYB 2BOVA 2FP4B 5KAPA 2FUCA 1XFDA 5EXDA 5DBOA 2V3VA 3OLZA 4LAFA 4B3RB 1F6BA 4M37A 3EUFA 5K51A 4A23A 4C0KA 3ZBPA 4CL0A 5DXAA 1XHFA 4WH0A 2W00A 1JBKA 2HA5A 3G9XA 2Q4TA 1ZY2A 1TYAE 5JSHA 5BNWA 5F4ZA 1HA3A 3CRVA 2GM9A 4I1OA 4JT8A 1SUIA 2V8OA 4ZU1X 1SZDA 1UPAA 4G1MB 4ZVOA 3P1JA 4EP1A 4AY3A 1XQ6A 2WPDD 1GOTA 4CKBA 2GJ4A 3A4MA 5KYVA 3NLLA 2CD7A 1S8OA 1JT2A 3KHUA 2P78A 3FKSA 2FV8A 1PQYA 1HH4A 1UEJA 1MRSA 2R8PA 2HT1A 4U2KA 1UDWA 4Z5XA 3G2IA 2HUNA 3IJPA 2VNKA 4AN4A 4YR7A 5IHPA 1Z2OX 4CHGA 5FH9A 3ROFA 1BXRA 1J8MF 4IXWA 3PLRA 4MTCA 1EK2A 2CFSA 3VX4A 3ADBA 2EG5A 2GWRA 3GT3A 1SC1A 3IELA 1T9KA 3BRSA 1QZXA 1LLUA 2RGAA 4PXYA 5AHKA 2TMGA 5LDGA 5A4DA 3EE6A 4BN5A 5IAOA 2QTHA 3QFRA 1XMPA 5EUBA 3TRIA 4HYTA 2VS1A 4MQEB 5T57A 2VXOA 3ZHXA 4OV6B 3ZD6A 1KIMA 3GJ4A 1OAOA 1RCTE 1H6DA 2KX7A 1L4KA 3MJFA 3TW8A 5FTLA 4D57A 3OTQA 3D0QA 1G3IA 1M3SA 1RAIA 2R85A 3O93A 3PTZA 5ESXA 3BUSA 4Q1CA 2BHNA 3P9NA 4TWRA 1XPOA 4RF3A 1E6MA 4IJ6A 2H4HA 2NQ8A 2WD8A 3NP7A 5JT1A 2JGLA 2NTVA 2AHOA 4WZBB 1QX3A 2UUOA 1O6GA 4ZU6X 4PVDA 1PR3A 3G2MA 3JQ6A 5DGXA 2HIMA 1ORRA 3UAVA 3DBLB 1JRLA 1OAKA 2WMOB 3ZY5A 4MQFA 3Q2IA 4GM0A 1ZUNA 3DMPA 4ZTBA 3IP6A 5AVUA 4DR2B 4BB5A 3R77A 4EA6A 2MOKA 1XJCA 3AILA 4NHEA 2H2IA 3WHPA 1XV5A 4LVNA 2MYPA 2YWJA 4RMHA 2H17A 2D74A 2EGHA 5B4UA 5IBCA 4DCJA 5EMKA 5BWNA 2UZIR 1G20E 4B09A 3GK3A 3Q88A 3ZS8A 2ZOSA 4AULA 3KJXA 1HM5A 5DM0A 3OM9A 4K87A 1VE9A 4AKSA 4EZEA 5EWMA 1K7FB 1X6VA 4PCLA 2GZ1A 3D7NA 1A2KC 4HPWA 2ST1A 2PX5A 1MHPA 1SZPA 2QYSA 3V4PB 3EMDA 3PGA1 4IUDS 4F0JA 4IS2A 5K20A 1XJ5A 1QHGA 1EEXB 2RIPA 3VJKA 3ZIAA 3IILA 2E2WA 3DAGA 3KSUA 3X1YA 4B4VA 3OWXA 3BILA 3D0RA 2HU2A 2PHZA 4RF4A 1Z6YA 4C1BA 4E88A 2LPMA 1TJ4A 5C7LO 4WA8A 1XL0A 3Q40A 3ZW8A 3BN3A 3WQQA 2H4WA 1R9GA 1D2HA 3FF1A 3IOBA 2DWQA 1H5QA 2GM5A 2H7XA 1STOA 2OBNA 4I14A 4OBXA 3ZWAA 1CQIA 5EKSA 3LQ4A 1PFWA 1ULZA 4LGCA 4R41A 3NVDA 4WVLA 1DQRA 4JYPA 2F00A 4UZEA 1DS6A 4DJDC 2VAPA 4N5MA 4Q4HB 5EHGA 4QT0A 4QELA 4GYJA 1U6IA 3MUOA 1E8MA 4QWWA 3R5XA 1MJHA 5IN5A 1ZIPA 4U0KA 4X45A 4E5YA 1CR4A 1ZK4A 1XZPA 2RHMA 4LHEA 4GDFA 1Q0RA 2VJLA 4XDYA 3EISA 2Y1WA 2BSQA 3H8JA 3COPA 4WFIA 5FR1A 1WA5A 2H2FA 1N8SA 3VZPA 2J3DA 4DCUA 1AO3A 1GTMA 4KVFA 3KQUA 4MEBA 5K3SA 4J1SA 1GARA 3FCCA 4KYIB 4ZI3A 4JP2A 4HLQB 5GJBA 4BBAA 2HHJA 2WE7A 5CG1A 1P3DA 3VR4D 3JAKA 2VQEB 2Q2WA 1C9EA 2M2IA 3DM9B 4INOA 1LPSA 1RXYA 1U65A 5EXSA 2YWFA 1Q0HA 2EEZA 3QWAA 2GBGA 1A5BB 3D8NA 3ZI7A 3HY6A 4U9UA 3KFVA 3NTLA 4V0LA 1Q91A 1QYRA 1EVYA 1IBKB 4A5SA 3GGPA 3GRKA 3MJTA 3GHHA 2PZGA 4Q4LA 1ZJ5A 1XZDA 2HW8A 1H9CA 2WF7A 4Q7LA 2JD2A 4PBTA 1OWNA 2VJNA 4D3YA 2WOJA 5CB4F 1PJSA 5CDYA 3DOCA 4NCXA 1KPIA 5FI3A 3TD6A 2B1QA 4JT9A 4NBTA 2CNWD 3ZWOA 2UYQA 3Q3CA 2JLSA 1T35A 3U0BA 2ZI3A 1W36B 2QMEA 4XDHA 3G5MA 2XRZA 4Z4GA 3SDBA 2W6NA 4OHYA 1DAKA 2QE6A 4JJFA 1FTQA 2BDEA 2BEWB 3LL7A 2H63A 1ECJA 2QLNA 3U0VA 4BS9A 3U3OA 2I4MA 3ZLBA 3HR7A 3R7WA 4YMTA 5HZGA 3TF5A 1VG0B 5LP6F 4P92A 4TMFA 4PANA 4DCOA 2VR1A 2FW6A 2IQ5A 2XMDA 3VHXB 4AK9A 3GGCA 2JC3A 3D4OA 4CW7A 3UENA 4DMFA 4QAJA 4UVGA 4CIAA 2PFGA 4RY0A 1IY9A 3AR6A 2YS7A 2WA1A 1VKOA 1HYGA 4NV3A 2V4MA 4XRRA 1U2SA 5DGTA 3GWGA 4KX5A 5F5LA 3RRYA 4LWOA 4KIUA 3VMMA 4A92A 3M6UA 1AMNA 2O20A 1NBWB 2DFPA 4P7JA 5SZJA 4B3HA 2B5VA 2FETA 1K0FA 4LYJA 2H1HA 3EEOA 3ZQ4A 2GAIA 3ND5A 4LNUB 3VKWA 4B6FA 4HAWA 4D6PA 1BMDA 1W59A 3WLMA 2GXUA 3LF2A 2FSSA 5K8VA 2KM1A 3Q6IA 3WO0A 1D2GA 1D4FA 1A95A 2JI7A 4R54A 1RI4A 2O7QA 2XYVA 2XAUA 3BHMA 4G0ZA 2O5VA 3DXXA 2QT9A 5AKLA 3PQFA 3RS9A 3WY9A 3ZWVA 5KIAA 4YRAA 1J5EB 5KOHA 1FMFA 4P84A 4BQSA 3INGA 1WCV1 5K2MA 5M29A 1ST2A 4L0MA 3REQB 7YASA 4EJ2A 2Z98A 5JMPA 1TJ3A 3U3XA 1SVWA 1I0LA 4LOJA 4TKVB 4KO1S 1JL3A 1TQDA 2BUAA 3D5EA 3I61A 5CU7A 1M8FA 1EVKA 1JG4A 4R2IA 1YK1A 2XWSA 3CPSA 2PMCA 4H7EA 2H92A 1M0WA 4U8GA 1M1XB 4F2WA 4TKVA 1H4SA 3ZQJA 1PVDA 5SICE 2C2WA 4E22A 1GPBA 2JFUA 3GJ5A 2B8JA 2J0SA 3O1JC 3L7NA 2HNBA 3C7AA 2OPHA 3EASA 5LU9A 2H06A 1QAMA 4IH9A 4G2NA 1V39A 1MV5A 3CN9A 1SXHA 2OV2A 1CZNA 3DAOA 3WL5A 1M67A 5BT8A 2K5UA 1SCBA 3IRVA 5JXGA 4AURA 4J29A 3AVXA 4PHTA 1KYVA 1KDOA 5LLSA 2IY9A 3T1VA 3UB4A 2GK3A 1PLJA 1JBQA 1E2GA 2Q7OE 4W9MC 4HPJB 1X9GA 4GL4A 5TARA 2X3UA 3KXDA 4H60A 4WBSA 2L82A 3AR7A 3BXZA 2VDMB 2Q2QA 3I9JA 4CEIB 4HX2A 2V6GA 3CS3A 2J3MA 4MSUA 2EKLA 4FT4A 4CLEA 2AI2A 3EGCA 1MD9A 1Z0ZA 4E11A 1C1HA 1AQJA 2WTNA 3JVIA 4LG1A 3DB1A 4WD3A 3UK0A 1HEIA 4AP9A 2ZXEA 5HF8A 1KQFA 4BO5A 2AC4A 2R8XA 4I5FA 1VDZA 5C8ZA 5DISB 1IVNA 5E8JA 1NY5A 4P93A 1CQXA 4UBKA 4AG6A 4CXMA 3KYJB 1FQWA 1DRUA 3EXG1 3F6PA 4GOND 4TV8F 4EJ0A 4ETMA 3D81A 1WCYA 4LVOA 5JIBA 1SUWA 1S1MA 3FF4A 3MQ4A 4WFQA 3RO7A 5JI3E 4LBZA 4N9QA 4ZAGA 3LCVB 4GI1A 4JUCA 4N49A 3FFBA 2HK9A 4S1VA 5H3CA 3CLRD 1TJPB 3DCIA 2Z8ZA 3LUPA 5E1OA 2JCXA 3AIOA 1TTPB 3INYA 4JDUA 3ONDA 1I4DD 3R44A 4LJKA 5AKHA 1NC1A 3OCYA 4AMZA 1GZ4A 3GFQA 1YS6A 1VKRA 3KOXA 4LYGA 2IY7A 1VG9B 4Y0AA 4G0YA 4L07A 2W4IA 5DHTA 2PQMA 2BP7A 1Z4LA 3UJ6A 1ISRA 1FZTA 1G4HA 2VXYA 2CNLA 2CVOA 2O0KA 1CIVA 2FWPA 2I03A 3DS8A 5G1PA 1D9XA 2FWRA 4WOJA 2JI8A 3HM2A 3V48A 4ZOEA 1GR1A 3RRJA 1JYEA 5J2TB 3GLIE 3E9CA 1K8RA 1NJ1A 4ZVUA 1LVGA 2DQZA 2AZDA 4DGQA 5J1SB 2DBRA 5CLHA 2NU8A 4HDSA 3HJRA 3UW3A 1G8MA 1P5RA 2BFCA 3SC4A 1MDBA 1ZICA 1T10A 4Z4IA 1HDOA 3PQ7A 4RVHA 1Y1PA 2J3QA 2O7VA 3W6UA 3O38A 3QKSB 1HMYA 2M32A 2Y9MB 5E6RA 3T7DA 3ASUA 1W5FA 4DQXA 1YB1A 4O1HA 3DZCA 1OTHA 1KGDA 2BW0A 4GC5A 3VVCA 3ZVNA 4W8GA 2MSNA 1G1AA 2QX4A 1G291 2W8BA 4LDAA 1P62B 2HWKA 3KTFA 1QFJA 1XLVA 3IE1A 3UBTA 4KX3A 3ANSA 2RAPA 3M3PA 3Q3JB 4C05A 5AESA 5KHOC 1D3AA 1H5NA 5FRDA 4WK2B 1JHZA 2HZ7A 2B0JA 3PA8A 4L5AA 4N3AA 4B74A 1ATZA 1KI6A 4MLPA 2R1TB 1GGVA 2E37A 3O8OB 1CUVA 1ZR4A 2I7VA 2ODQA 2R47A 3OLQA 4RSHA 3CW8X 1KERA 3NHYA 1A4UA 1NW5A 5L3ZA 3H2BA 1JXMA 2GN8A 3GGJA 1RFLA 1FJXA 3E23A 2V65A 3PQEA 4JBXA 3SF8A 3RKSA 3LW8A 1W44A 2RGRA 3TXXA 5JQGA 3DQQA 4EVIA 4WN9B 4F3CA 5FWXB 1RPNA 1WRBA 1MC4A 2I6TA 2Q6TA 5D87A 1MAHA 1PX2A 1QFZA 2M6RA 1SK8A 4D02A 5JSQA 1TQ4A 1CUUA 3FYHA 5AJZA 1VSTA 2WAYA 1B3RA 3T8YA 2XBLA 1AMUA 1BXGB 2LKCA 2Y27A 2WUVA 3RUPA 3T61A 2G9QA 2ONJA 1H4QA 5EJMA 2HBQA 5IYZA 1GPAA 5ED0A 2V59A 1OREA 1T3GA 3H9GA 5TQ0B 2L69A 2FJPA 4EG8A 2JKVA 2EJTA 1CUDA 1XMVA 1WUJS 2PX3A 3RK1A 3JQCA 1JG1A 1N25A 2XUIA 4N3NA 5JS7A 3ZGVA 3HO1A 4GYKA 1KHTA 1PU2A 3TAXA 2HJVA 3BWEA 4UUAA 4TS4A 2AWNA 4NQRA 1PT5A 2B8TA 2FW7A 4KR0A 4EG4A 2G4VA 4GXRA 3QPDA 3L77A 1VI5A 4PRZA 1Z45A 4HGOA 2WUFA 4XA8A 3CVVA 3FDZB 4TT8A 4AYXA 3B1XA 3RTAA 4FB4A 5HKKD 1T3LA 3CCFA 1H2EA 1N8TA 4ZIRA 4KAFA 3WZMA 2GXQA 1M1YE 4MICA 3CF2A 1G5RA 5HW0A 4R9VA 3ORHA 4Q05A 3DMRA 3ESZA 4B17A 4YRSA 2C98A 3OICA 5HGJA 4ARCA 4IV0A 1GSOA 4X3PA 2F17A 2I4RA 1GPNA 4ZKDA 2JPDA 5LQKA 4UPDA 1ZAYA 3F3YA 2ISQA 3B85A 2X8BA 2OCYC 3S0JA 2BTEA 3GMSA 1EGAA 2X8AA 2JEYA 4QYSA 5TS2A 1XFAA 1KO4A 2JJMA 1KDRA 2UUPA 2EX0A 1GSAA 1S2GA 1U81A 4JNKA 4LGMA 1MJGA 1YB6A 3A1TA 3L06A 5F2NA 3QW4B 2UXCB 1DHTA 2R751 2RGXA 3HU3A 3DL7A 1WB6A 3QWHA 4OO3A 5E3HA 4EO7A 1ELOA 5EJFA 3ORRA 2WIBA 3SYNA 3DVAA 4MKRA 3EZ9A 2J46A 1FSFA 2RGBA 3OUTA 4IIBA 1OXVA 3HCOA 4HDMB 4S1OA 3O31A 2H07A 1JXAA 3CX8A 4TSFD 4Z49A 4I4TA 2UYGA 3UTCA 4IEEA 1PS0A 2NYRA 1Q16A 2W6MA 1SKQA 2AE1A 2X58A 3FMGA 3QVKA 1TD9A 5TQVA 4OI0A 2NU6A 1PYOA 4B3XA 721PA 4IFBA 3AUXA 4RELA 2FJ0A 4OXKA 5A7GA 2II6A 4EAAA 5BV0A 5B7PA 2CDCA 4W5QA 2R6ZA 2PGIA 3ZNPA 4OG2A 1VE7A 2R7KA 3AGPA 3M6LA 2NU6B 1U7TA 3MTAA 3O82A 2YNMC 4RFSB 4M4SA 1EZZA 2WJJA 1VJCA 4KIFA 1FVFA 1G21B 5DOVA 4CLRA 1JSCA 2IU3A 4H18A 2DE0X 2P2GA 5HE8A 2QXUA 2XGSA 4TS3A 2GBCA 1FXUA 5EERA 3QKUA 1V11A 4FEEA 3IALA 2QT1A 4BFSA 1HXHA 3PQ6A 3B3AA 3HBJA 4ARAA 2YL2A 1WDTA 1KBQA 1XB2A 3OP1A 3W5HA 3WJ1A 2ACWA 4D97A 5CNIA 2QL9A 1EP9A 1M1UA 1V11B 1KO5A 1PFGA 2HGSA 1UZNA 4KR7A 3ZJTA 2WAMA 3L3BA 4XGQA 3TQOA 2X5NA 2Q62A 4AMUA 2FSHA 4CEJA 4MKIA 3U56A 4FHFA 1J6UA 1QFYA 2H9YA 1BDHA 1G7CA 1RHMA 2D0OB 3DMNA 4I9HA 3SJAA 1VFNA 1VGQA 3UANA 1CXZA 2QSJA 4TOIA 5HK8A 3VYWA 5LIPA 1TU3A 4EATA 4RZ2A 2RHBA 4AVYA 1TZ2A 7MDHA 4YJHA 2XUAA 1J0DA 3LUDA 4WLUA 1BOOA 1P18A 2XNDA 5FAXA 2HWWA 2H4XA 3FB1A 3HDJA 5EYPB 1DC3A 5GADl 3GBVA 4H3VA 4J4HA 1GG2A 2HL6A 1N5KA 2HMYB 3AG6A 3IDAA 5CP8A 4BNUA 5CXQA 5ITZB 3OOHA 5BWOA 1CDZA 3EEBA 2RK4A 1WXQA 3VO9A 3A25A 1PK8A 2C8LA 4X65B 1N3BA 2D1RA 1HGXA 3HYLA 3O84A 621PA 3WDSA 4WKOA 1R8YA 3C6KA 3RU3A 4MARA 4BB6A 5DH9A 1RADA 3E18A 6ABPA 2JJYA 1NV8A 1CKEA 5A9SA 3THWB 4Q9NA 4V0RA 1QVRA 3NIFB 1QM5A 1P61B 1UBMS 1CUYA 3KP1A 3SYRA 3W1EA 3WIEA 2CEKA 1NIJA 2WD7B 4JLBA 1A2OA 1B8NA 5GJCA 2QAIA 2V6MA 4TXMA 4C22A 2ZS9A 4OJMX 1PJAA 5DULA 4K6MA 5FA6A 3FTQA 3W2IA 4CNBA 4OIFA 5KTYA 2PRZA 4OL9A 2AQ8A 2C3MA 2RAFA 3C85A 4I6GA 4YIKA 3KXKA 1H2WA 3HFRA 2GSDA 3F90A 2P5TB 4MI3A 1Y4DE 4BO9A 2V54A 5JSZB 2BF7A 2FOIA 4RCYA 1SBZA 3QBTA 3GDFA 4B2LA 1MX3A 1OX4B 4YMWA 5JD6A 2P69A 1RJDA 3NX4A 4PZ9A 3SJBA 1Q21A 4WFJA 4YRZA 3RYCB 2CNNA 1N7JA 4RLFA 4YT2A 4NG4A 3W9SA 4MIEA 2H1FA 4AJLA 1C1XB 4AWBA 3NDJA 1H0SA 3W9YA 1P0CA 1ODKA 4HZIA 5B2FA 5KKNB 3CPJB 3H97A 4OVKA 4FYJA 1BROA 1YR8A 3USCS 1O6ZA 3NTOA 3SM9A 2HIAA 1QBKC 4IBOA 2O8BB 1MJNA 4Q66C 2H11A 3WNCA 4DUGA 4LBYA 3GGSA 3EDRA 4QUBA 3RHZA 3CZAA 1TA9A 1R0CA 1NKTA 2XUGA 3ESAA 1VECA 4QARA 1O6CA 4MAFA 3TWOA 5J4HA 2PZFA 4B7XA 4QM7A 2IEYA 2WLSA 3KFLA 4YPFA 1KJ8A 3WK9A 1DC5A 4Z1MA 2PR2A 3O8RA 2IXBA 3ICQB 5JJCA 1N2IA 3W8FA 2Q0QA 1YV9A 3KE8A 2BFPA 3C4QA 2ZDGA 2XEXA 4KTTE 2A7XA 1X86B 5HOQA 4OQYA 4QJ5A 1U1IA 4BX9A 2VHYA 3WAJA 3ZXSA 1AGYA 5LPNA 2GD1O 1O95A 3L0YA 3H5TA 4M0MA 1AVTA 1VSVA 4I5GA 2HCRA 4FU0A 4PX9A 1QHSA 5BRJA 3ZHCA 2FKNA 4ECAA 4CDMA 3H05A 2A6PA 3OI7A 4MS1B 4UCWA 3R0XA 4IXMA 2OZLB 3E7DA 1DQPA 1Z82A 4KBGA 1J49A 4ZWNA 3DEIA 3VC7A 3VDMA 4K0KB 1L7DA 1PAUA 4H0NA 2DHEA 3KCNA 2PX8A 1WR8A 3NBFA 4DR1B 2P2CA 5KEIA 4TXHA 4UXHA 1YAJA 1EUQA 2XBUA 1L0BA 4KPGA 1FFBA 2XWJI 4MS3B 1G6OA 4ZRNA 4QLAA 3AU9A 3E9NA 3NWPA 3QA3E 3HRIA 4D0LB 3P2EA 4F84A 5A62A 3WSVA 2NU8B 3P5SA 3NOVA 3R7SA 3ICPA 3DBHB 4KO3S 3I0ZA 4WLVA 4BNLA 4RVOA 2FFAA 4FBLA 4MUMA 3F2VA 5TQ2A 2Z5LA 3WMGA 3D8RA 1USIA 1B41A 3KNZA 2HWYA 4HJXA 5DLEA 4ZANA 1XF9A 2JCYA 2EWWA 4GP9A 1LJUA 3UHOA 3N8DA 1L4BA 4RACA 1LCIA 4A0FA 3Q6MA 3E9EA 3E1GA 4H1TA 3OEWA 1SMKA 3TMAA 4D42A 1JEDA 1USWA 3AR4A 2PT9A 1OJ7A 1HLDA 2X0KA 4MKFA 1EFUA 4RA9A 1I30A 1D5WA 3CEAA 4PZPA 3EEYA 1P2GA 1XX6A 5CPBA 3O8DA 3ANTA 1E2QA 4PBSA 4UZFA 5HIKA 1Q3KA 2PRKA 4P3OA 1HYEA 4BWYA 4B47A 4JI2B 1J8YF 2JBWA 1IEWA 5GZ6A 1BRTA 3EHEA 3PGLA 2X8JB 5H59A 5KO2A 3L04A 1DO8A 1U8TA 4A16A 3WGNA 3FI0A 1LTQA 4UAGA 1LX7A 3K4HA 4M8LA 1AQYA 3CUKA 2AFHA 2H2WA 4LMAA 3K9CA 4REMA 1UPCA 2XT0A 5DCLA 5EQJB 3ROKA 3ZDYB 2BH9A 2W2TA 5EJ6A 3U4DA 2AA3A 3KLMX 1YHYA 2B1RA 1T3TA 4U63A 4XX0B 1CG6A 3ASZA 1P1BA 3C24A 3GAZA 4A27A 5CCEA 4MR8A 1Y34E 1IMJA 2C5SA 2V03A 3OX1A 5CNKA 4EFMA 4ZMBA 1YDWA 1AXGA 2HU7A 2X3FA 3H4MA 4C7BA 2RH4A 3A9WA 4CKXA 2WLTA 4FK8A 1QCZA 4OB6A 4RHCA 4DIUA 1H6CA 3FMVA 1HZZA 2EG9A 1Z4IA 2O48X 2IUYA 4MJLA 2FSFA 4L9RA 4R1SA 2X0DA 1LZKA 4Q3LA 3DULA 4EQZA 3MFQA 4OOEA 4RTMA 3A26A 3NWBA 3OUUA 3Q9UA 1XHLA 4R1OA 3L7KA 2WWWA 4KO4S 3VUEA 1WF6A 5P8WA 1N0IA 3T3GA 5BPHA 5JUWA 5KTSA 2C8KA 4G8CA 5KOIA 3W2EA 1E7YA 3DAFA 3WB2A 2GF0A 5IJ9A 1DQSA 4BO2A 1QORA 1GGEA 2IYPA 3U6BA 1R8JA 2XW6A 1TK3A 3FGNA 5KSWB 5IBRA 5CX1A 1YZLA 5K0EA 3DFUA 1H0RA 1R8QA 2HK8A 4LFBB 3OAAA 2O0JA 2RKOA 4ZTUB 1HSZA 2G06A 1DL5A 2WJGA 4L50A 4EF5A 1QQ5A 3Q7TA 2ZETA 3E9RA 1UJ4A 3P94A 4LJ7A 1TTQB 2WHXA 3O91A 3N0TA 1I0IA 1EFHA 2PS3A 2V4UA 4MW2A 5HFAA 3LT1A 4JC8A 2AD1A 1UADA 3IC5A 1D4ZA 2R4TA 3OIGA 4Q6BA 5ALGA 1NSYA 4KWIA 3B7PA 1ZVKA 1V96A 4BO4A 1CQZA 4YAWA 2NM0A 3NOOA 3S4YA 3UWSA 3FPAA 3HH8A 4KOAA 1VE3A 2J5RA 4E08A 1Q3TA 1K8XB 4IXNA 1K6IA 3I01A 4KXYA 5ES4B 4ZCSA 1MF7A 2GHIA 5HUQA 2FK7A 1QR6A 3TSZA 4IZOA 4M9UA 2JLYA 2XSZD 2BKAA 2WM2A 3MIZA 2CHUA 4ZOLB 4KH1A 4QTUB 5EWLB 4WOKA 4Y98A 4Q3OA 1H42A 5IF3A 1U7ZA 5JRJA 1USVA 5E4TA 3WHKA 2GLXA 2JK1A 1YE8A 5K0FA 2JA2A 1DKPA 3CNBA 4BGVA 5IPFA 2AD5A 5JNWA 1PTKA 2JZCA 5EWLA 4KCGA 4TV9B 2OFOA 4D7AA 1LTHR 1XTUA 4GBED 1ICIA 2HJHA 3AESB 4KE8A 5IAEA 3RYHB 2DBVO 4WJLA 4ZYZA 4KQWA 4LZWA 5KYWB 4HNQA 1FDWA 3QUBA 4R4JA 4E6EA 1IAQA 1Y80A 4M22A 1T6ZA 3FCUB 2PLNA 2XB9A 4L8WB 4OSEA 4DA0A 5H9WA 4EUHA 2WI8A 5ITSA 3B2NA 4BFVA 1CIJA 2C7RA 3IPLA 4I9GA 1CEXA 5LMZA 4JWKA 5LQUA 4DM3A 2ZJBA 1LU9A 3DBVO 3ZCXA 5C8YF 1X8LA 4GSLA 4ZQIA 1N36B 3ICWA 1NNSA 3MGCA 1IOLA 4XIIA 2CLKB 5JSYA 1CQWA 4U6NA 3L8EA 1JT9A 4JD5A 1GEGA 3JQAB 4R7TA 4B73A 1YVRA 2FWMX 1N0UA 3RRBA 3FJOA 3RUCA 2FEMA 4MPPA 4TVBA 1BNCA 1JEQB 2BHSA 5AW3A 1NI4B 1CJKC 4FGJA 3OWOA 3VR2D 4BE9A 3KVRA 2R1TA 3CUYA 4ENPA 1ZU5A 3DOOA 4U02A 3ZYCA 1T2AA 4EHKA 5IDQA 4Y6OA 3CT4A 3T5GA 1BA2A 1V26A 5JBIA 2O6LA 5KNDD 4RK5A 4Q5IA 1POWA 2W6ID 2D4HA 4G2TA 3RREA 3GLUA 5HCUA 1G8JA 1E4OA 1PQWA 1UC4B 2QLTA 3DNPA 5ALZA 5HA5A 3TIFA 1BXZA 2VDVE 1OY1A 1NN5A 3DJYA 4DOMA 1Z8DA 4YCJA 2QDKA 4FE7A 2PS0A 3RHTA 4X61A 3IE2A 3PSHA 1RYEA 2I33A 1QIFA 2YYAA 4WZ6A 2C58A 5DNVA 5GGXA 2LCQA 1XEWY 2Q7DA 2H59A 1WUTA 2E4VA 2HA4A 2OV6A 4QFBA 4XUEA 3AM4A 4Q3CA 3VSCA 3PENA 1JXOA 1U4SA 1M33A 4MKHA 4G23A 4P3XA 2A84A 3F97A 4H15A 5L7TA 4KPUB 1TU4A 5A04A 5C32A 2UVQA 3GVIA 4C5CA 4QOHA 5JJLA 2FPIB 2WQ7A 3D7KA 2A5YB 1XZNA 1ZISA 2COKA 1H5UA 2F3QA 2OA0A 5EIXA 3DE6X 4RDXA 3PNLA 1YL5A 2C3YA 4E51A 2WD7A 4E2WA 3TQHA 4FQ5A 1PL6A 1RAHA 2W2OA 3PK0A 3PCRB 1G4UR 2XQGA 4Q9IA 1GGFA 3WWDA 3FUVA 3W1VA 5K6AA 2OGSA 1LZLA 1SXJB 2VNIA 2ZSKA 1P0IA 2AR9A 2BT4A 1M8GA 2J8ZA 2QN9A 3HUFA 3ON5A 4KAXA 4Q7EA 4AUNA 4EELA 5JVDF 3CE6A 2G3YA 1M6VA 3SZMA 3V8MA 3V7WA 1FF9A 4LDRA 3O9VA 1SULA 4PSVA 4QD3A 4NF2A 2YV5A 4UVDA 1LBQA 4G9BA 1S8FA 5IC6A 3AVQA 5WRFA 1ZJZA 2ZEJA