2HESX

Cytosolic iron-sulphur assembly protein- 1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
324
structure length
308
Chain Sequence
b'SINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKFEMDLLAIIEEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLTILATGGDDGIVNFWSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ydr267cp
publication title Structure of the Yeast WD40 Domain Protein Cia1, a Component Acting Late in Iron-Sulfur Protein Biogenesis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Biosynthetic protein
total genus 81
structure length 308
sequence length 324
ec nomenclature
pdb deposition date 2006-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hesX00
3CFSB 3EI1B 4EWRA 4A08B 3VH0A 4XEIC 3KRXB 5JWZA 5FKRA 4GQ2P 4J81A 4ZOYA 5H17A 3IJ1A 5A2Qg 2CN2A 2H13A 5TDHB 4NSXA 3I8EA 3FGBA 4H5JA 3MKQA 3E0CA 2H9LA 4JSXC 4FWWA 3J81g 3SJLD 4ZOVA 4OZUA 3SLED 2P9UC 3RRMC 5THAA 3UVOA 4KFMB 4QQEA 5IGQA 1N6DA 2H9PA 5K1CC 2OK4A 5IC7A 3JPXA 2AGZA 5C2VB 3EWEA 3RMZD 2UZYB 5IGOA 3OKYA 1FWXA 4FAND 2HESX 4A2LA 3L4MD 3UVKA 4A08A 2CO0C 3IIYA 2P9IC 4FA5D 2CE9A 4FA1D 3AH8B 2O9KA 2QXVA 4GQBB 4CZVA 2H47A 3SWSD 4ES0A 4JT6C 5GXHA 4R7AB 4FAVD 1SHYB 3RN0D 3AFCA 3SHFA 3C99A 3I89A 1PGUA 2OJYA 2P9KC 1QNIA 1OMWB 4CI2A 3OKTA 5HQGA 4QRJA 4X61B 3FRXA 4I79A 3P4FA 2I3TA 1NEXB 5FLXg 2IUPA 5HE1B 3K27A 2P9SC 5AFU3 1RI6A 5EMKB 3N0EA 3DM0A 4A09A 4PNKB 2OIZA 5I5MA 4XYHA 1PI6A 3MMYA 2OVRB 4FHLA 3SN6B 3SVWD 4GM3A 2Q7QA 3C75H 4JSPC 5FKQA 1U4CA 5IJ8E 4JSNC 3SMRA 3BG0A 3I8CA 3UVNA 2H6NA 4PXWA 5B4WA 4J78A 4H5IA 2GNQA 5I5JA 5CXCA 3NVQA 2XL2A 2CNXA 3I7HA 1OLZA 1N6EA 3UVMA 3FM0A 2HYEA 4A0AB 4J8GA 3ZWLB 2I0RA 3JROA 4GM8A 4GQ1A 1NR0A 3OL2A 4PSXB 2XU7A 4ERYA 3OKYB 3IIWA 2HJBA 4A0BA 3DXMC 5GXIA 3NVNA 4FA4D 2IUVA 2H68A 3OKWA 3EI3B 3BG1A 3PXSD 3AL8A 2I0TA 4GM9A 4O3TB 2H9NA 4E5ZA 4GMBA 5H14A 4O45A 4TZ4A 2P9NC 3VA6A 4FA9D 2I0SA 4BL0A 5SXMA 5EALA 3SXTD 1XKSA 3UKRC 1YFQA 1VYHC 2Z2NA 3A0FA 3SFZA 3C5MA 3JZHA 4A0AA 1XIPA 2G9AA 2IURA 3DSMA 3W15A 5CXBA 3U4YA 3MZLA 4GZ8A 5EAMA 5FA5B 1A0RB 5EM2B 1TYQC 5CYKA 4A09B 3EI2A 2H9MA 3RFHA 2H3XA 3MKSB 4CI3A 3I7KA 1P22A 1K8KC 4CI8A 3EI3A 3IJ0A 4ZOXA 4X3EA 2B5LA 4GGCA 3PE7A 4J87A 4CY3A 5CXCB 3F3PA 5HE0B 3GFCA 2GC7A 3MXXA 3RN1D 4O3UB 5EAPA 4Y7RA 4QL1A 3JZGA 4LG8A 3V9FA 4JXMA 3KRWB 2AH1A 1JMXB 1MDAH 4E54A 3OL2B 2HKRA 3DXKC 4A0BB 3RLMD 2P9PC 5C2WB 5EMLB 2PBIB 3BWSA 5EM2A 3J80g 3I2NA 1B9XA 2XL3A 1JOFA 3I7LA 1SQ9A 3EG6A 3AL8B 1PBYB 2HXCA 3JAMg 2H6KA 5HYNB 5EMMB 1Q47A 2PM9A 4E5ZB 1MG2A 4L3HD 3F3GA 3EI4A 5EMJB 4N14A 3UR4A 4CY1A 4J82A 4FB1D 2J56H 1MG3A 4J8BA 2QC5A 2Z2PA 3CFVA 4YVDA 4JT5C 2AGXA 5IT9g 2J55H 5HE3B 2W18A 4Y5RD 2H6QA 5CXBB 4CZXA 5FKTA 1R5MA 4D0KA 1TBGA 3SBQA 1GOTB 4PBYA 2HJ4A 5CYKB 2IUQA 3EI2B 2YNNA 1GP2B 4D6VA 2B4EA 3IJCA 4G56B 4L3GD 4LGNA 4J0WA 2YMUA 1B9YA 2UZXB 4GGAA 4L1QD 4JD2C 4J73A 4CZYA 2YB8B 3UKUC 1K32A 4MK0B 1JJUB 3B7FA 4O1QD 2EBSA 4ZOZA 2GC4A 2YNPA 5C9ZB 3JZNA 2CO0A 4E54B 4A7JA 2H14A 3HFQA 3ORVD 5EARA 1PEVA 3UVLA 2OK6A 4Z8LA 5AMSA 5K19A 4PC0A 2AGLA 3ULEC 1XHMA 4PSWB 4J84A 3L4OD 3EU7A 3N0DA 4CY5A 4L9OA 2PM9B 3SCYA 3EI4B 1U2VC 4X60B 4ZN4A 4CI1A 4AOWA 4JSVC 3V5WB 2I3SA 4BUJC 4U7AA 4LG9A 1L0QA 3EMHA 3EI1A 3ODTA 4XYIA 3PVWB 3CIKB 3JRPA 3C9CA 2G99A 5FQDA 4A11B 5I5IA 2IWFA 4BH6A 4U1EI 2P9LC 4IMMA 3VGZA 4PBZA 2CE8A 3DWLC 4O9DA 2HKMA 3GREA 4J86A 2PM7B 2YBAA 4ERQA 2AGWA 2XYIA 4GGDA 5KDOB 5TEFA 3SBRA 5AJAA 3RSEC 4HDJA 4IA9A 2MTAH 2AH0A 2BBKH 3NVXA 3PXWD 2BCJB 2TRCB 2CN3A 2Z2OA 4ESGA 3AL9A 3PSCB 1GG2B 4ERZA 2B5MA 2B5NA 3MZKA 4CY2A 5TF2A 4CC9A 4QT8A 1SQJA 2OVQB 3K26A 3F3FA 2IWKA 3PVUB 5FXYA 5GSAA 3I7NA 4OWRA 4UI9R 4A11A 5H1MA 2OVPB 2J57G 1ERJA 5HE2B 5GMKn 2YNOA 5FKSA 1N6FA 3PSLA 1JMZB 3JB9L 5IJ7E 5TEEA 2AQ5A 3I7PA 4K3JB 4A2MA 2IAAA 3I7OA 4J77A 3OTTA 4K3ID 4X63B 2PM6B 2AGYA 3V7DB 1S4UX 4AEZA 3OW8A 3PXTD 1GXRA 4J79A 3SBPA 3RFGA 3IKOA 4J0XA
chains in the Genus database with same CATH superfamily
3CFSB 3EI1B 1C9IA 4EWRA 4A08B 3VH0A 4XEIC 3KRXB 5JWZA 5FKRA 4GQ2P 4J81A 4ZOYA 5H17A 3IJ1A 5A2Qg 2CN2A 2H13A 5TDHB 4NSXA 3I8EA 3FGBA 4H5JA 3MKQA 3E0CA 4WJKA 2H9LA 4JSXC 1T2XA 4FWWA 5M5RA 3J81g 3SJLD 4ZOVA 4OZUA 3IURA 3SLED 2P9UC 5E6RA 4BP9A 3RRMC 5THAA 3UVOA 4Z7OA 4KFMB 4QQEA 4WK0A 5IGQA 1N6DA 2H9PA 5K1CC 2OK4A 5IC7A 5C92A 4J0XA 3JPXA 3O4GA 2AGZA 5C2VB 3EWEA 2VDQA 1E8NA 3RMZD 2UZYB 5IGOA 4MMZA 3OKYA 1FWXA 4FAND 3V4PA 2HESX 4A2LA 3L4MD 3UVKA 1BPOA 4A08A 1H2XA 2CO0C 3IIYA 5M5VA 4DNWA 2P9IC 2VZ3A 4FA5D 1H2ZA 5HDBA 4Z7NA 2CE9A 4FA1D 3AH8B 2O9KA 2QXVA 4GQBB 4CZVA 2H47A 2VDRA 3SWSD 4ES0A 3EQ7A 4JT6C 5GXHA 4R7AB 3VI3A 2VDLA 4FAVD 4IRZA 3IUMA 1SHYB 3RN0D 3AFCA 3SHFA 3C99A 3I89A 1PGUA 2OJYA 2P9KC 3IUJA 3VI4A 1UOQA 1QNIA 1OMWB 2XZGA 4CI2A 3OKTA 5HQGA 4G1MA 4QRJA 4X61B 3FRXA 4I79A 3P4FA 2I3TA 1NEXB 5FLXg 2IUPA 5HE1B 4AX4A 3K27A 2P9SC 1E5TA 5AFU3 1RI6A 5EMKB 3N0EA 3QHYB 3DM0A 4AMZA 4A09A 2QR5A 4PNKB 2OIZA 5I5MA 4XYHA 1PI6A 3MMYA 2OVRB 4FHLA 3SN6B 3SVWD 4GM3A 2Q7QA 3C75H 4JSPC 5FKQA 1U4CA 5IJ8E 4JSNC 3SMRA 3BG0A 3I8CA 3EQ9A 2H6NA 3UVNA 4PXWA 5B4WA 1GOHA 4J78A 4H5IA 2GNQA 5M61A 5I5JA 5CXCA 3NVQA 2XL2A 3NIGA 2CNXA 3I7HA 3KCIA 3NIFA 1OLZA 4NC4A 1N6EA 3UVMA 3K72A 3FM0A 2HYEA 4A0AB 4J8GA 3ZDXA 3ZE0A 3ZWLB 4D9SA 2I0RA 1H2YA 3JROA 4GM8A 4GQ1A 1NR0A 3ZE2A 3OL2A 4PSXB 2XU7A 3GD1I 4ERYA 1UOOA 3OKYB 3IIWA 2HJBA 4A0BA 3DXMC 5GXIA 3NVNA 3MUNA 4FA4D 2IUVA 2H68A 3V4VA 1U8CA 3OKWA 1QFMA 5E6UA 4NBMA 3EI3B 3BG1A 3PXSD 3AL8A 2I0TA 5M5UA 3IUQA 4GM9A 4L1MA 3NIDA 4O3TB 2H9NA 4E5ZA 1JTDB 4GMBA 5H14A 4O45A 2VZ1A 4TZ4A 2P9NC 1UOPA 3VA6A 4FA9D 2VDNA 2I0SA 3IUNA 3QI0A 4BL0A 5SXMA 3IULA 5EALA 1E8MA 1XKSA 1A12A 2QZPA 3SXTD 3UKRC 3ZDYA 1YFQA 2VDPA 1VYHC 1TYEA 2Z2NA 3A0FA 3SFZA 1VE6A 3C5MA 3JZHA 4O02A 3IVMA 4A0AA 1XIPA 2G9AA 2IURA 2XE4A 3W15A 5CXBA 3U4YA 3MZLA 4GZ8A 5EAMA 5FA5B 1A0RB 4RE5A 5EM2B 1TYQC 4RE6A 5CYKA 4A09B 3EI2A 2H9MA 4UM8A 3RFHA 3ZE1A 2H3XA 3MKSB 3ZDZA 4CI3A 3I7KA 3MUOA 1P22A 1K8KC 4MMXA 4CI8A 3EI3A 3IJ0A 4UM9A 1K3IA 4ZOXA 4X3EA 2B5LA 4GGCA 3PE7A 4J87A 4AN1A 1O6FA 4CY3A 2HU8A 5CXCB 3F3PA 5HE0B 4AMYA 4MMYA 3GFCA 2GC7A 3MXXA 3RN1D 4O3UB 5EAPA 2EIEA 4Y7RA 4QL1A 2VDMA 3JZGA 4LG8A 3V9FA 4JXMA 3KRWB 4AN0A 2AH1A 2HU7A 4O2WA 1JMXB 1MDAH 4E54A 3OL2B 2HKRA 3DXKC 4WK4A 4A0BB 3T3PA 3RLMD 2P9PC 5C86A 5C2WB 5EMLB 3DDUA 2PBIB 3BWSA 5EM2A 3J80g 3I2NA 1B9XA 2XL3A 3K71A 1JOFA 3I7LA 1SQ9A 3EG6A 3AL8B 1PBYB 2HXCA 3JAMg 2H6KA 5HYNB 5EMMB 1Q47A 2VC2A 3GC3B 2PM9A 1VZ3A 4E5ZB 1MG2A 4L3HD 3F3GA 3EI4A 5EMJB 4N14A 3UR4A 4CY1A 4J82A 2JKXA 4FB1D 2J56H 2VDOA 1MG3A 4J8BA 2QC5A 2Z2PA 3CFVA 4YVDA 4JT5C 3OF7A 2AGXA 5IT9g 2J55H 5HE3B 2W18A 4Y5RD 2H6QA 5CXBB 4CZXA 5FKTA 1R5MA 4D0KA 1TBGA 3SBQA 1GOTB 4PBYA 2HJ4A 5CYKB 2IUQA 3EI2B 2YNNA 1GP2B 4D6VA 2B4EA 5FFOA 3IJCA 4G56B 2WQ8A 4L3GD 4LGNA 3K6SA 4J0WA 2YMUA 1B9YA 2UZXB 4GGAA 3O4IA 4L1QD 4JD2C 4J73A 4CZYA 2YB8B 3UKUC 4WK2A 1K32A 2VDKA 4MK0B 1JJUB 3B7FA 4O1QD 4BP8A 2EBSA 4ZOZA 2GC4A 2HU5A 2YNPA 5C9ZB 3O4HA 3JZNA 2CO0A 3MVDK 4E54B 4A7JA 2H14A 1H2WA 3HFQA 3IJEA 3ORVD 5EARA 1PEVA 1JV2A 3UVLA 2OK6A 4Z8LA 5AMSA 5K19A 2EIDA 4PC0A 2AGLA 3ULEC 1XHMA 4DNVA 4PSWB 4J84A 3L4OD 3EU7A 3N0DA 4CY5A 4L9OA 2PM9B 3SCYA 3EI4B 1C9LA 1U2VC 4X60B 4ZN4A 4CI1A 4AOWA 4JHPC 4JSVC 3FCUA 3V5WB 2I3SA 1VE7A 4G1EA 4BUJC 2EIBA 4U7AA 4LG9A 1L0QA 3EMHA 3EI1A 3ODTA 4XYIA 3PVWB 3CIKB 3JRPA 3C9CA 2G99A 1L5GA 1VZ2A 5FQDA 1GOGA 4A11B 5I5IA 3FCSA 5M5TA 2IWFA 1QFSA 4BH6A 4U1EI 2P9LC 4IMMA 3VGZA 4PBZA 2BKLA 2CE8A 1M1XA 3DWLC 1O6GA 4O9DA 2HKMA 3GREA 4J86A 2PM7B 2YBAA 4ERQA 2AGWA 2XYIA 4GGDA 5KDOB 5TEFA 3SBRA 4BCCA 5AJAA 3RSEC 4HDJA 4BCBA 4IA9A 3O4JA 2MTAH 2AH0A 2BBKH 3NVXA 4G55A 5E6SA 3PXWD 2BCJB 3EQ8A 4JHNA 2TRCB 2CN3A 2Z2OA 4ESGA 3AL9A 3PSCB 1GG2B 4ERZA 2B5MA 2B5NA 3MZKA 4CY2A 5TF2A 4CC9A 4QT8A 4NENA 1SQJA 2OVQB 3K26A 3F3FA 2IWKA 3PVUB 5FXYA 5GSAA 3I7NA 4OWRA 1UTCA 4UI9R 4A11A 4Z7QA 5H1MA 5M5SA 2OVPB 2J57G 1ERJA 5HE2B 5GMKn 2YNOA 4DNUA 5FKSA 1GOFA 4QAMA 2XDWA 1N6FA 3PSLA 5FFGA 1JMZB 3JB9L 1YR2A 5IJ7E 5TEEA 2AQ5A 2EICA 3I7PA 4K3JB 2IAAA 3T3MA 4A2MA 3I7OA 4J77A 3OTTA 4K3ID 4X63B 1I2MB 4NAAA 2PM6B 2AGYA 3V7DB 1S4UX 4AEZA 3OW8A 3PXTD 1GXRA 4J79A 4BCDA 3SBPA 3RFGA 3IKOA 3DSMA
chains in the Genus database with same CATH topology
3CFSB 3EI1B 4EWRA 4A08B 3VH0A 4XEIC 3KRXB 5JWZA 5FKRA 4GQ2P 4J81A 4ZOYA 5H17A 3IJ1A 5A2Qg 2CN2A 2H13A 5TDHB 4NSXA 3I8EA 3FGBA 4H5JA 3MKQA 3E0CA 2H9LA 4JSXC 4FWWA 3J81g 3SJLD 4ZOVA 4OZUA 3SLED 2P9UC 3RRMC 5THAA 3UVOA 4KFMB 4QQEA 5IGQA 1N6DA 2H9PA 5K1CC 2OK4A 5IC7A 3JPXA 2AGZA 5C2VB 3EWEA 3RMZD 2UZYB 5IGOA 3OKYA 1FWXA 4FAND 2HESX 4A2LA 3L4MD 3UVKA 4A08A 2CO0C 3IIYA 2P9IC 4FA5D 2CE9A 4FA1D 3AH8B 2O9KA 2QXVA 4GQBB 4CZVA 2H47A 3SWSD 4ES0A 4JT6C 5GXHA 4R7AB 4FAVD 1SHYB 3RN0D 3AFCA 3SHFA 3C99A 3I89A 1PGUA 2OJYA 2P9KC 1QNIA 1OMWB 4CI2A 3OKTA 5HQGA 4QRJA 4X61B 3FRXA 4I79A 3P4FA 2I3TA 1NEXB 5FLXg 2IUPA 5HE1B 3K27A 2P9SC 5AFU3 1RI6A 5EMKB 3N0EA 3DM0A 4A09A 4PNKB 2OIZA 5I5MA 4XYHA 1PI6A 3MMYA 2OVRB 4FHLA 3SN6B 3SVWD 4GM3A 2Q7QA 3C75H 4JSPC 5FKQA 1U4CA 5IJ8E 4JSNC 3SMRA 3BG0A 3I8CA 3UVNA 2H6NA 4PXWA 5B4WA 4J78A 4H5IA 2GNQA 5I5JA 5CXCA 3NVQA 2XL2A 2CNXA 3I7HA 1OLZA 1N6EA 3UVMA 3FM0A 2HYEA 4A0AB 4J8GA 3ZWLB 2I0RA 3JROA 4GM8A 4GQ1A 1NR0A 3OL2A 4PSXB 2XU7A 4ERYA 3OKYB 3IIWA 2HJBA 4A0BA 3DXMC 5GXIA 3NVNA 4FA4D 2IUVA 2H68A 3OKWA 3EI3B 3BG1A 3PXSD 3AL8A 2I0TA 4GM9A 4O3TB 2H9NA 4E5ZA 4GMBA 5H14A 4O45A 4TZ4A 2P9NC 3VA6A 4FA9D 2I0SA 4BL0A 5SXMA 5EALA 3SXTD 1XKSA 3UKRC 1YFQA 1VYHC 2Z2NA 3A0FA 3SFZA 3C5MA 3JZHA 4A0AA 1XIPA 2G9AA 2IURA 3DSMA 3W15A 5CXBA 3U4YA 3MZLA 4GZ8A 5EAMA 5FA5B 1A0RB 5EM2B 1TYQC 5CYKA 4A09B 3EI2A 2H9MA 3RFHA 2H3XA 3MKSB 4CI3A 3I7KA 1P22A 1K8KC 4CI8A 3EI3A 3IJ0A 4ZOXA 4X3EA 2B5LA 4GGCA 3PE7A 4J87A 4CY3A 5CXCB 3F3PA 5HE0B 3GFCA 2GC7A 3MXXA 3RN1D 4O3UB 5EAPA 4Y7RA 4QL1A 3JZGA 4LG8A 3V9FA 4JXMA 3KRWB 2AH1A 1JMXB 1MDAH 4E54A 3OL2B 2HKRA 3DXKC 4A0BB 3RLMD 2P9PC 5C2WB 5EMLB 2PBIB 3BWSA 5EM2A 3J80g 3I2NA 1B9XA 2XL3A 1JOFA 3I7LA 1SQ9A 3EG6A 3AL8B 1PBYB 2HXCA 3JAMg 2H6KA 5HYNB 5EMMB 1Q47A 2PM9A 4E5ZB 1MG2A 4L3HD 3F3GA 3EI4A 5EMJB 4N14A 3UR4A 4CY1A 4J82A 4FB1D 2J56H 1MG3A 4J8BA 2QC5A 2Z2PA 3CFVA 4YVDA 4JT5C 2AGXA 5IT9g 2J55H 5HE3B 2W18A 4Y5RD 2H6QA 5CXBB 4CZXA 5FKTA 1R5MA 4D0KA 1TBGA 3SBQA 1GOTB 4PBYA 2HJ4A 5CYKB 2IUQA 3EI2B 2YNNA 1GP2B 4D6VA 2B4EA 3IJCA 4G56B 4L3GD 4LGNA 4J0WA 2YMUA 1B9YA 2UZXB 4GGAA 4L1QD 4JD2C 4J73A 4CZYA 2YB8B 3UKUC 1K32A 4MK0B 1JJUB 3B7FA 4O1QD 2EBSA 4ZOZA 2GC4A 2YNPA 5C9ZB 3JZNA 2CO0A 4E54B 4A7JA 2H14A 3HFQA 3ORVD 5EARA 1PEVA 3UVLA 2OK6A 4Z8LA 5AMSA 5K19A 4PC0A 2AGLA 3ULEC 1XHMA 4PSWB 4J84A 3L4OD 3EU7A 3N0DA 4CY5A 4L9OA 2PM9B 3SCYA 3EI4B 1U2VC 4X60B 4ZN4A 4CI1A 4AOWA 4JSVC 3V5WB 2I3SA 4BUJC 4U7AA 4LG9A 1L0QA 3EMHA 3EI1A 3ODTA 4XYIA 3PVWB 3CIKB 3JRPA 3C9CA 2G99A 5FQDA 4A11B 5I5IA 2IWFA 4BH6A 4U1EI 2P9LC 4IMMA 3VGZA 4PBZA 2CE8A 3DWLC 4O9DA 2HKMA 3GREA 4J86A 2PM7B 2YBAA 4ERQA 2AGWA 2XYIA 4GGDA 5KDOB 5TEFA 3SBRA 5AJAA 3RSEC 4HDJA 4IA9A 2MTAH 2AH0A 2BBKH 3NVXA 3PXWD 2BCJB 2TRCB 2CN3A 2Z2OA 4ESGA 3AL9A 3PSCB 1GG2B 4ERZA 2B5MA 2B5NA 3MZKA 4CY2A 5TF2A 4CC9A 4QT8A 1SQJA 2OVQB 3K26A 3F3FA 2IWKA 3PVUB 5FXYA 5GSAA 3I7NA 4OWRA 4UI9R 4A11A 5H1MA 2OVPB 2J57G 1ERJA 5HE2B 5GMKn 2YNOA 5FKSA 1N6FA 3PSLA 1JMZB 3JB9L 5IJ7E 5TEEA 2AQ5A 3I7PA 4K3JB 4A2MA 2IAAA 3I7OA 4J77A 3OTTA 4K3ID 4X63B 2PM6B 2AGYA 3V7DB 1S4UX 4AEZA 3OW8A 3PXTD 1GXRA 4J79A 3SBPA 3RFGA 3IKOA 4J0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFS B;  3EI1 B;  4EWR A;  4A08 B;  3VH0 A;  4XEI C;  3KRX B;  5JWZ A;  5FKR A;  4GQ2 P;  4J81 A;  4ZOY A;  5H17 A;  3IJ1 A;  5A2Q g;  2CN2 A;  2H13 A;  5TDH B;  4NSX A;  3I8E A;  3FGB A;  4H5J A;  3MKQ A;  3E0C A;  2H9L A;  4JSX C;  4FWW A;  3J81 g;  3SJL D;  4ZOV A;  4OZU A;  3SLE D;  2P9U C;  3RRM C;  5THA A;  3UVO A;  4KFM B;  4QQE A;  5IGQ A;  1N6D A;  2H9P A;  5K1C C;  2OK4 A;  5IC7 A;  3JPX A;  2AGZ A;  5C2V B;  3EWE A;  3RMZ D;  2UZY B;  5IGO A;  3OKY A;  1FWX A;  4FAN D;  2HES X;  4A2L A;  3L4M D;  3UVK A;  4A08 A;  2CO0 C;  3IIY A;  2P9I C;  4FA5 D;  2CE9 A;  4FA1 D;  3AH8 B;  2O9K A;  2QXV A;  4GQB B;  4CZV A;  2H47 A;  3SWS D;  4ES0 A;  4JT6 C;  5GXH A;  4R7A B;  4FAV D;  1SHY B;  3RN0 D;  3AFC A;  3SHF A;  3C99 A;  3I89 A;  1PGU A;  2OJY A;  2P9K C;  1QNI A;  1OMW B;  4CI2 A;  3OKT A;  5HQG A;  4QRJ A;  4X61 B;  3FRX A;  4I79 A;  3P4F A;  2I3T A;  1NEX B;  5FLX g;  2IUP A;  5HE1 B;  3K27 A;  2P9S C;  5AFU 3;  1RI6 A;  5EMK B;  3N0E A;  3DM0 A;  4A09 A;  4PNK B;  2OIZ A;  5I5M A;  4XYH A;  1PI6 A;  3MMY A;  2OVR B;  4FHL A;  3SN6 B;  3SVW D;  4GM3 A;  2Q7Q A;  3C75 H;  4JSP C;  5FKQ A;  1U4C A;  5IJ8 E;  4JSN C;  3SMR A;  3BG0 A;  3I8C A;  3UVN A;  2H6N A;  4PXW A;  5B4W A;  4J78 A;  4H5I A;  2GNQ A;  5I5J A;  5CXC A;  3NVQ A;  2XL2 A;  2CNX A;  3I7H A;  1OLZ A;  1N6E A;  3UVM A;  3FM0 A;  2HYE A;  4A0A B;  4J8G A;  3ZWL B;  2I0R A;  3JRO A;  4GM8 A;  4GQ1 A;  1NR0 A;  3OL2 A;  4PSX B;  2XU7 A;  4ERY A;  3OKY B;  3IIW A;  2HJB A;  4A0B A;  3DXM C;  5GXI A;  3NVN A;  4FA4 D;  2IUV A;  2H68 A;  3OKW A;  3EI3 B;  3BG1 A;  3PXS D;  3AL8 A;  2I0T A;  4GM9 A;  4O3T B;  2H9N A;  4E5Z A;  4GMB A;  5H14 A;  4O45 A;  4TZ4 A;  2P9N C;  3VA6 A;  4FA9 D;  2I0S A;  4BL0 A;  5SXM A;  5EAL A;  3SXT D;  1XKS A;  3UKR C;  1YFQ A;  1VYH C;  2Z2N A;  3A0F A;  3SFZ A;  3C5M A;  3JZH A;  4A0A A;  1XIP A;  2G9A A;  2IUR A;  3DSM A;  3W15 A;  5CXB A;  3U4Y A;  3MZL A;  4GZ8 A;  5EAM A;  5FA5 B;  1A0R B;  5EM2 B;  1TYQ C;  5CYK A;  4A09 B;  3EI2 A;  2H9M A;  3RFH A;  2H3X A;  3MKS B;  4CI3 A;  3I7K A;  1P22 A;  1K8K C;  4CI8 A;  3EI3 A;  3IJ0 A;  4ZOX A;  4X3E A;  2B5L A;  4GGC A;  3PE7 A;  4J87 A;  4CY3 A;  5CXC B;  3F3P A;  5HE0 B;  3GFC A;  2GC7 A;  3MXX A;  3RN1 D;  4O3U B;  5EAP A;  4Y7R A;  4QL1 A;  3JZG A;  4LG8 A;  3V9F A;  4JXM A;  3KRW B;  2AH1 A;  1JMX B;  1MDA H;  4E54 A;  3OL2 B;  2HKR A;  3DXK C;  4A0B B;  3RLM D;  2P9P C;  5C2W B;  5EML B;  2PBI B;  3BWS A;  5EM2 A;  3J80 g;  3I2N A;  1B9X A;  2XL3 A;  1JOF A;  3I7L A;  1SQ9 A;  3EG6 A;  3AL8 B;  1PBY B;  2HXC A;  3JAM g;  2H6K A;  5HYN B;  5EMM B;  1Q47 A;  2PM9 A;  4E5Z B;  1MG2 A;  4L3H D;  3F3G A;  3EI4 A;  5EMJ B;  4N14 A;  3UR4 A;  4CY1 A;  4J82 A;  4FB1 D;  2J56 H;  1MG3 A;  4J8B A;  2QC5 A;  2Z2P A;  3CFV A;  4YVD A;  4JT5 C;  2AGX A;  5IT9 g;  2J55 H;  5HE3 B;  2W18 A;  4Y5R D;  2H6Q A;  5CXB B;  4CZX A;  5FKT A;  1R5M A;  4D0K A;  1TBG A;  3SBQ A;  1GOT B;  4PBY A;  2HJ4 A;  5CYK B;  2IUQ A;  3EI2 B;  2YNN A;  1GP2 B;  4D6V A;  2B4E A;  3IJC A;  4G56 B;  4L3G D;  4LGN A;  4J0W A;  2YMU A;  1B9Y A;  2UZX B;  4GGA A;  4L1Q D;  4JD2 C;  4J73 A;  4CZY A;  2YB8 B;  3UKU C;  1K32 A;  4MK0 B;  1JJU B;  3B7F A;  4O1Q D;  2EBS A;  4ZOZ A;  2GC4 A;  2YNP A;  5C9Z B;  3JZN A;  2CO0 A;  4E54 B;  4A7J A;  2H14 A;  3HFQ A;  3ORV D;  5EAR A;  1PEV A;  3UVL A;  2OK6 A;  4Z8L A;  5AMS A;  5K19 A;  4PC0 A;  2AGL A;  3ULE C;  1XHM A;  4PSW B;  4J84 A;  3L4O D;  3EU7 A;  3N0D A;  4CY5 A;  4L9O A;  2PM9 B;  3SCY A;  3EI4 B;  1U2V C;  4X60 B;  4ZN4 A;  4CI1 A;  4AOW A;  4JSV C;  3V5W B;  2I3S A;  4BUJ C;  4U7A A;  4LG9 A;  1L0Q A;  3EMH A;  3EI1 A;  3ODT A;  4XYI A;  3PVW B;  3CIK B;  3JRP A;  3C9C A;  2G99 A;  5FQD A;  4A11 B;  5I5I A;  2IWF A;  4BH6 A;  4U1E I;  2P9L C;  4IMM A;  3VGZ A;  4PBZ A;  2CE8 A;  3DWL C;  4O9D A;  2HKM A;  3GRE A;  4J86 A;  2PM7 B;  2YBA A;  4ERQ A;  2AGW A;  2XYI A;  4GGD A;  5KDO B;  5TEF A;  3SBR A;  5AJA A;  3RSE C;  4HDJ A;  4IA9 A;  2MTA H;  2AH0 A;  2BBK H;  3NVX A;  3PXW D;  2BCJ B;  2TRC B;  2CN3 A;  2Z2O A;  4ESG A;  3AL9 A;  3PSC B;  1GG2 B;  4ERZ A;  2B5M A;  2B5N A;  3MZK A;  4CY2 A;  5TF2 A;  4CC9 A;  4QT8 A;  1SQJ A;  2OVQ B;  3K26 A;  3F3F A;  2IWK A;  3PVU B;  5FXY A;  5GSA A;  3I7N A;  4OWR A;  4UI9 R;  4A11 A;  5H1M A;  2OVP B;  2J57 G;  1ERJ A;  5HE2 B;  5GMK n;  2YNO A;  5FKS A;  1N6F A;  3PSL A;  1JMZ B;  3JB9 L;  5IJ7 E;  5TEE A;  2AQ5 A;  3I7P A;  4K3J B;  4A2M A;  2IAA A;  3I7O A;  4J77 A;  3OTT A;  4K3I D;  4X63 B;  2PM6 B;  2AGY A;  3V7D B;  1S4U X;  4AEZ A;  3OW8 A;  3PXT D;  1GXR A;  4J79 A;  3SBP A;  3RFG A;  3IKO A;  4J0X A; 
#chains in the Genus database with same CATH topology
 3CFS B;  3EI1 B;  1C9I A;  4EWR A;  4A08 B;  3VH0 A;  4XEI C;  3KRX B;  5JWZ A;  5FKR A;  4GQ2 P;  4J81 A;  4ZOY A;  5H17 A;  3IJ1 A;  5A2Q g;  2CN2 A;  2H13 A;  5TDH B;  4NSX A;  3I8E A;  3FGB A;  4H5J A;  3MKQ A;  3E0C A;  4WJK A;  2H9L A;  4JSX C;  1T2X A;  4FWW A;  5M5R A;  3J81 g;  3SJL D;  4ZOV A;  4OZU A;  3IUR A;  3SLE D;  2P9U C;  5E6R A;  4BP9 A;  3RRM C;  5THA A;  3UVO A;  4Z7O A;  4KFM B;  4QQE A;  4WK0 A;  5IGQ A;  1N6D A;  2H9P A;  5K1C C;  2OK4 A;  5IC7 A;  5C92 A;  4J0X A;  3JPX A;  3O4G A;  2AGZ A;  5C2V B;  3EWE A;  2VDQ A;  1E8N A;  3RMZ D;  2UZY B;  5IGO A;  4MMZ A;  3OKY A;  1FWX A;  4FAN D;  3V4P A;  2HES X;  4A2L A;  3L4M D;  3UVK A;  1BPO A;  4A08 A;  1H2X A;  2CO0 C;  3IIY A;  5M5V A;  4DNW A;  2P9I C;  2VZ3 A;  4FA5 D;  1H2Z A;  5HDB A;  4Z7N A;  2CE9 A;  4FA1 D;  3AH8 B;  2O9K A;  2QXV A;  4GQB B;  4CZV A;  2H47 A;  2VDR A;  3SWS D;  4ES0 A;  3EQ7 A;  4JT6 C;  5GXH A;  4R7A B;  3VI3 A;  2VDL A;  4FAV D;  4IRZ A;  3IUM A;  1SHY B;  3RN0 D;  3AFC A;  3SHF A;  3C99 A;  3I89 A;  1PGU A;  2OJY A;  2P9K C;  3IUJ A;  3VI4 A;  1UOQ A;  1QNI A;  1OMW B;  2XZG A;  4CI2 A;  3OKT A;  5HQG A;  4G1M A;  4QRJ A;  4X61 B;  3FRX A;  4I79 A;  3P4F A;  2I3T A;  1NEX B;  5FLX g;  2IUP A;  5HE1 B;  4AX4 A;  3K27 A;  2P9S C;  1E5T A;  5AFU 3;  1RI6 A;  5EMK B;  3N0E A;  3QHY B;  3DM0 A;  4AMZ A;  4A09 A;  2QR5 A;  4PNK B;  2OIZ A;  5I5M A;  4XYH A;  1PI6 A;  3MMY A;  2OVR B;  4FHL A;  3SN6 B;  3SVW D;  4GM3 A;  2Q7Q A;  3C75 H;  4JSP C;  5FKQ A;  1U4C A;  5IJ8 E;  4JSN C;  3SMR A;  3BG0 A;  3I8C A;  3EQ9 A;  2H6N A;  3UVN A;  4PXW A;  5B4W A;  1GOH A;  4J78 A;  4H5I A;  2GNQ A;  5M61 A;  5I5J A;  5CXC A;  3NVQ A;  2XL2 A;  3NIG A;  2CNX A;  3I7H A;  3KCI A;  3NIF A;  1OLZ A;  4NC4 A;  1N6E A;  3UVM A;  3K72 A;  3FM0 A;  2HYE A;  4A0A B;  4J8G A;  3ZDX A;  3ZE0 A;  3ZWL B;  4D9S A;  2I0R A;  1H2Y A;  3JRO A;  4GM8 A;  4GQ1 A;  1NR0 A;  3ZE2 A;  3OL2 A;  4PSX B;  2XU7 A;  3GD1 I;  4ERY A;  1UOO A;  3OKY B;  3IIW A;  2HJB A;  4A0B A;  3DXM C;  5GXI A;  3NVN A;  3MUN A;  4FA4 D;  2IUV A;  2H68 A;  3V4V A;  1U8C A;  3OKW A;  1QFM A;  5E6U A;  4NBM A;  3EI3 B;  3BG1 A;  3PXS D;  3AL8 A;  2I0T A;  5M5U A;  3IUQ A;  4GM9 A;  4L1M A;  3NID A;  4O3T B;  2H9N A;  4E5Z A;  1JTD B;  4GMB A;  5H14 A;  4O45 A;  2VZ1 A;  4TZ4 A;  2P9N C;  1UOP A;  3VA6 A;  4FA9 D;  2VDN A;  2I0S A;  3IUN A;  3QI0 A;  4BL0 A;  5SXM A;  3IUL A;  5EAL A;  1E8M A;  1XKS A;  1A12 A;  2QZP A;  3SXT D;  3UKR C;  3ZDY A;  1YFQ A;  2VDP A;  1VYH C;  1TYE A;  2Z2N A;  3A0F A;  3SFZ A;  1VE6 A;  3C5M A;  3JZH A;  4O02 A;  3IVM A;  4A0A A;  1XIP A;  2G9A A;  2IUR A;  2XE4 A;  3W15 A;  5CXB A;  3U4Y A;  3MZL A;  4GZ8 A;  5EAM A;  5FA5 B;  1A0R B;  4RE5 A;  5EM2 B;  1TYQ C;  4RE6 A;  5CYK A;  4A09 B;  3EI2 A;  2H9M A;  4UM8 A;  3RFH A;  3ZE1 A;  2H3X A;  3MKS B;  3ZDZ A;  4CI3 A;  3I7K A;  3MUO A;  1P22 A;  1K8K C;  4MMX A;  4CI8 A;  3EI3 A;  3IJ0 A;  4UM9 A;  1K3I A;  4ZOX A;  4X3E A;  2B5L A;  4GGC A;  3PE7 A;  4J87 A;  4AN1 A;  1O6F A;  4CY3 A;  2HU8 A;  5CXC B;  3F3P A;  5HE0 B;  4AMY A;  4MMY A;  3GFC A;  2GC7 A;  3MXX A;  3RN1 D;  4O3U B;  5EAP A;  2EIE A;  4Y7R A;  4QL1 A;  2VDM A;  3JZG A;  4LG8 A;  3V9F A;  4JXM A;  3KRW B;  4AN0 A;  2AH1 A;  2HU7 A;  4O2W A;  1JMX B;  1MDA H;  4E54 A;  3OL2 B;  2HKR A;  3DXK C;  4WK4 A;  4A0B B;  3T3P A;  3RLM D;  2P9P C;  5C86 A;  5C2W B;  5EML B;  3DDU A;  2PBI B;  3BWS A;  5EM2 A;  3J80 g;  3I2N A;  1B9X A;  2XL3 A;  3K71 A;  1JOF A;  3I7L A;  1SQ9 A;  3EG6 A;  3AL8 B;  1PBY B;  2HXC A;  3JAM g;  2H6K A;  5HYN B;  5EMM B;  1Q47 A;  2VC2 A;  3GC3 B;  2PM9 A;  1VZ3 A;  4E5Z B;  1MG2 A;  4L3H D;  3F3G A;  3EI4 A;  5EMJ B;  4N14 A;  3UR4 A;  4CY1 A;  4J82 A;  2JKX A;  4FB1 D;  2J56 H;  2VDO A;  1MG3 A;  4J8B A;  2QC5 A;  2Z2P A;  3CFV A;  4YVD A;  4JT5 C;  3OF7 A;  2AGX A;  5IT9 g;  2J55 H;  5HE3 B;  2W18 A;  4Y5R D;  2H6Q A;  5CXB B;  4CZX A;  5FKT A;  1R5M A;  4D0K A;  1TBG A;  3SBQ A;  1GOT B;  4PBY A;  2HJ4 A;  5CYK B;  2IUQ A;  3EI2 B;  2YNN A;  1GP2 B;  4D6V A;  2B4E A;  5FFO A;  3IJC A;  4G56 B;  2WQ8 A;  4L3G D;  4LGN A;  3K6S A;  4J0W A;  2YMU A;  1B9Y A;  2UZX B;  4GGA A;  3O4I A;  4L1Q D;  4JD2 C;  4J73 A;  4CZY A;  2YB8 B;  3UKU C;  4WK2 A;  1K32 A;  2VDK A;  4MK0 B;  1JJU B;  3B7F A;  4O1Q D;  4BP8 A;  2EBS A;  4ZOZ A;  2GC4 A;  2HU5 A;  2YNP A;  5C9Z B;  3O4H A;  3JZN A;  2CO0 A;  3MVD K;  4E54 B;  4A7J A;  2H14 A;  1H2W A;  3HFQ A;  3IJE A;  3ORV D;  5EAR A;  1PEV A;  1JV2 A;  3UVL A;  2OK6 A;  4Z8L A;  5AMS A;  5K19 A;  2EID A;  4PC0 A;  2AGL A;  3ULE C;  1XHM A;  4DNV A;  4PSW B;  4J84 A;  3L4O D;  3EU7 A;  3N0D A;  4CY5 A;  4L9O A;  2PM9 B;  3SCY A;  3EI4 B;  1C9L A;  1U2V C;  4X60 B;  4ZN4 A;  4CI1 A;  4AOW A;  4JHP C;  4JSV C;  3FCU A;  3V5W B;  2I3S A;  1VE7 A;  4G1E A;  4BUJ C;  2EIB A;  4U7A A;  4LG9 A;  1L0Q A;  3EMH A;  3EI1 A;  3ODT A;  4XYI A;  3PVW B;  3CIK B;  3JRP A;  3C9C A;  2G99 A;  1L5G A;  1VZ2 A;  5FQD A;  1GOG A;  4A11 B;  5I5I A;  3FCS A;  5M5T A;  2IWF A;  1QFS A;  4BH6 A;  4U1E I;  2P9L C;  4IMM A;  3VGZ A;  4PBZ A;  2BKL A;  2CE8 A;  1M1X A;  3DWL C;  1O6G A;  4O9D A;  2HKM A;  3GRE A;  4J86 A;  2PM7 B;  2YBA A;  4ERQ A;  2AGW A;  2XYI A;  4GGD A;  5KDO B;  5TEF A;  3SBR A;  4BCC A;  5AJA A;  3RSE C;  4HDJ A;  4BCB A;  4IA9 A;  3O4J A;  2MTA H;  2AH0 A;  2BBK H;  3NVX A;  4G55 A;  5E6S A;  3PXW D;  2BCJ B;  3EQ8 A;  4JHN A;  2TRC B;  2CN3 A;  2Z2O A;  4ESG A;  3AL9 A;  3PSC B;  1GG2 B;  4ERZ A;  2B5M A;  2B5N A;  3MZK A;  4CY2 A;  5TF2 A;  4CC9 A;  4QT8 A;  4NEN A;  1SQJ A;  2OVQ B;  3K26 A;  3F3F A;  2IWK A;  3PVU B;  5FXY A;  5GSA A;  3I7N A;  4OWR A;  1UTC A;  4UI9 R;  4A11 A;  4Z7Q A;  5H1M A;  5M5S A;  2OVP B;  2J57 G;  1ERJ A;  5HE2 B;  5GMK n;  2YNO A;  4DNU A;  5FKS A;  1GOF A;  4QAM A;  2XDW A;  1N6F A;  3PSL A;  5FFG A;  1JMZ B;  3JB9 L;  1YR2 A;  5IJ7 E;  5TEE A;  2AQ5 A;  2EIC A;  3I7P A;  4K3J B;  2IAA A;  3T3M A;  4A2M A;  3I7O A;  4J77 A;  3OTT A;  4K3I D;  4X63 B;  1I2M B;  4NAA A;  2PM6 B;  2AGY A;  3V7D B;  1S4U X;  4AEZ A;  3OW8 A;  3PXT D;  1GXR A;  4J79 A;  4BCD A;  3SBP A;  3RFG A;  3IKO A;  3DSM A; 
#chains in the Genus database with same CATH homology
 3CFS B;  3EI1 B;  4EWR A;  4A08 B;  3VH0 A;  4XEI C;  3KRX B;  5JWZ A;  5FKR A;  4GQ2 P;  4J81 A;  4ZOY A;  5H17 A;  3IJ1 A;  5A2Q g;  2CN2 A;  2H13 A;  5TDH B;  4NSX A;  3I8E A;  3FGB A;  4H5J A;  3MKQ A;  3E0C A;  2H9L A;  4JSX C;  4FWW A;  3J81 g;  3SJL D;  4ZOV A;  4OZU A;  3SLE D;  2P9U C;  3RRM C;  5THA A;  3UVO A;  4KFM B;  4QQE A;  5IGQ A;  1N6D A;  2H9P A;  5K1C C;  2OK4 A;  5IC7 A;  3JPX A;  2AGZ A;  5C2V B;  3EWE A;  3RMZ D;  2UZY B;  5IGO A;  3OKY A;  1FWX A;  4FAN D;  2HES X;  4A2L A;  3L4M D;  3UVK A;  4A08 A;  2CO0 C;  3IIY A;  2P9I C;  4FA5 D;  2CE9 A;  4FA1 D;  3AH8 B;  2O9K A;  2QXV A;  4GQB B;  4CZV A;  2H47 A;  3SWS D;  4ES0 A;  4JT6 C;  5GXH A;  4R7A B;  4FAV D;  1SHY B;  3RN0 D;  3AFC A;  3SHF A;  3C99 A;  3I89 A;  1PGU A;  2OJY A;  2P9K C;  1QNI A;  1OMW B;  4CI2 A;  3OKT A;  5HQG A;  4QRJ A;  4X61 B;  3FRX A;  4I79 A;  3P4F A;  2I3T A;  1NEX B;  5FLX g;  2IUP A;  5HE1 B;  3K27 A;  2P9S C;  5AFU 3;  1RI6 A;  5EMK B;  3N0E A;  3DM0 A;  4A09 A;  4PNK B;  2OIZ A;  5I5M A;  4XYH A;  1PI6 A;  3MMY A;  2OVR B;  4FHL A;  3SN6 B;  3SVW D;  4GM3 A;  2Q7Q A;  3C75 H;  4JSP C;  5FKQ A;  1U4C A;  5IJ8 E;  4JSN C;  3SMR A;  3BG0 A;  3I8C A;  3UVN A;  2H6N A;  4PXW A;  5B4W A;  4J78 A;  4H5I A;  2GNQ A;  5I5J A;  5CXC A;  3NVQ A;  2XL2 A;  2CNX A;  3I7H A;  1OLZ A;  1N6E A;  3UVM A;  3FM0 A;  2HYE A;  4A0A B;  4J8G A;  3ZWL B;  2I0R A;  3JRO A;  4GM8 A;  4GQ1 A;  1NR0 A;  3OL2 A;  4PSX B;  2XU7 A;  4ERY A;  3OKY B;  3IIW A;  2HJB A;  4A0B A;  3DXM C;  5GXI A;  3NVN A;  4FA4 D;  2IUV A;  2H68 A;  3OKW A;  3EI3 B;  3BG1 A;  3PXS D;  3AL8 A;  2I0T A;  4GM9 A;  4O3T B;  2H9N A;  4E5Z A;  4GMB A;  5H14 A;  4O45 A;  4TZ4 A;  2P9N C;  3VA6 A;  4FA9 D;  2I0S A;  4BL0 A;  5SXM A;  5EAL A;  3SXT D;  1XKS A;  3UKR C;  1YFQ A;  1VYH C;  2Z2N A;  3A0F A;  3SFZ A;  3C5M A;  3JZH A;  4A0A A;  1XIP A;  2G9A A;  2IUR A;  3DSM A;  3W15 A;  5CXB A;  3U4Y A;  3MZL A;  4GZ8 A;  5EAM A;  5FA5 B;  1A0R B;  5EM2 B;  1TYQ C;  5CYK A;  4A09 B;  3EI2 A;  2H9M A;  3RFH A;  2H3X A;  3MKS B;  4CI3 A;  3I7K A;  1P22 A;  1K8K C;  4CI8 A;  3EI3 A;  3IJ0 A;  4ZOX A;  4X3E A;  2B5L A;  4GGC A;  3PE7 A;  4J87 A;  4CY3 A;  5CXC B;  3F3P A;  5HE0 B;  3GFC A;  2GC7 A;  3MXX A;  3RN1 D;  4O3U B;  5EAP A;  4Y7R A;  4QL1 A;  3JZG A;  4LG8 A;  3V9F A;  4JXM A;  3KRW B;  2AH1 A;  1JMX B;  1MDA H;  4E54 A;  3OL2 B;  2HKR A;  3DXK C;  4A0B B;  3RLM D;  2P9P C;  5C2W B;  5EML B;  2PBI B;  3BWS A;  5EM2 A;  3J80 g;  3I2N A;  1B9X A;  2XL3 A;  1JOF A;  3I7L A;  1SQ9 A;  3EG6 A;  3AL8 B;  1PBY B;  2HXC A;  3JAM g;  2H6K A;  5HYN B;  5EMM B;  1Q47 A;  2PM9 A;  4E5Z B;  1MG2 A;  4L3H D;  3F3G A;  3EI4 A;  5EMJ B;  4N14 A;  3UR4 A;  4CY1 A;  4J82 A;  4FB1 D;  2J56 H;  1MG3 A;  4J8B A;  2QC5 A;  2Z2P A;  3CFV A;  4YVD A;  4JT5 C;  2AGX A;  5IT9 g;  2J55 H;  5HE3 B;  2W18 A;  4Y5R D;  2H6Q A;  5CXB B;  4CZX A;  5FKT A;  1R5M A;  4D0K A;  1TBG A;  3SBQ A;  1GOT B;  4PBY A;  2HJ4 A;  5CYK B;  2IUQ A;  3EI2 B;  2YNN A;  1GP2 B;  4D6V A;  2B4E A;  3IJC A;  4G56 B;  4L3G D;  4LGN A;  4J0W A;  2YMU A;  1B9Y A;  2UZX B;  4GGA A;  4L1Q D;  4JD2 C;  4J73 A;  4CZY A;  2YB8 B;  3UKU C;  1K32 A;  4MK0 B;  1JJU B;  3B7F A;  4O1Q D;  2EBS A;  4ZOZ A;  2GC4 A;  2YNP A;  5C9Z B;  3JZN A;  2CO0 A;  4E54 B;  4A7J A;  2H14 A;  3HFQ A;  3ORV D;  5EAR A;  1PEV A;  3UVL A;  2OK6 A;  4Z8L A;  5AMS A;  5K19 A;  4PC0 A;  2AGL A;  3ULE C;  1XHM A;  4PSW B;  4J84 A;  3L4O D;  3EU7 A;  3N0D A;  4CY5 A;  4L9O A;  2PM9 B;  3SCY A;  3EI4 B;  1U2V C;  4X60 B;  4ZN4 A;  4CI1 A;  4AOW A;  4JSV C;  3V5W B;  2I3S A;  4BUJ C;  4U7A A;  4LG9 A;  1L0Q A;  3EMH A;  3EI1 A;  3ODT A;  4XYI A;  3PVW B;  3CIK B;  3JRP A;  3C9C A;  2G99 A;  5FQD A;  4A11 B;  5I5I A;  2IWF A;  4BH6 A;  4U1E I;  2P9L C;  4IMM A;  3VGZ A;  4PBZ A;  2CE8 A;  3DWL C;  4O9D A;  2HKM A;  3GRE A;  4J86 A;  2PM7 B;  2YBA A;  4ERQ A;  2AGW A;  2XYI A;  4GGD A;  5KDO B;  5TEF A;  3SBR A;  5AJA A;  3RSE C;  4HDJ A;  4IA9 A;  2MTA H;  2AH0 A;  2BBK H;  3NVX A;  3PXW D;  2BCJ B;  2TRC B;  2CN3 A;  2Z2O A;  4ESG A;  3AL9 A;  3PSC B;  1GG2 B;  4ERZ A;  2B5M A;  2B5N A;  3MZK A;  4CY2 A;  5TF2 A;  4CC9 A;  4QT8 A;  1SQJ A;  2OVQ B;  3K26 A;  3F3F A;  2IWK A;  3PVU B;  5FXY A;  5GSA A;  3I7N A;  4OWR A;  4UI9 R;  4A11 A;  5H1M A;  2OVP B;  2J57 G;  1ERJ A;  5HE2 B;  5GMK n;  2YNO A;  5FKS A;  1N6F A;  3PSL A;  1JMZ B;  3JB9 L;  5IJ7 E;  5TEE A;  2AQ5 A;  3I7P A;  4K3J B;  4A2M A;  2IAA A;  3I7O A;  4J77 A;  3OTT A;  4K3I D;  4X63 B;  2PM6 B;  2AGY A;  3V7D B;  1S4U X;  4AEZ A;  3OW8 A;  3PXT D;  1GXR A;  4J79 A;  3SBP A;  3RFG A;  3IKO A;  4J0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...