2HEQA

Nmr structure of bacillus subtilis protein yorp, northeast structural genomics target sr399.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
84
structure length
84
Chain Sequence
b'MAGDPLPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYVLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YorP protein
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title NMR Structure of Bacillus subtilis protein YorP, Northeast Structural Genomics Target SR399.
rcsb
total genus 12
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2heqA01
2ED0A 4A63B 2LJ1A 4OMMA 1VA7A 4IIOA 2CSIA 2KT8A 4GBQA 1ZBJA 4AFQC 1GFCA 2KXDA 4D8DA 4JZ4A 1PKTA 2DJQA 2JXBA 3I35A 1ABOA 2YUPA 3M0QA 2RQUA 1ZUYA 2FPDA 2DBMA 2EYWA 3H0HA 3RBBB 4F17A 4OMOA 1ARKA 5FWCA 2FRWA 2YDLA 4E6RA 5IHKA 2B86A 3EG2A 1AVZC 1U3OA 5HCKA 4AFZC 3I5SA 1VYVA 1OOTA 1B07A 1AWWA 2DE0X 2EKHA 3UA7A 2G6FX 2QDLA 2LX7A 4K11A 1AWOA 1YNZA 4JJBA 1H3HA 3EG1A 2FG0A 2GGRA 2HBWA 2J6KA 1KIKA 1YP5A 2HEQA 4J9BA 1UG1A 2EYZA 2DILA 2ED1A 2MCNA 1YWOA 1RLQC 2FPFA 2YUNA 2FPEA 4J9DA 4M4ZA 1AZEA 4J9FA 1UUEA 2W0ZA 1M3CA 2ECZA 3PVLA 1OV3A 2PNIA 1U06A 2J06A 1KFZA 2VWFA 2K2MA 1QCFA 4J9GA 4ESRA 1PRLC 1RI9A 2RQTA 2FO0A 4R0KA 1NEBA 1I07A 1NEGA 1X2QA 2EYXA 4JJCA 2A36A 1AOJA 1CKAA 3I9QA 3UATA 1WXBA 1X2KA 1SHGA 2J6FA 1MUZA 2KRNA 1T0JA 1X6GA 1GCQC 5I22A 5FWBA 2RQWA 3LH5A 5I11A 1SRLA 1X43A 1I1JA 2BTTA 2RNAA 2CH4W 1NLOC 2KRMA 1HJDA 1JQQA 1W6XA 2KYMA 2VVKA 3FJ5A 3VS2A 2M51A 2GQIA 3TVTA 3VS1A 1UECA 3ULRB 3REBB 2XMFA 4ORZA 4RTYA 2DVJA 2YUQA 2AKLA 1FMKA 1BBZA 2ROLA 2F2VA 1NLPC 2ABLA 2MIOA 1GBQA 2JM9A 2BZXA 3QWXX 2D8JA 2BZYA 2LP5A 3H0FA 5IXFA 2KROA 2LQNA 3NPFA 2O9VA 2GTOA 1W1FA 1K1ZA 3SEMA 1TUCA 4FSSA 3M0RA 2KRSA 1H8KA 4LUDA 1Y0MA 2CUBA 1GCPA 4D8KA 4AG2C 2KE9A 2F2XA 4J9IA 4RTXA 2AKKA 2JM8A 1UDLA 2K6DA 2X3XD 4J9HA 1HD3A 4F14A 3H0IA 1OEBA 3VS7A 2OI3A 4Z8AA 1E6GA 3TSZA 1GCQA 2FRYA 4WCIA 1MV0B 4CC2A 3JV3A 4CC4B 1ZUUA 2BZ8A 3SHWA 3M0TA 1TUDA 2C0IA 1IO6A 1BB9A 4RTVA 1X27A 2GTJA 1XOVA 1K9AA 1YCSB 1ABQA 1OPKA 2K9GA 3NGPA 1N5ZA 2NUZA 4QT7A 2AZSA 3GBQA 2CT3A 4CC7A 2SEMA 1AZGB 4Z89A 1CSKA 2AZVA 5IHIA 4JPBW 2EW3A 3R6NA 2D0NA 1RLPC 1QWFA 4IIMA 4OMQA 1GL5A 3EGUA 3M0SA 1WYXA 2YSQA 2E5KA 4J9EA 2LJ3A 3H41A 1T0HA 2M0YA 2DMOA 1YN8A 1ZSGA 2LQWA 3NHNA 1KSWA 4GLMA 1WXUA 2I0NA 3UF4A 1UE9A 2YUOA 2J05A 4RTZA 2J6OA 3ZL7C 3C0CA 2CSQA 1JO8A 2L3QA 3O5ZA 3RNJA 1WX6A 2H8HA 1WFWA 5IH2A 1A0NB 1AWXA 2KBTA 2CT4A 4AFSC 1BU1A 4RTTA 3I5RA 2L3SA 1PKSA 3EHRA 3VS0A 4JJDA 2A08A 2LJ0A 1E6HA 2KXCA 5GJVB 1AWJA 2CREA 1K76A 4JZ3A 1MV3A 2JTEA 2L0AA 4HCKA 1W70A 3EG0A 1K0XA 4J9CA 1PNJA 1UHCA 1UJ0A 1M3AA 2LCSA 3EHQA 2DL4A 3VRZA 1AEYA 1QKXA 3PE0A 2FEIA 2HDAA 1SRMA 2GBQA 1S1NA 2KNBB 1SHFA 1QKWA 4ZNXA 2KT1A 2L2PA 2X3WD 4HVWA 3REAB 2DA9A 2J7IA 1AD5A 1OPLA 1G83A 1SPKA 3PVQA 3NMZC 4X1VA 1Z9ZA 2O9SA 1G2BA 2V1RA 2HSPA 2EGEA 2DLPA 4RTUA 1YWPA 2HCKA 4Z88A 3TSWA 5FW9A 2ESWA 4DEXA 2NWMA 1Y57A 1TG0A 2MOXA 2LNHB 2RQVA 4HXJA 2C0TA 1X6BA 2DM1A 1SEMA 2CDTA 1JEGA 2OAWA 3VS6A 1JXOA 1WI7A 5IHNA 1WA7A 1ZX6A 2P4RA 1WDXA 3U23A 1T3LA 2VKNA 2RN8A 1SSHA 2EBPA 2A37A 1M30A 4RTWA 1EFNA 4CC3A 2SRCA 1GBRA 1T3SA 2DRKA 1M8MA 2K3BA 1Z9QA 3CQTA 5GJWB 1JU5C 1E7OA 2PZ1A 2DF6A 3VS5A 4HVVA 3UA6A 2EGAA 2V1QA 2JS2A 4AFUC 2O88A 1NG2A 1PWTA 4LE9A 2LMJA 1WXTA 1UJYA 3EG3A 2OJ2A 3VS4A 4EIKA 2YT6A 2GNCA 5EC7A 2DYBA 3VRYA 1VYUA 2DL7A 2DRMA 1BK2A 2EVRA 3QWYA 1FYNA 1U5SA 5L23A 2DL3A 3VS3A 1ZLMA 2F2WA 2D8HA 2L3PA 3IQLA 1NYFA 1PRMC 2DBKA 2ROTA 1UFFA 2K7AA 2RMOA 2CH4A 1NM7A 2DX1A 2IIMA 2KYBA 2A28A 2JMAA 5ECAA 2C0OA 2RQRA 1M27C 2EGCA 2EYYA 2JMCA 2O31A 2PTKA 1UGVA 2KGTA 2DNUA 1WIEA 3M0PA 1H92A 3A98A 1I0CA 2AK5A 2D1XA 1KJWA 1UTIA 4F16A 1UHFA 2KEAA 2KR3A 2W10A 1RUWA 4LNPA 1J3TA 4HVUA 1GFDA 1K0SA 2K79A 2EQIA 1CKBA 1V1CA 1X69A 1WLPB 1M3BA 4AG1C 1LCKA 1GRIA 1HSQA 1K4US 4OMPA 1JXMA 1B3QA 4Y92A 2JW4A 1PHTA 1ZUKA 5IXBA 4KRTA 2JT4A 1QWEA 2RPNA 2O2OA 4LUEA 1NYGA 1QLYA 2ENMA 2EPDA 2LZ6B 2JS0A 1VYTA 2DL5A 4RUGA 3M0UA 4LN2A 3KFVA 4DEYA 2RF0A 2DL8A 3THKA 4OMNA 2CUDA 4OMLA
chains in the Genus database with same CATH superfamily
2ED0A 3CCQA 5J39A 2LJ1A 1I5LA 4C8QB 1VA7A 2E6ZA 3CC2Q 2KT8A 5J26A 1ZBJA 4D8DA 4JZ4A 1PKTA 3KBGA 2EQJA 2BE9B 1N9SA 3J81E 1WHKA 5CKFA 3TU4K 1K73U 5D6XA 1ZUYA 2QEXT 1VQLQ 3JCMg 1Q7YC 2DBMA 3H0HA 3RBBB 4F17A 1VQ9T 3LWIA 2Y4XA 4E6RA 2B86A 4CRIA 5HCKA 3V7CA 5KYXB 4IKFA 3I56A 4AFZC 1OOTA 3QZ9B 3QIIA 1KK7A 2G6FX 3E2UA 4M7AB 4M77G 3E9FA 4JUVA 2XG8D 7AT1B 5GMKm 5D6WA 3HTRA 5GAN8 1AWOA 4F7UE 1VQOQ 3OW2P 2M02A 5J3BA 4J7FA 4HCZA 2DILA 4Q5WA 1RLQC 2FPFA 2RB6A 2YUNA 4M4ZA 2FYKA 1OYXA 2QA4Q 1AZEA 3JCMX 4XQ3A 1UUEA 1X6OA 4LDUA 2ECZA 5KYUB 3SDZA 5I2SA 2YRVA 3CPFA 1BI1A 2PNIA 1U06A 1YJWA 2QTXA 1VQNQ 2V26A 2K2MA 2XIDA 1QCFA 3EGXB 3MJXA 3OYFA 3PNWC 1ZSZB 1K73C 3BFMA 5GAMg 1S72A 1WXBA 3BW1A 5FROA 3JCMQ 1M1KC 1SHGA 4OB3B 3MCAB 1MUZA 1T0JA 2CS7A 2KRNA 1WQ7A 5CKDA 4C92G 2RQWA 2MWOA 4XTYA 4DOWA 2RNAA 2CH4W 1NLOC 4HT9A 2COYA 4J83A 1NJIU 4X34A 3DB3A 4ORZA 4II1A 2DVJA 2IG0A 2KY9A 2ROLA 2F2VA 3OYMA 1TU0B 4C8QG 4ZN1A 1VQ4Q 4FYYB 2ABLA 2RD1A 5LJ3j 1GBQA 1ZHIA 3PMIA 1WZOA 3CCJQ 2BZYA 1XJWB 2LP5A 3HL8A 6AT1B 4KGVB 2KROA 2LQNA 3NPFA 2HKQB 8ATCB 5GAOm 1K1ZA 3QJYA 1XQHA 2F2XA 4RTXA 2ZAEA 1YHQQ 2AKKA 4BY6B 1UDLA 1VQMQ 2NYSA 4F14A 3M59A 1Q95G 3H0IA 4RKUE 2OTLT 1QVFS 3EG9B 4M7AG 1Q82U 3VS7A 3CCJA 3TSZA 1GCQA 4CC2A 1VQ9Q 1TUDA 3CC7T 2C0IA 4ME7A 1IO6A 1BB9A 3J80E 4JRPA 2GTJA 1XOVA 1QMCA 4PJOG 1YCSB 1ABQA 1OPKA 2K9GA 3KUFA 4QT7A 2DTHA 3E9GA 4M75E 2CT3A 1OX9A 3L2WA 5GANg 3CPWP 2D0NA 5GAN7 3LGFA 2K3XA 3EGUA 3M0SA 1YHQT 1WYXA 3R6OA 3ASKA 2P0QA 3CMET 4BE0A 2E5KA 3AHUA 1RL2A 1BI0A 1T0HA 1NE8A 3QKJA 2NUTA 1YN8A 4PJOA 2CZ1B 1IREB 2LQWA 3NHNA 4XTXA 4M7AC 1U1SA 2KI7A 2YUOA 2J05A 4KUIA 4C0DB 3ZL7C 3C0CA 5LJ5d 3X28B 2O4XB 4PJOC 2L3QA 3O5ZA 5IH2A 3LW5E 3Q1JA 3URGA 1VQ4A 2CT4A 4KGXB 3RDVA 1RAIB 3I5RA 2L3SA 1PKSA 3LWHA 2O01E 4JJDA 4N4HA 5GJVB 1AWJA 1VUBA 1MV3A 4MZTA 3G1JA 2ZCFB 4P5NA 1PNJA 2RHIA 3OYKA 3CD6T 1M3AA 2D9TA 2LCSA 2P0KA 1ZSZC 2DL4A 3HPWA 1AEYA 3FJPA 4C92A 2GBQA 4HT8A 4ZNXA 5CKEA 3CCLQ 1Q7YR 2X3WD 3REAB 2J7IA 2MPXC 3NMZC 4X1VA 1G2BA 3OB9A 1KC8C 2V1RA 3EGXA 4DBRA 1LVKA 2CZ0B 2HSPA 1PD1A 1OZ2A 3JCMb 4RTUA 3A1PA 3CCVA 5LJ3d 3HRUA 4PJLA 4Z88A 3RMSA 4GY5A 2ESWA 3CC7Q 1SSFA 4F7UF 4ZTJA 2C0TA 2EQKA 1X6BA 5HY6A 3G71Q 2R5MA 2DM1A 5GAMf 1IHWA 1JEGA 4BE1A 4A4GA 4C5GA 1S72Q 2JZ2A 2QDYB 4ATOA 2VKNA 3VUZA 2RN8A 2CZ6B 1M30A 3V8JA 4OB1B 2SRCA 3VYGA 2XKOC 1D1AA 1KQ2A 3EFOB 2Y4YA 2K3BA 1Z9QA 4XU1A 3D7SB 1E7OA 2PZ1A 3VS5A 3X24B 3UA6A 1N8RU 3GLXA 3I56Q 2V1QA 5LJ5h 5IT9E 3QYHB 4PJJA 5KYWB 4AFUC 2YLBA 2VGMA 1NG2A 2ZPEB 4OF1A 2OJ2A 3G4SQ 3VS4A 1Q82R 3FC3A 2HKNA 3CMAQ 4JLGA 4BY6C 2DYBA 2DL7A 1JRIA 2RJFA 3H6ZA 1BK2A 2EVRA 3UWNA 3A8OB 4M78D 5KE2A 3E1SA 2E6NA 5FU7B 4EDUA 2G3RA 4M7DD 2L3PA 1NJIC 5DLOA 5GMKi 1NYFA 2FZCB 1PRMC 1B34A 3M4GA 1NM7A 2MMPA 4MMLA 3QHSA 2LT4A 1LNXA 5ECAA 2CP0A 1M27C 2JMCA 1VQ7T 2O31A 5A0LA 2V8JA 4PJMA 3CC4T 2QK0A 3M0PA 4PJOD 2XI9A 2WACA 3A98A 4PJNA 5GAN3 3VJPA 1VIEA 2E12A 3EFOA 2YXYA 5KYXA 1W4SA 4C92C 1S72T 2AIRB 3MEVA 1RAFB 1IGQA 1V1CA 1M3BA 1GRIA 1HSQA 4OMPA 5LJ3f 3OBYA 1PHTA 1M9SA 2RI3A 3SWNA 2VUBA 1QWEA 2O2OA 3GP8A 2QTVA 3N5BB 4AT1B 1NYGA 4FYVB 2ENMA 2MF2A 2LZ6B 4DBHA 2VGNA 5CAIA 2LNVA 3WVEB 1UB4A 1D1CA 4RUGA 4LN2A 3KFVA 4HCCA 2DL8A 1H641 5L8RE 3JAME 1B34B 4HA8A 4RG2A 3MHXA 2DPPB 4IIOA 1VQ6Q 3BE3A 4AFQC 2OX7A 4C5HA 2DJQA 5A0DA 5A0GA 3M0QA 3HRTA 5GAMj 2DAQA 3JCMf 3VKIA 2DD5A 2DYIA 1O75A 5FWCA 2FRWA 3M58A 3EG2A 1AVZC 1U3OA 1ZBXA 5HK3A 1QVFA 4PKCC 2OTJA 2RHZA 4TVRA 1I4K1 1RACB 2DE0X 2L8DA 4PLLA 2CZ7B 3UA7A 5AYFA 1HXDA 2QDLA 3RKXA 2JNGA 3FEOA 3PIOA 3OYBA 3CBOA 4M77B 1C6VX 4C0FA 3V8LA 1KQSA 1VQPA 4RCCA 3TQ7P 2GGRA 2HBWA 2J6KA 5C6SA 1BI3A 4J9BA 3L42A 2EYZA 4ANJA 2L3RA 3JB9J 2FL7A 3OW2S 3CEYA 4PFZA 3RMQA 2GFAA 4R55A 1M3CA 2QI2A 3HRSA 1WHMA 1BIAA 4RG8A 3TEEA 4M7AA 3X25B 4MDXA 2VWFA 2DZCA 1PRLC 1RI9A 1TWBA 2RJEA 2RQTA 2KMTA 1I07A 2EYXA 4JJCA 2A36A 1CKAA 3I9QA 1M4ZA 1FX7A 4N0AA 5FLXE 5FWBA 3LH5A 5I11A 2YLCA 3F70A 2BTTA 3DLLA 2EQUA 2KRMA 1HJDA 2DJZA 1VQKA 1SKUB 3OA6A 2VVKA 1YJ9A 1YIJQ 1MNDA 2QG9B 3FJ5A 1VQ8A 3A8HB 1UECA 3ULRB 4M7DF 3HKSA 3MEWA 1TTHB 4BACA 1BBZA 4C0ZA 4JRIA 1NLPC 4M75C 2K5FA 1GXIE 1JB0E 2CP3A 1VQNA 2KVQG 2JM9A 4QVCA 4X9CA 1FMVA 1YJ9T 2GTOA 1W1FA 1TUCA 4FSSA 3MEAA 2HQHA 3CCLA 1G3SA 2QQBA 2COZA 2E65A 2MWPA 1G3YA 5HKCA 3JCMP 1GCPA 4D8KA 4AG2C 2DXUA 2KE9A 2ZZDA 4FW2A 4F04B 5GANe 2EJFA 5IAYA 2XU8A 1OEBA 1D1BA 2OI3A 4OB2B 5EG2A 2HQEA 2RHUA 3G4SA 3JV3A 5GAMd 3CBMA 3G7ZA 1QP2A 3TREA 2DXTA 3HSBA 2X35A 3NGPA 2QQ9A 1LOJA 3PIPA 2EW3A 1G5VA 1OULA 4OMQA 3QG1A 1RAGB 4F7UG 1I8FA 4AMCA 4OMFB 4J9EA 2LJ3A 2VB6A 1Y96B 2RI5A 5I21A 3O8VA 5GAMh 2H3JA 1WXUA 2I0NA 3UF4A 4A53A 4RTZA 1M2VB 2R5AA 2QEXQ 1VQLT 2LC4A 1Y7XA 1VQ8Q 1K9MU 2VV5A 1VQKQ 3RNJA 2WSFE 2H8HA 2X4WA 4KGZB 4DBQA 1QP3A 1QVGP 2GQVA 2XDBA 1R8OB 5CCAA 1V76A 3EHRA 1UEBA 3VS0A 1G3TA 1I5OB 3C12A 4FT2A 1R0BG 1E6HA 2KXCA 2QEXA 3JB9I 1MNEA 2CREA 4HKEA 1K76A 3LYIA 4HCKA 4XU3A 3JCMh 1W70A 3JCMJ 4PK4A 1UJ0A 4DBFA 1UGQB 3CCUQ 4JRQA 3MPUB 3FDRA 2FEIA 3ME9A 1SRMA 1S1NA 1DJ7B 3MP1A 1KC8R 4M75A 4KH1B 1Q81C 2AHJB 4HVWA 3A8MB 1Q86C 4DA4A 1SPKA 3PVQA 2DEQA 3P8DA 5GAOr 5GAOp 3A8GB 2QXFA 2F5TX 3OYAA 1ZSZA 3L2UA 3EG9A 2BKDN 4N4GA 2LQ8A 4BB7A 4DEXA 3MEUA 2DTIA 3JB9G 3OY9A 2HD0A 5D6YA 1VQPQ 2CDTA 3OS1A 1X01A 2X51A 1K73R 2DD4A 3QBYA 4FYXB 1JXOA 1WA7A 3PT9A 2RJDA 1WGSA 2P4RA 1WDXA 3RIRA 4M78F 4C92E 4NL3A 1G3WA 4EPCA 5GJWB 2DF6A 4HVVA 3M56A 2JS2A 4FT4A 4C8QE 5KYWA 2O88A 3UPUA 4M7DB 1WXTA 1UJYA 3EG3A 1P92A 4IUTA 4M77F 1K8AC 2DTOA 5CO7A 4FYWB 2COWA 5EC7A 2DRMA 2DZ9A 3LX7A 3CCEA 3QWYA 1U5SA 1FWZA 5L23A 1IXDA 1IRXA 3H8ZA 2FB7A 1AT1B 2ZPBB 3GPLA 2C06A 3OSSC 4JDSA 2FHDA 2F2WA 2D8HA 3IQLA 3JCMW 3CCJT 1PSFA 2ROTA 1MMAA 2K7AA 2RMOA 2CH4A 4M7DC 1WQWA 2DX1A 1OU9A 3FLGA 2KYBA 1NPRA 4A4KA 2IVWA 3CCET 2RQRA 2YWWA 2EGCA 1LJOA 4R56A 1UGVA 2DNUA 4XTWA 2JUFA 5GMKj 2F69A 2XD0A 1I0CA 2D1XA 2ATCB 2XICA 1M90R 2KEAA 2KR3A 3X20B 2OTLQ 3OYGA 1NBEB 2YHTA 4B6MA 1K0SA 4M78C 1AHJB 2DIQA 1LCKA 4E7SA 4XK8E 4C92F 2R57A 4M7AD 1B3QA 2RJCA 1Q86U 2JW4A 5C0MA 5M9OA 1TS9A 5IXBA 8AT1B 4KRTA 3OYYA 4E7LA 2RPNA 9ATCB 4LUEA 3EAEA 1M1KR 2D0QB 3I55Q 3M0UA 1U8RA 1JJ2A 4DEYA 2RF0A 2QA4T 4OMNA 1YJNQ 3OYHA 4OMLA 3MO8A 2E3HA 2M0OA 3EGDA 4J8OA 1JBMA 2CSIA 4FM4B 4FIBA 5GANf 2XHCA 4GBQA 1GFCA 1YI2A 3I35A 1Y71A 4LXCA 1H3ZA 1ABOA 2YUPA 1JJ2P 3VV0A 2FPDA 2JJ9A 3OYLA 4M7DG 4OMOA 1K9MC 2A0FB 4NS5A 1BCMA 2RHXA 3META 1W2BS 2RK2A 4A4HA 3J7AF 1B07A 2PVOB 2LQKA 1AWWA 1QW1A 2QASA 1VQNT 1RAAB 1EIFA 5FRNA 1RAEB 4FSXA 4Y28E 1FMWA 2LX7A 3G6EA 4BE2A 1MHNA 4IUQA 3CCUT 3EG1A 3PMTA 3OW2A 4LDVA 2PU9B 4BD3A 4J5YA 1K9MR 1TXQA 1YP5A 4F7UA 2DO3A 2ED1A 4BI8B 1YWOA 4IUUA 3EFSA 1KQSS 4J9DA 2LCCA 4E7IA 3PVLA 4OB0B 3CCMT 4YTLA 3GNGA 3QDFA 2HNIA 1F1BB 4ZGJB 4ESRA 3A5ZB 1VQKT 4R0KA 3WXMB 3OYIA 4JLIA 4OVAA 1NEGA 3V7RA 4L59A 1BI2A 1Y07A 4FCYA 3QPHA 1TOVA 4M78G 1Y96A 1GCQC 5I22A 3EFRA 1SRLA 3EH1A 2K5IA 1YJNA 3OYDA 2DVEA 1JQQA 1WJRA 5IN1A 1W6XA 2KYMA 3VS2A 3VS1A 3TVTA 2XMFA 4FU6A 1I81A 4RTYA 2AKLA 1FMKA 1UGPB 3V8KA 1UGSB 4QQGA 2MIOA 1YJNT 1KHIA 2AT1B 3PTAA 1MMNA 3QWXX 2XDDA 3I55T 1PC0A 3G6ET 2MK5A 4OP0A 5GMKe 2O9VA 2VASA 3M0RA 2KRSA 4C0GA 5GMKh 4EMKB 1H8KA 2F1LA 1Y0MA 2CUBA 1N9RA 4KBMB 5GAOn 1VQ6T 2PQWA 4KT0E 1OU8A 2EJGA 2JM8A 2X3XD 4J9HA 1HD3A 4B9XA 1YITT 1M90U 5CQXA 4PJOF 2FRYA 3CMAA 3LH0A 1MV0B 3DLMA 2BZ8A 1MGQA 3SHWA 4MDWA 5GAN6 3OBWA 4JRKA 4RTVA 2KDSA 4V2SA 3CPWS 1U1TA 1N5ZA 2NUZA 2NUPA 5GMKl 2AZSA 3CXCS 3GBQA 4CC7A 1CSKA 3CCVT 2AZVA 3CPWA 2CP7A 1RLPC 4IIMA 1GL5A 4CI0C 2ZPFB 3DKMA 3JB9F 3UT1A 3L2VA 1XNIA 3QO3A 4F7UB 2JN0A 3GOXA 2LCLA 3CC4Q 2DMOA 1QVFP 3FB9A 3ZEHA 2JTMA 1YJWT 5CK9A 4GLMA 3CBPA 2J6OA 4B9WA 2CSQA 1JO8A 4PNOA 1BKBA 4BI3A 1WX6A 1WFWA 3M5AA 2DEUA 2DXBA 1AWXA 2O4XA 2KBTA 3NFCA 2LDMA 4AFSC 2EIFA 1BU1A 3L1AA 4LD6A 4Z02A 1KD1R 2HL5C 1D09B 4PLIA 2QYZA 4E7JA 4M7DE 2LJ0A 2DK3A 2KAFA 4QKUA 5LJ5j 2JTEA 2L0AA 3RESA 3MP8A 4PL6A 3I56T 3HP9A 3EG0A 3JSCA 1LPLA 2A7YA 4BDZA 4M7DA 1K0XA 1QVPA 2P0PA 1UHCA 2ZGWA 4QQDA 1NJIR 1X75C 3VRZA 3NTIA 1KD1C 3CCRA 1BCOA 3PE0A 2HQXA 2HDAA 2I2LA 2QA4A 1G8XA 5KH6A 2LRQA 1SHFA 2KT1A 4O6JA 4A4EA 3CCMQ 2L2PA 2Z0WA 2DA9A 1AD5A 1G83A 2X9HA 4WTOB 1VQ7A 1VQOA 2GF7A 1N8RR 3G71T 4M7AF 2DLPA 4JJNK 3NTKA 4BUGA 3TSWA 2KSSA 5FW9A 2JVVA 2NWMA 1Y57A 2LNHB 4J6WA 3M4YA 2E10A 3FIFA 4EMGA 2NUPB 5KYYB 5KYYA 2QQAA 3VS6A 2EYQA 1WI7A 5LL6S 3UDCA 3CCRQ 2E5QA 1ZX6A 2EQMA 3U23A 1T3LA 4C92B 1V29B 2EBPA 4RTWA 1EFNA 3BY7A 2QQSA 3CMEQ 3NTHA 2DETA 2K2VA 3EGDB 2RM4A 2DRKA 1M8MA 3VUBA 3CQTA 1JU5C 1VOMA 3CCRT 5LJ3e 5CIUA 2K57A 2HAXA 1PWTA 4LE9A 2LMJA 4JS5A 3S3MA 3INZA 5DLQE 1VQ4T 2YT6A 2Y90A 5FU7C 3VRYA 1VYUA 4PFOA 5GAN2 1QCNA 1N8RC 4JS4A 2K3YA 2DL3A 4UC4A 4M7AE 1ZLMA 3TCJA 1UFFA 2EFIA 1SF9A 3M9QA 2EKOA 1VQPT 2IIMA 5HK0A 2A28A 2YRDA 4PJOE 3SWNB 4ZGDB 2JMAA 4L5GA 4Y91A 3EH2A 5FU6B 2QQRA 2EYYA 1IB8A 2IPOB 3QYGB 4HCBA 1WIEA 3QUIA 4ZGEB 2E41A 4XU2A 3CXCP 2AK5A 1UTIA 3P8BB 3ZBDA 2M9UA 1PCXA 4M75B 3HFNA 1RUWA 5KYNA 1FXXA 3JRZA 4HVUA 1GFDA 2V8IA 5GAOl 2EQIA 1CKBA 4AG1C 1WLPB 1YHQA 1WNLA 1Q82C 3C94A 1K4US 4RCBA 2LVMA 3MKDA 4Y92A 1ZUKA 1WPYA 4N4IA 2JT4A 1HYOA 3HFOA 4J6YA 4M77D 1VQ8T 3OSVA 5LJ5e 1KC8U 3GIBA 1QLYA 2EPDA 4MMKA 4M75D 2FZKB 1UGRB 1OI1A 3CCSA 1YIJA 3KXTA 3OMCA 3L2QA 2JTFA 1VQ5T 3I55A 3V7SA 4A63B 5KYUA 4OMMA 4LDWA 2KXDA 5KCHA 2JXBA 1YIJT 2E1HA 2EWNA 3SB2A 2RQUA 3CCST 1W2BA 5D7UA 5CQYA 2XDPA 3E19A 2EYWA 1ARKA 2YDLA 5IHKA 1YFNA 3I5SA 1VYVA 1KQ1A 1BIBA 4N0AC 1YI2Q 1PG5B 2EKHA 3OYEA 2RHYA 5LJ3g 1M2VA 4KH0B 5A2QE 1XTDA 4ZN3A 1M1GA 4K11A 3RKWA 2HMAA 1YNZA 4JJBA 1H3HA 2FG0A 1KQSP 1RAHB 1QCOA 2R58A 1WJQA 3JCMe 2P4TA 2HEQA 1KIKA 1RI0A 1UG1A 3GNFB 4DOVA 3RERA 2MCNA 2XK0A 3M55A 4LDXA 2FPEA 4PJOB 4J9FA 2WSCE 3RKYA 1YITA 2W0ZA 1KD1U 5GANh 4KUDK 2YRCA 2A3LA 2E3IA 1OV3A 4C8QD 2J06A 1RADB 1KFZA 4C0DC 5FU6C 4J9GA 2DXCA 3SWNC 2ZPHB 3CCEQ 2FO0A 3LGLA 1NEBA 3M57A 3FRNA 1X2QA 4C8QF 4J7IA 4BDYA 3G6EQ 1D0YA 1AOJA 3UATA 4MZPA 1D0ZA 5LJ5f 1X2KA 4C92D 2NUTB 1B7TA 2J6FA 1X6GA 3SD4A 1EZZB 3CCSQ 2HZYA 4E2FB 4DQ2A 2KQWA 5CKHA 4M78B 1X43A 1I1JA 2EJ9A 1Q7YU 2CGHA 1M1FA 1IHVA 4ZTFA 2M51A 2GQIA 3REBB 2YUQA 3JCMV 2BIVA 1JJ2S 3RUXA 1C0MA 1EX4A 4C8QC 5LJ5g 2E4HA 3PGGA 1R0CB 5GAMe 5AT1B 2CKKA 2BZXA 2D8JA 2FVUA 1K8AU 1WHHA 3H0FA 5IXFA 3SEMA 4XTVA 3X26B 4QQ6A 1KHCA 4XTUA 5CVIA 4C8QA 1ZQ1A 4LUDA 5GAN4 2HSEB 4ELZC 2X4XA 3GF5A 4J9IA 1M1KU 2K6DA 1M2OA 5GANd 4WF2A 1Q81R 3RR6A 2CP6A 2PUOB 5DY9A 4QVDA 3QJ6A 4Z8AA 3ZFJA 1E6GA 4LDYA 2K5LA 4WCIA 4X9DA 5I2MA 2OTJT 4CC4B 1ZUUA 3OYJA 1SG5A 3VYHB 3M0TA 3CXCA 1X27A 3CD6Q 2E64A 1K9AA 2OTLA 3CC4A 2WSEE 1IZ6A 3CCQT 1BYMA 2SEMA 1AZGB 4Z89A 1VIFA 5IHIA 4JPBW 3R6NA 4VUBA 1QWFA 2V8KA 1D3BB 1R77A 2CP2A 2YSQA 2VYTA 3H41A 4NL2A 2M0YA 1WJSA 1VQ9A 1MMGA 1ZSGA 1IGUA 1PM3A 1VQ5Q 1KSWA 4FL6A 5DM7R 1UE9A 4FW1A 4LD9K 4A54A 4E7KA 3BDLA 4C5IA 3OS0A 1Q81U 3OMGA 1Q86R 4XAXB 1PD0A 5CKBA 1A0NB 4OGCA 1ZA2B 1QVGA 5FRMA 1W2BP 4NOYA 3L2ZA 2PVDB 2MAMA 4RTTA 1ACMB 5CR2A 2VC8A 3MP6A 1VQ7Q 2L5QA 2A08A 3JCMc 2DFUA 3LLRA 2KK4A 4M78E 4JZ3A 3OS5A 2QAZA 2LTOA 3S6WA 2FZGB 3QDRB 4J9CA 4A4FA 1D0XA 4E7HA 3OQ5A 2RA2A 2VXFA 3S3NA 1ZA1B 3EHQA 5GANj 1VQOT 2X4YA 1WHJA 3M53A 1QKXA 2KNBB 3JB9D 1QKWA 2QGFB 4M77E 3QZ5B 4J6XA 4ELYC 1OPLA 1Z9ZA 2O9SA 2PUKB 1NPPA 4KULA 3H9NA 1C1AA 3BDUA 4IUPA 2EGEA 3PFSA 1M8VA 1QQJA 2H3EB 1YJWQ 2DIGA 1WHLA 4RMOA 4E7ZA 3CCMA 1YWPA 2B8AA 2DKGA 4EMHA 3CC7A 5GAN5 2HCKA 1OZ3A 4M77C 1YI2T 3M54A 3DB4A 2ZPIB 1TG0A 2MOXA 3VU3C 2RQVA 5GAOq 4HXJA 1M90C 2NLUA 4EMKA 1SEMA 1OQKA 5KE3A 1VQ5A 2GCXA 2OTJQ 1TUGB 2OAWA 3JCMd 5IHNA 4M77A 3OYNA 3CCVQ 4C5EA 2GFUA 1SSHA 2MI6A 1VQMA 2DERA 3P8HA 2A37A 4CC3A 4EMKC 1N27A 1GBRA 1N6AA 1T3SA 4M75F 1YITQ 1YJ9Q 5KCOA 3G4ST 2M16A 3CC2A 1YCYA 4M78A 2EGAA 2OAUA 2D6FA 1QVGS 3ER0A 3WVDB 1WHGA 2PVGB 2X4JA 2K4YA 1M5Q1 3QSUA 1HK9A 4EIKA 2JOYA 3AT1B 2EAYA 2GNCA 1MMDA 2M1HA 2LT1A 3CCUA 3CCLT 3CC2T 3CD6A 1FYNA 2BUDA 1VQLA 4O5VA 3VS3A 4MZMA 3CMEA 4L6V5 3S3OA 2DBKA 5LJ3h 2L89A 2RI2A 2QGGA 2CYZB 4QVZA 3OS2A 2ZPGB 3JB9H 1TSFA 1RABB 2HL3A 4XTZA 2C0OA 3T9NA 1YBYA 2CP5A 3OYCA 2PTKA 1D3BA 2KGTA 2P84A 3C95A 2HBPA 1H92A 1PSEA 1KJWA 2RO0A 4F16A 2F5KA 1UHFA 3QXEB 2W10A 4QW2A 4LNPA 4E47A 1J3TA 3A8LB 4IURA 4M75G 2K79A 3SFMA 1X69A 1VQ6A 1K8AR 1OX8A 1VQMT 1JXMA 3CCQQ 3L2RA 4GLKA 2MYSA 4OGEA 2RK1A 4BI4A 1KG1A 2VXEA 4XU0A 3CMAT 4PFPA 1TH7A 1NZ9A 4IUVA 2LX9A 2JS0A 1O9SA 1VYTA 2DL5A 2BE7D 4D6WA 3C4SA 3G71A 2E70A 3THKA 3HHTB 2RH2A 2CUDA
chains in the Genus database with same CATH topology
2ED0A 4A63B 2LJ1A 4OMMA 1VA7A 4IIOA 2CSIA 2KT8A 4GBQA 1ZBJA 4AFQC 1GFCA 2KXDA 4D8DA 4JZ4A 1PKTA 2DJQA 2JXBA 3I35A 1ABOA 2YUPA 3M0QA 2RQUA 1ZUYA 2FPDA 2DBMA 2EYWA 3H0HA 3RBBB 4F17A 4OMOA 1ARKA 5FWCA 2FRWA 2YDLA 4E6RA 5IHKA 2B86A 3EG2A 1AVZC 1U3OA 5HCKA 4AFZC 3I5SA 1VYVA 1OOTA 1B07A 1AWWA 2DE0X 2EKHA 3UA7A 2G6FX 2QDLA 2LX7A 4K11A 1AWOA 1YNZA 4JJBA 1H3HA 3EG1A 2FG0A 2GGRA 2HBWA 2J6KA 1KIKA 1YP5A 2HEQA 4J9BA 1UG1A 2EYZA 2DILA 2ED1A 2MCNA 1YWOA 1RLQC 2FPFA 2YUNA 2FPEA 4J9DA 4M4ZA 1AZEA 4J9FA 1UUEA 2W0ZA 1M3CA 2ECZA 3PVLA 1OV3A 2PNIA 1U06A 2J06A 1KFZA 2VWFA 2K2MA 1QCFA 4J9GA 4ESRA 1PRLC 1RI9A 2RQTA 2FO0A 4R0KA 1NEBA 1I07A 1NEGA 1X2QA 2EYXA 4JJCA 2A36A 1AOJA 1CKAA 3I9QA 3UATA 1WXBA 1X2KA 1SHGA 2J6FA 1MUZA 2KRNA 1T0JA 1X6GA 1GCQC 5I22A 5FWBA 2RQWA 3LH5A 5I11A 1SRLA 1X43A 1I1JA 2BTTA 2RNAA 2CH4W 1NLOC 2KRMA 1HJDA 1JQQA 1W6XA 2KYMA 2VVKA 3FJ5A 3VS2A 2M51A 2GQIA 3TVTA 3VS1A 1UECA 3ULRB 3REBB 2XMFA 4ORZA 4RTYA 2DVJA 2YUQA 2AKLA 1FMKA 1BBZA 2ROLA 2F2VA 1NLPC 2ABLA 2MIOA 1GBQA 2JM9A 2BZXA 3QWXX 2D8JA 2BZYA 2LP5A 3H0FA 5IXFA 2KROA 2LQNA 3NPFA 2O9VA 2GTOA 1W1FA 1K1ZA 3SEMA 1TUCA 4FSSA 3M0RA 2KRSA 1H8KA 4LUDA 1Y0MA 2CUBA 1GCPA 4D8KA 4AG2C 2KE9A 2F2XA 4J9IA 4RTXA 2AKKA 2JM8A 1UDLA 2K6DA 2X3XD 4J9HA 1HD3A 4F14A 3H0IA 1OEBA 3VS7A 2OI3A 4Z8AA 1E6GA 3TSZA 1GCQA 2FRYA 4WCIA 1MV0B 4CC2A 3JV3A 4CC4B 1ZUUA 2BZ8A 3SHWA 3M0TA 1TUDA 2C0IA 1IO6A 1BB9A 4RTVA 1X27A 2GTJA 1XOVA 1K9AA 1YCSB 1ABQA 1OPKA 2K9GA 3NGPA 1N5ZA 2NUZA 4QT7A 2AZSA 3GBQA 2CT3A 4CC7A 2SEMA 1AZGB 4Z89A 1CSKA 2AZVA 5IHIA 4JPBW 2EW3A 3R6NA 2D0NA 1RLPC 1QWFA 4IIMA 4OMQA 1GL5A 3EGUA 3M0SA 1WYXA 2YSQA 2E5KA 4J9EA 2LJ3A 3H41A 1T0HA 2M0YA 2DMOA 1YN8A 1ZSGA 2LQWA 3NHNA 1KSWA 4GLMA 1WXUA 2I0NA 3UF4A 1UE9A 2YUOA 2J05A 4RTZA 2J6OA 3ZL7C 3C0CA 2CSQA 1JO8A 2L3QA 3O5ZA 3RNJA 1WX6A 2H8HA 1WFWA 5IH2A 1A0NB 1AWXA 2KBTA 2CT4A 4AFSC 1BU1A 4RTTA 3I5RA 2L3SA 1PKSA 3EHRA 3VS0A 4JJDA 2A08A 2LJ0A 1E6HA 2KXCA 5GJVB 1AWJA 2CREA 1K76A 4JZ3A 1MV3A 2JTEA 2L0AA 4HCKA 1W70A 3EG0A 1K0XA 4J9CA 1PNJA 1UHCA 1UJ0A 1M3AA 2LCSA 3EHQA 2DL4A 3VRZA 1AEYA 1QKXA 3PE0A 2FEIA 2HDAA 1SRMA 2GBQA 1S1NA 2KNBB 1SHFA 1QKWA 4ZNXA 2KT1A 2L2PA 2X3WD 4HVWA 3REAB 2DA9A 2J7IA 1AD5A 1OPLA 1G83A 1SPKA 3PVQA 3NMZC 4X1VA 1Z9ZA 2O9SA 1G2BA 2V1RA 2HSPA 2EGEA 2DLPA 4RTUA 1YWPA 2HCKA 4Z88A 3TSWA 5FW9A 2ESWA 4DEXA 2NWMA 1Y57A 1TG0A 2MOXA 2LNHB 2RQVA 4HXJA 2C0TA 1X6BA 2DM1A 1SEMA 2CDTA 1JEGA 2OAWA 3VS6A 1JXOA 1WI7A 5IHNA 1WA7A 1ZX6A 2P4RA 1WDXA 3U23A 1T3LA 2VKNA 2RN8A 1SSHA 2EBPA 2A37A 1M30A 4RTWA 1EFNA 4CC3A 2SRCA 1GBRA 1T3SA 2DRKA 1M8MA 2K3BA 1Z9QA 3CQTA 5GJWB 1JU5C 1E7OA 2PZ1A 2DF6A 3VS5A 4HVVA 3UA6A 2EGAA 2V1QA 2JS2A 4AFUC 2O88A 1NG2A 1PWTA 4LE9A 2LMJA 1WXTA 1UJYA 3EG3A 2OJ2A 3VS4A 4EIKA 2YT6A 2GNCA 5EC7A 2DYBA 3VRYA 1VYUA 2DL7A 2DRMA 1BK2A 2EVRA 3QWYA 1FYNA 1U5SA 5L23A 2DL3A 3VS3A 1ZLMA 2F2WA 2D8HA 2L3PA 3IQLA 1NYFA 1PRMC 2DBKA 2ROTA 1UFFA 2K7AA 2RMOA 2CH4A 1NM7A 2DX1A 2IIMA 2KYBA 2A28A 2JMAA 5ECAA 2C0OA 2RQRA 1M27C 2EGCA 2EYYA 2JMCA 2O31A 2PTKA 1UGVA 2KGTA 2DNUA 1WIEA 3M0PA 1H92A 3A98A 1I0CA 2AK5A 2D1XA 1KJWA 1UTIA 4F16A 1UHFA 2KEAA 2KR3A 2W10A 1RUWA 4LNPA 1J3TA 4HVUA 1GFDA 1K0SA 2K79A 2EQIA 1CKBA 1V1CA 1X69A 1WLPB 1M3BA 4AG1C 1LCKA 1GRIA 1HSQA 1K4US 4OMPA 1JXMA 1B3QA 4Y92A 2JW4A 1PHTA 1ZUKA 5IXBA 4KRTA 2JT4A 1QWEA 2RPNA 2O2OA 4LUEA 1NYGA 1QLYA 2ENMA 2EPDA 2LZ6B 2JS0A 1VYTA 2DL5A 4RUGA 3M0UA 4LN2A 3KFVA 4DEYA 2RF0A 2DL8A 3THKA 4OMNA 2CUDA 4OMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ED0 A;  4A63 B;  2LJ1 A;  4OMM A;  1VA7 A;  4IIO A;  2CSI A;  2KT8 A;  4GBQ A;  1ZBJ A;  4AFQ C;  1GFC A;  2KXD A;  4D8D A;  4JZ4 A;  1PKT A;  2DJQ A;  2JXB A;  3I35 A;  1ABO A;  2YUP A;  3M0Q A;  2RQU A;  1ZUY A;  2FPD A;  2DBM A;  2EYW A;  3H0H A;  3RBB B;  4F17 A;  4OMO A;  1ARK A;  5FWC A;  2FRW A;  2YDL A;  4E6R A;  5IHK A;  2B86 A;  3EG2 A;  1AVZ C;  1U3O A;  5HCK A;  4AFZ C;  3I5S A;  1VYV A;  1OOT A;  1B07 A;  1AWW A;  2DE0 X;  2EKH A;  3UA7 A;  2G6F X;  2QDL A;  2LX7 A;  4K11 A;  1AWO A;  1YNZ A;  4JJB A;  1H3H A;  3EG1 A;  2FG0 A;  2GGR A;  2HBW A;  2J6K A;  1KIK A;  1YP5 A;  2HEQ A;  4J9B A;  1UG1 A;  2EYZ A;  2DIL A;  2ED1 A;  2MCN A;  1YWO A;  1RLQ C;  2FPF A;  2YUN A;  2FPE A;  4J9D A;  4M4Z A;  1AZE A;  4J9F A;  1UUE A;  2W0Z A;  1M3C A;  2ECZ A;  3PVL A;  1OV3 A;  2PNI A;  1U06 A;  2J06 A;  1KFZ A;  2VWF A;  2K2M A;  1QCF A;  4J9G A;  4ESR A;  1PRL C;  1RI9 A;  2RQT A;  2FO0 A;  4R0K A;  1NEB A;  1I07 A;  1NEG A;  1X2Q A;  2EYX A;  4JJC A;  2A36 A;  1AOJ A;  1CKA A;  3I9Q A;  3UAT A;  1WXB A;  1X2K A;  1SHG A;  2J6F A;  1MUZ A;  2KRN A;  1T0J A;  1X6G A;  1GCQ C;  5I22 A;  5FWB A;  2RQW A;  3LH5 A;  5I11 A;  1SRL A;  1X43 A;  1I1J A;  2BTT A;  2RNA A;  2CH4 W;  1NLO C;  2KRM A;  1HJD A;  1JQQ A;  1W6X A;  2KYM A;  2VVK A;  3FJ5 A;  3VS2 A;  2M51 A;  2GQI A;  3TVT A;  3VS1 A;  1UEC A;  3ULR B;  3REB B;  2XMF A;  4ORZ A;  4RTY A;  2DVJ A;  2YUQ A;  2AKL A;  1FMK A;  1BBZ A;  2ROL A;  2F2V A;  1NLP C;  2ABL A;  2MIO A;  1GBQ A;  2JM9 A;  2BZX A;  3QWX X;  2D8J A;  2BZY A;  2LP5 A;  3H0F A;  5IXF A;  2KRO A;  2LQN A;  3NPF A;  2O9V A;  2GTO A;  1W1F A;  1K1Z A;  3SEM A;  1TUC A;  4FSS A;  3M0R A;  2KRS A;  1H8K A;  4LUD A;  1Y0M A;  2CUB A;  1GCP A;  4D8K A;  4AG2 C;  2KE9 A;  2F2X A;  4J9I A;  4RTX A;  2AKK A;  2JM8 A;  1UDL A;  2K6D A;  2X3X D;  4J9H A;  1HD3 A;  4F14 A;  3H0I A;  1OEB A;  3VS7 A;  2OI3 A;  4Z8A A;  1E6G A;  3TSZ A;  1GCQ A;  2FRY A;  4WCI A;  1MV0 B;  4CC2 A;  3JV3 A;  4CC4 B;  1ZUU A;  2BZ8 A;  3SHW A;  3M0T A;  1TUD A;  2C0I A;  1IO6 A;  1BB9 A;  4RTV A;  1X27 A;  2GTJ A;  1XOV A;  1K9A A;  1YCS B;  1ABQ A;  1OPK A;  2K9G A;  3NGP A;  1N5Z A;  2NUZ A;  4QT7 A;  2AZS A;  3GBQ A;  2CT3 A;  4CC7 A;  2SEM A;  1AZG B;  4Z89 A;  1CSK A;  2AZV A;  5IHI A;  4JPB W;  2EW3 A;  3R6N A;  2D0N A;  1RLP C;  1QWF A;  4IIM A;  4OMQ A;  1GL5 A;  3EGU A;  3M0S A;  1WYX A;  2YSQ A;  2E5K A;  4J9E A;  2LJ3 A;  3H41 A;  1T0H A;  2M0Y A;  2DMO A;  1YN8 A;  1ZSG A;  2LQW A;  3NHN A;  1KSW A;  4GLM A;  1WXU A;  2I0N A;  3UF4 A;  1UE9 A;  2YUO A;  2J05 A;  4RTZ A;  2J6O A;  3ZL7 C;  3C0C A;  2CSQ A;  1JO8 A;  2L3Q A;  3O5Z A;  3RNJ A;  1WX6 A;  2H8H A;  1WFW A;  5IH2 A;  1A0N B;  1AWX A;  2KBT A;  2CT4 A;  4AFS C;  1BU1 A;  4RTT A;  3I5R A;  2L3S A;  1PKS A;  3EHR A;  3VS0 A;  4JJD A;  2A08 A;  2LJ0 A;  1E6H A;  2KXC A;  5GJV B;  1AWJ A;  2CRE A;  1K76 A;  4JZ3 A;  1MV3 A;  2JTE A;  2L0A A;  4HCK A;  1W70 A;  3EG0 A;  1K0X A;  4J9C A;  1PNJ A;  1UHC A;  1UJ0 A;  1M3A A;  2LCS A;  3EHQ A;  2DL4 A;  3VRZ A;  1AEY A;  1QKX A;  3PE0 A;  2FEI A;  2HDA A;  1SRM A;  2GBQ A;  1S1N A;  2KNB B;  1SHF A;  1QKW A;  4ZNX A;  2KT1 A;  2L2P A;  2X3W D;  4HVW A;  3REA B;  2DA9 A;  2J7I A;  1AD5 A;  1OPL A;  1G83 A;  1SPK A;  3PVQ A;  3NMZ C;  4X1V A;  1Z9Z A;  2O9S A;  1G2B A;  2V1R A;  2HSP A;  2EGE A;  2DLP A;  4RTU A;  1YWP A;  2HCK A;  4Z88 A;  3TSW A;  5FW9 A;  2ESW A;  4DEX A;  2NWM A;  1Y57 A;  1TG0 A;  2MOX A;  2LNH B;  2RQV A;  4HXJ A;  2C0T A;  1X6B A;  2DM1 A;  1SEM A;  2CDT A;  1JEG A;  2OAW A;  3VS6 A;  1JXO A;  1WI7 A;  5IHN A;  1WA7 A;  1ZX6 A;  2P4R A;  1WDX A;  3U23 A;  1T3L A;  2VKN A;  2RN8 A;  1SSH A;  2EBP A;  2A37 A;  1M30 A;  4RTW A;  1EFN A;  4CC3 A;  2SRC A;  1GBR A;  1T3S A;  2DRK A;  1M8M A;  2K3B A;  1Z9Q A;  3CQT A;  5GJW B;  1JU5 C;  1E7O A;  2PZ1 A;  2DF6 A;  3VS5 A;  4HVV A;  3UA6 A;  2EGA A;  2V1Q A;  2JS2 A;  4AFU C;  2O88 A;  1NG2 A;  1PWT A;  4LE9 A;  2LMJ A;  1WXT A;  1UJY A;  3EG3 A;  2OJ2 A;  3VS4 A;  4EIK A;  2YT6 A;  2GNC A;  5EC7 A;  2DYB A;  3VRY A;  1VYU A;  2DL7 A;  2DRM A;  1BK2 A;  2EVR A;  3QWY A;  1FYN A;  1U5S A;  5L23 A;  2DL3 A;  3VS3 A;  1ZLM A;  2F2W A;  2D8H A;  2L3P A;  3IQL A;  1NYF A;  1PRM C;  2DBK A;  2ROT A;  1UFF A;  2K7A A;  2RMO A;  2CH4 A;  1NM7 A;  2DX1 A;  2IIM A;  2KYB A;  2A28 A;  2JMA A;  5ECA A;  2C0O A;  2RQR A;  1M27 C;  2EGC A;  2EYY A;  2JMC A;  2O31 A;  2PTK A;  1UGV A;  2KGT A;  2DNU A;  1WIE A;  3M0P A;  1H92 A;  3A98 A;  1I0C A;  2AK5 A;  2D1X A;  1KJW A;  1UTI A;  4F16 A;  1UHF A;  2KEA A;  2KR3 A;  2W10 A;  1RUW A;  4LNP A;  1J3T A;  4HVU A;  1GFD A;  1K0S A;  2K79 A;  2EQI A;  1CKB A;  1V1C A;  1X69 A;  1WLP B;  1M3B A;  4AG1 C;  1LCK A;  1GRI A;  1HSQ A;  1K4U S;  4OMP A;  1JXM A;  1B3Q A;  4Y92 A;  2JW4 A;  1PHT A;  1ZUK A;  5IXB A;  4KRT A;  2JT4 A;  1QWE A;  2RPN A;  2O2O A;  4LUE A;  1NYG A;  1QLY A;  2ENM A;  2EPD A;  2LZ6 B;  2JS0 A;  1VYT A;  2DL5 A;  4RUG A;  3M0U A;  4LN2 A;  3KFV A;  4DEY A;  2RF0 A;  2DL8 A;  3THK A;  4OMN A;  2CUD A;  4OML A; 
#chains in the Genus database with same CATH topology
 2ED0 A;  3CCQ A;  5J39 A;  2LJ1 A;  1I5L A;  4C8Q B;  1VA7 A;  2E6Z A;  3CC2 Q;  2KT8 A;  5J26 A;  1ZBJ A;  4D8D A;  4JZ4 A;  1PKT A;  3KBG A;  2EQJ A;  2BE9 B;  1N9S A;  3J81 E;  1WHK A;  5CKF A;  3TU4 K;  1K73 U;  5D6X A;  1ZUY A;  2QEX T;  1VQL Q;  3JCM g;  1Q7Y C;  2DBM A;  3H0H A;  3RBB B;  4F17 A;  1VQ9 T;  3LWI A;  2Y4X A;  4E6R A;  2B86 A;  4CRI A;  5HCK A;  3V7C A;  5KYX B;  4IKF A;  3I56 A;  4AFZ C;  1OOT A;  3QZ9 B;  3QII A;  1KK7 A;  2G6F X;  3E2U A;  4M7A B;  4M77 G;  3E9F A;  4JUV A;  2XG8 D;  7AT1 B;  5GMK m;  5D6W A;  3HTR A;  5GAN 8;  1AWO A;  4F7U E;  1VQO Q;  3OW2 P;  2M02 A;  5J3B A;  4J7F A;  4HCZ A;  2DIL A;  4Q5W A;  1RLQ C;  2FPF A;  2RB6 A;  2YUN A;  4M4Z A;  2FYK A;  1OYX A;  2QA4 Q;  1AZE A;  3JCM X;  4XQ3 A;  1UUE A;  1X6O A;  4LDU A;  2ECZ A;  5KYU B;  3SDZ A;  5I2S A;  2YRV A;  3CPF A;  1BI1 A;  2PNI A;  1U06 A;  1YJW A;  2QTX A;  1VQN Q;  2V26 A;  2K2M A;  2XID A;  1QCF A;  3EGX B;  3MJX A;  3OYF A;  3PNW C;  1ZSZ B;  1K73 C;  3BFM A;  5GAM g;  1S72 A;  1WXB A;  3BW1 A;  5FRO A;  3JCM Q;  1M1K C;  1SHG A;  4OB3 B;  3MCA B;  1MUZ A;  1T0J A;  2CS7 A;  2KRN A;  1WQ7 A;  5CKD A;  4C92 G;  2RQW A;  2MWO A;  4XTY A;  4DOW A;  2RNA A;  2CH4 W;  1NLO C;  4HT9 A;  2COY A;  4J83 A;  1NJI U;  4X34 A;  3DB3 A;  4ORZ A;  4II1 A;  2DVJ A;  2IG0 A;  2KY9 A;  2ROL A;  2F2V A;  3OYM A;  1TU0 B;  4C8Q G;  4ZN1 A;  1VQ4 Q;  4FYY B;  2ABL A;  2RD1 A;  5LJ3 j;  1GBQ A;  1ZHI A;  3PMI A;  1WZO A;  3CCJ Q;  2BZY A;  1XJW B;  2LP5 A;  3HL8 A;  6AT1 B;  4KGV B;  2KRO A;  2LQN A;  3NPF A;  2HKQ B;  8ATC B;  5GAO m;  1K1Z A;  3QJY A;  1XQH A;  2F2X A;  4RTX A;  2ZAE A;  1YHQ Q;  2AKK A;  4BY6 B;  1UDL A;  1VQM Q;  2NYS A;  4F14 A;  3M59 A;  1Q95 G;  3H0I A;  4RKU E;  2OTL T;  1QVF S;  3EG9 B;  4M7A G;  1Q82 U;  3VS7 A;  3CCJ A;  3TSZ A;  1GCQ A;  4CC2 A;  1VQ9 Q;  1TUD A;  3CC7 T;  2C0I A;  4ME7 A;  1IO6 A;  1BB9 A;  3J80 E;  4JRP A;  2GTJ A;  1XOV A;  1QMC A;  4PJO G;  1YCS B;  1ABQ A;  1OPK A;  2K9G A;  3KUF A;  4QT7 A;  2DTH A;  3E9G A;  4M75 E;  2CT3 A;  1OX9 A;  3L2W A;  5GAN g;  3CPW P;  2D0N A;  5GAN 7;  3LGF A;  2K3X A;  3EGU A;  3M0S A;  1YHQ T;  1WYX A;  3R6O A;  3ASK A;  2P0Q A;  3CME T;  4BE0 A;  2E5K A;  3AHU A;  1RL2 A;  1BI0 A;  1T0H A;  1NE8 A;  3QKJ A;  2NUT A;  1YN8 A;  4PJO A;  2CZ1 B;  1IRE B;  2LQW A;  3NHN A;  4XTX A;  4M7A C;  1U1S A;  2KI7 A;  2YUO A;  2J05 A;  4KUI A;  4C0D B;  3ZL7 C;  3C0C A;  5LJ5 d;  3X28 B;  2O4X B;  4PJO C;  2L3Q A;  3O5Z A;  5IH2 A;  3LW5 E;  3Q1J A;  3URG A;  1VQ4 A;  2CT4 A;  4KGX B;  3RDV A;  1RAI B;  3I5R A;  2L3S A;  1PKS A;  3LWH A;  2O01 E;  4JJD A;  4N4H A;  5GJV B;  1AWJ A;  1VUB A;  1MV3 A;  4MZT A;  3G1J A;  2ZCF B;  4P5N A;  1PNJ A;  2RHI A;  3OYK A;  3CD6 T;  1M3A A;  2D9T A;  2LCS A;  2P0K A;  1ZSZ C;  2DL4 A;  3HPW A;  1AEY A;  3FJP A;  4C92 A;  2GBQ A;  4HT8 A;  4ZNX A;  5CKE A;  3CCL Q;  1Q7Y R;  2X3W D;  3REA B;  2J7I A;  2MPX C;  3NMZ C;  4X1V A;  1G2B A;  3OB9 A;  1KC8 C;  2V1R A;  3EGX A;  4DBR A;  1LVK A;  2CZ0 B;  2HSP A;  1PD1 A;  1OZ2 A;  3JCM b;  4RTU A;  3A1P A;  3CCV A;  5LJ3 d;  3HRU A;  4PJL A;  4Z88 A;  3RMS A;  4GY5 A;  2ESW A;  3CC7 Q;  1SSF A;  4F7U F;  4ZTJ A;  2C0T A;  2EQK A;  1X6B A;  5HY6 A;  3G71 Q;  2R5M A;  2DM1 A;  5GAM f;  1IHW A;  1JEG A;  4BE1 A;  4A4G A;  4C5G A;  1S72 Q;  2JZ2 A;  2QDY B;  4ATO A;  2VKN A;  3VUZ A;  2RN8 A;  2CZ6 B;  1M30 A;  3V8J A;  4OB1 B;  2SRC A;  3VYG A;  2XKO C;  1D1A A;  1KQ2 A;  3EFO B;  2Y4Y A;  2K3B A;  1Z9Q A;  4XU1 A;  3D7S B;  1E7O A;  2PZ1 A;  3VS5 A;  3X24 B;  3UA6 A;  1N8R U;  3GLX A;  3I56 Q;  2V1Q A;  5LJ5 h;  5IT9 E;  3QYH B;  4PJJ A;  5KYW B;  4AFU C;  2YLB A;  2VGM A;  1NG2 A;  2ZPE B;  4OF1 A;  2OJ2 A;  3G4S Q;  3VS4 A;  1Q82 R;  3FC3 A;  2HKN A;  3CMA Q;  4JLG A;  4BY6 C;  2DYB A;  2DL7 A;  1JRI A;  2RJF A;  3H6Z A;  1BK2 A;  2EVR A;  3UWN A;  3A8O B;  4M78 D;  5KE2 A;  3E1S A;  2E6N A;  5FU7 B;  4EDU A;  2G3R A;  4M7D D;  2L3P A;  1NJI C;  5DLO A;  5GMK i;  1NYF A;  2FZC B;  1PRM C;  1B34 A;  3M4G A;  1NM7 A;  2MMP A;  4MML A;  3QHS A;  2LT4 A;  1LNX A;  5ECA A;  2CP0 A;  1M27 C;  2JMC A;  1VQ7 T;  2O31 A;  5A0L A;  2V8J A;  4PJM A;  3CC4 T;  2QK0 A;  3M0P A;  4PJO D;  2XI9 A;  2WAC A;  3A98 A;  4PJN A;  5GAN 3;  3VJP A;  1VIE A;  2E12 A;  3EFO A;  2YXY A;  5KYX A;  1W4S A;  4C92 C;  1S72 T;  2AIR B;  3MEV A;  1RAF B;  1IGQ A;  1V1C A;  1M3B A;  1GRI A;  1HSQ A;  4OMP A;  5LJ3 f;  3OBY A;  1PHT A;  1M9S A;  2RI3 A;  3SWN A;  2VUB A;  1QWE A;  2O2O A;  3GP8 A;  2QTV A;  3N5B B;  4AT1 B;  1NYG A;  4FYV B;  2ENM A;  2MF2 A;  2LZ6 B;  4DBH A;  2VGN A;  5CAI A;  2LNV A;  3WVE B;  1UB4 A;  1D1C A;  4RUG A;  4LN2 A;  3KFV A;  4HCC A;  2DL8 A;  1H64 1;  5L8R E;  3JAM E;  1B34 B;  4HA8 A;  4RG2 A;  3MHX A;  2DPP B;  4IIO A;  1VQ6 Q;  3BE3 A;  4AFQ C;  2OX7 A;  4C5H A;  2DJQ A;  5A0D A;  5A0G A;  3M0Q A;  3HRT A;  5GAM j;  2DAQ A;  3JCM f;  3VKI A;  2DD5 A;  2DYI A;  1O75 A;  5FWC A;  2FRW A;  3M58 A;  3EG2 A;  1AVZ C;  1U3O A;  1ZBX A;  5HK3 A;  1QVF A;  4PKC C;  2OTJ A;  2RHZ A;  4TVR A;  1I4K 1;  1RAC B;  2DE0 X;  2L8D A;  4PLL A;  2CZ7 B;  3UA7 A;  5AYF A;  1HXD A;  2QDL A;  3RKX A;  2JNG A;  3FEO A;  3PIO A;  3OYB A;  3CBO A;  4M77 B;  1C6V X;  4C0F A;  3V8L A;  1KQS A;  1VQP A;  4RCC A;  3TQ7 P;  2GGR A;  2HBW A;  2J6K A;  5C6S A;  1BI3 A;  4J9B A;  3L42 A;  2EYZ A;  4ANJ A;  2L3R A;  3JB9 J;  2FL7 A;  3OW2 S;  3CEY A;  4PFZ A;  3RMQ A;  2GFA A;  4R55 A;  1M3C A;  2QI2 A;  3HRS A;  1WHM A;  1BIA A;  4RG8 A;  3TEE A;  4M7A A;  3X25 B;  4MDX A;  2VWF A;  2DZC A;  1PRL C;  1RI9 A;  1TWB A;  2RJE A;  2RQT A;  2KMT A;  1I07 A;  2EYX A;  4JJC A;  2A36 A;  1CKA A;  3I9Q A;  1M4Z A;  1FX7 A;  4N0A A;  5FLX E;  5FWB A;  3LH5 A;  5I11 A;  2YLC A;  3F70 A;  2BTT A;  3DLL A;  2EQU A;  2KRM A;  1HJD A;  2DJZ A;  1VQK A;  1SKU B;  3OA6 A;  2VVK A;  1YJ9 A;  1YIJ Q;  1MND A;  2QG9 B;  3FJ5 A;  1VQ8 A;  3A8H B;  1UEC A;  3ULR B;  4M7D F;  3HKS A;  3MEW A;  1TTH B;  4BAC A;  1BBZ A;  4C0Z A;  4JRI A;  1NLP C;  4M75 C;  2K5F A;  1GXI E;  1JB0 E;  2CP3 A;  1VQN A;  2KVQ G;  2JM9 A;  4QVC A;  4X9C A;  1FMV A;  1YJ9 T;  2GTO A;  1W1F A;  1TUC A;  4FSS A;  3MEA A;  2HQH A;  3CCL A;  1G3S A;  2QQB A;  2COZ A;  2E65 A;  2MWP A;  1G3Y A;  5HKC A;  3JCM P;  1GCP A;  4D8K A;  4AG2 C;  2DXU A;  2KE9 A;  2ZZD A;  4FW2 A;  4F04 B;  5GAN e;  2EJF A;  5IAY A;  2XU8 A;  1OEB A;  1D1B A;  2OI3 A;  4OB2 B;  5EG2 A;  2HQE A;  2RHU A;  3G4S A;  3JV3 A;  5GAM d;  3CBM A;  3G7Z A;  1QP2 A;  3TRE A;  2DXT A;  3HSB A;  2X35 A;  3NGP A;  2QQ9 A;  1LOJ A;  3PIP A;  2EW3 A;  1G5V A;  1OUL A;  4OMQ A;  3QG1 A;  1RAG B;  4F7U G;  1I8F A;  4AMC A;  4OMF B;  4J9E A;  2LJ3 A;  2VB6 A;  1Y96 B;  2RI5 A;  5I21 A;  3O8V A;  5GAM h;  2H3J A;  1WXU A;  2I0N A;  3UF4 A;  4A53 A;  4RTZ A;  1M2V B;  2R5A A;  2QEX Q;  1VQL T;  2LC4 A;  1Y7X A;  1VQ8 Q;  1K9M U;  2VV5 A;  1VQK Q;  3RNJ A;  2WSF E;  2H8H A;  2X4W A;  4KGZ B;  4DBQ A;  1QP3 A;  1QVG P;  2GQV A;  2XDB A;  1R8O B;  5CCA A;  1V76 A;  3EHR A;  1UEB A;  3VS0 A;  1G3T A;  1I5O B;  3C12 A;  4FT2 A;  1R0B G;  1E6H A;  2KXC A;  2QEX A;  3JB9 I;  1MNE A;  2CRE A;  4HKE A;  1K76 A;  3LYI A;  4HCK A;  4XU3 A;  3JCM h;  1W70 A;  3JCM J;  4PK4 A;  1UJ0 A;  4DBF A;  1UGQ B;  3CCU Q;  4JRQ A;  3MPU B;  3FDR A;  2FEI A;  3ME9 A;  1SRM A;  1S1N A;  1DJ7 B;  3MP1 A;  1KC8 R;  4M75 A;  4KH1 B;  1Q81 C;  2AHJ B;  4HVW A;  3A8M B;  1Q86 C;  4DA4 A;  1SPK A;  3PVQ A;  2DEQ A;  3P8D A;  5GAO r;  5GAO p;  3A8G B;  2QXF A;  2F5T X;  3OYA A;  1ZSZ A;  3L2U A;  3EG9 A;  2BKD N;  4N4G A;  2LQ8 A;  4BB7 A;  4DEX A;  3MEU A;  2DTI A;  3JB9 G;  3OY9 A;  2HD0 A;  5D6Y A;  1VQP Q;  2CDT A;  3OS1 A;  1X01 A;  2X51 A;  1K73 R;  2DD4 A;  3QBY A;  4FYX B;  1JXO A;  1WA7 A;  3PT9 A;  2RJD A;  1WGS A;  2P4R A;  1WDX A;  3RIR A;  4M78 F;  4C92 E;  4NL3 A;  1G3W A;  4EPC A;  5GJW B;  2DF6 A;  4HVV A;  3M56 A;  2JS2 A;  4FT4 A;  4C8Q E;  5KYW A;  2O88 A;  3UPU A;  4M7D B;  1WXT A;  1UJY A;  3EG3 A;  1P92 A;  4IUT A;  4M77 F;  1K8A C;  2DTO A;  5CO7 A;  4FYW B;  2COW A;  5EC7 A;  2DRM A;  2DZ9 A;  3LX7 A;  3CCE A;  3QWY A;  1U5S A;  1FWZ A;  5L23 A;  1IXD A;  1IRX A;  3H8Z A;  2FB7 A;  1AT1 B;  2ZPB B;  3GPL A;  2C06 A;  3OSS C;  4JDS A;  2FHD A;  2F2W A;  2D8H A;  3IQL A;  3JCM W;  3CCJ T;  1PSF A;  2ROT A;  1MMA A;  2K7A A;  2RMO A;  2CH4 A;  4M7D C;  1WQW A;  2DX1 A;  1OU9 A;  3FLG A;  2KYB A;  1NPR A;  4A4K A;  2IVW A;  3CCE T;  2RQR A;  2YWW A;  2EGC A;  1LJO A;  4R56 A;  1UGV A;  2DNU A;  4XTW A;  2JUF A;  5GMK j;  2F69 A;  2XD0 A;  1I0C A;  2D1X A;  2ATC B;  2XIC A;  1M90 R;  2KEA A;  2KR3 A;  3X20 B;  2OTL Q;  3OYG A;  1NBE B;  2YHT A;  4B6M A;  1K0S A;  4M78 C;  1AHJ B;  2DIQ A;  1LCK A;  4E7S A;  4XK8 E;  4C92 F;  2R57 A;  4M7A D;  1B3Q A;  2RJC A;  1Q86 U;  2JW4 A;  5C0M A;  5M9O A;  1TS9 A;  5IXB A;  8AT1 B;  4KRT A;  3OYY A;  4E7L A;  2RPN A;  9ATC B;  4LUE A;  3EAE A;  1M1K R;  2D0Q B;  3I55 Q;  3M0U A;  1U8R A;  1JJ2 A;  4DEY A;  2RF0 A;  2QA4 T;  4OMN A;  1YJN Q;  3OYH A;  4OML A;  3MO8 A;  2E3H A;  2M0O A;  3EGD A;  4J8O A;  1JBM A;  2CSI A;  4FM4 B;  4FIB A;  5GAN f;  2XHC A;  4GBQ A;  1GFC A;  1YI2 A;  3I35 A;  1Y71 A;  4LXC A;  1H3Z A;  1ABO A;  2YUP A;  1JJ2 P;  3VV0 A;  2FPD A;  2JJ9 A;  3OYL A;  4M7D G;  4OMO A;  1K9M C;  2A0F B;  4NS5 A;  1BCM A;  2RHX A;  3MET A;  1W2B S;  2RK2 A;  4A4H A;  3J7A F;  1B07 A;  2PVO B;  2LQK A;  1AWW A;  1QW1 A;  2QAS A;  1VQN T;  1RAA B;  1EIF A;  5FRN A;  1RAE B;  4FSX A;  4Y28 E;  1FMW A;  2LX7 A;  3G6E A;  4BE2 A;  1MHN A;  4IUQ A;  3CCU T;  3EG1 A;  3PMT A;  3OW2 A;  4LDV A;  2PU9 B;  4BD3 A;  4J5Y A;  1K9M R;  1TXQ A;  1YP5 A;  4F7U A;  2DO3 A;  2ED1 A;  4BI8 B;  1YWO A;  4IUU A;  3EFS A;  1KQS S;  4J9D A;  2LCC A;  4E7I A;  3PVL A;  4OB0 B;  3CCM T;  4YTL A;  3GNG A;  3QDF A;  2HNI A;  1F1B B;  4ZGJ B;  4ESR A;  3A5Z B;  1VQK T;  4R0K A;  3WXM B;  3OYI A;  4JLI A;  4OVA A;  1NEG A;  3V7R A;  4L59 A;  1BI2 A;  1Y07 A;  4FCY A;  3QPH A;  1TOV A;  4M78 G;  1Y96 A;  1GCQ C;  5I22 A;  3EFR A;  1SRL A;  3EH1 A;  2K5I A;  1YJN A;  3OYD A;  2DVE A;  1JQQ A;  1WJR A;  5IN1 A;  1W6X A;  2KYM A;  3VS2 A;  3VS1 A;  3TVT A;  2XMF A;  4FU6 A;  1I81 A;  4RTY A;  2AKL A;  1FMK A;  1UGP B;  3V8K A;  1UGS B;  4QQG A;  2MIO A;  1YJN T;  1KHI A;  2AT1 B;  3PTA A;  1MMN A;  3QWX X;  2XDD A;  3I55 T;  1PC0 A;  3G6E T;  2MK5 A;  4OP0 A;  5GMK e;  2O9V A;  2VAS A;  3M0R A;  2KRS A;  4C0G A;  5GMK h;  4EMK B;  1H8K A;  2F1L A;  1Y0M A;  2CUB A;  1N9R A;  4KBM B;  5GAO n;  1VQ6 T;  2PQW A;  4KT0 E;  1OU8 A;  2EJG A;  2JM8 A;  2X3X D;  4J9H A;  1HD3 A;  4B9X A;  1YIT T;  1M90 U;  5CQX A;  4PJO F;  2FRY A;  3CMA A;  3LH0 A;  1MV0 B;  3DLM A;  2BZ8 A;  1MGQ A;  3SHW A;  4MDW A;  5GAN 6;  3OBW A;  4JRK A;  4RTV A;  2KDS A;  4V2S A;  3CPW S;  1U1T A;  1N5Z A;  2NUZ A;  2NUP A;  5GMK l;  2AZS A;  3CXC S;  3GBQ A;  4CC7 A;  1CSK A;  3CCV T;  2AZV A;  3CPW A;  2CP7 A;  1RLP C;  4IIM A;  1GL5 A;  4CI0 C;  2ZPF B;  3DKM A;  3JB9 F;  3UT1 A;  3L2V A;  1XNI A;  3QO3 A;  4F7U B;  2JN0 A;  3GOX A;  2LCL A;  3CC4 Q;  2DMO A;  1QVF P;  3FB9 A;  3ZEH A;  2JTM A;  1YJW T;  5CK9 A;  4GLM A;  3CBP A;  2J6O A;  4B9W A;  2CSQ A;  1JO8 A;  4PNO A;  1BKB A;  4BI3 A;  1WX6 A;  1WFW A;  3M5A A;  2DEU A;  2DXB A;  1AWX A;  2O4X A;  2KBT A;  3NFC A;  2LDM A;  4AFS C;  2EIF A;  1BU1 A;  3L1A A;  4LD6 A;  4Z02 A;  1KD1 R;  2HL5 C;  1D09 B;  4PLI A;  2QYZ A;  4E7J A;  4M7D E;  2LJ0 A;  2DK3 A;  2KAF A;  4QKU A;  5LJ5 j;  2JTE A;  2L0A A;  3RES A;  3MP8 A;  4PL6 A;  3I56 T;  3HP9 A;  3EG0 A;  3JSC A;  1LPL A;  2A7Y A;  4BDZ A;  4M7D A;  1K0X A;  1QVP A;  2P0P A;  1UHC A;  2ZGW A;  4QQD A;  1NJI R;  1X75 C;  3VRZ A;  3NTI A;  1KD1 C;  3CCR A;  1BCO A;  3PE0 A;  2HQX A;  2HDA A;  2I2L A;  2QA4 A;  1G8X A;  5KH6 A;  2LRQ A;  1SHF A;  2KT1 A;  4O6J A;  4A4E A;  3CCM Q;  2L2P A;  2Z0W A;  2DA9 A;  1AD5 A;  1G83 A;  2X9H A;  4WTO B;  1VQ7 A;  1VQO A;  2GF7 A;  1N8R R;  3G71 T;  4M7A F;  2DLP A;  4JJN K;  3NTK A;  4BUG A;  3TSW A;  2KSS A;  5FW9 A;  2JVV A;  2NWM A;  1Y57 A;  2LNH B;  4J6W A;  3M4Y A;  2E10 A;  3FIF A;  4EMG A;  2NUP B;  5KYY B;  5KYY A;  2QQA A;  3VS6 A;  2EYQ A;  1WI7 A;  5LL6 S;  3UDC A;  3CCR Q;  2E5Q A;  1ZX6 A;  2EQM A;  3U23 A;  1T3L A;  4C92 B;  1V29 B;  2EBP A;  4RTW A;  1EFN A;  3BY7 A;  2QQS A;  3CME Q;  3NTH A;  2DET A;  2K2V A;  3EGD B;  2RM4 A;  2DRK A;  1M8M A;  3VUB A;  3CQT A;  1JU5 C;  1VOM A;  3CCR T;  5LJ3 e;  5CIU A;  2K57 A;  2HAX A;  1PWT A;  4LE9 A;  2LMJ A;  4JS5 A;  3S3M A;  3INZ A;  5DLQ E;  1VQ4 T;  2YT6 A;  2Y90 A;  5FU7 C;  3VRY A;  1VYU A;  4PFO A;  5GAN 2;  1QCN A;  1N8R C;  4JS4 A;  2K3Y A;  2DL3 A;  4UC4 A;  4M7A E;  1ZLM A;  3TCJ A;  1UFF A;  2EFI A;  1SF9 A;  3M9Q A;  2EKO A;  1VQP T;  2IIM A;  5HK0 A;  2A28 A;  2YRD A;  4PJO E;  3SWN B;  4ZGD B;  2JMA A;  4L5G A;  4Y91 A;  3EH2 A;  5FU6 B;  2QQR A;  2EYY A;  1IB8 A;  2IPO B;  3QYG B;  4HCB A;  1WIE A;  3QUI A;  4ZGE B;  2E41 A;  4XU2 A;  3CXC P;  2AK5 A;  1UTI A;  3P8B B;  3ZBD A;  2M9U A;  1PCX A;  4M75 B;  3HFN A;  1RUW A;  5KYN A;  1FXX A;  3JRZ A;  4HVU A;  1GFD A;  2V8I A;  5GAO l;  2EQI A;  1CKB A;  4AG1 C;  1WLP B;  1YHQ A;  1WNL A;  1Q82 C;  3C94 A;  1K4U S;  4RCB A;  2LVM A;  3MKD A;  4Y92 A;  1ZUK A;  1WPY A;  4N4I A;  2JT4 A;  1HYO A;  3HFO A;  4J6Y A;  4M77 D;  1VQ8 T;  3OSV A;  5LJ5 e;  1KC8 U;  3GIB A;  1QLY A;  2EPD A;  4MMK A;  4M75 D;  2FZK B;  1UGR B;  1OI1 A;  3CCS A;  1YIJ A;  3KXT A;  3OMC A;  3L2Q A;  2JTF A;  1VQ5 T;  3I55 A;  3V7S A;  4A63 B;  5KYU A;  4OMM A;  4LDW A;  2KXD A;  5KCH A;  2JXB A;  1YIJ T;  2E1H A;  2EWN A;  3SB2 A;  2RQU A;  3CCS T;  1W2B A;  5D7U A;  5CQY A;  2XDP A;  3E19 A;  2EYW A;  1ARK A;  2YDL A;  5IHK A;  1YFN A;  3I5S A;  1VYV A;  1KQ1 A;  1BIB A;  4N0A C;  1YI2 Q;  1PG5 B;  2EKH A;  3OYE A;  2RHY A;  5LJ3 g;  1M2V A;  4KH0 B;  5A2Q E;  1XTD A;  4ZN3 A;  1M1G A;  4K11 A;  3RKW A;  2HMA A;  1YNZ A;  4JJB A;  1H3H A;  2FG0 A;  1KQS P;  1RAH B;  1QCO A;  2R58 A;  1WJQ A;  3JCM e;  2P4T A;  2HEQ A;  1KIK A;  1RI0 A;  1UG1 A;  3GNF B;  4DOV A;  3RER A;  2MCN A;  2XK0 A;  3M55 A;  4LDX A;  2FPE A;  4PJO B;  4J9F A;  2WSC E;  3RKY A;  1YIT A;  2W0Z A;  1KD1 U;  5GAN h;  4KUD K;  2YRC A;  2A3L A;  2E3I A;  1OV3 A;  4C8Q D;  2J06 A;  1RAD B;  1KFZ A;  4C0D C;  5FU6 C;  4J9G A;  2DXC A;  3SWN C;  2ZPH B;  3CCE Q;  2FO0 A;  3LGL A;  1NEB A;  3M57 A;  3FRN A;  1X2Q A;  4C8Q F;  4J7I A;  4BDY A;  3G6E Q;  1D0Y A;  1AOJ A;  3UAT A;  4MZP A;  1D0Z A;  5LJ5 f;  1X2K A;  4C92 D;  2NUT B;  1B7T A;  2J6F A;  1X6G A;  3SD4 A;  1EZZ B;  3CCS Q;  2HZY A;  4E2F B;  4DQ2 A;  2KQW A;  5CKH A;  4M78 B;  1X43 A;  1I1J A;  2EJ9 A;  1Q7Y U;  2CGH A;  1M1F A;  1IHV A;  4ZTF A;  2M51 A;  2GQI A;  3REB B;  2YUQ A;  3JCM V;  2BIV A;  1JJ2 S;  3RUX A;  1C0M A;  1EX4 A;  4C8Q C;  5LJ5 g;  2E4H A;  3PGG A;  1R0C B;  5GAM e;  5AT1 B;  2CKK A;  2BZX A;  2D8J A;  2FVU A;  1K8A U;  1WHH A;  3H0F A;  5IXF A;  3SEM A;  4XTV A;  3X26 B;  4QQ6 A;  1KHC A;  4XTU A;  5CVI A;  4C8Q A;  1ZQ1 A;  4LUD A;  5GAN 4;  2HSE B;  4ELZ C;  2X4X A;  3GF5 A;  4J9I A;  1M1K U;  2K6D A;  1M2O A;  5GAN d;  4WF2 A;  1Q81 R;  3RR6 A;  2CP6 A;  2PUO B;  5DY9 A;  4QVD A;  3QJ6 A;  4Z8A A;  3ZFJ A;  1E6G A;  4LDY A;  2K5L A;  4WCI A;  4X9D A;  5I2M A;  2OTJ T;  4CC4 B;  1ZUU A;  3OYJ A;  1SG5 A;  3VYH B;  3M0T A;  3CXC A;  1X27 A;  3CD6 Q;  2E64 A;  1K9A A;  2OTL A;  3CC4 A;  2WSE E;  1IZ6 A;  3CCQ T;  1BYM A;  2SEM A;  1AZG B;  4Z89 A;  1VIF A;  5IHI A;  4JPB W;  3R6N A;  4VUB A;  1QWF A;  2V8K A;  1D3B B;  1R77 A;  2CP2 A;  2YSQ A;  2VYT A;  3H41 A;  4NL2 A;  2M0Y A;  1WJS A;  1VQ9 A;  1MMG A;  1ZSG A;  1IGU A;  1PM3 A;  1VQ5 Q;  1KSW A;  4FL6 A;  5DM7 R;  1UE9 A;  4FW1 A;  4LD9 K;  4A54 A;  4E7K A;  3BDL A;  4C5I A;  3OS0 A;  1Q81 U;  3OMG A;  1Q86 R;  4XAX B;  1PD0 A;  5CKB A;  1A0N B;  4OGC A;  1ZA2 B;  1QVG A;  5FRM A;  1W2B P;  4NOY A;  3L2Z A;  2PVD B;  2MAM A;  4RTT A;  1ACM B;  5CR2 A;  2VC8 A;  3MP6 A;  1VQ7 Q;  2L5Q A;  2A08 A;  3JCM c;  2DFU A;  3LLR A;  2KK4 A;  4M78 E;  4JZ3 A;  3OS5 A;  2QAZ A;  2LTO A;  3S6W A;  2FZG B;  3QDR B;  4J9C A;  4A4F A;  1D0X A;  4E7H A;  3OQ5 A;  2RA2 A;  2VXF A;  3S3N A;  1ZA1 B;  3EHQ A;  5GAN j;  1VQO T;  2X4Y A;  1WHJ A;  3M53 A;  1QKX A;  2KNB B;  3JB9 D;  1QKW A;  2QGF B;  4M77 E;  3QZ5 B;  4J6X A;  4ELY C;  1OPL A;  1Z9Z A;  2O9S A;  2PUK B;  1NPP A;  4KUL A;  3H9N A;  1C1A A;  3BDU A;  4IUP A;  2EGE A;  3PFS A;  1M8V A;  1QQJ A;  2H3E B;  1YJW Q;  2DIG A;  1WHL A;  4RMO A;  4E7Z A;  3CCM A;  1YWP A;  2B8A A;  2DKG A;  4EMH A;  3CC7 A;  5GAN 5;  2HCK A;  1OZ3 A;  4M77 C;  1YI2 T;  3M54 A;  3DB4 A;  2ZPI B;  1TG0 A;  2MOX A;  3VU3 C;  2RQV A;  5GAO q;  4HXJ A;  1M90 C;  2NLU A;  4EMK A;  1SEM A;  1OQK A;  5KE3 A;  1VQ5 A;  2GCX A;  2OTJ Q;  1TUG B;  2OAW A;  3JCM d;  5IHN A;  4M77 A;  3OYN A;  3CCV Q;  4C5E A;  2GFU A;  1SSH A;  2MI6 A;  1VQM A;  2DER A;  3P8H A;  2A37 A;  4CC3 A;  4EMK C;  1N27 A;  1GBR A;  1N6A A;  1T3S A;  4M75 F;  1YIT Q;  1YJ9 Q;  5KCO A;  3G4S T;  2M16 A;  3CC2 A;  1YCY A;  4M78 A;  2EGA A;  2OAU A;  2D6F A;  1QVG S;  3ER0 A;  3WVD B;  1WHG A;  2PVG B;  2X4J A;  2K4Y A;  1M5Q 1;  3QSU A;  1HK9 A;  4EIK A;  2JOY A;  3AT1 B;  2EAY A;  2GNC A;  1MMD A;  2M1H A;  2LT1 A;  3CCU A;  3CCL T;  3CC2 T;  3CD6 A;  1FYN A;  2BUD A;  1VQL A;  4O5V A;  3VS3 A;  4MZM A;  3CME A;  4L6V 5;  3S3O A;  2DBK A;  5LJ3 h;  2L89 A;  2RI2 A;  2QGG A;  2CYZ B;  4QVZ A;  3OS2 A;  2ZPG B;  3JB9 H;  1TSF A;  1RAB B;  2HL3 A;  4XTZ A;  2C0O A;  3T9N A;  1YBY A;  2CP5 A;  3OYC A;  2PTK A;  1D3B A;  2KGT A;  2P84 A;  3C95 A;  2HBP A;  1H92 A;  1PSE A;  1KJW A;  2RO0 A;  4F16 A;  2F5K A;  1UHF A;  3QXE B;  2W10 A;  4QW2 A;  4LNP A;  4E47 A;  1J3T A;  3A8L B;  4IUR A;  4M75 G;  2K79 A;  3SFM A;  1X69 A;  1VQ6 A;  1K8A R;  1OX8 A;  1VQM T;  1JXM A;  3CCQ Q;  3L2R A;  4GLK A;  2MYS A;  4OGE A;  2RK1 A;  4BI4 A;  1KG1 A;  2VXE A;  4XU0 A;  3CMA T;  4PFP A;  1TH7 A;  1NZ9 A;  4IUV A;  2LX9 A;  2JS0 A;  1O9S A;  1VYT A;  2DL5 A;  2BE7 D;  4D6W A;  3C4S A;  3G71 A;  2E70 A;  3THK A;  3HHT B;  2RH2 A;  2CUD A; 
#chains in the Genus database with same CATH homology
 2ED0 A;  4A63 B;  2LJ1 A;  4OMM A;  1VA7 A;  4IIO A;  2CSI A;  2KT8 A;  4GBQ A;  1ZBJ A;  4AFQ C;  1GFC A;  2KXD A;  4D8D A;  4JZ4 A;  1PKT A;  2DJQ A;  2JXB A;  3I35 A;  1ABO A;  2YUP A;  3M0Q A;  2RQU A;  1ZUY A;  2FPD A;  2DBM A;  2EYW A;  3H0H A;  3RBB B;  4F17 A;  4OMO A;  1ARK A;  5FWC A;  2FRW A;  2YDL A;  4E6R A;  5IHK A;  2B86 A;  3EG2 A;  1AVZ C;  1U3O A;  5HCK A;  4AFZ C;  3I5S A;  1VYV A;  1OOT A;  1B07 A;  1AWW A;  2DE0 X;  2EKH A;  3UA7 A;  2G6F X;  2QDL A;  2LX7 A;  4K11 A;  1AWO A;  1YNZ A;  4JJB A;  1H3H A;  3EG1 A;  2FG0 A;  2GGR A;  2HBW A;  2J6K A;  1KIK A;  1YP5 A;  2HEQ A;  4J9B A;  1UG1 A;  2EYZ A;  2DIL A;  2ED1 A;  2MCN A;  1YWO A;  1RLQ C;  2FPF A;  2YUN A;  2FPE A;  4J9D A;  4M4Z A;  1AZE A;  4J9F A;  1UUE A;  2W0Z A;  1M3C A;  2ECZ A;  3PVL A;  1OV3 A;  2PNI A;  1U06 A;  2J06 A;  1KFZ A;  2VWF A;  2K2M A;  1QCF A;  4J9G A;  4ESR A;  1PRL C;  1RI9 A;  2RQT A;  2FO0 A;  4R0K A;  1NEB A;  1I07 A;  1NEG A;  1X2Q A;  2EYX A;  4JJC A;  2A36 A;  1AOJ A;  1CKA A;  3I9Q A;  3UAT A;  1WXB A;  1X2K A;  1SHG A;  2J6F A;  1MUZ A;  2KRN A;  1T0J A;  1X6G A;  1GCQ C;  5I22 A;  5FWB A;  2RQW A;  3LH5 A;  5I11 A;  1SRL A;  1X43 A;  1I1J A;  2BTT A;  2RNA A;  2CH4 W;  1NLO C;  2KRM A;  1HJD A;  1JQQ A;  1W6X A;  2KYM A;  2VVK A;  3FJ5 A;  3VS2 A;  2M51 A;  2GQI A;  3TVT A;  3VS1 A;  1UEC A;  3ULR B;  3REB B;  2XMF A;  4ORZ A;  4RTY A;  2DVJ A;  2YUQ A;  2AKL A;  1FMK A;  1BBZ A;  2ROL A;  2F2V A;  1NLP C;  2ABL A;  2MIO A;  1GBQ A;  2JM9 A;  2BZX A;  3QWX X;  2D8J A;  2BZY A;  2LP5 A;  3H0F A;  5IXF A;  2KRO A;  2LQN A;  3NPF A;  2O9V A;  2GTO A;  1W1F A;  1K1Z A;  3SEM A;  1TUC A;  4FSS A;  3M0R A;  2KRS A;  1H8K A;  4LUD A;  1Y0M A;  2CUB A;  1GCP A;  4D8K A;  4AG2 C;  2KE9 A;  2F2X A;  4J9I A;  4RTX A;  2AKK A;  2JM8 A;  1UDL A;  2K6D A;  2X3X D;  4J9H A;  1HD3 A;  4F14 A;  3H0I A;  1OEB A;  3VS7 A;  2OI3 A;  4Z8A A;  1E6G A;  3TSZ A;  1GCQ A;  2FRY A;  4WCI A;  1MV0 B;  4CC2 A;  3JV3 A;  4CC4 B;  1ZUU A;  2BZ8 A;  3SHW A;  3M0T A;  1TUD A;  2C0I A;  1IO6 A;  1BB9 A;  4RTV A;  1X27 A;  2GTJ A;  1XOV A;  1K9A A;  1YCS B;  1ABQ A;  1OPK A;  2K9G A;  3NGP A;  1N5Z A;  2NUZ A;  4QT7 A;  2AZS A;  3GBQ A;  2CT3 A;  4CC7 A;  2SEM A;  1AZG B;  4Z89 A;  1CSK A;  2AZV A;  5IHI A;  4JPB W;  2EW3 A;  3R6N A;  2D0N A;  1RLP C;  1QWF A;  4IIM A;  4OMQ A;  1GL5 A;  3EGU A;  3M0S A;  1WYX A;  2YSQ A;  2E5K A;  4J9E A;  2LJ3 A;  3H41 A;  1T0H A;  2M0Y A;  2DMO A;  1YN8 A;  1ZSG A;  2LQW A;  3NHN A;  1KSW A;  4GLM A;  1WXU A;  2I0N A;  3UF4 A;  1UE9 A;  2YUO A;  2J05 A;  4RTZ A;  2J6O A;  3ZL7 C;  3C0C A;  2CSQ A;  1JO8 A;  2L3Q A;  3O5Z A;  3RNJ A;  1WX6 A;  2H8H A;  1WFW A;  5IH2 A;  1A0N B;  1AWX A;  2KBT A;  2CT4 A;  4AFS C;  1BU1 A;  4RTT A;  3I5R A;  2L3S A;  1PKS A;  3EHR A;  3VS0 A;  4JJD A;  2A08 A;  2LJ0 A;  1E6H A;  2KXC A;  5GJV B;  1AWJ A;  2CRE A;  1K76 A;  4JZ3 A;  1MV3 A;  2JTE A;  2L0A A;  4HCK A;  1W70 A;  3EG0 A;  1K0X A;  4J9C A;  1PNJ A;  1UHC A;  1UJ0 A;  1M3A A;  2LCS A;  3EHQ A;  2DL4 A;  3VRZ A;  1AEY A;  1QKX A;  3PE0 A;  2FEI A;  2HDA A;  1SRM A;  2GBQ A;  1S1N A;  2KNB B;  1SHF A;  1QKW A;  4ZNX A;  2KT1 A;  2L2P A;  2X3W D;  4HVW A;  3REA B;  2DA9 A;  2J7I A;  1AD5 A;  1OPL A;  1G83 A;  1SPK A;  3PVQ A;  3NMZ C;  4X1V A;  1Z9Z A;  2O9S A;  1G2B A;  2V1R A;  2HSP A;  2EGE A;  2DLP A;  4RTU A;  1YWP A;  2HCK A;  4Z88 A;  3TSW A;  5FW9 A;  2ESW A;  4DEX A;  2NWM A;  1Y57 A;  1TG0 A;  2MOX A;  2LNH B;  2RQV A;  4HXJ A;  2C0T A;  1X6B A;  2DM1 A;  1SEM A;  2CDT A;  1JEG A;  2OAW A;  3VS6 A;  1JXO A;  1WI7 A;  5IHN A;  1WA7 A;  1ZX6 A;  2P4R A;  1WDX A;  3U23 A;  1T3L A;  2VKN A;  2RN8 A;  1SSH A;  2EBP A;  2A37 A;  1M30 A;  4RTW A;  1EFN A;  4CC3 A;  2SRC A;  1GBR A;  1T3S A;  2DRK A;  1M8M A;  2K3B A;  1Z9Q A;  3CQT A;  5GJW B;  1JU5 C;  1E7O A;  2PZ1 A;  2DF6 A;  3VS5 A;  4HVV A;  3UA6 A;  2EGA A;  2V1Q A;  2JS2 A;  4AFU C;  2O88 A;  1NG2 A;  1PWT A;  4LE9 A;  2LMJ A;  1WXT A;  1UJY A;  3EG3 A;  2OJ2 A;  3VS4 A;  4EIK A;  2YT6 A;  2GNC A;  5EC7 A;  2DYB A;  3VRY A;  1VYU A;  2DL7 A;  2DRM A;  1BK2 A;  2EVR A;  3QWY A;  1FYN A;  1U5S A;  5L23 A;  2DL3 A;  3VS3 A;  1ZLM A;  2F2W A;  2D8H A;  2L3P A;  3IQL A;  1NYF A;  1PRM C;  2DBK A;  2ROT A;  1UFF A;  2K7A A;  2RMO A;  2CH4 A;  1NM7 A;  2DX1 A;  2IIM A;  2KYB A;  2A28 A;  2JMA A;  5ECA A;  2C0O A;  2RQR A;  1M27 C;  2EGC A;  2EYY A;  2JMC A;  2O31 A;  2PTK A;  1UGV A;  2KGT A;  2DNU A;  1WIE A;  3M0P A;  1H92 A;  3A98 A;  1I0C A;  2AK5 A;  2D1X A;  1KJW A;  1UTI A;  4F16 A;  1UHF A;  2KEA A;  2KR3 A;  2W10 A;  1RUW A;  4LNP A;  1J3T A;  4HVU A;  1GFD A;  1K0S A;  2K79 A;  2EQI A;  1CKB A;  1V1C A;  1X69 A;  1WLP B;  1M3B A;  4AG1 C;  1LCK A;  1GRI A;  1HSQ A;  1K4U S;  4OMP A;  1JXM A;  1B3Q A;  4Y92 A;  2JW4 A;  1PHT A;  1ZUK A;  5IXB A;  4KRT A;  2JT4 A;  1QWE A;  2RPN A;  2O2O A;  4LUE A;  1NYG A;  1QLY A;  2ENM A;  2EPD A;  2LZ6 B;  2JS0 A;  1VYT A;  2DL5 A;  4RUG A;  3M0U A;  4LN2 A;  3KFV A;  4DEY A;  2RF0 A;  2DL8 A;  3THK A;  4OMN A;  2CUD A;  4OML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...