2HESX

Cytosolic iron-sulphur assembly protein- 1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
324
structure length
308
Chain Sequence
SINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKFEMDLLAIIEEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLTILATGGDDGIVNFWSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ydr267cp
publication title Structure of the Yeast WD40 Domain Protein Cia1, a Component Acting Late in Iron-Sulfur Protein Biogenesis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Biosynthetic protein
total genus 81
structure length 308
sequence length 324
ec nomenclature
pdb deposition date 2006-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hesX00
5GXHA 2MTAH 2YNOA 3AL8B 1VYHC 3F3FA 4PC0A 5EMLB 3L4OD 4FA1D 1N6FA 4IA9A 2GC7A 3DXMC 5CXBA 3RFGA 3V7DB 1FWXA 2YB8B 5EAPA 4IMMA 1K8KC 1S4UX 3SJLD 3UKRC 2P9NC 5EMMB 4GQBB 3VH0A 4FAND 4LGNA 2H6KA 2OK4A 2QC5A 5HE3B 4CC9A 2H13A 5C9ZB 3A0FA 1JJUB 3J81g 3JZNA 3PVUB 4Y7RA 4U1EI 2CO0A 3JRPA 4FB1D 3J80g 4ZN4A 4A0BA 4ZOVA 2CE8A 4ZOZA 4BL0A 4L9OA 5I5MA 3PSLA 4A0AA 4N14A 2XYIA 3GFCA 3ORVD 4U7AA 4YVDA 4H5JA 4CI1A 1SQJA 5GSAA 2AH1A 4QRJA 4BUJC 3OW8A 5FKQA 2PM7B 4FHLA 2OVPB 4HDJA 3MKSB 4H5IA 5H1MA 5FQDA 2CN2A 3CIKB 3HFQA 4TZ4A 3SHFA 2BBKH 3EU7A 3F3PA 5HE0B 3MMYA 5HE1B 4R7AB 3MXXA 3JZGA 3OKYA 2TRCB 2B5NA 1TYQC 2XL2A 4GZ8A 3ULEC 2IURA 4ZOYA 3ODTA 4J81A 5H14A 3JPXA 3W15A 2CE9A 4J78A 4O3UB 4EWRA 4FA4D 4PXWA 5AFU3 5FA5B 3PXSD 5CXCB 1RI6A 4CY1A 4OZUA 2IUPA 4FAVD 3I7NA 1P22A 3U4YA 1K32A 3NVNA 3VGZA 5IJ8E 3OTTA 3SVWD 1A0RB 4ERYA 1GXRA 5I5IA 3SLED 5TEFA 1L0QA 2XL3A 3I7LA 3EI2A 5EMJB 5FKSA 5CXCA 2G9AA 2YBAA 4XYHA 3ZWLB 4A08B 3CFVA 4CZYA 1SHYB 1OLZA 3I7PA 4CZVA 2CNXA 4J77A 1JMZB 4MK0B 4CY2A 2W18A 4D0KA 5TF2A 2B4EA 3BG0A 3I7KA 4GGAA 5HQGA 3OL2A 3N0EA 4A08A 3CFSB 3JROA 4ZOXA 4JT5C 2H47A 1MG3A 4GM3A 3JAMg 2IUVA 4FA9D 3KRXB 1B9YA 4PNKB 1XHMA 4J87A 2AH0A 4A0BB 3SXTD 3V9FA 5AJAA 4Z8LA 3KRWB 4XYIA 2H68A 3I8EA 4GM8A 2I3SA 5HYNB 4GQ1A 2PM9B 2IWKA 2GNQA 4A0AB 2HYEA 4J0WA 1XKSA 2P9UC 2AGLA 1U4CA 3AFCA 2XU7A 5KDOB 3UVMA 5EALA 2I0RA 5IJ7E 4J79A 5TDHB 4L1QD 4J84A 3SWSD 3V5WB 2AQ5A 2PM9A 2AGYA 3RN1D 4KFMB 5FKRA 2H14A 3C9CA 3VA6A 2J56H 3OKYB 2QXVA 5JWZA 2IAAA 3NVQA 4L3GD 4X60B 5I5JA 2HKMA 1PBYB 3UVNA 4X63B 3EG6A 4O45A 5H17A 3SFZA 4LG8A 5EAMA 3F3GA 1U2VC 2P9IC 3UKUC 4D6VA 4X61B 3IJCA 1SQ9A 2PM6B 4J86A 4A09B 4AEZA 4JT6C 4AOWA 4CI2A 4OWRA 2GC4A 3DM0A 3PXTD 3C75H 4GQ2P 4CI3A 1PGUA 2H9PA 2B5LA 4JXMA 1JOFA 3I89A 4JSXC 2P9LC 4UI9R 3EI2B 4A09A 2OK6A 4PSXB 5B4WA 4J8BA 3EI4B 3B7FA 3PXWD 3AL9A 4K3ID 3OKTA 4JSPC 3AH8B 4JSNC 2YMUA 5A2Qg 2H6NA 3MKQA 3OL2B 3IKOA 4QT8A 3EI4A 4A2LA 5HE2B 3SBRA 4E5ZA 4BH6A 2UZYB 2H9LA 2OVQB 2I3TA 3MZLA 3DSMA 1TBGA 2HJBA 3DXKC 3NVXA 4LG9A 4JSVC 3EWEA 3FM0A 3MZKA 2H9NA 5CYKB 3E0CA 5EMKB 4JD2C 5C2WB 4QL1A 3SCYA 3SBPA 3DWLC 3I8CA 4PBYA 2H9MA 3K27A 3C99A 2Z2NA 1XIPA 4ES0A 2AGZA 5EARA 4O9DA 2OIZA 5THAA 3RLMD 5IGQA 5GXIA 3JB9L 3EI3B 3P4FA 4G56B 3BWSA 4E54A 5CYKA 2O9KA 2J55H 2OJYA 3SN6B 5GMKn 3IIYA 1N6DA 2H6QA 5EM2B 5IT9g 3AL8A 2P9KC 3I7HA 3BG1A 3EI3A 4J8GA 3EMHA 3PE7A 4O1QD 2AGWA 5FXYA 4X3EA 3IJ0A 2PBIB 4A11B 2UZXB 5EM2A 4QQEA 4ESGA 2Z2PA 4FWWA 3I2NA 4O3TB 2EBSA 3RRMC 4I79A 3I7OA 4GGDA 4K3JB 1JMXB 3SMRA 1GG2B 3GREA 3C5MA 2HESX 5IGOA 1GP2B 2BCJB 1MDAH 1OMWB 2IUQA 4FA5D 4A11A 3RFHA 2I0SA 4L3HD 2CO0C 1Q47A 3L4MD 2YNPA 1NEXB 4A2MA 2OVRB 5SXMA 5K1CC 3UVKA 4PSWB 3K26A 4Y5RD 5FKTA 4CY3A 2J57G 2B5MA 2G99A 3IIWA 4GGCA 2CN3A 3FRXA 5K19A 4A7JA 4CZXA 2HKRA 2P9PC 2YNNA 4CI8A 2AGXA 2HJ4A 5C2VB 3EI1B 4GM9A 2H3XA 2IWFA 4NSXA 3UVLA 2Q7QA 4E5ZB 4XEIC 3PVWB 1QNIA 4J0XA 3UVOA 1N6EA 3SBQA 2I0TA 1PI6A 4J73A 3EI1A 3PSCB 5AMSA 1PEVA 1YFQA 3FGBA 2HXCA 3RMZD 3JZHA 3OKWA 3IJ1A 1NR0A 3UR4A 2P9SC 3N0DA 5IC7A 4PBZA 4ERZA 2Z2OA 5TEEA 3RN0D 1R5MA 4ERQA 4E54B 3RSEC 1ERJA 4GMBA 5CXBB 5FLXg 4J82A 1MG2A 4CY5A 1GOTB 1B9XA
chains in the Genus database with same CATH superfamily
5GXHA 2MTAH 2YNOA 2XDWA 3AL8B 1VYHC 3F3FA 4PC0A 5EMLB 3L4OD 4FA1D 1N6FA 4IA9A 2GC7A 1QFMA 4AMYA 3DXMC 5CXBA 3RFGA 3V7DB 1FWXA 4JHPC 2YB8B 4G1MA 5EAPA 4IMMA 1K8KC 1S4UX 1U8CA 3SJLD 3UKRC 3K71A 5E6UA 2P9NC 2EIBA 5EMMB 4GQBB 3VH0A 4FAND 4LGNA 4BCBA 3NIGA 1H2ZA 2H6KA 2OK4A 1M1XA 5M5UA 2QC5A 5HE3B 4CC9A 2H13A 5C9ZB 3A0FA 1JJUB 3ZDZA 3J81g 3V4PA 3JZNA 3PVUB 4Y7RA 3VI4A 4U1EI 2CO0A 3JRPA 4FB1D 3J80g 4ZN4A 4A0BA 4JHNA 4ZOVA 5FFGA 2VZ1A 2CE8A 4ZOZA 4BL0A 4L9OA 1QFSA 5I5MA 3PSLA 4A0AA 4N14A 4Z7QA 2XYIA 3GFCA 2VDRA 3ORVD 4U7AA 4YVDA 4H5JA 4CI1A 1SQJA 5GSAA 1TYEA 2AH1A 4QRJA 4BUJC 3OW8A 1K3IA 5FKQA 2PM7B 4FHLA 1E8MA 2OVPB 4HDJA 3GC3B 3MKSB 4H5IA 5H1MA 5FQDA 2CN2A 3CIKB 3HFQA 4TZ4A 3SHFA 2BBKH 3EU7A 3F3PA 5HE0B 3FCSA 3MMYA 2VC2A 3IURA 5HE1B 4R7AB 3MXXA 3JZGA 3IVMA 3OKYA 2TRCB 2B5NA 1TYQC 2XL2A 4GZ8A 5M5VA 3ULEC 2IURA 2EICA 4ZOYA 3EQ8A 3O4JA 3ZE0A 3ODTA 1T2XA 4J81A 5H14A 3JPXA 3W15A 1H2YA 2CE9A 4AN1A 4J78A 4O3UB 4EWRA 4FA4D 4PXWA 4BP8A 3EQ7A 5AFU3 5E6RA 5FA5B 3PXSD 5CXCB 1RI6A 4CY1A 4OZUA 5C92A 2IUPA 4FAVD 1VE7A 3I7NA 1P22A 3U4YA 1K32A 3NVNA 3VGZA 5IJ8E 3OTTA 3SVWD 1A0RB 4ERYA 1GXRA 5M61A 5I5IA 3SLED 5TEFA 1L0QA 1YR2A 2XL3A 3DDUA 3I7LA 3EI2A 5EMJB 5FKSA 5CXCA 2G9AA 2YBAA 4XYHA 3ZWLB 4A08B 3CFVA 1L5GA 3T3MA 5M5SA 4CZYA 1SHYB 1OLZA 3MVDK 3I7PA 4CZVA 2CNXA 4J77A 4NC4A 3NIDA 1JMZB 4MK0B 4CY2A 4DNWA 2W18A 4D0KA 5TF2A 3NIFA 2B4EA 3BG0A 3I7KA 4GGAA 5HQGA 3OL2A 3N0EA 4A08A 3CFSB 3JROA 4ZOXA 4JT5C 2H47A 1MG3A 4GM3A 3JAMg 2IUVA 4FA9D 1VZ2A 3IUMA 4O2WA 3KRXB 1B9YA 2EIEA 4PNKB 1XHMA 4QAMA 4J87A 2AH0A 4A0BB 4G1EA 3T3PA 3SXTD 4WK2A 3V9FA 5AJAA 4Z8LA 3KRWB 4XYIA 2H68A 3I8EA 4GM8A 2I3SA 5HYNB 4GQ1A 2PM9B 2IWKA 2GNQA 4A0AB 2HYEA 4J0WA 5M5RA 1XKSA 2P9UC 4MMXA 2AGLA 1U4CA 1C9IA 3AFCA 2XU7A 5KDOB 3UVMA 5C86A 5EALA 2I0RA 5IJ7E 4J79A 5TDHB 4L1QD 4J84A 3ZDXA 3SWSD 3V5WB 2AQ5A 2EIDA 2PM9A 2AGYA 3RN1D 4KFMB 5FKRA 2H14A 3C9CA 3VA6A 4Z7NA 3QHYB 2J56H 3ZDYA 3OKYB 2QXVA 5JWZA 2IAAA 3NVQA 4L3GD 4X60B 5I5JA 3MUOA 2HKMA 4WK0A 1PBYB 3UVNA 4X63B 1UOOA 3EG6A 4O45A 4AMZA 5H17A 3O4GA 4WJKA 3SFZA 4LG8A 5EAMA 3F3GA 1H2WA 1U2VC 2P9IC 3UKUC 4D6VA 4X61B 3IJCA 2VDMA 1SQ9A 2PM6B 4J86A 4A09B 4AEZA 4JT6C 4AOWA 4CI2A 4OWRA 2GC4A 3DM0A 3V4VA 3PXTD 3C75H 4GQ2P 4CI3A 1PGUA 2H9PA 2B5LA 4JXMA 1JOFA 3I89A 4JSXC 1UOPA 2P9LC 2VDNA 4UI9R 3EI2B 4A09A 2OK6A 4PSXB 5B4WA 4J8BA 3EI4B 2HU8A 3B7FA 2BKLA 3PXWD 2QR5A 3AL9A 4K3ID 1VZ3A 3GD1I 3OKTA 4JSPC 3AH8B 4JSNC 2YMUA 5A2Qg 4MMZA 2H6NA 4NAAA 2JKXA 3MKQA 3O4HA 3OL2B 3IKOA 4QT8A 3ZE1A 3EI4A 4A2LA 3IUQA 5HE2B 3SBRA 4WK4A 4E5ZA 4BH6A 2UZYB 5FFOA 2H9LA 2OVQB 3IJEA 2I3TA 3MZLA 4NENA 4DNVA 3DSMA 1TBGA 2HJBA 3DXKC 3NVXA 4LG9A 4JSVC 3EWEA 2VDQA 3FM0A 3MZKA 2H9NA 2VDPA 5CYKB 3E0CA 1I2MB 5EMKB 3K72A 3KCIA 4JD2C 5C2WB 4QL1A 3SCYA 3SBPA 3DWLC 1BPOA 3I8CA 4PBYA 2H9MA 3K27A 3C99A 4D9SA 2Z2NA 1XIPA 4ES0A 2AGZA 2XE4A 5EARA 4O9DA 2OIZA 5THAA 3RLMD 5IGQA 5GXIA 3JB9L 3EI3B 3P4FA 4G56B 3BWSA 4E54A 4UM8A 4RE5A 5CYKA 2O9KA 2J55H 2OJYA 3SN6B 5GMKn 3IIYA 1N6DA 2H6QA 5EM2B 5IT9g 3AL8A 2P9KC 2VDKA 3I7HA 3BG1A 3EI3A 4J8GA 4MMYA 3EMHA 2VDLA 3PE7A 4O1QD 1UTCA 2AGWA 1E8NA 4Z7OA 5FXYA 4NBMA 4X3EA 3IJ0A 2VDOA 2PBIB 4A11B 2UZXB 1GOHA 4QQEA 5EM2A 4ESGA 4AN0A 2Z2PA 4FWWA 3I2NA 4O3TB 2EBSA 3RRMC 4I79A 3I7OA 4GGDA 4K3JB 1JMXB 3SMRA 1GG2B 5E6SA 3GREA 3C5MA 3IULA 2HESX 5IGOA 5M5TA 1GP2B 2BCJB 1MDAH 2VZ3A 1OMWB 1GOFA 2HU5A 2IUQA 4A11A 3RFHA 4FA5D 3QI0A 2I0SA 4L3HD 1GOGA 2CO0C 2WQ8A 1H2XA 3MUNA 1Q47A 3L4MD 2YNPA 1NEXB 4UM9A 4A2MA 2OVRB 5SXMA 5K1CC 3FCUA 3IUNA 3VI3A 3UVKA 1VE6A 1C9LA 4BP9A 4PSWB 3K26A 4IRZA 4Y5RD 5FKTA 4CY3A 1E5TA 1A12A 2J57G 2B5MA 2G99A 3IIWA 4GGCA 2CN3A 2HU7A 3FRXA 5K19A 4RE6A 4A7JA 4CZXA 2XZGA 2HKRA 3K6SA 2P9PC 2YNNA 4CI8A 2AGXA 2HJ4A 3OF7A 3O4IA 5C2VB 3EI1B 4GM9A 3IUJA 2H3XA 2IWFA 4NSXA 3UVLA 2Q7QA 4E5ZB 4O02A 4XEIC 1UOQA 3PVWB 1QNIA 4G55A 4J0XA 4BCCA 4L1MA 4DNUA 1JV2A 1N6EA 3SBQA 3UVOA 2I0TA 1PI6A 4J73A 3EI1A 3PSCB 5HDBA 2QZPA 5AMSA 1PEVA 1YFQA 3ZE2A 3FGBA 2HXCA 3RMZD 3JZHA 3OKWA 4AX4A 3IJ1A 1NR0A 3UR4A 2P9SC 3N0DA 5IC7A 4PBZA 4ERZA 3EQ9A 2Z2OA 5TEEA 3RN0D 1O6FA 1R5MA 4ERQA 4BCDA 4E54B 3RSEC 1ERJA 4GMBA 1JTDB 5CXBB 5FLXg 4J82A 1O6GA 1MG2A 4CY5A 1GOTB 1B9XA
chains in the Genus database with same CATH topology
5GXHA 2MTAH 2YNOA 3AL8B 1VYHC 3F3FA 4PC0A 5EMLB 3L4OD 4FA1D 1N6FA 4IA9A 2GC7A 3DXMC 5CXBA 3RFGA 3V7DB 1FWXA 2YB8B 5EAPA 4IMMA 1K8KC 1S4UX 3SJLD 3UKRC 2P9NC 5EMMB 4GQBB 3VH0A 4FAND 4LGNA 2H6KA 2OK4A 2QC5A 5HE3B 4CC9A 2H13A 5C9ZB 3A0FA 1JJUB 3J81g 3JZNA 3PVUB 4Y7RA 4U1EI 2CO0A 3JRPA 4FB1D 3J80g 4ZN4A 4A0BA 4ZOVA 2CE8A 4ZOZA 4BL0A 4L9OA 5I5MA 3PSLA 4A0AA 4N14A 2XYIA 3GFCA 3ORVD 4U7AA 4YVDA 4H5JA 4CI1A 1SQJA 5GSAA 2AH1A 4QRJA 4BUJC 3OW8A 5FKQA 2PM7B 4FHLA 2OVPB 4HDJA 3MKSB 4H5IA 5H1MA 5FQDA 2CN2A 3CIKB 3HFQA 4TZ4A 3SHFA 2BBKH 3EU7A 3F3PA 5HE0B 3MMYA 5HE1B 4R7AB 3MXXA 3JZGA 3OKYA 2TRCB 2B5NA 1TYQC 2XL2A 4GZ8A 3ULEC 2IURA 4ZOYA 3ODTA 4J81A 5H14A 3JPXA 3W15A 2CE9A 4J78A 4O3UB 4EWRA 4FA4D 4PXWA 5AFU3 5FA5B 3PXSD 5CXCB 1RI6A 4CY1A 4OZUA 2IUPA 4FAVD 3I7NA 1P22A 3U4YA 1K32A 3NVNA 3VGZA 5IJ8E 3OTTA 3SVWD 1A0RB 4ERYA 1GXRA 5I5IA 3SLED 5TEFA 1L0QA 2XL3A 3I7LA 3EI2A 5EMJB 5FKSA 5CXCA 2G9AA 2YBAA 4XYHA 3ZWLB 4A08B 3CFVA 4CZYA 1SHYB 1OLZA 3I7PA 4CZVA 2CNXA 4J77A 1JMZB 4MK0B 4CY2A 2W18A 4D0KA 5TF2A 2B4EA 3BG0A 3I7KA 4GGAA 5HQGA 3OL2A 3N0EA 4A08A 3CFSB 3JROA 4ZOXA 4JT5C 2H47A 1MG3A 4GM3A 3JAMg 2IUVA 4FA9D 3KRXB 1B9YA 4PNKB 1XHMA 4J87A 2AH0A 4A0BB 3SXTD 3V9FA 5AJAA 4Z8LA 3KRWB 4XYIA 2H68A 3I8EA 4GM8A 2I3SA 5HYNB 4GQ1A 2PM9B 2IWKA 2GNQA 4A0AB 2HYEA 4J0WA 1XKSA 2P9UC 2AGLA 1U4CA 3AFCA 2XU7A 5KDOB 3UVMA 5EALA 2I0RA 5IJ7E 4J79A 5TDHB 4L1QD 4J84A 3SWSD 3V5WB 2AQ5A 2PM9A 2AGYA 3RN1D 4KFMB 5FKRA 2H14A 3C9CA 3VA6A 2J56H 3OKYB 2QXVA 5JWZA 2IAAA 3NVQA 4L3GD 4X60B 5I5JA 2HKMA 1PBYB 3UVNA 4X63B 3EG6A 4O45A 5H17A 3SFZA 4LG8A 5EAMA 3F3GA 1U2VC 2P9IC 3UKUC 4D6VA 4X61B 3IJCA 1SQ9A 2PM6B 4J86A 4A09B 4AEZA 4JT6C 4AOWA 4CI2A 4OWRA 2GC4A 3DM0A 3PXTD 3C75H 4GQ2P 4CI3A 1PGUA 2H9PA 2B5LA 4JXMA 1JOFA 3I89A 4JSXC 2P9LC 4UI9R 3EI2B 4A09A 2OK6A 4PSXB 5B4WA 4J8BA 3EI4B 3B7FA 3PXWD 3AL9A 4K3ID 3OKTA 4JSPC 3AH8B 4JSNC 2YMUA 5A2Qg 2H6NA 3MKQA 3OL2B 3IKOA 4QT8A 3EI4A 4A2LA 5HE2B 3SBRA 4E5ZA 4BH6A 2UZYB 2H9LA 2OVQB 2I3TA 3MZLA 3DSMA 1TBGA 2HJBA 3DXKC 3NVXA 4LG9A 4JSVC 3EWEA 3FM0A 3MZKA 2H9NA 5CYKB 3E0CA 5EMKB 4JD2C 5C2WB 4QL1A 3SCYA 3SBPA 3DWLC 3I8CA 4PBYA 2H9MA 3K27A 3C99A 2Z2NA 1XIPA 4ES0A 2AGZA 5EARA 4O9DA 2OIZA 5THAA 3RLMD 5IGQA 5GXIA 3JB9L 3EI3B 3P4FA 4G56B 3BWSA 4E54A 5CYKA 2O9KA 2J55H 2OJYA 3SN6B 5GMKn 3IIYA 1N6DA 2H6QA 5EM2B 5IT9g 3AL8A 2P9KC 3I7HA 3BG1A 3EI3A 4J8GA 3EMHA 3PE7A 4O1QD 2AGWA 5FXYA 4X3EA 3IJ0A 2PBIB 4A11B 2UZXB 5EM2A 4QQEA 4ESGA 2Z2PA 4FWWA 3I2NA 4O3TB 2EBSA 3RRMC 4I79A 3I7OA 4GGDA 4K3JB 1JMXB 3SMRA 1GG2B 3GREA 3C5MA 2HESX 5IGOA 1GP2B 2BCJB 1MDAH 1OMWB 2IUQA 4FA5D 4A11A 3RFHA 2I0SA 4L3HD 2CO0C 1Q47A 3L4MD 2YNPA 1NEXB 4A2MA 2OVRB 5SXMA 5K1CC 3UVKA 4PSWB 3K26A 4Y5RD 5FKTA 4CY3A 2J57G 2B5MA 2G99A 3IIWA 4GGCA 2CN3A 3FRXA 5K19A 4A7JA 4CZXA 2HKRA 2P9PC 2YNNA 4CI8A 2AGXA 2HJ4A 5C2VB 3EI1B 4GM9A 2H3XA 2IWFA 4NSXA 3UVLA 2Q7QA 4E5ZB 4XEIC 3PVWB 1QNIA 4J0XA 3UVOA 1N6EA 3SBQA 2I0TA 1PI6A 4J73A 3EI1A 3PSCB 5AMSA 1PEVA 1YFQA 3FGBA 2HXCA 3RMZD 3JZHA 3OKWA 3IJ1A 1NR0A 3UR4A 2P9SC 3N0DA 5IC7A 4PBZA 4ERZA 2Z2OA 5TEEA 3RN0D 1R5MA 4ERQA 4E54B 3RSEC 1ERJA 4GMBA 5CXBB 5FLXg 4J82A 1MG2A 4CY5A 1GOTB 1B9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXH A;  2MTA H;  2YNO A;  3AL8 B;  1VYH C;  3F3F A;  4PC0 A;  5EML B;  3L4O D;  4FA1 D;  1N6F A;  4IA9 A;  2GC7 A;  3DXM C;  5CXB A;  3RFG A;  3V7D B;  1FWX A;  2YB8 B;  5EAP A;  4IMM A;  1K8K C;  1S4U X;  3SJL D;  3UKR C;  2P9N C;  5EMM B;  4GQB B;  3VH0 A;  4FAN D;  4LGN A;  2H6K A;  2OK4 A;  2QC5 A;  5HE3 B;  4CC9 A;  2H13 A;  5C9Z B;  3A0F A;  1JJU B;  3J81 g;  3JZN A;  3PVU B;  4Y7R A;  4U1E I;  2CO0 A;  3JRP A;  4FB1 D;  3J80 g;  4ZN4 A;  4A0B A;  4ZOV A;  2CE8 A;  4ZOZ A;  4BL0 A;  4L9O A;  5I5M A;  3PSL A;  4A0A A;  4N14 A;  2XYI A;  3GFC A;  3ORV D;  4U7A A;  4YVD A;  4H5J A;  4CI1 A;  1SQJ A;  5GSA A;  2AH1 A;  4QRJ A;  4BUJ C;  3OW8 A;  5FKQ A;  2PM7 B;  4FHL A;  2OVP B;  4HDJ A;  3MKS B;  4H5I A;  5H1M A;  5FQD A;  2CN2 A;  3CIK B;  3HFQ A;  4TZ4 A;  3SHF A;  2BBK H;  3EU7 A;  3F3P A;  5HE0 B;  3MMY A;  5HE1 B;  4R7A B;  3MXX A;  3JZG A;  3OKY A;  2TRC B;  2B5N A;  1TYQ C;  2XL2 A;  4GZ8 A;  3ULE C;  2IUR A;  4ZOY A;  3ODT A;  4J81 A;  5H14 A;  3JPX A;  3W15 A;  2CE9 A;  4J78 A;  4O3U B;  4EWR A;  4FA4 D;  4PXW A;  5AFU 3;  5FA5 B;  3PXS D;  5CXC B;  1RI6 A;  4CY1 A;  4OZU A;  2IUP A;  4FAV D;  3I7N A;  1P22 A;  3U4Y A;  1K32 A;  3NVN A;  3VGZ A;  5IJ8 E;  3OTT A;  3SVW D;  1A0R B;  4ERY A;  1GXR A;  5I5I A;  3SLE D;  5TEF A;  1L0Q A;  2XL3 A;  3I7L A;  3EI2 A;  5EMJ B;  5FKS A;  5CXC A;  2G9A A;  2YBA A;  4XYH A;  3ZWL B;  4A08 B;  3CFV A;  4CZY A;  1SHY B;  1OLZ A;  3I7P A;  4CZV A;  2CNX A;  4J77 A;  1JMZ B;  4MK0 B;  4CY2 A;  2W18 A;  4D0K A;  5TF2 A;  2B4E A;  3BG0 A;  3I7K A;  4GGA A;  5HQG A;  3OL2 A;  3N0E A;  4A08 A;  3CFS B;  3JRO A;  4ZOX A;  4JT5 C;  2H47 A;  1MG3 A;  4GM3 A;  3JAM g;  2IUV A;  4FA9 D;  3KRX B;  1B9Y A;  4PNK B;  1XHM A;  4J87 A;  2AH0 A;  4A0B B;  3SXT D;  3V9F A;  5AJA A;  4Z8L A;  3KRW B;  4XYI A;  2H68 A;  3I8E A;  4GM8 A;  2I3S A;  5HYN B;  4GQ1 A;  2PM9 B;  2IWK A;  2GNQ A;  4A0A B;  2HYE A;  4J0W A;  1XKS A;  2P9U C;  2AGL A;  1U4C A;  3AFC A;  2XU7 A;  5KDO B;  3UVM A;  5EAL A;  2I0R A;  5IJ7 E;  4J79 A;  5TDH B;  4L1Q D;  4J84 A;  3SWS D;  3V5W B;  2AQ5 A;  2PM9 A;  2AGY A;  3RN1 D;  4KFM B;  5FKR A;  2H14 A;  3C9C A;  3VA6 A;  2J56 H;  3OKY B;  2QXV A;  5JWZ A;  2IAA A;  3NVQ A;  4L3G D;  4X60 B;  5I5J A;  2HKM A;  1PBY B;  3UVN A;  4X63 B;  3EG6 A;  4O45 A;  5H17 A;  3SFZ A;  4LG8 A;  5EAM A;  3F3G A;  1U2V C;  2P9I C;  3UKU C;  4D6V A;  4X61 B;  3IJC A;  1SQ9 A;  2PM6 B;  4J86 A;  4A09 B;  4AEZ A;  4JT6 C;  4AOW A;  4CI2 A;  4OWR A;  2GC4 A;  3DM0 A;  3PXT D;  3C75 H;  4GQ2 P;  4CI3 A;  1PGU A;  2H9P A;  2B5L A;  4JXM A;  1JOF A;  3I89 A;  4JSX C;  2P9L C;  4UI9 R;  3EI2 B;  4A09 A;  2OK6 A;  4PSX B;  5B4W A;  4J8B A;  3EI4 B;  3B7F A;  3PXW D;  3AL9 A;  4K3I D;  3OKT A;  4JSP C;  3AH8 B;  4JSN C;  2YMU A;  5A2Q g;  2H6N A;  3MKQ A;  3OL2 B;  3IKO A;  4QT8 A;  3EI4 A;  4A2L A;  5HE2 B;  3SBR A;  4E5Z A;  4BH6 A;  2UZY B;  2H9L A;  2OVQ B;  2I3T A;  3MZL A;  3DSM A;  1TBG A;  2HJB A;  3DXK C;  3NVX A;  4LG9 A;  4JSV C;  3EWE A;  3FM0 A;  3MZK A;  2H9N A;  5CYK B;  3E0C A;  5EMK B;  4JD2 C;  5C2W B;  4QL1 A;  3SCY A;  3SBP A;  3DWL C;  3I8C A;  4PBY A;  2H9M A;  3K27 A;  3C99 A;  2Z2N A;  1XIP A;  4ES0 A;  2AGZ A;  5EAR A;  4O9D A;  2OIZ A;  5THA A;  3RLM D;  5IGQ A;  5GXI A;  3JB9 L;  3EI3 B;  3P4F A;  4G56 B;  3BWS A;  4E54 A;  5CYK A;  2O9K A;  2J55 H;  2OJY A;  3SN6 B;  5GMK n;  3IIY A;  1N6D A;  2H6Q A;  5EM2 B;  5IT9 g;  3AL8 A;  2P9K C;  3I7H A;  3BG1 A;  3EI3 A;  4J8G A;  3EMH A;  3PE7 A;  4O1Q D;  2AGW A;  5FXY A;  4X3E A;  3IJ0 A;  2PBI B;  4A11 B;  2UZX B;  5EM2 A;  4QQE A;  4ESG A;  2Z2P A;  4FWW A;  3I2N A;  4O3T B;  2EBS A;  3RRM C;  4I79 A;  3I7O A;  4GGD A;  4K3J B;  1JMX B;  3SMR A;  1GG2 B;  3GRE A;  3C5M A;  2HES X;  5IGO A;  1GP2 B;  2BCJ B;  1MDA H;  1OMW B;  2IUQ A;  4FA5 D;  4A11 A;  3RFH A;  2I0S A;  4L3H D;  2CO0 C;  1Q47 A;  3L4M D;  2YNP A;  1NEX B;  4A2M A;  2OVR B;  5SXM A;  5K1C C;  3UVK A;  4PSW B;  3K26 A;  4Y5R D;  5FKT A;  4CY3 A;  2J57 G;  2B5M A;  2G99 A;  3IIW A;  4GGC A;  2CN3 A;  3FRX A;  5K19 A;  4A7J A;  4CZX A;  2HKR A;  2P9P C;  2YNN A;  4CI8 A;  2AGX A;  2HJ4 A;  5C2V B;  3EI1 B;  4GM9 A;  2H3X A;  2IWF A;  4NSX A;  3UVL A;  2Q7Q A;  4E5Z B;  4XEI C;  3PVW B;  1QNI A;  4J0X A;  3UVO A;  1N6E A;  3SBQ A;  2I0T A;  1PI6 A;  4J73 A;  3EI1 A;  3PSC B;  5AMS A;  1PEV A;  1YFQ A;  3FGB A;  2HXC A;  3RMZ D;  3JZH A;  3OKW A;  3IJ1 A;  1NR0 A;  3UR4 A;  2P9S C;  3N0D A;  5IC7 A;  4PBZ A;  4ERZ A;  2Z2O A;  5TEE A;  3RN0 D;  1R5M A;  4ERQ A;  4E54 B;  3RSE C;  1ERJ A;  4GMB A;  5CXB B;  5FLX g;  4J82 A;  1MG2 A;  4CY5 A;  1GOT B;  1B9X A; 
#chains in the Genus database with same CATH topology
 5GXH A;  2MTA H;  2YNO A;  2XDW A;  3AL8 B;  1VYH C;  3F3F A;  4PC0 A;  5EML B;  3L4O D;  4FA1 D;  1N6F A;  4IA9 A;  2GC7 A;  1QFM A;  4AMY A;  3DXM C;  5CXB A;  3RFG A;  3V7D B;  1FWX A;  4JHP C;  2YB8 B;  4G1M A;  5EAP A;  4IMM A;  1K8K C;  1S4U X;  1U8C A;  3SJL D;  3UKR C;  3K71 A;  5E6U A;  2P9N C;  2EIB A;  5EMM B;  4GQB B;  3VH0 A;  4FAN D;  4LGN A;  4BCB A;  3NIG A;  1H2Z A;  2H6K A;  2OK4 A;  1M1X A;  5M5U A;  2QC5 A;  5HE3 B;  4CC9 A;  2H13 A;  5C9Z B;  3A0F A;  1JJU B;  3ZDZ A;  3J81 g;  3V4P A;  3JZN A;  3PVU B;  4Y7R A;  3VI4 A;  4U1E I;  2CO0 A;  3JRP A;  4FB1 D;  3J80 g;  4ZN4 A;  4A0B A;  4JHN A;  4ZOV A;  5FFG A;  2VZ1 A;  2CE8 A;  4ZOZ A;  4BL0 A;  4L9O A;  1QFS A;  5I5M A;  3PSL A;  4A0A A;  4N14 A;  4Z7Q A;  2XYI A;  3GFC A;  2VDR A;  3ORV D;  4U7A A;  4YVD A;  4H5J A;  4CI1 A;  1SQJ A;  5GSA A;  1TYE A;  2AH1 A;  4QRJ A;  4BUJ C;  3OW8 A;  1K3I A;  5FKQ A;  2PM7 B;  4FHL A;  1E8M A;  2OVP B;  4HDJ A;  3GC3 B;  3MKS B;  4H5I A;  5H1M A;  5FQD A;  2CN2 A;  3CIK B;  3HFQ A;  4TZ4 A;  3SHF A;  2BBK H;  3EU7 A;  3F3P A;  5HE0 B;  3FCS A;  3MMY A;  2VC2 A;  3IUR A;  5HE1 B;  4R7A B;  3MXX A;  3JZG A;  3IVM A;  3OKY A;  2TRC B;  2B5N A;  1TYQ C;  2XL2 A;  4GZ8 A;  5M5V A;  3ULE C;  2IUR A;  2EIC A;  4ZOY A;  3EQ8 A;  3O4J A;  3ZE0 A;  3ODT A;  1T2X A;  4J81 A;  5H14 A;  3JPX A;  3W15 A;  1H2Y A;  2CE9 A;  4AN1 A;  4J78 A;  4O3U B;  4EWR A;  4FA4 D;  4PXW A;  4BP8 A;  3EQ7 A;  5AFU 3;  5E6R A;  5FA5 B;  3PXS D;  5CXC B;  1RI6 A;  4CY1 A;  4OZU A;  5C92 A;  2IUP A;  4FAV D;  1VE7 A;  3I7N A;  1P22 A;  3U4Y A;  1K32 A;  3NVN A;  3VGZ A;  5IJ8 E;  3OTT A;  3SVW D;  1A0R B;  4ERY A;  1GXR A;  5M61 A;  5I5I A;  3SLE D;  5TEF A;  1L0Q A;  1YR2 A;  2XL3 A;  3DDU A;  3I7L A;  3EI2 A;  5EMJ B;  5FKS A;  5CXC A;  2G9A A;  2YBA A;  4XYH A;  3ZWL B;  4A08 B;  3CFV A;  1L5G A;  3T3M A;  5M5S A;  4CZY A;  1SHY B;  1OLZ A;  3MVD K;  3I7P A;  4CZV A;  2CNX A;  4J77 A;  4NC4 A;  3NID A;  1JMZ B;  4MK0 B;  4CY2 A;  4DNW A;  2W18 A;  4D0K A;  5TF2 A;  3NIF A;  2B4E A;  3BG0 A;  3I7K A;  4GGA A;  5HQG A;  3OL2 A;  3N0E A;  4A08 A;  3CFS B;  3JRO A;  4ZOX A;  4JT5 C;  2H47 A;  1MG3 A;  4GM3 A;  3JAM g;  2IUV A;  4FA9 D;  1VZ2 A;  3IUM A;  4O2W A;  3KRX B;  1B9Y A;  2EIE A;  4PNK B;  1XHM A;  4QAM A;  4J87 A;  2AH0 A;  4A0B B;  4G1E A;  3T3P A;  3SXT D;  4WK2 A;  3V9F A;  5AJA A;  4Z8L A;  3KRW B;  4XYI A;  2H68 A;  3I8E A;  4GM8 A;  2I3S A;  5HYN B;  4GQ1 A;  2PM9 B;  2IWK A;  2GNQ A;  4A0A B;  2HYE A;  4J0W A;  5M5R A;  1XKS A;  2P9U C;  4MMX A;  2AGL A;  1U4C A;  1C9I A;  3AFC A;  2XU7 A;  5KDO B;  3UVM A;  5C86 A;  5EAL A;  2I0R A;  5IJ7 E;  4J79 A;  5TDH B;  4L1Q D;  4J84 A;  3ZDX A;  3SWS D;  3V5W B;  2AQ5 A;  2EID A;  2PM9 A;  2AGY A;  3RN1 D;  4KFM B;  5FKR A;  2H14 A;  3C9C A;  3VA6 A;  4Z7N A;  3QHY B;  2J56 H;  3ZDY A;  3OKY B;  2QXV A;  5JWZ A;  2IAA A;  3NVQ A;  4L3G D;  4X60 B;  5I5J A;  3MUO A;  2HKM A;  4WK0 A;  1PBY B;  3UVN A;  4X63 B;  1UOO A;  3EG6 A;  4O45 A;  4AMZ A;  5H17 A;  3O4G A;  4WJK A;  3SFZ A;  4LG8 A;  5EAM A;  3F3G A;  1H2W A;  1U2V C;  2P9I C;  3UKU C;  4D6V A;  4X61 B;  3IJC A;  2VDM A;  1SQ9 A;  2PM6 B;  4J86 A;  4A09 B;  4AEZ A;  4JT6 C;  4AOW A;  4CI2 A;  4OWR A;  2GC4 A;  3DM0 A;  3V4V A;  3PXT D;  3C75 H;  4GQ2 P;  4CI3 A;  1PGU A;  2H9P A;  2B5L A;  4JXM A;  1JOF A;  3I89 A;  4JSX C;  1UOP A;  2P9L C;  2VDN A;  4UI9 R;  3EI2 B;  4A09 A;  2OK6 A;  4PSX B;  5B4W A;  4J8B A;  3EI4 B;  2HU8 A;  3B7F A;  2BKL A;  3PXW D;  2QR5 A;  3AL9 A;  4K3I D;  1VZ3 A;  3GD1 I;  3OKT A;  4JSP C;  3AH8 B;  4JSN C;  2YMU A;  5A2Q g;  4MMZ A;  2H6N A;  4NAA A;  2JKX A;  3MKQ A;  3O4H A;  3OL2 B;  3IKO A;  4QT8 A;  3ZE1 A;  3EI4 A;  4A2L A;  3IUQ A;  5HE2 B;  3SBR A;  4WK4 A;  4E5Z A;  4BH6 A;  2UZY B;  5FFO A;  2H9L A;  2OVQ B;  3IJE A;  2I3T A;  3MZL A;  4NEN A;  4DNV A;  3DSM A;  1TBG A;  2HJB A;  3DXK C;  3NVX A;  4LG9 A;  4JSV C;  3EWE A;  2VDQ A;  3FM0 A;  3MZK A;  2H9N A;  2VDP A;  5CYK B;  3E0C A;  1I2M B;  5EMK B;  3K72 A;  3KCI A;  4JD2 C;  5C2W B;  4QL1 A;  3SCY A;  3SBP A;  3DWL C;  1BPO A;  3I8C A;  4PBY A;  2H9M A;  3K27 A;  3C99 A;  4D9S A;  2Z2N A;  1XIP A;  4ES0 A;  2AGZ A;  2XE4 A;  5EAR A;  4O9D A;  2OIZ A;  5THA A;  3RLM D;  5IGQ A;  5GXI A;  3JB9 L;  3EI3 B;  3P4F A;  4G56 B;  3BWS A;  4E54 A;  4UM8 A;  4RE5 A;  5CYK A;  2O9K A;  2J55 H;  2OJY A;  3SN6 B;  5GMK n;  3IIY A;  1N6D A;  2H6Q A;  5EM2 B;  5IT9 g;  3AL8 A;  2P9K C;  2VDK A;  3I7H A;  3BG1 A;  3EI3 A;  4J8G A;  4MMY A;  3EMH A;  2VDL A;  3PE7 A;  4O1Q D;  1UTC A;  2AGW A;  1E8N A;  4Z7O A;  5FXY A;  4NBM A;  4X3E A;  3IJ0 A;  2VDO A;  2PBI B;  4A11 B;  2UZX B;  1GOH A;  4QQE A;  5EM2 A;  4ESG A;  4AN0 A;  2Z2P A;  4FWW A;  3I2N A;  4O3T B;  2EBS A;  3RRM C;  4I79 A;  3I7O A;  4GGD A;  4K3J B;  1JMX B;  3SMR A;  1GG2 B;  5E6S A;  3GRE A;  3C5M A;  3IUL A;  2HES X;  5IGO A;  5M5T A;  1GP2 B;  2BCJ B;  1MDA H;  2VZ3 A;  1OMW B;  1GOF A;  2HU5 A;  2IUQ A;  4A11 A;  3RFH A;  4FA5 D;  3QI0 A;  2I0S A;  4L3H D;  1GOG A;  2CO0 C;  2WQ8 A;  1H2X A;  3MUN A;  1Q47 A;  3L4M D;  2YNP A;  1NEX B;  4UM9 A;  4A2M A;  2OVR B;  5SXM A;  5K1C C;  3FCU A;  3IUN A;  3VI3 A;  3UVK A;  1VE6 A;  1C9L A;  4BP9 A;  4PSW B;  3K26 A;  4IRZ A;  4Y5R D;  5FKT A;  4CY3 A;  1E5T A;  1A12 A;  2J57 G;  2B5M A;  2G99 A;  3IIW A;  4GGC A;  2CN3 A;  2HU7 A;  3FRX A;  5K19 A;  4RE6 A;  4A7J A;  4CZX A;  2XZG A;  2HKR A;  3K6S A;  2P9P C;  2YNN A;  4CI8 A;  2AGX A;  2HJ4 A;  3OF7 A;  3O4I A;  5C2V B;  3EI1 B;  4GM9 A;  3IUJ A;  2H3X A;  2IWF A;  4NSX A;  3UVL A;  2Q7Q A;  4E5Z B;  4O02 A;  4XEI C;  1UOQ A;  3PVW B;  1QNI A;  4G55 A;  4J0X A;  4BCC A;  4L1M A;  4DNU A;  1JV2 A;  1N6E A;  3SBQ A;  3UVO A;  2I0T A;  1PI6 A;  4J73 A;  3EI1 A;  3PSC B;  5HDB A;  2QZP A;  5AMS A;  1PEV A;  1YFQ A;  3ZE2 A;  3FGB A;  2HXC A;  3RMZ D;  3JZH A;  3OKW A;  4AX4 A;  3IJ1 A;  1NR0 A;  3UR4 A;  2P9S C;  3N0D A;  5IC7 A;  4PBZ A;  4ERZ A;  3EQ9 A;  2Z2O A;  5TEE A;  3RN0 D;  1O6F A;  1R5M A;  4ERQ A;  4BCD A;  4E54 B;  3RSE C;  1ERJ A;  4GMB A;  1JTD B;  5CXB B;  5FLX g;  4J82 A;  1O6G A;  1MG2 A;  4CY5 A;  1GOT B;  1B9X A; 
#chains in the Genus database with same CATH homology
 5GXH A;  2MTA H;  2YNO A;  3AL8 B;  1VYH C;  3F3F A;  4PC0 A;  5EML B;  3L4O D;  4FA1 D;  1N6F A;  4IA9 A;  2GC7 A;  3DXM C;  5CXB A;  3RFG A;  3V7D B;  1FWX A;  2YB8 B;  5EAP A;  4IMM A;  1K8K C;  1S4U X;  3SJL D;  3UKR C;  2P9N C;  5EMM B;  4GQB B;  3VH0 A;  4FAN D;  4LGN A;  2H6K A;  2OK4 A;  2QC5 A;  5HE3 B;  4CC9 A;  2H13 A;  5C9Z B;  3A0F A;  1JJU B;  3J81 g;  3JZN A;  3PVU B;  4Y7R A;  4U1E I;  2CO0 A;  3JRP A;  4FB1 D;  3J80 g;  4ZN4 A;  4A0B A;  4ZOV A;  2CE8 A;  4ZOZ A;  4BL0 A;  4L9O A;  5I5M A;  3PSL A;  4A0A A;  4N14 A;  2XYI A;  3GFC A;  3ORV D;  4U7A A;  4YVD A;  4H5J A;  4CI1 A;  1SQJ A;  5GSA A;  2AH1 A;  4QRJ A;  4BUJ C;  3OW8 A;  5FKQ A;  2PM7 B;  4FHL A;  2OVP B;  4HDJ A;  3MKS B;  4H5I A;  5H1M A;  5FQD A;  2CN2 A;  3CIK B;  3HFQ A;  4TZ4 A;  3SHF A;  2BBK H;  3EU7 A;  3F3P A;  5HE0 B;  3MMY A;  5HE1 B;  4R7A B;  3MXX A;  3JZG A;  3OKY A;  2TRC B;  2B5N A;  1TYQ C;  2XL2 A;  4GZ8 A;  3ULE C;  2IUR A;  4ZOY A;  3ODT A;  4J81 A;  5H14 A;  3JPX A;  3W15 A;  2CE9 A;  4J78 A;  4O3U B;  4EWR A;  4FA4 D;  4PXW A;  5AFU 3;  5FA5 B;  3PXS D;  5CXC B;  1RI6 A;  4CY1 A;  4OZU A;  2IUP A;  4FAV D;  3I7N A;  1P22 A;  3U4Y A;  1K32 A;  3NVN A;  3VGZ A;  5IJ8 E;  3OTT A;  3SVW D;  1A0R B;  4ERY A;  1GXR A;  5I5I A;  3SLE D;  5TEF A;  1L0Q A;  2XL3 A;  3I7L A;  3EI2 A;  5EMJ B;  5FKS A;  5CXC A;  2G9A A;  2YBA A;  4XYH A;  3ZWL B;  4A08 B;  3CFV A;  4CZY A;  1SHY B;  1OLZ A;  3I7P A;  4CZV A;  2CNX A;  4J77 A;  1JMZ B;  4MK0 B;  4CY2 A;  2W18 A;  4D0K A;  5TF2 A;  2B4E A;  3BG0 A;  3I7K A;  4GGA A;  5HQG A;  3OL2 A;  3N0E A;  4A08 A;  3CFS B;  3JRO A;  4ZOX A;  4JT5 C;  2H47 A;  1MG3 A;  4GM3 A;  3JAM g;  2IUV A;  4FA9 D;  3KRX B;  1B9Y A;  4PNK B;  1XHM A;  4J87 A;  2AH0 A;  4A0B B;  3SXT D;  3V9F A;  5AJA A;  4Z8L A;  3KRW B;  4XYI A;  2H68 A;  3I8E A;  4GM8 A;  2I3S A;  5HYN B;  4GQ1 A;  2PM9 B;  2IWK A;  2GNQ A;  4A0A B;  2HYE A;  4J0W A;  1XKS A;  2P9U C;  2AGL A;  1U4C A;  3AFC A;  2XU7 A;  5KDO B;  3UVM A;  5EAL A;  2I0R A;  5IJ7 E;  4J79 A;  5TDH B;  4L1Q D;  4J84 A;  3SWS D;  3V5W B;  2AQ5 A;  2PM9 A;  2AGY A;  3RN1 D;  4KFM B;  5FKR A;  2H14 A;  3C9C A;  3VA6 A;  2J56 H;  3OKY B;  2QXV A;  5JWZ A;  2IAA A;  3NVQ A;  4L3G D;  4X60 B;  5I5J A;  2HKM A;  1PBY B;  3UVN A;  4X63 B;  3EG6 A;  4O45 A;  5H17 A;  3SFZ A;  4LG8 A;  5EAM A;  3F3G A;  1U2V C;  2P9I C;  3UKU C;  4D6V A;  4X61 B;  3IJC A;  1SQ9 A;  2PM6 B;  4J86 A;  4A09 B;  4AEZ A;  4JT6 C;  4AOW A;  4CI2 A;  4OWR A;  2GC4 A;  3DM0 A;  3PXT D;  3C75 H;  4GQ2 P;  4CI3 A;  1PGU A;  2H9P A;  2B5L A;  4JXM A;  1JOF A;  3I89 A;  4JSX C;  2P9L C;  4UI9 R;  3EI2 B;  4A09 A;  2OK6 A;  4PSX B;  5B4W A;  4J8B A;  3EI4 B;  3B7F A;  3PXW D;  3AL9 A;  4K3I D;  3OKT A;  4JSP C;  3AH8 B;  4JSN C;  2YMU A;  5A2Q g;  2H6N A;  3MKQ A;  3OL2 B;  3IKO A;  4QT8 A;  3EI4 A;  4A2L A;  5HE2 B;  3SBR A;  4E5Z A;  4BH6 A;  2UZY B;  2H9L A;  2OVQ B;  2I3T A;  3MZL A;  3DSM A;  1TBG A;  2HJB A;  3DXK C;  3NVX A;  4LG9 A;  4JSV C;  3EWE A;  3FM0 A;  3MZK A;  2H9N A;  5CYK B;  3E0C A;  5EMK B;  4JD2 C;  5C2W B;  4QL1 A;  3SCY A;  3SBP A;  3DWL C;  3I8C A;  4PBY A;  2H9M A;  3K27 A;  3C99 A;  2Z2N A;  1XIP A;  4ES0 A;  2AGZ A;  5EAR A;  4O9D A;  2OIZ A;  5THA A;  3RLM D;  5IGQ A;  5GXI A;  3JB9 L;  3EI3 B;  3P4F A;  4G56 B;  3BWS A;  4E54 A;  5CYK A;  2O9K A;  2J55 H;  2OJY A;  3SN6 B;  5GMK n;  3IIY A;  1N6D A;  2H6Q A;  5EM2 B;  5IT9 g;  3AL8 A;  2P9K C;  3I7H A;  3BG1 A;  3EI3 A;  4J8G A;  3EMH A;  3PE7 A;  4O1Q D;  2AGW A;  5FXY A;  4X3E A;  3IJ0 A;  2PBI B;  4A11 B;  2UZX B;  5EM2 A;  4QQE A;  4ESG A;  2Z2P A;  4FWW A;  3I2N A;  4O3T B;  2EBS A;  3RRM C;  4I79 A;  3I7O A;  4GGD A;  4K3J B;  1JMX B;  3SMR A;  1GG2 B;  3GRE A;  3C5M A;  2HES X;  5IGO A;  1GP2 B;  2BCJ B;  1MDA H;  1OMW B;  2IUQ A;  4FA5 D;  4A11 A;  3RFH A;  2I0S A;  4L3H D;  2CO0 C;  1Q47 A;  3L4M D;  2YNP A;  1NEX B;  4A2M A;  2OVR B;  5SXM A;  5K1C C;  3UVK A;  4PSW B;  3K26 A;  4Y5R D;  5FKT A;  4CY3 A;  2J57 G;  2B5M A;  2G99 A;  3IIW A;  4GGC A;  2CN3 A;  3FRX A;  5K19 A;  4A7J A;  4CZX A;  2HKR A;  2P9P C;  2YNN A;  4CI8 A;  2AGX A;  2HJ4 A;  5C2V B;  3EI1 B;  4GM9 A;  2H3X A;  2IWF A;  4NSX A;  3UVL A;  2Q7Q A;  4E5Z B;  4XEI C;  3PVW B;  1QNI A;  4J0X A;  3UVO A;  1N6E A;  3SBQ A;  2I0T A;  1PI6 A;  4J73 A;  3EI1 A;  3PSC B;  5AMS A;  1PEV A;  1YFQ A;  3FGB A;  2HXC A;  3RMZ D;  3JZH A;  3OKW A;  3IJ1 A;  1NR0 A;  3UR4 A;  2P9S C;  3N0D A;  5IC7 A;  4PBZ A;  4ERZ A;  2Z2O A;  5TEE A;  3RN0 D;  1R5M A;  4ERQ A;  4E54 B;  3RSE C;  1ERJ A;  4GMB A;  5CXB B;  5FLX g;  4J82 A;  1MG2 A;  4CY5 A;  1GOT B;  1B9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...