2HESX

Cytosolic iron-sulphur assembly protein- 1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
324
structure length
308
Chain Sequence
SINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKFEMDLLAIIEEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLTILATGGDDGIVNFWSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Yeast WD40 Domain Protein Cia1, a Component Acting Late in Iron-Sulfur Protein Biogenesis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Biosynthetic protein
molecule keywords Ydr267cp
total genus 81
structure length 308
sequence length 324
ec nomenclature
pdb deposition date 2006-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hesX00
5SXMA 3SLED 2CN2A 1U2VC 1TYQC 3AL8B 5IJ7E 4YVDA 5GSAA 2Z2OA 3PSLA 5EM2A 3SFZA 4UI9R 2PM9A 4R7AB 5HQGA 3K26A 2CE9A 5I5MA 1JJUB 4ERYA 4TZ4A 3SWSD 1B9YA 1SQ9A 4CI1A 1S4UX 5CYKA 5C2VB 3I89A 4X60B 3C5MA 4OWRA 2OVRB 5FLXg 3JZGA 5EAMA 3I7NA 4I79A 3SHFA 5EARA 2P9PC 3I7LA 3DM0A 4GM3A 2O9KA 3JZHA 4J8GA 2Q7QA 3CIKB 1JMZB 2UZYB 4J86A 4G56B 3N0EA 3L4OD 5B4WA 3IIWA 2G99A 2PM9B 4Y5RD 2P9NC 3EU7A 3UVLA 4A0BA 1PBYB 1NR0A 2HKMA 1PGUA 3SVWD 3I8CA 4GM9A 5THAA 5FQDA 2BBKH 1JMXB 4QQEA 2MTAH 1TBGA 2YNNA 2H6NA 1XHMA 4O3TB 4L9OA 5IJ8E 4EWRA 5HE1B 2PM7B 4A08B 2P9SC 5AJAA 1FWXA 4J73A 5FKTA 4O1QD 1OMWB 3FGBA 4JSVC 5IC7A 3I7PA 3PVUB 4FWWA 4FAND 4LG8A 3JROA 2EBSA 2IURA 2IUPA 3RLMD 2P9UC 3UVNA 4ZOVA 3UVMA 3P4FA 5CXCB 2HESX 3OL2B 4A11B 2AGYA 4A11A 3MZLA 4GQ2P 3PVWB 3OKWA 3SCYA 4JSNC 4ZOXA 3MKQA 4A08A 2AGXA 4MK0B 2B5MA 3IJ1A 4XYIA 4FA1D 5TDHB 3SJLD 4A2MA 4A0BB 5I5JA 4HDJA 4K3ID 1A0RB 5JWZA 3SXTD 2H68A 4H5JA 3UVOA 4Z8LA 4CZXA 3ODTA 3ORVD 4AEZA 1SQJA 3K27A 4IA9A 5CXCA 2PM6B 2YBAA 4L3HD 4ZOYA 4E54B 2YMUA 4D6VA 1Q47A 2H9MA 4J82A 4CY1A 2CO0A 2H9NA 1XKSA 3I7OA 3SBQA 3B7FA 3AH8B 2H14A 2IWFA 2OK4A 4O9DA 3C99A 3GREA 2W18A 2OJYA 3UKUC 4JT6C 2GNQA 1ERJA 2OVPB 4JSPC 3I7KA 4X61B 3I2NA 5CXBA 4CI3A 3J80g 3EWEA 2J57G 2PBIB 3FM0A 2QC5A 2CE8A 4Y7RA 4U7AA 2HKRA 4LG9A 2OK6A 2G9AA 4GGAA 3BG0A 4CZYA 1GOTB 5HE0B 3EI4A 1GXRA 3MKSB 3AFCA 4A2LA 1YFQA 3UVKA 4CZVA 5K1CC 3AL9A 2HYEA 3N0DA 4X63B 5HYNB 1XIPA 3JAMg 2TRCB 5K19A 2HXCA 3OKTA 4JSXC 4E5ZA 4BUJC 4D0KA 2YB8B 1R5MA 2P9LC 4J8BA 4FB1D 4K3JB 4N14A 2OVQB 4JT5C 4PNKB 5GXIA 2B5LA 2UZXB 3EI4B 3JRPA 4PC0A 4BL0A 4GQBB 4ZOZA 3VA6A 5A2Qg 3U4YA 2AGWA 5EMJB 4PXWA 3I8EA 3SMRA 2HJBA 3MZKA 3IIYA 5KDOB 1PI6A 1JOFA 3PSCB 2I0SA 4CY3A 1N6DA 4FA4D 3OW8A 2P9KC 4ERZA 2BCJB 2IUVA 3CFVA 4A0AA 2I0RA 4J79A 3NVQA 2IAAA 4IMMA 4J78A 3EI2A 1GG2B 4GMBA 3EI2B 2CO0C 4GGCA 4KFMB 3BG1A 1PEVA 2XYIA 5GXHA 2Z2NA 3I7HA 2XU7A 4GQ1A 4JD2C 3OTTA 3DXMC 5AMSA 5FKRA 3SBPA 4J81A 3ZWLB 4E54A 2GC4A 2J55H 2H6QA 5H17A 5IT9g 1OLZA 3EG6A 3C9CA 4QL1A 4L3GD 5FA5B 2OIZA 5IGOA 4QT8A 3JZNA 3UKRC 1MDAH 3DXKC 5EMLB 4J0WA 5FKSA 3V5WB 3GFCA 1K32A 3EI3B 2AGLA 4U1EI 3FRXA 2I0TA 1L0QA 3A0FA 4AOWA 1K8KC 3KRXB 4OZUA 1B9XA 5EALA 2IUQA 4ES0A 4O45A 3RRMC 5TF2A 2CNXA 2AH1A 3SN6B 4NSXA 2P9IC 2H9PA 2XL2A 3DWLC 5EM2B 2H9LA 2HJ4A 1U4CA 2H6KA 2YNPA 3EI1B 4J77A 4J84A 3KRWB 5H14A 1N6FA 4FHLA 4CI2A 5HE3B 2B5NA 3JPXA 3NVNA 3IJCA 5FXYA 3PXTD 5H1MA 4PSXB 1GP2B 4XEIC 3IKOA 1MG2A 3J81g 2XL3A 4ERQA 3RN1D 3OKYB 4L1QD 4X3EA 3HFQA 2B4EA 3DSMA 4BH6A 4CC9A 3L4MD 1P22A 4A7JA 1QNIA 2J56H 3F3PA 4H5IA 3F3FA 1MG3A 2H47A 3PXSD 1N6EA 5CYKB 2H3XA 3EI3A 3V7DB 3BWSA 2AH0A 3RFGA 1NEXB 4J87A 3JB9L 4E5ZB 3RFHA 4A09B 2CN3A 5IGQA 1RI6A 4PSWB 3IJ0A 5FKQA 5TEEA 3W15A 3PE7A 4FA5D 4QRJA 4A0AB 4PBYA 4ESGA 5GMKn 2AQ5A 3EI1A 2AGZA 2GC7A 3CFSB 5TEFA 4FA9D 2I3SA 3VH0A 4CY2A 3E0CA 5HE2B 5AFU3 5EMMB 5EMKB 2H13A 3V9FA 3PXWD 5C9ZB 3VGZA 3SBRA 4A09A 3OKYA 5EAPA 4GGDA 3AL8A 3RN0D 4LGNA 3C75H 5C2WB 4GZ8A 2QXVA 4PBZA 4XYHA 2I3TA 3MXXA 2Z2PA 2YNOA 3UR4A 3F3GA 1SHYB 3RSEC 3EMHA 3MMYA 4JXMA 4GM8A 4CI8A 5I5IA 3RMZD 5CXBB 4FAVD 3ULEC 4CY5A 4J0XA 4O3UB 3NVXA 1VYHC 2IWKA 4ZN4A 3OL2A
chains in the Genus database with same CATH superfamily
5SXMA 3SLED 2CN2A 4UM9A 1U2VC 1TYQC 3AL8B 5IJ7E 4YVDA 5GSAA 2Z2OA 3NIGA 3PSLA 1H2ZA 5EM2A 3SFZA 4UI9R 2PM9A 4R7AB 5HQGA 5M61A 3K26A 2CE9A 3VI4A 5I5MA 1JJUB 4ERYA 4TZ4A 3SWSD 1JV2A 1B9YA 2EIDA 1SQ9A 4CI1A 2HU7A 1S4UX 5CYKA 4JHNA 3ZDXA 5C2VB 2EIEA 3I89A 4X60B 3C5MA 4OWRA 2OVRB 5FLXg 3JZGA 4NBMA 5EAMA 3I7NA 4I79A 1C9IA 3SHFA 5EARA 2P9PC 3I7LA 2XZGA 3DM0A 4GM3A 2O9KA 3JZHA 4J8GA 5E6UA 2Q7QA 2VDMA 3CIKB 1JMZB 2UZYB 4J86A 4G56B 3N0EA 3L4OD 2XDWA 5B4WA 3IIWA 4MMZA 2G99A 2PM9B 4Y5RD 2P9NC 3EU7A 3UVLA 4A0BA 1PBYB 4WJKA 4G55A 2QZPA 1NR0A 2HKMA 4BP9A 1PGUA 3SVWD 5M5SA 3I8CA 4WK0A 4GM9A 5THAA 5FQDA 2BBKH 1JMXB 4QQEA 2MTAH 2VC2A 3FCSA 1QFSA 1UOOA 2VDKA 1TBGA 2YNNA 2H6NA 1XHMA 4O3TB 4L9OA 5IJ8E 2XE4A 4EWRA 5HE1B 3MUNA 2PM7B 4A08B 2P9SC 5AJAA 1FWXA 4J73A 5FKTA 1OMWB 3FGBA 4JSVC 4O1QD 5IC7A 3I7PA 3PVUB 4FWWA 4NAAA 4FAND 4LG8A 1UTCA 1E8NA 3JROA 1BPOA 2EBSA 2IURA 1E8MA 2IUPA 3RLMD 2P9UC 3UVNA 4ZOVA 3UVMA 3P4FA 5CXCB 2HESX 3OL2B 4A11B 2AGYA 4A11A 3MZLA 2VDRA 4GQ2P 1QFMA 3PVWB 1A12A 1L5GA 3OKWA 3SCYA 4JSNC 4ZOXA 5E6SA 3MKQA 4A08A 1O6GA 2AGXA 1M1XA 4Z7QA 4MK0B 2B5MA 3IJ1A 4XYIA 4FA1D 4WK4A 5TDHB 2EIBA 4NENA 3SJLD 4A2MA 4A0BB 5I5JA 4HDJA 3ZDYA 4K3ID 1A0RB 5JWZA 3SXTD 2H68A 2WQ8A 4H5JA 3UVOA 4Z8LA 4CZXA 3ODTA 3ORVD 4AEZA 1SQJA 3K27A 4IA9A 4G1MA 5CXCA 2PM6B 5FFGA 2YBAA 4L3HD 4ZOYA 4E54B 2YMUA 4D6VA 1Q47A 2H9MA 4J82A 4CY1A 2CO0A 2H9NA 1XKSA 3GC3B 3I7OA 3SBQA 3B7FA 3EQ8A 3AH8B 2H14A 2IWFA 2OK4A 3C99A 4O9DA 3GREA 2W18A 2OJYA 3UKUC 3IUMA 3O4GA 4JT6C 2GNQA 5FFOA 1ERJA 4UM8A 2OVPB 4QAMA 4JSPC 3I7KA 4X61B 3ZE1A 3I2NA 1VZ3A 5CXBA 3MUOA 4CI3A 3J80g 3K71A 3EWEA 2J57G 1O6FA 2PBIB 3FM0A 3DDUA 2QC5A 2CE8A 4Y7RA 4U7AA 2HKRA 3IUQA 4LG9A 4AX4A 2OK6A 2G9AA 3NIFA 4GGAA 3BG0A 4CZYA 1GOTB 5HE0B 3EI4A 1GXRA 3MKSB 3AFCA 4JHPC 4A2LA 1YFQA 3UVKA 4CZVA 1UOQA 5K1CC 4BCCA 3AL9A 1GOGA 2HYEA 3N0DA 4X63B 5HYNB 1XIPA 3JAMg 2TRCB 2BKLA 5K19A 2HXCA 4O02A 3OKTA 4JSXC 4E5ZA 4BUJC 4Z7NA 4D0KA 1TYEA 2YB8B 1R5MA 2P9LC 4J8BA 4FB1D 4K3JB 4N14A 3O4HA 2OVQB 4JT5C 4PNKB 5GXIA 2B5LA 2UZXB 3EI4B 3JRPA 4PC0A 4BL0A 4GQBB 4DNWA 1U8CA 4ZOZA 3VA6A 5A2Qg 3U4YA 2AGWA 5EMJB 4PXWA 3I8EA 3SMRA 4D9SA 2HJBA 3MZKA 3IIYA 5KDOB 1PI6A 1JOFA 3PSCB 2I0SA 3EQ9A 1H2XA 4CY3A 1N6DA 4FA4D 5C86A 3OW8A 3EQ7A 2P9KC 4ERZA 2BCJB 2IUVA 4MMYA 3CFVA 4A0AA 2VDPA 2I0RA 4J79A 3IVMA 3NVQA 3OF7A 2IAAA 4IMMA 2VZ3A 4J78A 2VDLA 3ZDZA 3EI2A 1GG2B 4GMBA 3EI2B 2CO0C 4GGCA 4KFMB 3BG1A 1PEVA 2XYIA 5GXHA 2Z2NA 3I7HA 2XU7A 4GQ1A 4JD2C 1T2XA 5M5TA 3OTTA 3DXMC 5AMSA 5FKRA 3SBPA 4J81A 3ZWLB 5M5VA 3IUJA 4E54A 2GC4A 2J55H 2H6QA 5H17A 5HDBA 1VE7A 3V4PA 5IT9g 1OLZA 3EG6A 3C9CA 4QL1A 4L3GD 5FA5B 2OIZA 3ZE0A 5IGOA 4AMZA 4QT8A 3JZNA 3O4JA 2VDNA 4DNVA 3UKRC 1MDAH 3DXKC 1H2YA 5EMLB 4J0WA 5FKSA 3V5WB 3GFCA 1K32A 3EI3B 2AGLA 4U1EI 3FRXA 3T3MA 2I0TA 1L0QA 3A0FA 4AOWA 4Z7OA 1K8KC 3KRXB 4OZUA 4O2WA 1B9XA 2VDOA 1JTDB 5EALA 2IUQA 4ES0A 4O45A 3RRMC 5TF2A 2CNXA 4IRZA 3NIDA 2AH1A 3SN6B 4AN0A 3KCIA 4NSXA 2P9IC 2H9PA 2XL2A 3DWLC 4AN1A 5EM2B 2JKXA 2H9LA 2HJ4A 1U4CA 2H6KA 2YNPA 3EI1B 4J77A 4J84A 3KRWB 5H14A 2EICA 1N6FA 4FHLA 4CI2A 5HE3B 2B5NA 3JPXA 3K6SA 3NVNA 3IJCA 2VZ1A 5FXYA 3PXTD 3IUNA 5H1MA 1H2WA 1GOHA 4PSXB 1UOPA 1GP2B 4XEIC 3IKOA 1MG2A 4RE5A 3J81g 1VE6A 2XL3A 3RN1D 3OKYB 4ERQA 2HU8A 3K72A 4L1QD 4X3EA 3HFQA 2B4EA 3DSMA 3V4VA 4BH6A 3IJEA 4CC9A 3L4MD 1P22A 4A7JA 1QNIA 2J56H 3F3PA 4H5IA 3F3FA 1MG3A 4BCBA 2H47A 3PXSD 1N6EA 5CYKB 2H3XA 3EI3A 3V7DB 3BWSA 2AH0A 3FCUA 4WK2A 3RFGA 3QI0A 3ZE2A 1NEXB 4J87A 3JB9L 3IURA 4BP8A 5E6RA 4E5ZB 5M5RA 3T3PA 3RFHA 4A09B 3GD1I 2CN3A 5IGQA 2HU5A 4NC4A 4AMYA 1RI6A 4PSWB 3IJ0A 5FKQA 5TEEA 3W15A 3PE7A 4RE6A 4FA5D 4QRJA 4A0AB 4PBYA 2VDQA 4ESGA 5GMKn 2AQ5A 3EI1A 2AGZA 2GC7A 3CFSB 5TEFA 4FA9D 2I3SA 3VH0A 4CY2A 3E0CA 5HE2B 5AFU3 1I2MB 5EMMB 1YR2A 5EMKB 2H13A 3V9FA 5M5UA 1GOFA 3PXWD 5C9ZB 1C9LA 3VGZA 3SBRA 4A09A 4DNUA 3OKYA 5EAPA 4GGDA 3AL8A 4MMXA 3RN0D 1E5TA 3VI3A 4LGNA 3C75H 3IULA 5C2WB 4GZ8A 2QXVA 4L1MA 4PBZA 4XYHA 1VZ2A 3QHYB 5C92A 2I3TA 3MXXA 2Z2PA 2YNOA 4G1EA 3UR4A 3F3GA 1SHYB 4BCDA 3MVDK 3RSEC 3EMHA 3MMYA 4JXMA 1K3IA 4GM8A 4CI8A 5I5IA 3RMZD 5CXBB 4FAVD 2QR5A 3ULEC 4CY5A 4J0XA 3O4IA 4O3UB 3NVXA 1VYHC 2IWKA 4ZN4A 3OL2A
chains in the Genus database with same CATH topology
5SXMA 3SLED 2CN2A 1U2VC 1TYQC 3AL8B 5IJ7E 4YVDA 5GSAA 2Z2OA 3PSLA 5EM2A 3SFZA 4UI9R 2PM9A 4R7AB 5HQGA 3K26A 2CE9A 5I5MA 1JJUB 4ERYA 4TZ4A 3SWSD 1B9YA 1SQ9A 4CI1A 1S4UX 5CYKA 5C2VB 3I89A 4X60B 3C5MA 4OWRA 2OVRB 5FLXg 3JZGA 5EAMA 3I7NA 4I79A 3SHFA 5EARA 2P9PC 3I7LA 3DM0A 4GM3A 2O9KA 3JZHA 4J8GA 2Q7QA 3CIKB 1JMZB 2UZYB 4J86A 4G56B 3N0EA 3L4OD 5B4WA 3IIWA 2G99A 2PM9B 4Y5RD 2P9NC 3EU7A 3UVLA 4A0BA 1PBYB 1NR0A 2HKMA 1PGUA 3SVWD 3I8CA 4GM9A 5THAA 5FQDA 2BBKH 1JMXB 4QQEA 2MTAH 1TBGA 2YNNA 2H6NA 1XHMA 4O3TB 4L9OA 5IJ8E 4EWRA 5HE1B 2PM7B 4A08B 2P9SC 5AJAA 1FWXA 4J73A 5FKTA 4O1QD 1OMWB 3FGBA 4JSVC 5IC7A 3I7PA 3PVUB 4FWWA 4FAND 4LG8A 3JROA 2EBSA 2IURA 2IUPA 3RLMD 2P9UC 3UVNA 4ZOVA 3UVMA 3P4FA 5CXCB 2HESX 3OL2B 4A11B 2AGYA 4A11A 3MZLA 4GQ2P 3PVWB 3OKWA 3SCYA 4JSNC 4ZOXA 3MKQA 4A08A 2AGXA 4MK0B 2B5MA 3IJ1A 4XYIA 4FA1D 5TDHB 3SJLD 4A2MA 4A0BB 5I5JA 4HDJA 4K3ID 1A0RB 5JWZA 3SXTD 2H68A 4H5JA 3UVOA 4Z8LA 4CZXA 3ODTA 3ORVD 4AEZA 1SQJA 3K27A 4IA9A 5CXCA 2PM6B 2YBAA 4L3HD 4ZOYA 4E54B 2YMUA 4D6VA 1Q47A 2H9MA 4J82A 4CY1A 2CO0A 2H9NA 1XKSA 3I7OA 3SBQA 3B7FA 3AH8B 2H14A 2IWFA 2OK4A 4O9DA 3C99A 3GREA 2W18A 2OJYA 3UKUC 4JT6C 2GNQA 1ERJA 2OVPB 4JSPC 3I7KA 4X61B 3I2NA 5CXBA 4CI3A 3J80g 3EWEA 2J57G 2PBIB 3FM0A 2QC5A 2CE8A 4Y7RA 4U7AA 2HKRA 4LG9A 2OK6A 2G9AA 4GGAA 3BG0A 4CZYA 1GOTB 5HE0B 3EI4A 1GXRA 3MKSB 3AFCA 4A2LA 1YFQA 3UVKA 4CZVA 5K1CC 3AL9A 2HYEA 3N0DA 4X63B 5HYNB 1XIPA 3JAMg 2TRCB 5K19A 2HXCA 3OKTA 4JSXC 4E5ZA 4BUJC 4D0KA 2YB8B 1R5MA 2P9LC 4J8BA 4FB1D 4K3JB 4N14A 2OVQB 4JT5C 4PNKB 5GXIA 2B5LA 2UZXB 3EI4B 3JRPA 4PC0A 4BL0A 4GQBB 4ZOZA 3VA6A 5A2Qg 3U4YA 2AGWA 5EMJB 4PXWA 3I8EA 3SMRA 2HJBA 3MZKA 3IIYA 5KDOB 1PI6A 1JOFA 3PSCB 2I0SA 4CY3A 1N6DA 4FA4D 3OW8A 2P9KC 4ERZA 2BCJB 2IUVA 3CFVA 4A0AA 2I0RA 4J79A 3NVQA 2IAAA 4IMMA 4J78A 3EI2A 1GG2B 4GMBA 3EI2B 2CO0C 4GGCA 4KFMB 3BG1A 1PEVA 2XYIA 5GXHA 2Z2NA 3I7HA 2XU7A 4GQ1A 4JD2C 3OTTA 3DXMC 5AMSA 5FKRA 3SBPA 4J81A 3ZWLB 4E54A 2GC4A 2J55H 2H6QA 5H17A 5IT9g 1OLZA 3EG6A 3C9CA 4QL1A 4L3GD 5FA5B 2OIZA 5IGOA 4QT8A 3JZNA 3UKRC 1MDAH 3DXKC 5EMLB 4J0WA 5FKSA 3V5WB 3GFCA 1K32A 3EI3B 2AGLA 4U1EI 3FRXA 2I0TA 1L0QA 3A0FA 4AOWA 1K8KC 3KRXB 4OZUA 1B9XA 5EALA 2IUQA 4ES0A 4O45A 3RRMC 5TF2A 2CNXA 2AH1A 3SN6B 4NSXA 2P9IC 2H9PA 2XL2A 3DWLC 5EM2B 2H9LA 2HJ4A 1U4CA 2H6KA 2YNPA 3EI1B 4J77A 4J84A 3KRWB 5H14A 1N6FA 4FHLA 4CI2A 5HE3B 2B5NA 3JPXA 3NVNA 3IJCA 5FXYA 3PXTD 5H1MA 4PSXB 1GP2B 4XEIC 3IKOA 1MG2A 3J81g 2XL3A 4ERQA 3RN1D 3OKYB 4L1QD 4X3EA 3HFQA 2B4EA 3DSMA 4BH6A 4CC9A 3L4MD 1P22A 4A7JA 1QNIA 2J56H 3F3PA 4H5IA 3F3FA 1MG3A 2H47A 3PXSD 1N6EA 5CYKB 2H3XA 3EI3A 3V7DB 3BWSA 2AH0A 3RFGA 1NEXB 4J87A 3JB9L 4E5ZB 3RFHA 4A09B 2CN3A 5IGQA 1RI6A 4PSWB 3IJ0A 5FKQA 5TEEA 3W15A 3PE7A 4FA5D 4QRJA 4A0AB 4PBYA 4ESGA 5GMKn 2AQ5A 3EI1A 2AGZA 2GC7A 3CFSB 5TEFA 4FA9D 2I3SA 3VH0A 4CY2A 3E0CA 5HE2B 5AFU3 5EMMB 5EMKB 2H13A 3V9FA 3PXWD 5C9ZB 3VGZA 3SBRA 4A09A 3OKYA 5EAPA 4GGDA 3AL8A 3RN0D 4LGNA 3C75H 5C2WB 4GZ8A 2QXVA 4PBZA 4XYHA 2I3TA 3MXXA 2Z2PA 2YNOA 3UR4A 3F3GA 1SHYB 3RSEC 3EMHA 3MMYA 4JXMA 4GM8A 4CI8A 5I5IA 3RMZD 5CXBB 4FAVD 3ULEC 4CY5A 4J0XA 4O3UB 3NVXA 1VYHC 2IWKA 4ZN4A 3OL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SXM A;  3SLE D;  2CN2 A;  1U2V C;  1TYQ C;  3AL8 B;  5IJ7 E;  4YVD A;  5GSA A;  2Z2O A;  3PSL A;  5EM2 A;  3SFZ A;  4UI9 R;  2PM9 A;  4R7A B;  5HQG A;  3K26 A;  2CE9 A;  5I5M A;  1JJU B;  4ERY A;  4TZ4 A;  3SWS D;  1B9Y A;  1SQ9 A;  4CI1 A;  1S4U X;  5CYK A;  5C2V B;  3I89 A;  4X60 B;  3C5M A;  4OWR A;  2OVR B;  5FLX g;  3JZG A;  5EAM A;  3I7N A;  4I79 A;  3SHF A;  5EAR A;  2P9P C;  3I7L A;  3DM0 A;  4GM3 A;  2O9K A;  3JZH A;  4J8G A;  2Q7Q A;  3CIK B;  1JMZ B;  2UZY B;  4J86 A;  4G56 B;  3N0E A;  3L4O D;  5B4W A;  3IIW A;  2G99 A;  2PM9 B;  4Y5R D;  2P9N C;  3EU7 A;  3UVL A;  4A0B A;  1PBY B;  1NR0 A;  2HKM A;  1PGU A;  3SVW D;  3I8C A;  4GM9 A;  5THA A;  5FQD A;  2BBK H;  1JMX B;  4QQE A;  2MTA H;  1TBG A;  2YNN A;  2H6N A;  1XHM A;  4O3T B;  4L9O A;  5IJ8 E;  4EWR A;  5HE1 B;  2PM7 B;  4A08 B;  2P9S C;  5AJA A;  1FWX A;  4J73 A;  5FKT A;  4O1Q D;  1OMW B;  3FGB A;  4JSV C;  5IC7 A;  3I7P A;  3PVU B;  4FWW A;  4FAN D;  4LG8 A;  3JRO A;  2EBS A;  2IUR A;  2IUP A;  3RLM D;  2P9U C;  3UVN A;  4ZOV A;  3UVM A;  3P4F A;  5CXC B;  2HES X;  3OL2 B;  4A11 B;  2AGY A;  4A11 A;  3MZL A;  4GQ2 P;  3PVW B;  3OKW A;  3SCY A;  4JSN C;  4ZOX A;  3MKQ A;  4A08 A;  2AGX A;  4MK0 B;  2B5M A;  3IJ1 A;  4XYI A;  4FA1 D;  5TDH B;  3SJL D;  4A2M A;  4A0B B;  5I5J A;  4HDJ A;  4K3I D;  1A0R B;  5JWZ A;  3SXT D;  2H68 A;  4H5J A;  3UVO A;  4Z8L A;  4CZX A;  3ODT A;  3ORV D;  4AEZ A;  1SQJ A;  3K27 A;  4IA9 A;  5CXC A;  2PM6 B;  2YBA A;  4L3H D;  4ZOY A;  4E54 B;  2YMU A;  4D6V A;  1Q47 A;  2H9M A;  4J82 A;  4CY1 A;  2CO0 A;  2H9N A;  1XKS A;  3I7O A;  3SBQ A;  3B7F A;  3AH8 B;  2H14 A;  2IWF A;  2OK4 A;  4O9D A;  3C99 A;  3GRE A;  2W18 A;  2OJY A;  3UKU C;  4JT6 C;  2GNQ A;  1ERJ A;  2OVP B;  4JSP C;  3I7K A;  4X61 B;  3I2N A;  5CXB A;  4CI3 A;  3J80 g;  3EWE A;  2J57 G;  2PBI B;  3FM0 A;  2QC5 A;  2CE8 A;  4Y7R A;  4U7A A;  2HKR A;  4LG9 A;  2OK6 A;  2G9A A;  4GGA A;  3BG0 A;  4CZY A;  1GOT B;  5HE0 B;  3EI4 A;  1GXR A;  3MKS B;  3AFC A;  4A2L A;  1YFQ A;  3UVK A;  4CZV A;  5K1C C;  3AL9 A;  2HYE A;  3N0D A;  4X63 B;  5HYN B;  1XIP A;  3JAM g;  2TRC B;  5K19 A;  2HXC A;  3OKT A;  4JSX C;  4E5Z A;  4BUJ C;  4D0K A;  2YB8 B;  1R5M A;  2P9L C;  4J8B A;  4FB1 D;  4K3J B;  4N14 A;  2OVQ B;  4JT5 C;  4PNK B;  5GXI A;  2B5L A;  2UZX B;  3EI4 B;  3JRP A;  4PC0 A;  4BL0 A;  4GQB B;  4ZOZ A;  3VA6 A;  5A2Q g;  3U4Y A;  2AGW A;  5EMJ B;  4PXW A;  3I8E A;  3SMR A;  2HJB A;  3MZK A;  3IIY A;  5KDO B;  1PI6 A;  1JOF A;  3PSC B;  2I0S A;  4CY3 A;  1N6D A;  4FA4 D;  3OW8 A;  2P9K C;  4ERZ A;  2BCJ B;  2IUV A;  3CFV A;  4A0A A;  2I0R A;  4J79 A;  3NVQ A;  2IAA A;  4IMM A;  4J78 A;  3EI2 A;  1GG2 B;  4GMB A;  3EI2 B;  2CO0 C;  4GGC A;  4KFM B;  3BG1 A;  1PEV A;  2XYI A;  5GXH A;  2Z2N A;  3I7H A;  2XU7 A;  4GQ1 A;  4JD2 C;  3OTT A;  3DXM C;  5AMS A;  5FKR A;  3SBP A;  4J81 A;  3ZWL B;  4E54 A;  2GC4 A;  2J55 H;  2H6Q A;  5H17 A;  5IT9 g;  1OLZ A;  3EG6 A;  3C9C A;  4QL1 A;  4L3G D;  5FA5 B;  2OIZ A;  5IGO A;  4QT8 A;  3JZN A;  3UKR C;  1MDA H;  3DXK C;  5EML B;  4J0W A;  5FKS A;  3V5W B;  3GFC A;  1K32 A;  3EI3 B;  2AGL A;  4U1E I;  3FRX A;  2I0T A;  1L0Q A;  3A0F A;  4AOW A;  1K8K C;  3KRX B;  4OZU A;  1B9X A;  5EAL A;  2IUQ A;  4ES0 A;  4O45 A;  3RRM C;  5TF2 A;  2CNX A;  2AH1 A;  3SN6 B;  4NSX A;  2P9I C;  2H9P A;  2XL2 A;  3DWL C;  5EM2 B;  2H9L A;  2HJ4 A;  1U4C A;  2H6K A;  2YNP A;  3EI1 B;  4J77 A;  4J84 A;  3KRW B;  5H14 A;  1N6F A;  4FHL A;  4CI2 A;  5HE3 B;  2B5N A;  3JPX A;  3NVN A;  3IJC A;  5FXY A;  3PXT D;  5H1M A;  4PSX B;  1GP2 B;  4XEI C;  3IKO A;  1MG2 A;  3J81 g;  2XL3 A;  4ERQ A;  3RN1 D;  3OKY B;  4L1Q D;  4X3E A;  3HFQ A;  2B4E A;  3DSM A;  4BH6 A;  4CC9 A;  3L4M D;  1P22 A;  4A7J A;  1QNI A;  2J56 H;  3F3P A;  4H5I A;  3F3F A;  1MG3 A;  2H47 A;  3PXS D;  1N6E A;  5CYK B;  2H3X A;  3EI3 A;  3V7D B;  3BWS A;  2AH0 A;  3RFG A;  1NEX B;  4J87 A;  3JB9 L;  4E5Z B;  3RFH A;  4A09 B;  2CN3 A;  5IGQ A;  1RI6 A;  4PSW B;  3IJ0 A;  5FKQ A;  5TEE A;  3W15 A;  3PE7 A;  4FA5 D;  4QRJ A;  4A0A B;  4PBY A;  4ESG A;  5GMK n;  2AQ5 A;  3EI1 A;  2AGZ A;  2GC7 A;  3CFS B;  5TEF A;  4FA9 D;  2I3S A;  3VH0 A;  4CY2 A;  3E0C A;  5HE2 B;  5AFU 3;  5EMM B;  5EMK B;  2H13 A;  3V9F A;  3PXW D;  5C9Z B;  3VGZ A;  3SBR A;  4A09 A;  3OKY A;  5EAP A;  4GGD A;  3AL8 A;  3RN0 D;  4LGN A;  3C75 H;  5C2W B;  4GZ8 A;  2QXV A;  4PBZ A;  4XYH A;  2I3T A;  3MXX A;  2Z2P A;  2YNO A;  3UR4 A;  3F3G A;  1SHY B;  3RSE C;  3EMH A;  3MMY A;  4JXM A;  4GM8 A;  4CI8 A;  5I5I A;  3RMZ D;  5CXB B;  4FAV D;  3ULE C;  4CY5 A;  4J0X A;  4O3U B;  3NVX A;  1VYH C;  2IWK A;  4ZN4 A;  3OL2 A; 
#chains in the Genus database with same CATH topology
 5SXM A;  3SLE D;  2CN2 A;  4UM9 A;  1U2V C;  1TYQ C;  3AL8 B;  5IJ7 E;  4YVD A;  5GSA A;  2Z2O A;  3NIG A;  3PSL A;  1H2Z A;  5EM2 A;  3SFZ A;  4UI9 R;  2PM9 A;  4R7A B;  5HQG A;  5M61 A;  3K26 A;  2CE9 A;  3VI4 A;  5I5M A;  1JJU B;  4ERY A;  4TZ4 A;  3SWS D;  1JV2 A;  1B9Y A;  2EID A;  1SQ9 A;  4CI1 A;  2HU7 A;  1S4U X;  5CYK A;  4JHN A;  3ZDX A;  5C2V B;  2EIE A;  3I89 A;  4X60 B;  3C5M A;  4OWR A;  2OVR B;  5FLX g;  3JZG A;  4NBM A;  5EAM A;  3I7N A;  4I79 A;  1C9I A;  3SHF A;  5EAR A;  2P9P C;  3I7L A;  2XZG A;  3DM0 A;  4GM3 A;  2O9K A;  3JZH A;  4J8G A;  5E6U A;  2Q7Q A;  2VDM A;  3CIK B;  1JMZ B;  2UZY B;  4J86 A;  4G56 B;  3N0E A;  3L4O D;  2XDW A;  5B4W A;  3IIW A;  4MMZ A;  2G99 A;  2PM9 B;  4Y5R D;  2P9N C;  3EU7 A;  3UVL A;  4A0B A;  1PBY B;  4WJK A;  4G55 A;  2QZP A;  1NR0 A;  2HKM A;  4BP9 A;  1PGU A;  3SVW D;  5M5S A;  3I8C A;  4WK0 A;  4GM9 A;  5THA A;  5FQD A;  2BBK H;  1JMX B;  4QQE A;  2MTA H;  2VC2 A;  3FCS A;  1QFS A;  1UOO A;  2VDK A;  1TBG A;  2YNN A;  2H6N A;  1XHM A;  4O3T B;  4L9O A;  5IJ8 E;  2XE4 A;  4EWR A;  5HE1 B;  3MUN A;  2PM7 B;  4A08 B;  2P9S C;  5AJA A;  1FWX A;  4J73 A;  5FKT A;  1OMW B;  3FGB A;  4JSV C;  4O1Q D;  5IC7 A;  3I7P A;  3PVU B;  4FWW A;  4NAA A;  4FAN D;  4LG8 A;  1UTC A;  1E8N A;  3JRO A;  1BPO A;  2EBS A;  2IUR A;  1E8M A;  2IUP A;  3RLM D;  2P9U C;  3UVN A;  4ZOV A;  3UVM A;  3P4F A;  5CXC B;  2HES X;  3OL2 B;  4A11 B;  2AGY A;  4A11 A;  3MZL A;  2VDR A;  4GQ2 P;  1QFM A;  3PVW B;  1A12 A;  1L5G A;  3OKW A;  3SCY A;  4JSN C;  4ZOX A;  5E6S A;  3MKQ A;  4A08 A;  1O6G A;  2AGX A;  1M1X A;  4Z7Q A;  4MK0 B;  2B5M A;  3IJ1 A;  4XYI A;  4FA1 D;  4WK4 A;  5TDH B;  2EIB A;  4NEN A;  3SJL D;  4A2M A;  4A0B B;  5I5J A;  4HDJ A;  3ZDY A;  4K3I D;  1A0R B;  5JWZ A;  3SXT D;  2H68 A;  2WQ8 A;  4H5J A;  3UVO A;  4Z8L A;  4CZX A;  3ODT A;  3ORV D;  4AEZ A;  1SQJ A;  3K27 A;  4IA9 A;  4G1M A;  5CXC A;  2PM6 B;  5FFG A;  2YBA A;  4L3H D;  4ZOY A;  4E54 B;  2YMU A;  4D6V A;  1Q47 A;  2H9M A;  4J82 A;  4CY1 A;  2CO0 A;  2H9N A;  1XKS A;  3GC3 B;  3I7O A;  3SBQ A;  3B7F A;  3EQ8 A;  3AH8 B;  2H14 A;  2IWF A;  2OK4 A;  3C99 A;  4O9D A;  3GRE A;  2W18 A;  2OJY A;  3UKU C;  3IUM A;  3O4G A;  4JT6 C;  2GNQ A;  5FFO A;  1ERJ A;  4UM8 A;  2OVP B;  4QAM A;  4JSP C;  3I7K A;  4X61 B;  3ZE1 A;  3I2N A;  1VZ3 A;  5CXB A;  3MUO A;  4CI3 A;  3J80 g;  3K71 A;  3EWE A;  2J57 G;  1O6F A;  2PBI B;  3FM0 A;  3DDU A;  2QC5 A;  2CE8 A;  4Y7R A;  4U7A A;  2HKR A;  3IUQ A;  4LG9 A;  4AX4 A;  2OK6 A;  2G9A A;  3NIF A;  4GGA A;  3BG0 A;  4CZY A;  1GOT B;  5HE0 B;  3EI4 A;  1GXR A;  3MKS B;  3AFC A;  4JHP C;  4A2L A;  1YFQ A;  3UVK A;  4CZV A;  1UOQ A;  5K1C C;  4BCC A;  3AL9 A;  1GOG A;  2HYE A;  3N0D A;  4X63 B;  5HYN B;  1XIP A;  3JAM g;  2TRC B;  2BKL A;  5K19 A;  2HXC A;  4O02 A;  3OKT A;  4JSX C;  4E5Z A;  4BUJ C;  4Z7N A;  4D0K A;  1TYE A;  2YB8 B;  1R5M A;  2P9L C;  4J8B A;  4FB1 D;  4K3J B;  4N14 A;  3O4H A;  2OVQ B;  4JT5 C;  4PNK B;  5GXI A;  2B5L A;  2UZX B;  3EI4 B;  3JRP A;  4PC0 A;  4BL0 A;  4GQB B;  4DNW A;  1U8C A;  4ZOZ A;  3VA6 A;  5A2Q g;  3U4Y A;  2AGW A;  5EMJ B;  4PXW A;  3I8E A;  3SMR A;  4D9S A;  2HJB A;  3MZK A;  3IIY A;  5KDO B;  1PI6 A;  1JOF A;  3PSC B;  2I0S A;  3EQ9 A;  1H2X A;  4CY3 A;  1N6D A;  4FA4 D;  5C86 A;  3OW8 A;  3EQ7 A;  2P9K C;  4ERZ A;  2BCJ B;  2IUV A;  4MMY A;  3CFV A;  4A0A A;  2VDP A;  2I0R A;  4J79 A;  3IVM A;  3NVQ A;  3OF7 A;  2IAA A;  4IMM A;  2VZ3 A;  4J78 A;  2VDL A;  3ZDZ A;  3EI2 A;  1GG2 B;  4GMB A;  3EI2 B;  2CO0 C;  4GGC A;  4KFM B;  3BG1 A;  1PEV A;  2XYI A;  5GXH A;  2Z2N A;  3I7H A;  2XU7 A;  4GQ1 A;  4JD2 C;  1T2X A;  5M5T A;  3OTT A;  3DXM C;  5AMS A;  5FKR A;  3SBP A;  4J81 A;  3ZWL B;  5M5V A;  3IUJ A;  4E54 A;  2GC4 A;  2J55 H;  2H6Q A;  5H17 A;  5HDB A;  1VE7 A;  3V4P A;  5IT9 g;  1OLZ A;  3EG6 A;  3C9C A;  4QL1 A;  4L3G D;  5FA5 B;  2OIZ A;  3ZE0 A;  5IGO A;  4AMZ A;  4QT8 A;  3JZN A;  3O4J A;  2VDN A;  4DNV A;  3UKR C;  1MDA H;  3DXK C;  1H2Y A;  5EML B;  4J0W A;  5FKS A;  3V5W B;  3GFC A;  1K32 A;  3EI3 B;  2AGL A;  4U1E I;  3FRX A;  3T3M A;  2I0T A;  1L0Q A;  3A0F A;  4AOW A;  4Z7O A;  1K8K C;  3KRX B;  4OZU A;  4O2W A;  1B9X A;  2VDO A;  1JTD B;  5EAL A;  2IUQ A;  4ES0 A;  4O45 A;  3RRM C;  5TF2 A;  2CNX A;  4IRZ A;  3NID A;  2AH1 A;  3SN6 B;  4AN0 A;  3KCI A;  4NSX A;  2P9I C;  2H9P A;  2XL2 A;  3DWL C;  4AN1 A;  5EM2 B;  2JKX A;  2H9L A;  2HJ4 A;  1U4C A;  2H6K A;  2YNP A;  3EI1 B;  4J77 A;  4J84 A;  3KRW B;  5H14 A;  2EIC A;  1N6F A;  4FHL A;  4CI2 A;  5HE3 B;  2B5N A;  3JPX A;  3K6S A;  3NVN A;  3IJC A;  2VZ1 A;  5FXY A;  3PXT D;  3IUN A;  5H1M A;  1H2W A;  1GOH A;  4PSX B;  1UOP A;  1GP2 B;  4XEI C;  3IKO A;  1MG2 A;  4RE5 A;  3J81 g;  1VE6 A;  2XL3 A;  3RN1 D;  3OKY B;  4ERQ A;  2HU8 A;  3K72 A;  4L1Q D;  4X3E A;  3HFQ A;  2B4E A;  3DSM A;  3V4V A;  4BH6 A;  3IJE A;  4CC9 A;  3L4M D;  1P22 A;  4A7J A;  1QNI A;  2J56 H;  3F3P A;  4H5I A;  3F3F A;  1MG3 A;  4BCB A;  2H47 A;  3PXS D;  1N6E A;  5CYK B;  2H3X A;  3EI3 A;  3V7D B;  3BWS A;  2AH0 A;  3FCU A;  4WK2 A;  3RFG A;  3QI0 A;  3ZE2 A;  1NEX B;  4J87 A;  3JB9 L;  3IUR A;  4BP8 A;  5E6R A;  4E5Z B;  5M5R A;  3T3P A;  3RFH A;  4A09 B;  3GD1 I;  2CN3 A;  5IGQ A;  2HU5 A;  4NC4 A;  4AMY A;  1RI6 A;  4PSW B;  3IJ0 A;  5FKQ A;  5TEE A;  3W15 A;  3PE7 A;  4RE6 A;  4FA5 D;  4QRJ A;  4A0A B;  4PBY A;  2VDQ A;  4ESG A;  5GMK n;  2AQ5 A;  3EI1 A;  2AGZ A;  2GC7 A;  3CFS B;  5TEF A;  4FA9 D;  2I3S A;  3VH0 A;  4CY2 A;  3E0C A;  5HE2 B;  5AFU 3;  1I2M B;  5EMM B;  1YR2 A;  5EMK B;  2H13 A;  3V9F A;  5M5U A;  1GOF A;  3PXW D;  5C9Z B;  1C9L A;  3VGZ A;  3SBR A;  4A09 A;  4DNU A;  3OKY A;  5EAP A;  4GGD A;  3AL8 A;  4MMX A;  3RN0 D;  1E5T A;  3VI3 A;  4LGN A;  3C75 H;  3IUL A;  5C2W B;  4GZ8 A;  2QXV A;  4L1M A;  4PBZ A;  4XYH A;  1VZ2 A;  3QHY B;  5C92 A;  2I3T A;  3MXX A;  2Z2P A;  2YNO A;  4G1E A;  3UR4 A;  3F3G A;  1SHY B;  4BCD A;  3MVD K;  3RSE C;  3EMH A;  3MMY A;  4JXM A;  1K3I A;  4GM8 A;  4CI8 A;  5I5I A;  3RMZ D;  5CXB B;  4FAV D;  2QR5 A;  3ULE C;  4CY5 A;  4J0X A;  3O4I A;  4O3U B;  3NVX A;  1VYH C;  2IWK A;  4ZN4 A;  3OL2 A; 
#chains in the Genus database with same CATH homology
 5SXM A;  3SLE D;  2CN2 A;  1U2V C;  1TYQ C;  3AL8 B;  5IJ7 E;  4YVD A;  5GSA A;  2Z2O A;  3PSL A;  5EM2 A;  3SFZ A;  4UI9 R;  2PM9 A;  4R7A B;  5HQG A;  3K26 A;  2CE9 A;  5I5M A;  1JJU B;  4ERY A;  4TZ4 A;  3SWS D;  1B9Y A;  1SQ9 A;  4CI1 A;  1S4U X;  5CYK A;  5C2V B;  3I89 A;  4X60 B;  3C5M A;  4OWR A;  2OVR B;  5FLX g;  3JZG A;  5EAM A;  3I7N A;  4I79 A;  3SHF A;  5EAR A;  2P9P C;  3I7L A;  3DM0 A;  4GM3 A;  2O9K A;  3JZH A;  4J8G A;  2Q7Q A;  3CIK B;  1JMZ B;  2UZY B;  4J86 A;  4G56 B;  3N0E A;  3L4O D;  5B4W A;  3IIW A;  2G99 A;  2PM9 B;  4Y5R D;  2P9N C;  3EU7 A;  3UVL A;  4A0B A;  1PBY B;  1NR0 A;  2HKM A;  1PGU A;  3SVW D;  3I8C A;  4GM9 A;  5THA A;  5FQD A;  2BBK H;  1JMX B;  4QQE A;  2MTA H;  1TBG A;  2YNN A;  2H6N A;  1XHM A;  4O3T B;  4L9O A;  5IJ8 E;  4EWR A;  5HE1 B;  2PM7 B;  4A08 B;  2P9S C;  5AJA A;  1FWX A;  4J73 A;  5FKT A;  4O1Q D;  1OMW B;  3FGB A;  4JSV C;  5IC7 A;  3I7P A;  3PVU B;  4FWW A;  4FAN D;  4LG8 A;  3JRO A;  2EBS A;  2IUR A;  2IUP A;  3RLM D;  2P9U C;  3UVN A;  4ZOV A;  3UVM A;  3P4F A;  5CXC B;  2HES X;  3OL2 B;  4A11 B;  2AGY A;  4A11 A;  3MZL A;  4GQ2 P;  3PVW B;  3OKW A;  3SCY A;  4JSN C;  4ZOX A;  3MKQ A;  4A08 A;  2AGX A;  4MK0 B;  2B5M A;  3IJ1 A;  4XYI A;  4FA1 D;  5TDH B;  3SJL D;  4A2M A;  4A0B B;  5I5J A;  4HDJ A;  4K3I D;  1A0R B;  5JWZ A;  3SXT D;  2H68 A;  4H5J A;  3UVO A;  4Z8L A;  4CZX A;  3ODT A;  3ORV D;  4AEZ A;  1SQJ A;  3K27 A;  4IA9 A;  5CXC A;  2PM6 B;  2YBA A;  4L3H D;  4ZOY A;  4E54 B;  2YMU A;  4D6V A;  1Q47 A;  2H9M A;  4J82 A;  4CY1 A;  2CO0 A;  2H9N A;  1XKS A;  3I7O A;  3SBQ A;  3B7F A;  3AH8 B;  2H14 A;  2IWF A;  2OK4 A;  4O9D A;  3C99 A;  3GRE A;  2W18 A;  2OJY A;  3UKU C;  4JT6 C;  2GNQ A;  1ERJ A;  2OVP B;  4JSP C;  3I7K A;  4X61 B;  3I2N A;  5CXB A;  4CI3 A;  3J80 g;  3EWE A;  2J57 G;  2PBI B;  3FM0 A;  2QC5 A;  2CE8 A;  4Y7R A;  4U7A A;  2HKR A;  4LG9 A;  2OK6 A;  2G9A A;  4GGA A;  3BG0 A;  4CZY A;  1GOT B;  5HE0 B;  3EI4 A;  1GXR A;  3MKS B;  3AFC A;  4A2L A;  1YFQ A;  3UVK A;  4CZV A;  5K1C C;  3AL9 A;  2HYE A;  3N0D A;  4X63 B;  5HYN B;  1XIP A;  3JAM g;  2TRC B;  5K19 A;  2HXC A;  3OKT A;  4JSX C;  4E5Z A;  4BUJ C;  4D0K A;  2YB8 B;  1R5M A;  2P9L C;  4J8B A;  4FB1 D;  4K3J B;  4N14 A;  2OVQ B;  4JT5 C;  4PNK B;  5GXI A;  2B5L A;  2UZX B;  3EI4 B;  3JRP A;  4PC0 A;  4BL0 A;  4GQB B;  4ZOZ A;  3VA6 A;  5A2Q g;  3U4Y A;  2AGW A;  5EMJ B;  4PXW A;  3I8E A;  3SMR A;  2HJB A;  3MZK A;  3IIY A;  5KDO B;  1PI6 A;  1JOF A;  3PSC B;  2I0S A;  4CY3 A;  1N6D A;  4FA4 D;  3OW8 A;  2P9K C;  4ERZ A;  2BCJ B;  2IUV A;  3CFV A;  4A0A A;  2I0R A;  4J79 A;  3NVQ A;  2IAA A;  4IMM A;  4J78 A;  3EI2 A;  1GG2 B;  4GMB A;  3EI2 B;  2CO0 C;  4GGC A;  4KFM B;  3BG1 A;  1PEV A;  2XYI A;  5GXH A;  2Z2N A;  3I7H A;  2XU7 A;  4GQ1 A;  4JD2 C;  3OTT A;  3DXM C;  5AMS A;  5FKR A;  3SBP A;  4J81 A;  3ZWL B;  4E54 A;  2GC4 A;  2J55 H;  2H6Q A;  5H17 A;  5IT9 g;  1OLZ A;  3EG6 A;  3C9C A;  4QL1 A;  4L3G D;  5FA5 B;  2OIZ A;  5IGO A;  4QT8 A;  3JZN A;  3UKR C;  1MDA H;  3DXK C;  5EML B;  4J0W A;  5FKS A;  3V5W B;  3GFC A;  1K32 A;  3EI3 B;  2AGL A;  4U1E I;  3FRX A;  2I0T A;  1L0Q A;  3A0F A;  4AOW A;  1K8K C;  3KRX B;  4OZU A;  1B9X A;  5EAL A;  2IUQ A;  4ES0 A;  4O45 A;  3RRM C;  5TF2 A;  2CNX A;  2AH1 A;  3SN6 B;  4NSX A;  2P9I C;  2H9P A;  2XL2 A;  3DWL C;  5EM2 B;  2H9L A;  2HJ4 A;  1U4C A;  2H6K A;  2YNP A;  3EI1 B;  4J77 A;  4J84 A;  3KRW B;  5H14 A;  1N6F A;  4FHL A;  4CI2 A;  5HE3 B;  2B5N A;  3JPX A;  3NVN A;  3IJC A;  5FXY A;  3PXT D;  5H1M A;  4PSX B;  1GP2 B;  4XEI C;  3IKO A;  1MG2 A;  3J81 g;  2XL3 A;  4ERQ A;  3RN1 D;  3OKY B;  4L1Q D;  4X3E A;  3HFQ A;  2B4E A;  3DSM A;  4BH6 A;  4CC9 A;  3L4M D;  1P22 A;  4A7J A;  1QNI A;  2J56 H;  3F3P A;  4H5I A;  3F3F A;  1MG3 A;  2H47 A;  3PXS D;  1N6E A;  5CYK B;  2H3X A;  3EI3 A;  3V7D B;  3BWS A;  2AH0 A;  3RFG A;  1NEX B;  4J87 A;  3JB9 L;  4E5Z B;  3RFH A;  4A09 B;  2CN3 A;  5IGQ A;  1RI6 A;  4PSW B;  3IJ0 A;  5FKQ A;  5TEE A;  3W15 A;  3PE7 A;  4FA5 D;  4QRJ A;  4A0A B;  4PBY A;  4ESG A;  5GMK n;  2AQ5 A;  3EI1 A;  2AGZ A;  2GC7 A;  3CFS B;  5TEF A;  4FA9 D;  2I3S A;  3VH0 A;  4CY2 A;  3E0C A;  5HE2 B;  5AFU 3;  5EMM B;  5EMK B;  2H13 A;  3V9F A;  3PXW D;  5C9Z B;  3VGZ A;  3SBR A;  4A09 A;  3OKY A;  5EAP A;  4GGD A;  3AL8 A;  3RN0 D;  4LGN A;  3C75 H;  5C2W B;  4GZ8 A;  2QXV A;  4PBZ A;  4XYH A;  2I3T A;  3MXX A;  2Z2P A;  2YNO A;  3UR4 A;  3F3G A;  1SHY B;  3RSE C;  3EMH A;  3MMY A;  4JXM A;  4GM8 A;  4CI8 A;  5I5I A;  3RMZ D;  5CXB B;  4FAV D;  3ULE C;  4CY5 A;  4J0X A;  4O3U B;  3NVX A;  1VYH C;  2IWK A;  4ZN4 A;  3OL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...