2HEQA

Nmr structure of bacillus subtilis protein yorp, northeast structural genomics target sr399.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
84
structure length
84
Chain Sequence
MAGDPLPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YorP protein
publication title NMR Structure of Bacillus subtilis protein YorP, Northeast Structural Genomics Target SR399.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 12
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2heqA01
1GRIA 1KJWA 2DMOA 2RQTA 3EG2A 1GL5A 1ZUUA 4OMMA 2K3BA 4HVUA 4DEXA 2KT1A 1RUWA 1YCSB 2RN8A 4JZ4A 1X6BA 2J7IA 2ROTA 2C0IA 4CC3A 4D8KA 1JQQA 5IXBA 1BBZA 2JW4A 1WX6A 1H3HA 3ULRB 5I11A 2FEIA 3VS3A 2EGCA 1UUEA 2HBWA 4QT7A 2KRSA 2KXDA 2OAWA 3TSZA 2L3QA 1ZUKA 2EQIA 2RQRA 1BB9A 2DJQA 2FRYA 2J6FA 2YUQA 1VYTA 1NM7A 4RTZA 2DBKA 2LQNA 1SRMA 4JJDA 4LE9A 2KE9A 1M3AA 1UECA 1VYVA 2DLPA 3REBB 1HD3A 2EYYA 5GJWB 4JJCA 5GJVB 1K1ZA 4IIMA 2V1RA 4RUGA 3I35A 3LH5A 1YWOA 3QWXX 2KRNA 2KEAA 3UATA 2EKHA 2AZVA 1ABOA 4CC7A 1B07A 2FG0A 4Z89A 2LNHB 3PE0A 4GBQA 3VS7A 3EG3A 1UFFA 1ZSGA 1FMKA 2C0TA 2DYBA 5L23A 1AOJA 1MUZA 2GTOA 2J6KA 4HVWA 1WYXA 1PKTA 3O5ZA 1JU5C 2FPDA 1X2KA 1VA7A 1Z9ZA 4RTXA 4Z8AA 3VS1A 2MCNA 2JMAA 2KYBA 1J3TA 1AEYA 2O88A 1K0SA 4JJBA 2EPDA 2EYWA 2RPNA 4KRTA 4J9BA 1NLOC 1AWXA 4M4ZA 2SEMA 2NUZA 2AK5A 2CDTA 4GLMA 2L0AA 2EGAA 1OEBA 2JM9A 1V1CA 2MIOA 2LJ3A 2JS2A 1U3OA 2DM1A 2EVRA 1IO6A 2KR3A 2KYMA 3UA7A 1UHFA 1M3BA 2VVKA 1UDLA 2FPEA 2X3XD 2GQIA 1TUDA 2RQWA 3H41A 3M0SA 2F2VA 5FW9A 4RTVA 2EW3A 2HCKA 2H8HA 1I07A 1CSKA 3EGUA 1WIEA 4OMOA 1MV3A 2HDAA 4R0KA 2YSQA 3VRYA 2J05A 2K2MA 4F17A 4WCIA 2K9GA 2DRKA 3QWYA 2KROA 3NGPA 1WXTA 1QCFA 4AFZC 1G2BA 1AD5A 3VS6A 2RQUA 4FSSA 1CKAA 3ZL7C 4J9GA 2JMCA 3THKA 2QDLA 2MOXA 4J9CA 3RBBB 4LUDA 1ZBJA 1U5SA 5FWCA 2XMFA 2W0ZA 3H0IA 1K0XA 1OPLA 1NG2A 3CQTA 4OMLA 2HEQA 1PWTA 2D8JA 1NEBA 4F16A 1OV3A 3R6NA 1UHCA 3M0QA 4AFUC 2LZ6B 4F14A 1YN8A 2DNUA 2ED1A 4E6RA 2BTTA 1PKSA 1SSHA 4OMQA 4ESRA 2J06A 1T0JA 2LX7A 3TSWA 1WDXA 1QKXA 3TVTA 2BZ8A 1T3SA 1G83A 2DL7A 2YUNA 3KFVA 4LN2A 5HCKA 2RNAA 3M0RA 2K6DA 2DL5A 3EG0A 1QKWA 3C0CA 2CH4A 3IQLA 1UGVA 5IXFA 1MV0B 2LQWA 2KRMA 1FYNA 1WFWA 1SRLA 2CUBA 2CH4W 1X6GA 2AZSA 2BZXA 2CSQA 1H92A 2GNCA 1Y0MA 4HXJA 1BU1A 2PZ1A 3NHNA 1TG0A 3VS5A 2LJ0A 2LP5A 2A28A 1NYGA 2X3WD 2DBMA 1M3CA 1QWEA 2DX1A 5I22A 1WXUA 1PHTA 2DRMA 1E6GA 2ROLA 2CT4A 1JXOA 2M51A 2G6FX 2NWMA 5FWBA 5IHIA 3I9QA 1EFNA 3REAB 1M27C 1X2QA 2DL8A 2GBQA 1YWPA 1CKBA 1K9AA 2O9VA 2YT6A 2KNBB 1GCQA 2RMOA 2HSPA 4AFQC 2I0NA 1A0NB 1AVZC 2M0YA 4IIOA 1PRLC 2PTKA 2OI3A 2K79A 4EIKA 1W70A 1JXMA 1AWOA 1U06A 3EG1A 2B86A 2DL4A 2EYXA 1M8MA 2LJ1A 1TUCA 2DL3A 1WA7A 2AKLA 2O31A 2J6OA 4OMNA 1T3LA 2P4RA 5IH2A 1XOVA 2JT4A 2C0OA 2CUDA 3M0TA 1JEGA 4LNPA 3EHQA 4RTUA 2RF0A 3UF4A 3NMZC 2AKKA 5IHKA 1RI9A 2EGEA 1RLPC 4J9FA 1AZGB 1KSWA 2GGRA 3A98A 2KBTA 4JZ3A 2ENMA 1GFCA 2CREA 1PRMC 4A63B 2K7AA 1X43A 2D8HA 2FPFA 2D1XA 2GTJA 2DF6A 2DE0X 1T0HA 2CSIA 2FO0A 2O9SA 1GBQA 2YUPA 1VYUA 2ED0A 4RTWA 1H8KA 1AZEA 4Y92A 1QWFA 3UA6A 3VRZA 2EYZA 2FRWA 1WLPB 1NYFA 4OMPA 3VS4A 3PVQA 3I5SA 2CT3A 2JTEA 2L3SA 4AG2C 3M0UA 4LUEA 1K4US 3EHRA 1ARKA 1UE9A 2KXCA 5IHNA 2D0NA 1LCKA 2VKNA 1KIKA 1E7OA 3U23A 4AFSC 1NLPC 1W1FA 1SHFA 2DVJA 2L3PA 1N5ZA 4RTYA 5ECAA 1PNJA 1GCQC 1QLYA 1UTIA 3PVLA 2JM8A 2W10A 4CC2A 1BK2A 3NPFA 1ZUYA 4RTTA 4DEYA 2KGTA 3RNJA 2L2PA 4JPBW 1NEGA 1YP5A 4HCKA 1ABQA 2KT8A 1GCPA 2A36A 2RQVA 1X27A 3H0HA 2ESWA 2PNIA 4HVVA 4K11A 3M0PA 4ORZA 1I1JA 1UJ0A 4ZNXA 2JXBA 1S1NA 3FJ5A 1YNZA 1E6HA 1AWWA 4D8DA 2F2WA 1HSQA 1SPKA 2YDLA 2EBPA 1UG1A 1UJYA 3VS0A 2IIMA 4J9DA 3VS2A 1SEMA 3H0FA 3SEMA 1GBRA 1OOTA 2ECZA 1B3QA 1JO8A 1AWJA 1K76A 4CC4B 2F2XA 3I5RA 3GBQA 1HJDA 2DILA 1GFDA 3JV3A 2LCSA 4J9IA 1W6XA 1ZX6A 2JS0A 2SRCA 4J9EA 2O2OA 2YUOA 2DA9A 1KFZA 1X69A 2E5KA 2A08A 1SHGA 1Y57A 4Z88A 4AG1C 1I0CA 2A37A 1WXBA 1Z9QA 2VWFA 2OJ2A 5EC7A 1ZLMA 2LMJA 4X1VA 1OPKA 1M30A 2ABLA 1RLQC 2BZYA 3SHWA 1WI7A 2V1QA 4J9HA
chains in the Genus database with same CATH superfamily
2DXBA 2DMOA 1D1CA 4XTUA 5D6YA 4DEXA 4ELZC 5CKFA 3V7RA 1VQLA 3OSVA 4PJJA 4JZ4A 1X6BA 3MHXA 4XQ3A 1OZ2A 2QEXA 1VQ7Q 1QW1A 2NUTA 5L8RE 1H3HA 2QDYB 5LJ3g 8AT1B 2EGCA 2L89A 3QG1A 3VU3C 2HBWA 4QT7A 3TQ7P 2KRSA 1XNIA 4BUGA 3EGDB 2HQHA 3CCVT 2L3QA 1MMNA 2FRYA 2J6FA 5GAOr 2P4TA 4ANJA 4J7FA 3OW2S 4BI8B 1IREB 4LE9A 1SRMA 2K3YA 3LLRA 4RCBA 1UECA 1VYVA 1Q81R 2DLPA 3NTKA 5GJWB 2LCLA 2PUOB 3BW1A 5GJVB 3PIPA 4IIMA 2V1RA 5A0LA 1AHJB 2DETA 3LH5A 1YWOA 3QWXX 4E7SA 3BDLA 4CC7A 1QP2A 2Y4XA 3PE0A 2XU8A 1PSFA 2C0TA 1YJNT 2COWA 5L23A 2GTOA 2E5QA 2JVVA 1PKTA 4PL6A 3UDCA 2COZA 1Z9ZA 3QDRB 3INZA 4QVZA 4F7UG 2IVWA 3TCJA 2GF7A 2WSEE 5J26A 2EPDA 2EYWA 3G71T 4KRTA 2NUZA 3QSUA 1WQWA 2CDTA 3LGLA 3X28B 4OGCA 1I5LA 4LDVA 4KULA 5CQYA 5LJ3j 2P0QA 1VQ9Q 3CCLA 2MIOA 2M1HA 2ZPFB 4FYWB 2K4YA 3OBYA 1C0MA 3JSCA 2X51A 2EVRA 5CQXA 3UA7A 4VUBA 1IB8A 3FEOA 2DKGA 1Q7YC 3WVDB 4MZPA 3M0SA 1VQPA 3MEVA 4QQDA 2YLCA 2G3RA 1I81A 3CCRT 1YCYA 1I07A 1Q82R 4PLIA 4A4HA 1C1AA 3OB9A 3VRYA 3CMEA 2K9GA 4FL6A 2DO3A 2DRKA 1KC8C 1MMDA 4M78E 2KAFA 2RHXA 4AFZC 1QCFA 3CC2A 4M77B 1AD5A 3VS6A 2RQUA 1CKAA 4MDWA 4J9GA 4E7ZA 1M1FA 3E9GA 3OYJA 4A4KA 5FWCA 3CCMQ 1BI1A 1K0XA 4ZGJB 5KH6A 5GMKj 1KD1U 4V2SA 2HQXA 2HEQA 1PWTA 3JCMV 6AT1B 2D8JA 1D1AA 1NEBA 1K73R 1KQ2A 1D0XA 3R6NA 4GLKA 3FIFA 4FCYA 1YN8A 1VQ8T 2DNUA 3OQ5A 4M78A 3QBYA 1BIAA 2J06A 2LX7A 4P5NA 3TSWA 3LYIA 4A4EA 3SDZA 5CKDA 4M7AG 3CCQA 1N27A 1TSFA 4IURA 5FU6C 1YHQA 3PNWC 3KFVA 1KHCA 2XHCA 3M0RA 2K6DA 3C0CA 2CH4A 3OYEA 1RAGB 1UGVA 5IXFA 3CXCA 1MV0B 2LQWA 2KRMA 1FYNA 1WFWA 3KXTA 2RJCA 3CPWA 1YJWQ 1SF9A 2QXFA 2DD5A 2ZPEB 3A8GB 4M75C 4M7DB 2CSQA 3PTAA 4E7IA 1KQSP 1H92A 3V8JA 1FXXA 1Y0MA 1R8OB 2E70A 2HSEB 1Y96B 4M78D 3JCMQ 2A28A 2NLUA 1NYGA 3RKWA 2DBMA 1VQ6T 5D6WA 1M3CA 1QWEA 2DX1A 4A53A 5GANd 1K8AR 4FM4B 2FHDA 1E6GA 3GOXA 2ROLA 4AT1B 2OTLQ 3A8HB 3JAME 1P92A 4F7UE 2MMPA 5LJ5g 1VIEA 2E6ZA 5M9OA 2RJFA 4HT8A 4BY6B 1YWPA 5KYYB 2JN0A 3X25B 2RMOA 5CKHA 1ZQ1A 2HSPA 3EFOB 2EYQA 3TU4K 3RUXA 2I0NA 1A0NB 1AVZC 4IIOA 1OX8A 1PRLC 2K79A 4C8QC 1U06A 2DL4A 5GAN8 1M8MA 2LJ1A 2A7YA 1VQOA 2FZCB 2IPOB 2DL3A 2R5MA 4FIBA 1T3LA 3LW5E 2ATCB 4J6XA 3UWNA 2JT4A 2C0OA 1JEGA 3M0TA 1M5Q1 2YRDA 4F7UA 1K9MC 4XAXB 4N4GA 2CP5A 3EGXA 4PJNA 5IHKA 1QVGA 1RLPC 1LVKA 2EQMA 1D1BA 3CXCS 2CP0A 4JZ3A 5DY9A 3CPWS 2ENMA 4M77F 1KQSS 1D3BB 2D8HA 3M59A 2GTJA 2H3EB 2DF6A 2DE0X 4XTVA 1JJ2A 2CSIA 1WZOA 5I2SA 3CCUT 1H8KA 2VASA 2E4HA 4Y92A 2K5LA 3FLGA 1NYFA 3EAEA 3JCMd 3PVQA 2JTEA 1M90U 1ACMB 4M7AF 3MP6A 4AG2C 1WHGA 3M0UA 4LUEA 1NJIU 4DBRA 3EHRA 3GP8A 3OYNA 3DB3A 1RAHB 1UE9A 3MEWA 3SD4A 1H641 5GAMh 1PSEA 3L2UA 4A4FA 3CCSQ 2LT1A 2Y4YA 2LQ8A 4M7AE 3UPUA 1IHVA 4DOVA 1WJRA 2VGMA 4ZN3A 3OY9A 2DZCA 3HRTA 1GCQC 2DVEA 1QLYA 3PVLA 4M7DF 2W10A 3CMAQ 1VQ4A 1NPPA 4MMKA 1JRIA 3VYHB 2ZPGB 1YJNQ 2KK4A 2LQKA 3VUBA 1YITQ 1BI3A 2V8KA 4PK4A 1QVGS 3C4SA 3OMCA 3RR6A 4PLLA 4M7AA 1E6HA 2QGGA 2RHYA 2HD0A 1PG5B 3GPLA 2NUTB 1UJYA 2O01E 3VS2A 3H0FA 2JJ9A 5I2MA 1JJ2S 2F2XA 2DILA 1GFDA 3JV3A 1QP3A 5AYFA 4J9IA 2WSFE 3HPWA 2X9HA 1VQNQ 4FSXA 4BI4A 3MEUA 2MF2A 4MMLA 1XQHA 2E10A 2E5KA 1Y57A 1FWZA 4C8QE 1I0CA 2MAMA 2A37A 2VB6A 5FU7C 4R55A 1M1KU 2OTJQ 3M4GA 3G7ZA 1Y96A 4AMCA 1ZBXA 4OGEA 2LMJA 3I56T 1OPKA 1W4SA 2OX7A 2V8IA 3HKSA 1RLQC 2KSSA 1UGQB 2PUKB 2KDSA 1WI7A 2V1QA 2K57A 2CKKA 5D7UA 2KY9A 1GL5A 2K3BA 4HVUA 4C92C 3OYLA 1YI2T 2RO0A 2KT1A 1RUWA 1QVFP 1VQ9A 2X4JA 2RN8A 1PD0A 1B7TA 1RAEB 2XD0A 2ROTA 2C0IA 2RB6A 4D8KA 2VXFA 5IXBA 1S72Q 3R6OA 1PCXA 2A3LA 2HL5C 3JB9I 1YJ9T 1M4ZA 2YXYA 1W2BA 4QVCA 2FEIA 3KBGA 4C0GA 3OBWA 2COYA 2F5KA 5GAMd 3PGGA 4DBFA 1ZUKA 2EQIA 2RQRA 2BE7D 2YRVA 4PJOF 4DOWA 2XDBA 5GMKm 1VYTA 2XI9A 2PU9B 4RTZA 2DBKA 2LQNA 3OA6A 1OU9A 3SB2A 2C06A 3REBB 1HD3A 3CC4Q 3C94A 4JJCA 3OYKA 2FVUA 3J7AF 2B8AA 3JB9G 3G4ST 4KH1B 4C8QD 2VGNA 4B9WA 3S3OA 3META 3V8LA 3JRZA 4B9XA 3UATA 3CCMA 4EPCA 3GIBA 1VQMA 3I55T 2GCXA 1BCMA 3EFSA 1UGPB 2J6KA 1WYXA 2FPDA 4X9CA 1VQ6Q 2DPPB 2RJDA 2JMAA 1AEYA 2O88A 5CVIA 4PJOA 1AWXA 1NLOC 2SEMA 3QUIA 2RA2A 1RAFB 3A8MB 1G3WA 1QCNA 2DXCA 2RK1A 2EGAA 4JRQA 1N8RR 2JM9A 2RK2A 3HP9A 3FC3A 4UC4A 3QYHB 1VQLT 3TEEA 3NFCA 1YJWA 2LJ3A 3HFNA 2QEXT 3T9NA 1ZSZA 4OF1A 4M78B 1WJSA 1BIBA 2ZZDA 3WVEB 4KGVB 1RI0A 1G3TA 2LT4A 2K5IA 1TXQA 1TUDA 3JCMP 5FW9A 4RTVA 2EW3A 1XTDA 5DLOA 3FB9A 2MPXC 4OMOA 1MV3A 3OMGA 2QI2A 2YSQA 2J05A 2JOYA 2K2MA 2OTLA 5LJ5f 4XK8E 3NGPA 2JUFA 2E6NA 1G2BA 4FT4A 5HKCA 4XU0A 1I8FA 2MI6A 3THKA 4LUDA 5KYNA 4OB3B 4C92E 5GAN4 1OPLA 1NG2A 5GANe 4OMLA 3MJXA 4N0AC 3CBPA 3GLXA 5HK0A 3CCUQ 3M0QA 1WGSA 1Q81C 4OVAA 1WDXA 3ME9A 5CIUA 3TVTA 2YHTA 4XTZA 1IXDA 2F69A 2DL7A 3SWNC 2DL5A 3EG0A 1UGSB 2EJFA 5KE3A 1VQ5Q 3CCLT 3A8LB 2CH4W 4PJLA 4QQ6A 4HA8A 2BZXA 3CPFA 4BE2A 3CCJQ 2CZ7B 4F7UB 4HXJA 3EGXB 2R58A 2X3WD 1VQPT 3PMTA 3OSSC 5I22A 3G6EQ 4E7HA 1WXUA 2M0OA 1PHTA 2K5FA 2GFAA 5I21A 1JXOA 1MMAA 5GANh 4PJMA 3CMET 2XDPA 4C92D 5FWBA 4IUPA 1EFNA 3CC2T 3QIIA 1M27C 3CCSA 2GBQA 4PKCC 1CKBA 3HRSA 2O9VA 2YT6A 2FYKA 1WHKA 3RIRA 3MKDA 3ASKA 2HNIA 3M54A 2PTKA 2HBPA 4EMKC 1W70A 2CZ6B 4IKFA 3JCMe 3CMAA 4M78F 3EG1A 1V76A 1KD1R 1Q82C 1EIFA 1TUCA 4ZGEB 2VC8A 4KUIA 2J6OA 3V8KA 5IH2A 2RI3A 1SG5A 1IZ6A 3LWHA 3QJYA 4RG2A 1G3SA 3CCQT 2AKKA 3JB9D 4FW1A 1YHQT 3CD6Q 2GGRA 3A98A 2KBTA 5A2QE 3PMIA 4YTLA 2PVGB 3J80E 2RHZA 2D1XA 1K73C 1GBQA 2YUPA 1VQNA 1YIJA 4M7AB 1VYUA 1G3YA 4LXCA 2L5QA 1WLPB 4OMPA 2LDMA 1NPRA 2CP2A 3I5SA 2OTJA 1VQKQ 2CT3A 3MPUB 4FU6A 2P0KA 4Z02A 4L6V5 4J5YA 2QTVA 3JCMh 2QYZA 1PD1A 2DTHA 4AFSC 2M02A 3PT9A 4M75G 1KC8U 4ZN1A 1KQSA 2NYSA 3E9FA 2DJZA 2IG0A 2LVMA 4C5IA 5ECAA 3L2ZA 2BIVA 2HKQB 3SFMA 3G4SQ 1UTIA 4XU1A 3WXMB 4WF2A 4CC2A 1S72A 1K8AC 2CS7A 4PFOA 3A5ZB 4F7UF 2RHIA 4RTTA 4DEYA 3RKYA 2LX9A 5A0GA 1VQOT 4C5GA 3C12A 3ER0A 2KT8A 4R56A 1M8VA 1XJWB 5C6SA 2ESWA 2PNIA 4LD6A 5KYXA 1UB4A 3N5BB 3QXEB 4K11A 3RMQA 4M7DC 2RD1A 4ORZA 2XDDA 3GNGA 1S1NA 3M58A 1HSQA 2DIGA 2EJ9A 1UG1A 3SWNA 2QA4Q 4J9DA 3CC4A 4OP0A 1OOTA 1B3QA 1AWJA 1K76A 4C8QG 4CC4B 1QQJA 1VQLQ 1W6XA 3CC7Q 1M2VA 5FROA 4PFPA 4J9EA 2O2OA 3X24B 5GAMe 2YUOA 4ZTFA 2JZ2A 2EWNA 3QDFA 5AT1B 2HQEA 2XKOC 1WNLA 3MP8A 4BY6C 2A08A 1KG1A 4AG1C 1YFNA 1BKBA 3G1JA 1BI2A 5IN1A 2E3HA 3L2VA 1NJIC 3CCEQ 1M90R 3FDRA 5GAMj 1ZLMA 1MHNA 1NJIR 4X1VA 1QVPA 4KGXB 1M30A 1BYMA 1KJWA 3EG2A 5GMKi 2D6FA 1ZUUA 4OMMA 4ELYC 1YCSB 2M9UA 3EG9A 4EMHA 2A0FB 4CC3A 3AT1B 2EIFA 4FYVB 4QQGA 1BBZA 5KCHA 5EG2A 3M57A 2JW4A 1WX6A 4EMKA 1VQ4T 4HKEA 2QTXA 1TOVA 5C0MA 4PJOB 3VS3A 1UUEA 4BDZA 2EQUA 3EH1A 2ZAEA 3OYBA 1ZA1B 3CCVQ 2OAWA 3TSZA 5DLQE 2YUQA 1BB9A 2KI7A 2XICA 4RCCA 3M4YA 1EX4A 4A4GA 2YLBA 3E2UA 1ZSZB 1M3AA 4E47A 4GY5A 4QKUA 3QO3A 1I5OB 1VQ7A 4MDXA 4DQ2A 2KEAA 1LJOA 5LJ3f 1ABOA 4M75E 2FG0A 4Z89A 2LNHB 4Q5WA 2E12A 3KUFA 5CKEA 2VUBA 1UFFA 4ATOA 2DYBA 4HVWA 3CBOA 3O5ZA 1V29B 1M1GA 1X2KA 1VA7A 3VS1A 4A54A 1HK9A 1M1KR 3QZ5B 2KYBA 1K0SA 3G71Q 3HTRA 2RPNA 4J9BA 3TREA 5LJ5h 2AK5A 1X01A 2E65A 1VOMA 1OEBA 2E64A 4M75A 4C8QF 3H6ZA 5GAOp 1VQ9T 1VQ5A 4IUTA 1RABB 5FU7B 1N9SA 4KBMB 4X34A 3CCJA 2ZPBB 2X4YA 2CZ0B 2KR3A 2VVKA 2X4WA 1UDLA 5KE2A 2RQWA 2DEUA 3OS1A 3CCRQ 4KH0B 4LDYA 3G6EA 3RDVA 3BE3A 4BE0A 2BE9B 2I2LA 2HDAA 4R0KA 4F17A 4WCIA 3OYIA 3X26B 4M75D 3V7CA 2DYIA 2WSCE 4HCZA 4C92G 1SKUB 2CGHA 1QVFA 1WXTA 1U1TA 2QQ9A 3OYFA 5FRNA 3OYYA 2JMCA 1LNXA 1R0BG 2MOXA 3HL8A 1U8RA 4C8QA 3RBBB 1ZBJA 1U5SA 3LH0A 2XMFA 2W0ZA 2DXTA 3CCMT 3MEAA 1VQMT 4RKUE 3GNFB 1WPYA 4C0DB 2HKNA 2EAYA 1OV3A 1TTHB 1VQ8Q 4F14A 4E6RA 2BTTA 4F04B 1SSHA 4BE1A 4ESRA 3ZBDA 2DXUA 2MWOA 1QKXA 1D09B 4O5VA 3M55A 1T3SA 2DZ9A 1G83A 2RHUA 2YUNA 4LN2A 4KGZB 3CD6A 2RNAA 2QGFB 3QKJA 1SRLA 1MNDA 2CUBA 2QQRA 1X6GA 1YJWT 3MP1A 2AZSA 3J81E 2GNCA 1I4K1 1BU1A 1TUGB 3NHNA 2QASA 2FL7A 1HYOA 2LJ0A 2LP5A 5LJ5d 1IHWA 4HCCA 4HCBA 5GAN2 1Q86R 1VQKA 2DRMA 2DERA 1QMCA 1RACB 2CT4A 2RJEA 4KT0E 1N8RC 2DEQA 3VKIA 2OTLT 1QVFS 4L59A 4J8OA 3I9QA 4ME7A 4BDYA 2ZCFB 3REAB 3GF5A 2KMTA 5GANg 1G8XA 5GAN6 1Y7XA 3EFRA 3OW2P 2KNBB 1GCQA 4JRPA 4AFQC 2EQKA 2M0YA 4C5HA 2OI3A 5CK9A 2JTFA 4Y91A 4XTYA 3H9NA 4EIKA 1Q86U 1JXMA 1AWOA 1ZHIA 2CP6A 2B86A 2X4XA 1MGQA 2AHJB 3OYGA 2HZYA 1WA7A 4J6WA 4OMNA 3E1SA 3VUZA 5GMKl 1JBMA 1KQ1A 2CUDA 4LNPA 3EHQA 2X35A 2YWWA 4LDWA 1TS9A 4C92F 2V8JA 2EQJA 3L42A 3NMZC 4XU2A 5HK3A 1R0CB 1C6VX 1FMVA 4J9FA 1AZGB 1D0ZA 4EMGA 2QA4A 1GFCA 1ZA2B 4JRKA 5HY6A 3OS5A 1BI0A 2FZGB 2FPFA 1M9SA 4X9DA 1B34A 3VYGA 3CC7A 5KYXB 2FO0A 1Q95G 2P84A 1AZEA 1VQ4Q 1FX7A 3VRZA 2FRWA 3SWNB 2XIDA 5GANj 4XTXA 2L3SA 5CKBA 2NUPA 1K4US 1AT1B 3CCEA 1ARKA 3JB9F 5IHNA 2D0NA 1KIKA 1M2VB 3U23A 2O4XA 2OAUA 4C92A 3DLMA 4BI3A 3CCST 3OYCA 3JCMg 3PIOA 1N5ZA 3P8DA 3P8HA 4RG8A 1PNJA 4J83A 3BFMA 3H8ZA 2L8DA 1BK2A 1NZ9A 3CMAT 1IGUA 1MNEA 2FZKB 2KGTA 3RNJA 3S6WA 2H3JA 1M2OA 1NEGA 1YP5A 1TWBA 3CCVA 1GCPA 7AT1B 2RQVA 1F1BB 2QQAA 1YITT 3MCAB 1I1JA 5LJ3e 2JXBA 1VIFA 3EG9B 3FJ5A 3M56A 1Q81U 2HL3A 1PC0A 4D8DA 1SPKA 2YDLA 1Y71A 4EMKB 3VS0A 1OULA 4OB1B 2CZ1B 4PFZA 4FW2A 3SEMA 4MZTA 4LDXA 1GBRA 1JO8A 2ECZA 1KD1C 1QCOA 2JNGA 3I5RA 1HJDA 2LCSA 4B6MA 1HXDA 2DD4A 3CEYA 3OS0A 2WACA 3F70A 1VQNT 1YIJT 1LPLA 1YJNA 4JLIA 1X69A 4N4HA 3Q1JA 1YITA 1SHGA 4Z88A 3JCMc 1WXBA 2QAZA 2ZGWA 2OTJT 2VWFA 4OB0B 2P0PA 3ZEHA 2F1LA 4BD3A 1Q7YR 2OJ2A 4HT9A 3NTHA 3I56Q 2GQVA 3G71A 1JB0E 5IAYA 2ABLA 5KYWA 1FMWA 2BZYA 3JCMJ 1X75C 4FYYB 5GAOn 4J9HA 1GRIA 2RQTA 3JCMX 5FRMA 5GMKe 4JS4A 1YI2Q 1IGQA 1KC8R 1WHJA 2J7IA 1H3ZA 5LJ3h 1JQQA 2BKDN 4E2FB 3QPHA 4OB2B 4M77G 1S72T 4M77C 3V7SA 3JB9H 2HAXA 1YJ9Q 3A8OB 5FU6B 3ULRB 5I11A 2ZPIB 1Q7YU 1VQMQ 2KXDA 4FT2A 3CCRA 1Q82U 1VUBA 1RADB 5J3BA 1D0YA 2DJQA 1RAAB 2AT1B 2V26A 4M75B 2VV5A 1NM7A 4JJDA 2KE9A 1SSFA 4M7AC 5GAN5 5GAMg 2EYYA 3QJ6A 5FLXE 3CC4T 1K1ZA 5GAOq 3DLLA 4RUGA 4II1A 4Y28E 3I35A 2PQWA 2AIRB 1DJ7B 2KRNA 2EKHA 1G5VA 2AZVA 4N0AA 3CXCP 1B07A 5KYUA 2PVDB 2MK5A 3I55Q 3CPWP 4GBQA 3VS7A 3EG3A 1ZSGA 1FMKA 1K73U 1NBEB 1AOJA 1MUZA 5GMKh 1WQ7A 4JDSA 1JU5C 4M7DG 4Z8AA 4RTXA 1WJQA 1VQ8A 3EH2A 1LOJA 2MCNA 1J3TA 4JJBA 4C8QB 2K3XA 4M4ZA 3EGDA 3C95A 1WHHA 4GLMA 2DTIA 2L0AA 5KCOA 8ATCB 2RH2A 1V1CA 4BB7A 2QEXQ 2JS2A 2Z0WA 4ZGDB 3NTIA 3RERA 3L2QA 1U3OA 2DM1A 1IO6A 1GXIE 2KYMA 1X6OA 1UHFA 1M3BA 4PNOA 2M16A 2X3XD 2FPEA 4LDUA 2VYTA 1M90C 2GQIA 1K8AU 1VQ6A 2E41A 3H41A 3JB9J 4WTOB 2F2VA 1OU8A 3X20B 2HCKA 2H8HA 3ZFJA 1CSKA 3EGUA 2RM4A 1WIEA 3MO8A 2QQBA 3FJPA 3QWYA 2HMAA 5LJ3d 2FB7A 2KROA 4DA4A 4JJNK 5A0DA 2R5AA 1IRXA 5GANf 1K9MR 3QHSA 3DKMA 4FSSA 1QVGP 4E7KA 3ZL7C 2DK3A 3QYGB 2QDLA 1VQ7T 1PM3A 4J9CA 3LGFA 5LJ5e 3H0IA 4EDUA 2LTOA 2PVOB 3CQTA 3PFSA 3VJPA 2R57A 4F16A 1JJ2P 5GAN3 4M77E 4IUQA 1UHCA 4AFUC 2LZ6B 2ED1A 2LCCA 1PKSA 4L5GA 5LJ5j 2XK0A 4OMQA 4IUVA 1T0JA 1K9MU 4M75F 4DBQA 4NS5A 2BZ8A 4PJOG 1UGRB 5HCKA 4PJOC 1QKWA 2CP3A 4TVRA 1OI1A 4KUDK 1OZ3A 3IQLA 3CCLQ 4D6WA 1O9SA 3RKXA 1VQ5T 2LC4A 3O8VA 2DAQA 3A1PA 1MMGA 3S3MA 3CCJT 5GAN7 1OQKA 2PZ1A 2MWPA 4M77A 3URGA 1TG0A 3VS5A 3CCUA 5J39A 1ZSZC 1M1KC 1OYXA 4LD9K 1VQPQ 3OYDA 3G6ET 1R77A 2RI5A 1RAIB 3CMEQ 2M51A 4M7DE 2G6FX 1B34B 2NWMA 2JTMA 5IHIA 3CC2Q 1KHIA 2CYZB 4QVDA 3JCMf 3UT1A 1X2QA 2DL8A 1RL2A 1K9AA 4M77D 1KK7A 2EFIA 5CR2A 1Y07A 2NUPB 2E1HA 4XU3A 2Y90A 2E3IA 2LNVA 2EYXA 3JCMW 2AKLA 2O31A 1YIJQ 2O4XB 2P4RA 4C92B 4NL2A 4JRIA 1XOVA 4C0ZA 4M7DA 2EJGA 4CRIA 1U1SA 4CI0C 4RTUA 4M7AD 3M5AA 2DFUA 2RF0A 3UF4A 3CCQQ 3HFOA 1RI9A 4E7LA 2EGEA 1YHQQ 1KSWA 3CD6T 4J7IA 2D9TA 2QQSA 2CREA 3D7SB 2KVQG 1PRMC 4A63B 2YRCA 5GAOm 2K7AA 3L2WA 1X43A 3OYMA 4C0FA 1EZZB 4DBHA 1T0HA 3HRUA 2O9SA 4M7DD 1N9RA 3HHTB 5KYYA 4O6JA 3L2RA 2ED0A 4RTWA 3S3NA 3QZ9B 2DIQA 2GFUA 1QWFA 3UA6A 4BACA 2D0QB 2EYZA 3EFOA 3LX7A 4NOYA 3RESA 3VS4A 1OX9A 1W2BP 1VQKT 4E7JA 3M53A 3OYHA 4J6YA 3I56A 3P8BB 2KXCA 3FRNA 1LCKA 2VKNA 4IUUA 1E7OA 3JCMb 1O75A 4C0DC 1NLPC 1BCOA 2ZPHB 4FYXB 1W1FA 3L1AA 4NL3A 2CP7A 2XG8D 1SHFA 2DVJA 1YI2A 3BY7A 3RMSA 2L3PA 5CO7A 4PJOE 4RTYA 2DTOA 2JM8A 1Q86C 3LWIA 3M9QA 4JUVA 2MYSA 3NPFA 5CAIA 1YJ9A 1ZUYA 1VQOQ 3E19A 1TU0B 2L2PA 1YBYA 4JPBW 5D6XA 2K2VA 5KYWB 1D3BA 4HCKA 1ABQA 3BDUA 2A36A 4JS5A 1X27A 3H0HA 2LRQA 1TH7A 2L3RA 4HVVA 4OMFB 2BUDA 1UEBA 1WHLA 3M0PA 2F5TX 1UJ0A 4JLGA 4ZNXA 5LL6S 1YNZA 1AWWA 3OYAA 2F2WA 4ZTJA 2QK0A 3OW2A 2EBPA 5GAMf 2QA4T 2IIMA 1SEMA 4XTWA 3G4SA 2EKOA 2KQWA 3HSBA 4QW2A 5GAOl 5CCAA 3GBQA 2VXEA 1ZX6A 2JS0A 2SRCA 3DB4A 9ATCB 5DM7R 3CC7T 3CBMA 3I55A 2DA9A 2RI2A 1W2BS 1KFZA 5IT9E 1NE8A 3AHUA 3VV0A 1Z9QA 4M78G 4M78C 4RMOA 4PJOD 5EC7A 1N6AA 3CCET 1WHMA 2QG9B 4C5EA 3SHWA 4N4IA 5KYUB 3OS2A 4MZMA 1N8RU
chains in the Genus database with same CATH topology
1GRIA 1KJWA 2DMOA 2RQTA 3EG2A 1GL5A 1ZUUA 4OMMA 2K3BA 4HVUA 4DEXA 2KT1A 1RUWA 1YCSB 2RN8A 4JZ4A 1X6BA 2J7IA 2ROTA 2C0IA 4CC3A 4D8KA 1JQQA 5IXBA 1BBZA 2JW4A 1WX6A 1H3HA 3ULRB 5I11A 2FEIA 3VS3A 2EGCA 1UUEA 2HBWA 4QT7A 2KRSA 2KXDA 2OAWA 3TSZA 2L3QA 1ZUKA 2EQIA 2RQRA 1BB9A 2DJQA 2FRYA 2J6FA 2YUQA 1VYTA 1NM7A 4RTZA 2DBKA 2LQNA 1SRMA 4JJDA 4LE9A 2KE9A 1M3AA 1UECA 1VYVA 2DLPA 3REBB 1HD3A 2EYYA 5GJWB 4JJCA 5GJVB 1K1ZA 4IIMA 2V1RA 4RUGA 3I35A 3LH5A 1YWOA 3QWXX 2KRNA 2KEAA 3UATA 2EKHA 2AZVA 1ABOA 4CC7A 1B07A 2FG0A 4Z89A 2LNHB 3PE0A 4GBQA 3VS7A 3EG3A 1UFFA 1ZSGA 1FMKA 2C0TA 2DYBA 5L23A 1AOJA 1MUZA 2GTOA 2J6KA 4HVWA 1WYXA 1PKTA 3O5ZA 1JU5C 2FPDA 1X2KA 1VA7A 1Z9ZA 4RTXA 4Z8AA 3VS1A 2MCNA 2JMAA 2KYBA 1J3TA 1AEYA 2O88A 1K0SA 4JJBA 2EPDA 2EYWA 2RPNA 4KRTA 4J9BA 1NLOC 1AWXA 4M4ZA 2SEMA 2NUZA 2AK5A 2CDTA 4GLMA 2L0AA 2EGAA 1OEBA 2JM9A 1V1CA 2MIOA 2LJ3A 2JS2A 1U3OA 2DM1A 2EVRA 1IO6A 2KR3A 2KYMA 3UA7A 1UHFA 1M3BA 2VVKA 1UDLA 2FPEA 2X3XD 2GQIA 1TUDA 2RQWA 3H41A 3M0SA 2F2VA 5FW9A 4RTVA 2EW3A 2HCKA 2H8HA 1I07A 1CSKA 3EGUA 1WIEA 4OMOA 1MV3A 2HDAA 4R0KA 2YSQA 3VRYA 2J05A 2K2MA 4F17A 4WCIA 2K9GA 2DRKA 3QWYA 2KROA 3NGPA 1WXTA 1QCFA 4AFZC 1G2BA 1AD5A 3VS6A 2RQUA 4FSSA 1CKAA 3ZL7C 4J9GA 2JMCA 3THKA 2QDLA 2MOXA 4J9CA 3RBBB 4LUDA 1ZBJA 1U5SA 5FWCA 2XMFA 2W0ZA 3H0IA 1K0XA 1OPLA 1NG2A 3CQTA 4OMLA 2HEQA 1PWTA 2D8JA 1NEBA 4F16A 1OV3A 3R6NA 1UHCA 3M0QA 4AFUC 2LZ6B 4F14A 1YN8A 2DNUA 2ED1A 4E6RA 2BTTA 1PKSA 1SSHA 4OMQA 4ESRA 2J06A 1T0JA 2LX7A 3TSWA 1WDXA 1QKXA 3TVTA 2BZ8A 1T3SA 1G83A 2DL7A 2YUNA 3KFVA 4LN2A 5HCKA 2RNAA 3M0RA 2K6DA 2DL5A 3EG0A 1QKWA 3C0CA 2CH4A 3IQLA 1UGVA 5IXFA 1MV0B 2LQWA 2KRMA 1FYNA 1WFWA 1SRLA 2CUBA 2CH4W 1X6GA 2AZSA 2BZXA 2CSQA 1H92A 2GNCA 1Y0MA 4HXJA 1BU1A 2PZ1A 3NHNA 1TG0A 3VS5A 2LJ0A 2LP5A 2A28A 1NYGA 2X3WD 2DBMA 1M3CA 1QWEA 2DX1A 5I22A 1WXUA 1PHTA 2DRMA 1E6GA 2ROLA 2CT4A 1JXOA 2M51A 2G6FX 2NWMA 5FWBA 5IHIA 3I9QA 1EFNA 3REAB 1M27C 1X2QA 2DL8A 2GBQA 1YWPA 1CKBA 1K9AA 2O9VA 2YT6A 2KNBB 1GCQA 2RMOA 2HSPA 4AFQC 2I0NA 1A0NB 1AVZC 2M0YA 4IIOA 1PRLC 2PTKA 2OI3A 2K79A 4EIKA 1W70A 1JXMA 1AWOA 1U06A 3EG1A 2B86A 2DL4A 2EYXA 1M8MA 2LJ1A 1TUCA 2DL3A 1WA7A 2AKLA 2O31A 2J6OA 4OMNA 1T3LA 2P4RA 5IH2A 1XOVA 2JT4A 2C0OA 2CUDA 3M0TA 1JEGA 4LNPA 3EHQA 4RTUA 2RF0A 3UF4A 3NMZC 2AKKA 5IHKA 1RI9A 2EGEA 1RLPC 4J9FA 1AZGB 1KSWA 2GGRA 3A98A 2KBTA 4JZ3A 2ENMA 1GFCA 2CREA 1PRMC 4A63B 2K7AA 1X43A 2D8HA 2FPFA 2D1XA 2GTJA 2DF6A 2DE0X 1T0HA 2CSIA 2FO0A 2O9SA 1GBQA 2YUPA 1VYUA 2ED0A 4RTWA 1H8KA 1AZEA 4Y92A 1QWFA 3UA6A 3VRZA 2EYZA 2FRWA 1WLPB 1NYFA 4OMPA 3VS4A 3PVQA 3I5SA 2CT3A 2JTEA 2L3SA 4AG2C 3M0UA 4LUEA 1K4US 3EHRA 1ARKA 1UE9A 2KXCA 5IHNA 2D0NA 1LCKA 2VKNA 1KIKA 1E7OA 3U23A 4AFSC 1NLPC 1W1FA 1SHFA 2DVJA 2L3PA 1N5ZA 4RTYA 5ECAA 1PNJA 1GCQC 1QLYA 1UTIA 3PVLA 2JM8A 2W10A 4CC2A 1BK2A 3NPFA 1ZUYA 4RTTA 4DEYA 2KGTA 3RNJA 2L2PA 4JPBW 1NEGA 1YP5A 4HCKA 1ABQA 2KT8A 1GCPA 2A36A 2RQVA 1X27A 3H0HA 2ESWA 2PNIA 4HVVA 4K11A 3M0PA 4ORZA 1I1JA 1UJ0A 4ZNXA 2JXBA 1S1NA 3FJ5A 1YNZA 1E6HA 1AWWA 4D8DA 2F2WA 1HSQA 1SPKA 2YDLA 2EBPA 1UG1A 1UJYA 3VS0A 2IIMA 4J9DA 3VS2A 1SEMA 3H0FA 3SEMA 1GBRA 1OOTA 2ECZA 1B3QA 1JO8A 1AWJA 1K76A 4CC4B 2F2XA 3I5RA 3GBQA 1HJDA 2DILA 1GFDA 3JV3A 2LCSA 4J9IA 1W6XA 1ZX6A 2JS0A 2SRCA 4J9EA 2O2OA 2YUOA 2DA9A 1KFZA 1X69A 2E5KA 2A08A 1SHGA 1Y57A 4Z88A 4AG1C 1I0CA 2A37A 1WXBA 1Z9QA 2VWFA 2OJ2A 5EC7A 1ZLMA 2LMJA 4X1VA 1OPKA 1M30A 2ABLA 1RLQC 2BZYA 3SHWA 1WI7A 2V1QA 4J9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRI A;  1KJW A;  2DMO A;  2RQT A;  3EG2 A;  1GL5 A;  1ZUU A;  4OMM A;  2K3B A;  4HVU A;  4DEX A;  2KT1 A;  1RUW A;  1YCS B;  2RN8 A;  4JZ4 A;  1X6B A;  2J7I A;  2ROT A;  2C0I A;  4CC3 A;  4D8K A;  1JQQ A;  5IXB A;  1BBZ A;  2JW4 A;  1WX6 A;  1H3H A;  3ULR B;  5I11 A;  2FEI A;  3VS3 A;  2EGC A;  1UUE A;  2HBW A;  4QT7 A;  2KRS A;  2KXD A;  2OAW A;  3TSZ A;  2L3Q A;  1ZUK A;  2EQI A;  2RQR A;  1BB9 A;  2DJQ A;  2FRY A;  2J6F A;  2YUQ A;  1VYT A;  1NM7 A;  4RTZ A;  2DBK A;  2LQN A;  1SRM A;  4JJD A;  4LE9 A;  2KE9 A;  1M3A A;  1UEC A;  1VYV A;  2DLP A;  3REB B;  1HD3 A;  2EYY A;  5GJW B;  4JJC A;  5GJV B;  1K1Z A;  4IIM A;  2V1R A;  4RUG A;  3I35 A;  3LH5 A;  1YWO A;  3QWX X;  2KRN A;  2KEA A;  3UAT A;  2EKH A;  2AZV A;  1ABO A;  4CC7 A;  1B07 A;  2FG0 A;  4Z89 A;  2LNH B;  3PE0 A;  4GBQ A;  3VS7 A;  3EG3 A;  1UFF A;  1ZSG A;  1FMK A;  2C0T A;  2DYB A;  5L23 A;  1AOJ A;  1MUZ A;  2GTO A;  2J6K A;  4HVW A;  1WYX A;  1PKT A;  3O5Z A;  1JU5 C;  2FPD A;  1X2K A;  1VA7 A;  1Z9Z A;  4RTX A;  4Z8A A;  3VS1 A;  2MCN A;  2JMA A;  2KYB A;  1J3T A;  1AEY A;  2O88 A;  1K0S A;  4JJB A;  2EPD A;  2EYW A;  2RPN A;  4KRT A;  4J9B A;  1NLO C;  1AWX A;  4M4Z A;  2SEM A;  2NUZ A;  2AK5 A;  2CDT A;  4GLM A;  2L0A A;  2EGA A;  1OEB A;  2JM9 A;  1V1C A;  2MIO A;  2LJ3 A;  2JS2 A;  1U3O A;  2DM1 A;  2EVR A;  1IO6 A;  2KR3 A;  2KYM A;  3UA7 A;  1UHF A;  1M3B A;  2VVK A;  1UDL A;  2FPE A;  2X3X D;  2GQI A;  1TUD A;  2RQW A;  3H41 A;  3M0S A;  2F2V A;  5FW9 A;  4RTV A;  2EW3 A;  2HCK A;  2H8H A;  1I07 A;  1CSK A;  3EGU A;  1WIE A;  4OMO A;  1MV3 A;  2HDA A;  4R0K A;  2YSQ A;  3VRY A;  2J05 A;  2K2M A;  4F17 A;  4WCI A;  2K9G A;  2DRK A;  3QWY A;  2KRO A;  3NGP A;  1WXT A;  1QCF A;  4AFZ C;  1G2B A;  1AD5 A;  3VS6 A;  2RQU A;  4FSS A;  1CKA A;  3ZL7 C;  4J9G A;  2JMC A;  3THK A;  2QDL A;  2MOX A;  4J9C A;  3RBB B;  4LUD A;  1ZBJ A;  1U5S A;  5FWC A;  2XMF A;  2W0Z A;  3H0I A;  1K0X A;  1OPL A;  1NG2 A;  3CQT A;  4OML A;  2HEQ A;  1PWT A;  2D8J A;  1NEB A;  4F16 A;  1OV3 A;  3R6N A;  1UHC A;  3M0Q A;  4AFU C;  2LZ6 B;  4F14 A;  1YN8 A;  2DNU A;  2ED1 A;  4E6R A;  2BTT A;  1PKS A;  1SSH A;  4OMQ A;  4ESR A;  2J06 A;  1T0J A;  2LX7 A;  3TSW A;  1WDX A;  1QKX A;  3TVT A;  2BZ8 A;  1T3S A;  1G83 A;  2DL7 A;  2YUN A;  3KFV A;  4LN2 A;  5HCK A;  2RNA A;  3M0R A;  2K6D A;  2DL5 A;  3EG0 A;  1QKW A;  3C0C A;  2CH4 A;  3IQL A;  1UGV A;  5IXF A;  1MV0 B;  2LQW A;  2KRM A;  1FYN A;  1WFW A;  1SRL A;  2CUB A;  2CH4 W;  1X6G A;  2AZS A;  2BZX A;  2CSQ A;  1H92 A;  2GNC A;  1Y0M A;  4HXJ A;  1BU1 A;  2PZ1 A;  3NHN A;  1TG0 A;  3VS5 A;  2LJ0 A;  2LP5 A;  2A28 A;  1NYG A;  2X3W D;  2DBM A;  1M3C A;  1QWE A;  2DX1 A;  5I22 A;  1WXU A;  1PHT A;  2DRM A;  1E6G A;  2ROL A;  2CT4 A;  1JXO A;  2M51 A;  2G6F X;  2NWM A;  5FWB A;  5IHI A;  3I9Q A;  1EFN A;  3REA B;  1M27 C;  1X2Q A;  2DL8 A;  2GBQ A;  1YWP A;  1CKB A;  1K9A A;  2O9V A;  2YT6 A;  2KNB B;  1GCQ A;  2RMO A;  2HSP A;  4AFQ C;  2I0N A;  1A0N B;  1AVZ C;  2M0Y A;  4IIO A;  1PRL C;  2PTK A;  2OI3 A;  2K79 A;  4EIK A;  1W70 A;  1JXM A;  1AWO A;  1U06 A;  3EG1 A;  2B86 A;  2DL4 A;  2EYX A;  1M8M A;  2LJ1 A;  1TUC A;  2DL3 A;  1WA7 A;  2AKL A;  2O31 A;  2J6O A;  4OMN A;  1T3L A;  2P4R A;  5IH2 A;  1XOV A;  2JT4 A;  2C0O A;  2CUD A;  3M0T A;  1JEG A;  4LNP A;  3EHQ A;  4RTU A;  2RF0 A;  3UF4 A;  3NMZ C;  2AKK A;  5IHK A;  1RI9 A;  2EGE A;  1RLP C;  4J9F A;  1AZG B;  1KSW A;  2GGR A;  3A98 A;  2KBT A;  4JZ3 A;  2ENM A;  1GFC A;  2CRE A;  1PRM C;  4A63 B;  2K7A A;  1X43 A;  2D8H A;  2FPF A;  2D1X A;  2GTJ A;  2DF6 A;  2DE0 X;  1T0H A;  2CSI A;  2FO0 A;  2O9S A;  1GBQ A;  2YUP A;  1VYU A;  2ED0 A;  4RTW A;  1H8K A;  1AZE A;  4Y92 A;  1QWF A;  3UA6 A;  3VRZ A;  2EYZ A;  2FRW A;  1WLP B;  1NYF A;  4OMP A;  3VS4 A;  3PVQ A;  3I5S A;  2CT3 A;  2JTE A;  2L3S A;  4AG2 C;  3M0U A;  4LUE A;  1K4U S;  3EHR A;  1ARK A;  1UE9 A;  2KXC A;  5IHN A;  2D0N A;  1LCK A;  2VKN A;  1KIK A;  1E7O A;  3U23 A;  4AFS C;  1NLP C;  1W1F A;  1SHF A;  2DVJ A;  2L3P A;  1N5Z A;  4RTY A;  5ECA A;  1PNJ A;  1GCQ C;  1QLY A;  1UTI A;  3PVL A;  2JM8 A;  2W10 A;  4CC2 A;  1BK2 A;  3NPF A;  1ZUY A;  4RTT A;  4DEY A;  2KGT A;  3RNJ A;  2L2P A;  4JPB W;  1NEG A;  1YP5 A;  4HCK A;  1ABQ A;  2KT8 A;  1GCP A;  2A36 A;  2RQV A;  1X27 A;  3H0H A;  2ESW A;  2PNI A;  4HVV A;  4K11 A;  3M0P A;  4ORZ A;  1I1J A;  1UJ0 A;  4ZNX A;  2JXB A;  1S1N A;  3FJ5 A;  1YNZ A;  1E6H A;  1AWW A;  4D8D A;  2F2W A;  1HSQ A;  1SPK A;  2YDL A;  2EBP A;  1UG1 A;  1UJY A;  3VS0 A;  2IIM A;  4J9D A;  3VS2 A;  1SEM A;  3H0F A;  3SEM A;  1GBR A;  1OOT A;  2ECZ A;  1B3Q A;  1JO8 A;  1AWJ A;  1K76 A;  4CC4 B;  2F2X A;  3I5R A;  3GBQ A;  1HJD A;  2DIL A;  1GFD A;  3JV3 A;  2LCS A;  4J9I A;  1W6X A;  1ZX6 A;  2JS0 A;  2SRC A;  4J9E A;  2O2O A;  2YUO A;  2DA9 A;  1KFZ A;  1X69 A;  2E5K A;  2A08 A;  1SHG A;  1Y57 A;  4Z88 A;  4AG1 C;  1I0C A;  2A37 A;  1WXB A;  1Z9Q A;  2VWF A;  2OJ2 A;  5EC7 A;  1ZLM A;  2LMJ A;  4X1V A;  1OPK A;  1M30 A;  2ABL A;  1RLQ C;  2BZY A;  3SHW A;  1WI7 A;  2V1Q A;  4J9H A; 
#chains in the Genus database with same CATH topology
 2DXB A;  2DMO A;  1D1C A;  4XTU A;  5D6Y A;  4DEX A;  4ELZ C;  5CKF A;  3V7R A;  1VQL A;  3OSV A;  4PJJ A;  4JZ4 A;  1X6B A;  3MHX A;  4XQ3 A;  1OZ2 A;  2QEX A;  1VQ7 Q;  1QW1 A;  2NUT A;  5L8R E;  1H3H A;  2QDY B;  5LJ3 g;  8AT1 B;  2EGC A;  2L89 A;  3QG1 A;  3VU3 C;  2HBW A;  4QT7 A;  3TQ7 P;  2KRS A;  1XNI A;  4BUG A;  3EGD B;  2HQH A;  3CCV T;  2L3Q A;  1MMN A;  2FRY A;  2J6F A;  5GAO r;  2P4T A;  4ANJ A;  4J7F A;  3OW2 S;  4BI8 B;  1IRE B;  4LE9 A;  1SRM A;  2K3Y A;  3LLR A;  4RCB A;  1UEC A;  1VYV A;  1Q81 R;  2DLP A;  3NTK A;  5GJW B;  2LCL A;  2PUO B;  3BW1 A;  5GJV B;  3PIP A;  4IIM A;  2V1R A;  5A0L A;  1AHJ B;  2DET A;  3LH5 A;  1YWO A;  3QWX X;  4E7S A;  3BDL A;  4CC7 A;  1QP2 A;  2Y4X A;  3PE0 A;  2XU8 A;  1PSF A;  2C0T A;  1YJN T;  2COW A;  5L23 A;  2GTO A;  2E5Q A;  2JVV A;  1PKT A;  4PL6 A;  3UDC A;  2COZ A;  1Z9Z A;  3QDR B;  3INZ A;  4QVZ A;  4F7U G;  2IVW A;  3TCJ A;  2GF7 A;  2WSE E;  5J26 A;  2EPD A;  2EYW A;  3G71 T;  4KRT A;  2NUZ A;  3QSU A;  1WQW A;  2CDT A;  3LGL A;  3X28 B;  4OGC A;  1I5L A;  4LDV A;  4KUL A;  5CQY A;  5LJ3 j;  2P0Q A;  1VQ9 Q;  3CCL A;  2MIO A;  2M1H A;  2ZPF B;  4FYW B;  2K4Y A;  3OBY A;  1C0M A;  3JSC A;  2X51 A;  2EVR A;  5CQX A;  3UA7 A;  4VUB A;  1IB8 A;  3FEO A;  2DKG A;  1Q7Y C;  3WVD B;  4MZP A;  3M0S A;  1VQP A;  3MEV A;  4QQD A;  2YLC A;  2G3R A;  1I81 A;  3CCR T;  1YCY A;  1I07 A;  1Q82 R;  4PLI A;  4A4H A;  1C1A A;  3OB9 A;  3VRY A;  3CME A;  2K9G A;  4FL6 A;  2DO3 A;  2DRK A;  1KC8 C;  1MMD A;  4M78 E;  2KAF A;  2RHX A;  4AFZ C;  1QCF A;  3CC2 A;  4M77 B;  1AD5 A;  3VS6 A;  2RQU A;  1CKA A;  4MDW A;  4J9G A;  4E7Z A;  1M1F A;  3E9G A;  3OYJ A;  4A4K A;  5FWC A;  3CCM Q;  1BI1 A;  1K0X A;  4ZGJ B;  5KH6 A;  5GMK j;  1KD1 U;  4V2S A;  2HQX A;  2HEQ A;  1PWT A;  3JCM V;  6AT1 B;  2D8J A;  1D1A A;  1NEB A;  1K73 R;  1KQ2 A;  1D0X A;  3R6N A;  4GLK A;  3FIF A;  4FCY A;  1YN8 A;  1VQ8 T;  2DNU A;  3OQ5 A;  4M78 A;  3QBY A;  1BIA A;  2J06 A;  2LX7 A;  4P5N A;  3TSW A;  3LYI A;  4A4E A;  3SDZ A;  5CKD A;  4M7A G;  3CCQ A;  1N27 A;  1TSF A;  4IUR A;  5FU6 C;  1YHQ A;  3PNW C;  3KFV A;  1KHC A;  2XHC A;  3M0R A;  2K6D A;  3C0C A;  2CH4 A;  3OYE A;  1RAG B;  1UGV A;  5IXF A;  3CXC A;  1MV0 B;  2LQW A;  2KRM A;  1FYN A;  1WFW A;  3KXT A;  2RJC A;  3CPW A;  1YJW Q;  1SF9 A;  2QXF A;  2DD5 A;  2ZPE B;  3A8G B;  4M75 C;  4M7D B;  2CSQ A;  3PTA A;  4E7I A;  1KQS P;  1H92 A;  3V8J A;  1FXX A;  1Y0M A;  1R8O B;  2E70 A;  2HSE B;  1Y96 B;  4M78 D;  3JCM Q;  2A28 A;  2NLU A;  1NYG A;  3RKW A;  2DBM A;  1VQ6 T;  5D6W A;  1M3C A;  1QWE A;  2DX1 A;  4A53 A;  5GAN d;  1K8A R;  4FM4 B;  2FHD A;  1E6G A;  3GOX A;  2ROL A;  4AT1 B;  2OTL Q;  3A8H B;  3JAM E;  1P92 A;  4F7U E;  2MMP A;  5LJ5 g;  1VIE A;  2E6Z A;  5M9O A;  2RJF A;  4HT8 A;  4BY6 B;  1YWP A;  5KYY B;  2JN0 A;  3X25 B;  2RMO A;  5CKH A;  1ZQ1 A;  2HSP A;  3EFO B;  2EYQ A;  3TU4 K;  3RUX A;  2I0N A;  1A0N B;  1AVZ C;  4IIO A;  1OX8 A;  1PRL C;  2K79 A;  4C8Q C;  1U06 A;  2DL4 A;  5GAN 8;  1M8M A;  2LJ1 A;  2A7Y A;  1VQO A;  2FZC B;  2IPO B;  2DL3 A;  2R5M A;  4FIB A;  1T3L A;  3LW5 E;  2ATC B;  4J6X A;  3UWN A;  2JT4 A;  2C0O A;  1JEG A;  3M0T A;  1M5Q 1;  2YRD A;  4F7U A;  1K9M C;  4XAX B;  4N4G A;  2CP5 A;  3EGX A;  4PJN A;  5IHK A;  1QVG A;  1RLP C;  1LVK A;  2EQM A;  1D1B A;  3CXC S;  2CP0 A;  4JZ3 A;  5DY9 A;  3CPW S;  2ENM A;  4M77 F;  1KQS S;  1D3B B;  2D8H A;  3M59 A;  2GTJ A;  2H3E B;  2DF6 A;  2DE0 X;  4XTV A;  1JJ2 A;  2CSI A;  1WZO A;  5I2S A;  3CCU T;  1H8K A;  2VAS A;  2E4H A;  4Y92 A;  2K5L A;  3FLG A;  1NYF A;  3EAE A;  3JCM d;  3PVQ A;  2JTE A;  1M90 U;  1ACM B;  4M7A F;  3MP6 A;  4AG2 C;  1WHG A;  3M0U A;  4LUE A;  1NJI U;  4DBR A;  3EHR A;  3GP8 A;  3OYN A;  3DB3 A;  1RAH B;  1UE9 A;  3MEW A;  3SD4 A;  1H64 1;  5GAM h;  1PSE A;  3L2U A;  4A4F A;  3CCS Q;  2LT1 A;  2Y4Y A;  2LQ8 A;  4M7A E;  3UPU A;  1IHV A;  4DOV A;  1WJR A;  2VGM A;  4ZN3 A;  3OY9 A;  2DZC A;  3HRT A;  1GCQ C;  2DVE A;  1QLY A;  3PVL A;  4M7D F;  2W10 A;  3CMA Q;  1VQ4 A;  1NPP A;  4MMK A;  1JRI A;  3VYH B;  2ZPG B;  1YJN Q;  2KK4 A;  2LQK A;  3VUB A;  1YIT Q;  1BI3 A;  2V8K A;  4PK4 A;  1QVG S;  3C4S A;  3OMC A;  3RR6 A;  4PLL A;  4M7A A;  1E6H A;  2QGG A;  2RHY A;  2HD0 A;  1PG5 B;  3GPL A;  2NUT B;  1UJY A;  2O01 E;  3VS2 A;  3H0F A;  2JJ9 A;  5I2M A;  1JJ2 S;  2F2X A;  2DIL A;  1GFD A;  3JV3 A;  1QP3 A;  5AYF A;  4J9I A;  2WSF E;  3HPW A;  2X9H A;  1VQN Q;  4FSX A;  4BI4 A;  3MEU A;  2MF2 A;  4MML A;  1XQH A;  2E10 A;  2E5K A;  1Y57 A;  1FWZ A;  4C8Q E;  1I0C A;  2MAM A;  2A37 A;  2VB6 A;  5FU7 C;  4R55 A;  1M1K U;  2OTJ Q;  3M4G A;  3G7Z A;  1Y96 A;  4AMC A;  1ZBX A;  4OGE A;  2LMJ A;  3I56 T;  1OPK A;  1W4S A;  2OX7 A;  2V8I A;  3HKS A;  1RLQ C;  2KSS A;  1UGQ B;  2PUK B;  2KDS A;  1WI7 A;  2V1Q A;  2K57 A;  2CKK A;  5D7U A;  2KY9 A;  1GL5 A;  2K3B A;  4HVU A;  4C92 C;  3OYL A;  1YI2 T;  2RO0 A;  2KT1 A;  1RUW A;  1QVF P;  1VQ9 A;  2X4J A;  2RN8 A;  1PD0 A;  1B7T A;  1RAE B;  2XD0 A;  2ROT A;  2C0I A;  2RB6 A;  4D8K A;  2VXF A;  5IXB A;  1S72 Q;  3R6O A;  1PCX A;  2A3L A;  2HL5 C;  3JB9 I;  1YJ9 T;  1M4Z A;  2YXY A;  1W2B A;  4QVC A;  2FEI A;  3KBG A;  4C0G A;  3OBW A;  2COY A;  2F5K A;  5GAM d;  3PGG A;  4DBF A;  1ZUK A;  2EQI A;  2RQR A;  2BE7 D;  2YRV A;  4PJO F;  4DOW A;  2XDB A;  5GMK m;  1VYT A;  2XI9 A;  2PU9 B;  4RTZ A;  2DBK A;  2LQN A;  3OA6 A;  1OU9 A;  3SB2 A;  2C06 A;  3REB B;  1HD3 A;  3CC4 Q;  3C94 A;  4JJC A;  3OYK A;  2FVU A;  3J7A F;  2B8A A;  3JB9 G;  3G4S T;  4KH1 B;  4C8Q D;  2VGN A;  4B9W A;  3S3O A;  3MET A;  3V8L A;  3JRZ A;  4B9X A;  3UAT A;  3CCM A;  4EPC A;  3GIB A;  1VQM A;  3I55 T;  2GCX A;  1BCM A;  3EFS A;  1UGP B;  2J6K A;  1WYX A;  2FPD A;  4X9C A;  1VQ6 Q;  2DPP B;  2RJD A;  2JMA A;  1AEY A;  2O88 A;  5CVI A;  4PJO A;  1AWX A;  1NLO C;  2SEM A;  3QUI A;  2RA2 A;  1RAF B;  3A8M B;  1G3W A;  1QCN A;  2DXC A;  2RK1 A;  2EGA A;  4JRQ A;  1N8R R;  2JM9 A;  2RK2 A;  3HP9 A;  3FC3 A;  4UC4 A;  3QYH B;  1VQL T;  3TEE A;  3NFC A;  1YJW A;  2LJ3 A;  3HFN A;  2QEX T;  3T9N A;  1ZSZ A;  4OF1 A;  4M78 B;  1WJS A;  1BIB A;  2ZZD A;  3WVE B;  4KGV B;  1RI0 A;  1G3T A;  2LT4 A;  2K5I A;  1TXQ A;  1TUD A;  3JCM P;  5FW9 A;  4RTV A;  2EW3 A;  1XTD A;  5DLO A;  3FB9 A;  2MPX C;  4OMO A;  1MV3 A;  3OMG A;  2QI2 A;  2YSQ A;  2J05 A;  2JOY A;  2K2M A;  2OTL A;  5LJ5 f;  4XK8 E;  3NGP A;  2JUF A;  2E6N A;  1G2B A;  4FT4 A;  5HKC A;  4XU0 A;  1I8F A;  2MI6 A;  3THK A;  4LUD A;  5KYN A;  4OB3 B;  4C92 E;  5GAN 4;  1OPL A;  1NG2 A;  5GAN e;  4OML A;  3MJX A;  4N0A C;  3CBP A;  3GLX A;  5HK0 A;  3CCU Q;  3M0Q A;  1WGS A;  1Q81 C;  4OVA A;  1WDX A;  3ME9 A;  5CIU A;  3TVT A;  2YHT A;  4XTZ A;  1IXD A;  2F69 A;  2DL7 A;  3SWN C;  2DL5 A;  3EG0 A;  1UGS B;  2EJF A;  5KE3 A;  1VQ5 Q;  3CCL T;  3A8L B;  2CH4 W;  4PJL A;  4QQ6 A;  4HA8 A;  2BZX A;  3CPF A;  4BE2 A;  3CCJ Q;  2CZ7 B;  4F7U B;  4HXJ A;  3EGX B;  2R58 A;  2X3W D;  1VQP T;  3PMT A;  3OSS C;  5I22 A;  3G6E Q;  4E7H A;  1WXU A;  2M0O A;  1PHT A;  2K5F A;  2GFA A;  5I21 A;  1JXO A;  1MMA A;  5GAN h;  4PJM A;  3CME T;  2XDP A;  4C92 D;  5FWB A;  4IUP A;  1EFN A;  3CC2 T;  3QII A;  1M27 C;  3CCS A;  2GBQ A;  4PKC C;  1CKB A;  3HRS A;  2O9V A;  2YT6 A;  2FYK A;  1WHK A;  3RIR A;  3MKD A;  3ASK A;  2HNI A;  3M54 A;  2PTK A;  2HBP A;  4EMK C;  1W70 A;  2CZ6 B;  4IKF A;  3JCM e;  3CMA A;  4M78 F;  3EG1 A;  1V76 A;  1KD1 R;  1Q82 C;  1EIF A;  1TUC A;  4ZGE B;  2VC8 A;  4KUI A;  2J6O A;  3V8K A;  5IH2 A;  2RI3 A;  1SG5 A;  1IZ6 A;  3LWH A;  3QJY A;  4RG2 A;  1G3S A;  3CCQ T;  2AKK A;  3JB9 D;  4FW1 A;  1YHQ T;  3CD6 Q;  2GGR A;  3A98 A;  2KBT A;  5A2Q E;  3PMI A;  4YTL A;  2PVG B;  3J80 E;  2RHZ A;  2D1X A;  1K73 C;  1GBQ A;  2YUP A;  1VQN A;  1YIJ A;  4M7A B;  1VYU A;  1G3Y A;  4LXC A;  2L5Q A;  1WLP B;  4OMP A;  2LDM A;  1NPR A;  2CP2 A;  3I5S A;  2OTJ A;  1VQK Q;  2CT3 A;  3MPU B;  4FU6 A;  2P0K A;  4Z02 A;  4L6V 5;  4J5Y A;  2QTV A;  3JCM h;  2QYZ A;  1PD1 A;  2DTH A;  4AFS C;  2M02 A;  3PT9 A;  4M75 G;  1KC8 U;  4ZN1 A;  1KQS A;  2NYS A;  3E9F A;  2DJZ A;  2IG0 A;  2LVM A;  4C5I A;  5ECA A;  3L2Z A;  2BIV A;  2HKQ B;  3SFM A;  3G4S Q;  1UTI A;  4XU1 A;  3WXM B;  4WF2 A;  4CC2 A;  1S72 A;  1K8A C;  2CS7 A;  4PFO A;  3A5Z B;  4F7U F;  2RHI A;  4RTT A;  4DEY A;  3RKY A;  2LX9 A;  5A0G A;  1VQO T;  4C5G A;  3C12 A;  3ER0 A;  2KT8 A;  4R56 A;  1M8V A;  1XJW B;  5C6S A;  2ESW A;  2PNI A;  4LD6 A;  5KYX A;  1UB4 A;  3N5B B;  3QXE B;  4K11 A;  3RMQ A;  4M7D C;  2RD1 A;  4ORZ A;  2XDD A;  3GNG A;  1S1N A;  3M58 A;  1HSQ A;  2DIG A;  2EJ9 A;  1UG1 A;  3SWN A;  2QA4 Q;  4J9D A;  3CC4 A;  4OP0 A;  1OOT A;  1B3Q A;  1AWJ A;  1K76 A;  4C8Q G;  4CC4 B;  1QQJ A;  1VQL Q;  1W6X A;  3CC7 Q;  1M2V A;  5FRO A;  4PFP A;  4J9E A;  2O2O A;  3X24 B;  5GAM e;  2YUO A;  4ZTF A;  2JZ2 A;  2EWN A;  3QDF A;  5AT1 B;  2HQE A;  2XKO C;  1WNL A;  3MP8 A;  4BY6 C;  2A08 A;  1KG1 A;  4AG1 C;  1YFN A;  1BKB A;  3G1J A;  1BI2 A;  5IN1 A;  2E3H A;  3L2V A;  1NJI C;  3CCE Q;  1M90 R;  3FDR A;  5GAM j;  1ZLM A;  1MHN A;  1NJI R;  4X1V A;  1QVP A;  4KGX B;  1M30 A;  1BYM A;  1KJW A;  3EG2 A;  5GMK i;  2D6F A;  1ZUU A;  4OMM A;  4ELY C;  1YCS B;  2M9U A;  3EG9 A;  4EMH A;  2A0F B;  4CC3 A;  3AT1 B;  2EIF A;  4FYV B;  4QQG A;  1BBZ A;  5KCH A;  5EG2 A;  3M57 A;  2JW4 A;  1WX6 A;  4EMK A;  1VQ4 T;  4HKE A;  2QTX A;  1TOV A;  5C0M A;  4PJO B;  3VS3 A;  1UUE A;  4BDZ A;  2EQU A;  3EH1 A;  2ZAE A;  3OYB A;  1ZA1 B;  3CCV Q;  2OAW A;  3TSZ A;  5DLQ E;  2YUQ A;  1BB9 A;  2KI7 A;  2XIC A;  4RCC A;  3M4Y A;  1EX4 A;  4A4G A;  2YLB A;  3E2U A;  1ZSZ B;  1M3A A;  4E47 A;  4GY5 A;  4QKU A;  3QO3 A;  1I5O B;  1VQ7 A;  4MDX A;  4DQ2 A;  2KEA A;  1LJO A;  5LJ3 f;  1ABO A;  4M75 E;  2FG0 A;  4Z89 A;  2LNH B;  4Q5W A;  2E12 A;  3KUF A;  5CKE A;  2VUB A;  1UFF A;  4ATO A;  2DYB A;  4HVW A;  3CBO A;  3O5Z A;  1V29 B;  1M1G A;  1X2K A;  1VA7 A;  3VS1 A;  4A54 A;  1HK9 A;  1M1K R;  3QZ5 B;  2KYB A;  1K0S A;  3G71 Q;  3HTR A;  2RPN A;  4J9B A;  3TRE A;  5LJ5 h;  2AK5 A;  1X01 A;  2E65 A;  1VOM A;  1OEB A;  2E64 A;  4M75 A;  4C8Q F;  3H6Z A;  5GAO p;  1VQ9 T;  1VQ5 A;  4IUT A;  1RAB B;  5FU7 B;  1N9S A;  4KBM B;  4X34 A;  3CCJ A;  2ZPB B;  2X4Y A;  2CZ0 B;  2KR3 A;  2VVK A;  2X4W A;  1UDL A;  5KE2 A;  2RQW A;  2DEU A;  3OS1 A;  3CCR Q;  4KH0 B;  4LDY A;  3G6E A;  3RDV A;  3BE3 A;  4BE0 A;  2BE9 B;  2I2L A;  2HDA A;  4R0K A;  4F17 A;  4WCI A;  3OYI A;  3X26 B;  4M75 D;  3V7C A;  2DYI A;  2WSC E;  4HCZ A;  4C92 G;  1SKU B;  2CGH A;  1QVF A;  1WXT A;  1U1T A;  2QQ9 A;  3OYF A;  5FRN A;  3OYY A;  2JMC A;  1LNX A;  1R0B G;  2MOX A;  3HL8 A;  1U8R A;  4C8Q A;  3RBB B;  1ZBJ A;  1U5S A;  3LH0 A;  2XMF A;  2W0Z A;  2DXT A;  3CCM T;  3MEA A;  1VQM T;  4RKU E;  3GNF B;  1WPY A;  4C0D B;  2HKN A;  2EAY A;  1OV3 A;  1TTH B;  1VQ8 Q;  4F14 A;  4E6R A;  2BTT A;  4F04 B;  1SSH A;  4BE1 A;  4ESR A;  3ZBD A;  2DXU A;  2MWO A;  1QKX A;  1D09 B;  4O5V A;  3M55 A;  1T3S A;  2DZ9 A;  1G83 A;  2RHU A;  2YUN A;  4LN2 A;  4KGZ B;  3CD6 A;  2RNA A;  2QGF B;  3QKJ A;  1SRL A;  1MND A;  2CUB A;  2QQR A;  1X6G A;  1YJW T;  3MP1 A;  2AZS A;  3J81 E;  2GNC A;  1I4K 1;  1BU1 A;  1TUG B;  3NHN A;  2QAS A;  2FL7 A;  1HYO A;  2LJ0 A;  2LP5 A;  5LJ5 d;  1IHW A;  4HCC A;  4HCB A;  5GAN 2;  1Q86 R;  1VQK A;  2DRM A;  2DER A;  1QMC A;  1RAC B;  2CT4 A;  2RJE A;  4KT0 E;  1N8R C;  2DEQ A;  3VKI A;  2OTL T;  1QVF S;  4L59 A;  4J8O A;  3I9Q A;  4ME7 A;  4BDY A;  2ZCF B;  3REA B;  3GF5 A;  2KMT A;  5GAN g;  1G8X A;  5GAN 6;  1Y7X A;  3EFR A;  3OW2 P;  2KNB B;  1GCQ A;  4JRP A;  4AFQ C;  2EQK A;  2M0Y A;  4C5H A;  2OI3 A;  5CK9 A;  2JTF A;  4Y91 A;  4XTY A;  3H9N A;  4EIK A;  1Q86 U;  1JXM A;  1AWO A;  1ZHI A;  2CP6 A;  2B86 A;  2X4X A;  1MGQ A;  2AHJ B;  3OYG A;  2HZY A;  1WA7 A;  4J6W A;  4OMN A;  3E1S A;  3VUZ A;  5GMK l;  1JBM A;  1KQ1 A;  2CUD A;  4LNP A;  3EHQ A;  2X35 A;  2YWW A;  4LDW A;  1TS9 A;  4C92 F;  2V8J A;  2EQJ A;  3L42 A;  3NMZ C;  4XU2 A;  5HK3 A;  1R0C B;  1C6V X;  1FMV A;  4J9F A;  1AZG B;  1D0Z A;  4EMG A;  2QA4 A;  1GFC A;  1ZA2 B;  4JRK A;  5HY6 A;  3OS5 A;  1BI0 A;  2FZG B;  2FPF A;  1M9S A;  4X9D A;  1B34 A;  3VYG A;  3CC7 A;  5KYX B;  2FO0 A;  1Q95 G;  2P84 A;  1AZE A;  1VQ4 Q;  1FX7 A;  3VRZ A;  2FRW A;  3SWN B;  2XID A;  5GAN j;  4XTX A;  2L3S A;  5CKB A;  2NUP A;  1K4U S;  1AT1 B;  3CCE A;  1ARK A;  3JB9 F;  5IHN A;  2D0N A;  1KIK A;  1M2V B;  3U23 A;  2O4X A;  2OAU A;  4C92 A;  3DLM A;  4BI3 A;  3CCS T;  3OYC A;  3JCM g;  3PIO A;  1N5Z A;  3P8D A;  3P8H A;  4RG8 A;  1PNJ A;  4J83 A;  3BFM A;  3H8Z A;  2L8D A;  1BK2 A;  1NZ9 A;  3CMA T;  1IGU A;  1MNE A;  2FZK B;  2KGT A;  3RNJ A;  3S6W A;  2H3J A;  1M2O A;  1NEG A;  1YP5 A;  1TWB A;  3CCV A;  1GCP A;  7AT1 B;  2RQV A;  1F1B B;  2QQA A;  1YIT T;  3MCA B;  1I1J A;  5LJ3 e;  2JXB A;  1VIF A;  3EG9 B;  3FJ5 A;  3M56 A;  1Q81 U;  2HL3 A;  1PC0 A;  4D8D A;  1SPK A;  2YDL A;  1Y71 A;  4EMK B;  3VS0 A;  1OUL A;  4OB1 B;  2CZ1 B;  4PFZ A;  4FW2 A;  3SEM A;  4MZT A;  4LDX A;  1GBR A;  1JO8 A;  2ECZ A;  1KD1 C;  1QCO A;  2JNG A;  3I5R A;  1HJD A;  2LCS A;  4B6M A;  1HXD A;  2DD4 A;  3CEY A;  3OS0 A;  2WAC A;  3F70 A;  1VQN T;  1YIJ T;  1LPL A;  1YJN A;  4JLI A;  1X69 A;  4N4H A;  3Q1J A;  1YIT A;  1SHG A;  4Z88 A;  3JCM c;  1WXB A;  2QAZ A;  2ZGW A;  2OTJ T;  2VWF A;  4OB0 B;  2P0P A;  3ZEH A;  2F1L A;  4BD3 A;  1Q7Y R;  2OJ2 A;  4HT9 A;  3NTH A;  3I56 Q;  2GQV A;  3G71 A;  1JB0 E;  5IAY A;  2ABL A;  5KYW A;  1FMW A;  2BZY A;  3JCM J;  1X75 C;  4FYY B;  5GAO n;  4J9H A;  1GRI A;  2RQT A;  3JCM X;  5FRM A;  5GMK e;  4JS4 A;  1YI2 Q;  1IGQ A;  1KC8 R;  1WHJ A;  2J7I A;  1H3Z A;  5LJ3 h;  1JQQ A;  2BKD N;  4E2F B;  3QPH A;  4OB2 B;  4M77 G;  1S72 T;  4M77 C;  3V7S A;  3JB9 H;  2HAX A;  1YJ9 Q;  3A8O B;  5FU6 B;  3ULR B;  5I11 A;  2ZPI B;  1Q7Y U;  1VQM Q;  2KXD A;  4FT2 A;  3CCR A;  1Q82 U;  1VUB A;  1RAD B;  5J3B A;  1D0Y A;  2DJQ A;  1RAA B;  2AT1 B;  2V26 A;  4M75 B;  2VV5 A;  1NM7 A;  4JJD A;  2KE9 A;  1SSF A;  4M7A C;  5GAN 5;  5GAM g;  2EYY A;  3QJ6 A;  5FLX E;  3CC4 T;  1K1Z A;  5GAO q;  3DLL A;  4RUG A;  4II1 A;  4Y28 E;  3I35 A;  2PQW A;  2AIR B;  1DJ7 B;  2KRN A;  2EKH A;  1G5V A;  2AZV A;  4N0A A;  3CXC P;  1B07 A;  5KYU A;  2PVD B;  2MK5 A;  3I55 Q;  3CPW P;  4GBQ A;  3VS7 A;  3EG3 A;  1ZSG A;  1FMK A;  1K73 U;  1NBE B;  1AOJ A;  1MUZ A;  5GMK h;  1WQ7 A;  4JDS A;  1JU5 C;  4M7D G;  4Z8A A;  4RTX A;  1WJQ A;  1VQ8 A;  3EH2 A;  1LOJ A;  2MCN A;  1J3T A;  4JJB A;  4C8Q B;  2K3X A;  4M4Z A;  3EGD A;  3C95 A;  1WHH A;  4GLM A;  2DTI A;  2L0A A;  5KCO A;  8ATC B;  2RH2 A;  1V1C A;  4BB7 A;  2QEX Q;  2JS2 A;  2Z0W A;  4ZGD B;  3NTI A;  3RER A;  3L2Q A;  1U3O A;  2DM1 A;  1IO6 A;  1GXI E;  2KYM A;  1X6O A;  1UHF A;  1M3B A;  4PNO A;  2M16 A;  2X3X D;  2FPE A;  4LDU A;  2VYT A;  1M90 C;  2GQI A;  1K8A U;  1VQ6 A;  2E41 A;  3H41 A;  3JB9 J;  4WTO B;  2F2V A;  1OU8 A;  3X20 B;  2HCK A;  2H8H A;  3ZFJ A;  1CSK A;  3EGU A;  2RM4 A;  1WIE A;  3MO8 A;  2QQB A;  3FJP A;  3QWY A;  2HMA A;  5LJ3 d;  2FB7 A;  2KRO A;  4DA4 A;  4JJN K;  5A0D A;  2R5A A;  1IRX A;  5GAN f;  1K9M R;  3QHS A;  3DKM A;  4FSS A;  1QVG P;  4E7K A;  3ZL7 C;  2DK3 A;  3QYG B;  2QDL A;  1VQ7 T;  1PM3 A;  4J9C A;  3LGF A;  5LJ5 e;  3H0I A;  4EDU A;  2LTO A;  2PVO B;  3CQT A;  3PFS A;  3VJP A;  2R57 A;  4F16 A;  1JJ2 P;  5GAN 3;  4M77 E;  4IUQ A;  1UHC A;  4AFU C;  2LZ6 B;  2ED1 A;  2LCC A;  1PKS A;  4L5G A;  5LJ5 j;  2XK0 A;  4OMQ A;  4IUV A;  1T0J A;  1K9M U;  4M75 F;  4DBQ A;  4NS5 A;  2BZ8 A;  4PJO G;  1UGR B;  5HCK A;  4PJO C;  1QKW A;  2CP3 A;  4TVR A;  1OI1 A;  4KUD K;  1OZ3 A;  3IQL A;  3CCL Q;  4D6W A;  1O9S A;  3RKX A;  1VQ5 T;  2LC4 A;  3O8V A;  2DAQ A;  3A1P A;  1MMG A;  3S3M A;  3CCJ T;  5GAN 7;  1OQK A;  2PZ1 A;  2MWP A;  4M77 A;  3URG A;  1TG0 A;  3VS5 A;  3CCU A;  5J39 A;  1ZSZ C;  1M1K C;  1OYX A;  4LD9 K;  1VQP Q;  3OYD A;  3G6E T;  1R77 A;  2RI5 A;  1RAI B;  3CME Q;  2M51 A;  4M7D E;  2G6F X;  1B34 B;  2NWM A;  2JTM A;  5IHI A;  3CC2 Q;  1KHI A;  2CYZ B;  4QVD A;  3JCM f;  3UT1 A;  1X2Q A;  2DL8 A;  1RL2 A;  1K9A A;  4M77 D;  1KK7 A;  2EFI A;  5CR2 A;  1Y07 A;  2NUP B;  2E1H A;  4XU3 A;  2Y90 A;  2E3I A;  2LNV A;  2EYX A;  3JCM W;  2AKL A;  2O31 A;  1YIJ Q;  2O4X B;  2P4R A;  4C92 B;  4NL2 A;  4JRI A;  1XOV A;  4C0Z A;  4M7D A;  2EJG A;  4CRI A;  1U1S A;  4CI0 C;  4RTU A;  4M7A D;  3M5A A;  2DFU A;  2RF0 A;  3UF4 A;  3CCQ Q;  3HFO A;  1RI9 A;  4E7L A;  2EGE A;  1YHQ Q;  1KSW A;  3CD6 T;  4J7I A;  2D9T A;  2QQS A;  2CRE A;  3D7S B;  2KVQ G;  1PRM C;  4A63 B;  2YRC A;  5GAO m;  2K7A A;  3L2W A;  1X43 A;  3OYM A;  4C0F A;  1EZZ B;  4DBH A;  1T0H A;  3HRU A;  2O9S A;  4M7D D;  1N9R A;  3HHT B;  5KYY A;  4O6J A;  3L2R A;  2ED0 A;  4RTW A;  3S3N A;  3QZ9 B;  2DIQ A;  2GFU A;  1QWF A;  3UA6 A;  4BAC A;  2D0Q B;  2EYZ A;  3EFO A;  3LX7 A;  4NOY A;  3RES A;  3VS4 A;  1OX9 A;  1W2B P;  1VQK T;  4E7J A;  3M53 A;  3OYH A;  4J6Y A;  3I56 A;  3P8B B;  2KXC A;  3FRN A;  1LCK A;  2VKN A;  4IUU A;  1E7O A;  3JCM b;  1O75 A;  4C0D C;  1NLP C;  1BCO A;  2ZPH B;  4FYX B;  1W1F A;  3L1A A;  4NL3 A;  2CP7 A;  2XG8 D;  1SHF A;  2DVJ A;  1YI2 A;  3BY7 A;  3RMS A;  2L3P A;  5CO7 A;  4PJO E;  4RTY A;  2DTO A;  2JM8 A;  1Q86 C;  3LWI A;  3M9Q A;  4JUV A;  2MYS A;  3NPF A;  5CAI A;  1YJ9 A;  1ZUY A;  1VQO Q;  3E19 A;  1TU0 B;  2L2P A;  1YBY A;  4JPB W;  5D6X A;  2K2V A;  5KYW B;  1D3B A;  4HCK A;  1ABQ A;  3BDU A;  2A36 A;  4JS5 A;  1X27 A;  3H0H A;  2LRQ A;  1TH7 A;  2L3R A;  4HVV A;  4OMF B;  2BUD A;  1UEB A;  1WHL A;  3M0P A;  2F5T X;  1UJ0 A;  4JLG A;  4ZNX A;  5LL6 S;  1YNZ A;  1AWW A;  3OYA A;  2F2W A;  4ZTJ A;  2QK0 A;  3OW2 A;  2EBP A;  5GAM f;  2QA4 T;  2IIM A;  1SEM A;  4XTW A;  3G4S A;  2EKO A;  2KQW A;  3HSB A;  4QW2 A;  5GAO l;  5CCA A;  3GBQ A;  2VXE A;  1ZX6 A;  2JS0 A;  2SRC A;  3DB4 A;  9ATC B;  5DM7 R;  3CC7 T;  3CBM A;  3I55 A;  2DA9 A;  2RI2 A;  1W2B S;  1KFZ A;  5IT9 E;  1NE8 A;  3AHU A;  3VV0 A;  1Z9Q A;  4M78 G;  4M78 C;  4RMO A;  4PJO D;  5EC7 A;  1N6A A;  3CCE T;  1WHM A;  2QG9 B;  4C5E A;  3SHW A;  4N4I A;  5KYU B;  3OS2 A;  4MZM A;  1N8R U; 
#chains in the Genus database with same CATH homology
 1GRI A;  1KJW A;  2DMO A;  2RQT A;  3EG2 A;  1GL5 A;  1ZUU A;  4OMM A;  2K3B A;  4HVU A;  4DEX A;  2KT1 A;  1RUW A;  1YCS B;  2RN8 A;  4JZ4 A;  1X6B A;  2J7I A;  2ROT A;  2C0I A;  4CC3 A;  4D8K A;  1JQQ A;  5IXB A;  1BBZ A;  2JW4 A;  1WX6 A;  1H3H A;  3ULR B;  5I11 A;  2FEI A;  3VS3 A;  2EGC A;  1UUE A;  2HBW A;  4QT7 A;  2KRS A;  2KXD A;  2OAW A;  3TSZ A;  2L3Q A;  1ZUK A;  2EQI A;  2RQR A;  1BB9 A;  2DJQ A;  2FRY A;  2J6F A;  2YUQ A;  1VYT A;  1NM7 A;  4RTZ A;  2DBK A;  2LQN A;  1SRM A;  4JJD A;  4LE9 A;  2KE9 A;  1M3A A;  1UEC A;  1VYV A;  2DLP A;  3REB B;  1HD3 A;  2EYY A;  5GJW B;  4JJC A;  5GJV B;  1K1Z A;  4IIM A;  2V1R A;  4RUG A;  3I35 A;  3LH5 A;  1YWO A;  3QWX X;  2KRN A;  2KEA A;  3UAT A;  2EKH A;  2AZV A;  1ABO A;  4CC7 A;  1B07 A;  2FG0 A;  4Z89 A;  2LNH B;  3PE0 A;  4GBQ A;  3VS7 A;  3EG3 A;  1UFF A;  1ZSG A;  1FMK A;  2C0T A;  2DYB A;  5L23 A;  1AOJ A;  1MUZ A;  2GTO A;  2J6K A;  4HVW A;  1WYX A;  1PKT A;  3O5Z A;  1JU5 C;  2FPD A;  1X2K A;  1VA7 A;  1Z9Z A;  4RTX A;  4Z8A A;  3VS1 A;  2MCN A;  2JMA A;  2KYB A;  1J3T A;  1AEY A;  2O88 A;  1K0S A;  4JJB A;  2EPD A;  2EYW A;  2RPN A;  4KRT A;  4J9B A;  1NLO C;  1AWX A;  4M4Z A;  2SEM A;  2NUZ A;  2AK5 A;  2CDT A;  4GLM A;  2L0A A;  2EGA A;  1OEB A;  2JM9 A;  1V1C A;  2MIO A;  2LJ3 A;  2JS2 A;  1U3O A;  2DM1 A;  2EVR A;  1IO6 A;  2KR3 A;  2KYM A;  3UA7 A;  1UHF A;  1M3B A;  2VVK A;  1UDL A;  2FPE A;  2X3X D;  2GQI A;  1TUD A;  2RQW A;  3H41 A;  3M0S A;  2F2V A;  5FW9 A;  4RTV A;  2EW3 A;  2HCK A;  2H8H A;  1I07 A;  1CSK A;  3EGU A;  1WIE A;  4OMO A;  1MV3 A;  2HDA A;  4R0K A;  2YSQ A;  3VRY A;  2J05 A;  2K2M A;  4F17 A;  4WCI A;  2K9G A;  2DRK A;  3QWY A;  2KRO A;  3NGP A;  1WXT A;  1QCF A;  4AFZ C;  1G2B A;  1AD5 A;  3VS6 A;  2RQU A;  4FSS A;  1CKA A;  3ZL7 C;  4J9G A;  2JMC A;  3THK A;  2QDL A;  2MOX A;  4J9C A;  3RBB B;  4LUD A;  1ZBJ A;  1U5S A;  5FWC A;  2XMF A;  2W0Z A;  3H0I A;  1K0X A;  1OPL A;  1NG2 A;  3CQT A;  4OML A;  2HEQ A;  1PWT A;  2D8J A;  1NEB A;  4F16 A;  1OV3 A;  3R6N A;  1UHC A;  3M0Q A;  4AFU C;  2LZ6 B;  4F14 A;  1YN8 A;  2DNU A;  2ED1 A;  4E6R A;  2BTT A;  1PKS A;  1SSH A;  4OMQ A;  4ESR A;  2J06 A;  1T0J A;  2LX7 A;  3TSW A;  1WDX A;  1QKX A;  3TVT A;  2BZ8 A;  1T3S A;  1G83 A;  2DL7 A;  2YUN A;  3KFV A;  4LN2 A;  5HCK A;  2RNA A;  3M0R A;  2K6D A;  2DL5 A;  3EG0 A;  1QKW A;  3C0C A;  2CH4 A;  3IQL A;  1UGV A;  5IXF A;  1MV0 B;  2LQW A;  2KRM A;  1FYN A;  1WFW A;  1SRL A;  2CUB A;  2CH4 W;  1X6G A;  2AZS A;  2BZX A;  2CSQ A;  1H92 A;  2GNC A;  1Y0M A;  4HXJ A;  1BU1 A;  2PZ1 A;  3NHN A;  1TG0 A;  3VS5 A;  2LJ0 A;  2LP5 A;  2A28 A;  1NYG A;  2X3W D;  2DBM A;  1M3C A;  1QWE A;  2DX1 A;  5I22 A;  1WXU A;  1PHT A;  2DRM A;  1E6G A;  2ROL A;  2CT4 A;  1JXO A;  2M51 A;  2G6F X;  2NWM A;  5FWB A;  5IHI A;  3I9Q A;  1EFN A;  3REA B;  1M27 C;  1X2Q A;  2DL8 A;  2GBQ A;  1YWP A;  1CKB A;  1K9A A;  2O9V A;  2YT6 A;  2KNB B;  1GCQ A;  2RMO A;  2HSP A;  4AFQ C;  2I0N A;  1A0N B;  1AVZ C;  2M0Y A;  4IIO A;  1PRL C;  2PTK A;  2OI3 A;  2K79 A;  4EIK A;  1W70 A;  1JXM A;  1AWO A;  1U06 A;  3EG1 A;  2B86 A;  2DL4 A;  2EYX A;  1M8M A;  2LJ1 A;  1TUC A;  2DL3 A;  1WA7 A;  2AKL A;  2O31 A;  2J6O A;  4OMN A;  1T3L A;  2P4R A;  5IH2 A;  1XOV A;  2JT4 A;  2C0O A;  2CUD A;  3M0T A;  1JEG A;  4LNP A;  3EHQ A;  4RTU A;  2RF0 A;  3UF4 A;  3NMZ C;  2AKK A;  5IHK A;  1RI9 A;  2EGE A;  1RLP C;  4J9F A;  1AZG B;  1KSW A;  2GGR A;  3A98 A;  2KBT A;  4JZ3 A;  2ENM A;  1GFC A;  2CRE A;  1PRM C;  4A63 B;  2K7A A;  1X43 A;  2D8H A;  2FPF A;  2D1X A;  2GTJ A;  2DF6 A;  2DE0 X;  1T0H A;  2CSI A;  2FO0 A;  2O9S A;  1GBQ A;  2YUP A;  1VYU A;  2ED0 A;  4RTW A;  1H8K A;  1AZE A;  4Y92 A;  1QWF A;  3UA6 A;  3VRZ A;  2EYZ A;  2FRW A;  1WLP B;  1NYF A;  4OMP A;  3VS4 A;  3PVQ A;  3I5S A;  2CT3 A;  2JTE A;  2L3S A;  4AG2 C;  3M0U A;  4LUE A;  1K4U S;  3EHR A;  1ARK A;  1UE9 A;  2KXC A;  5IHN A;  2D0N A;  1LCK A;  2VKN A;  1KIK A;  1E7O A;  3U23 A;  4AFS C;  1NLP C;  1W1F A;  1SHF A;  2DVJ A;  2L3P A;  1N5Z A;  4RTY A;  5ECA A;  1PNJ A;  1GCQ C;  1QLY A;  1UTI A;  3PVL A;  2JM8 A;  2W10 A;  4CC2 A;  1BK2 A;  3NPF A;  1ZUY A;  4RTT A;  4DEY A;  2KGT A;  3RNJ A;  2L2P A;  4JPB W;  1NEG A;  1YP5 A;  4HCK A;  1ABQ A;  2KT8 A;  1GCP A;  2A36 A;  2RQV A;  1X27 A;  3H0H A;  2ESW A;  2PNI A;  4HVV A;  4K11 A;  3M0P A;  4ORZ A;  1I1J A;  1UJ0 A;  4ZNX A;  2JXB A;  1S1N A;  3FJ5 A;  1YNZ A;  1E6H A;  1AWW A;  4D8D A;  2F2W A;  1HSQ A;  1SPK A;  2YDL A;  2EBP A;  1UG1 A;  1UJY A;  3VS0 A;  2IIM A;  4J9D A;  3VS2 A;  1SEM A;  3H0F A;  3SEM A;  1GBR A;  1OOT A;  2ECZ A;  1B3Q A;  1JO8 A;  1AWJ A;  1K76 A;  4CC4 B;  2F2X A;  3I5R A;  3GBQ A;  1HJD A;  2DIL A;  1GFD A;  3JV3 A;  2LCS A;  4J9I A;  1W6X A;  1ZX6 A;  2JS0 A;  2SRC A;  4J9E A;  2O2O A;  2YUO A;  2DA9 A;  1KFZ A;  1X69 A;  2E5K A;  2A08 A;  1SHG A;  1Y57 A;  4Z88 A;  4AG1 C;  1I0C A;  2A37 A;  1WXB A;  1Z9Q A;  2VWF A;  2OJ2 A;  5EC7 A;  1ZLM A;  2LMJ A;  4X1V A;  1OPK A;  1M30 A;  2ABL A;  1RLQ C;  2BZY A;  3SHW A;  1WI7 A;  2V1Q A;  4J9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...