2HEUA

Atomic resolution structure of apo-form of rafe from streptococcus pneumoniae
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
391
structure length
390
Chain Sequence
LFQGPSSTVTIEYFNQKKEMTKTLEEITRDFEKENPKIVKVVNVPNAGEVLKTRVLAGDVPDVVNIYPQSIELQEWAKAGVFEDLSNKDYLKRVKNGYAEKYAVNEKVYNVPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIVAKGQTPFGIAGADAWTLNGYNQLAFATATGGGKEANQYLRYSQPNAIKLSDPIMKDDIKVMDILRINGSKQKNWEGAGYTDVIGAFARGDVLMTPNGSWAITAINEQKPNFKIGTFMIPGKEKGQSLTVGAGDLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEGVKQAGEDSPLAGMTEYAFTDRHLVWLQQYWTSEADFHTLTMNYVLTGDKQGMVNDLNAFFNPMKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar ABC transporter, sugar-binding protein
publication title High resolution crystal structures of RafE from Streptococcus pneumoniae.
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
total genus 134
structure length 390
sequence length 391
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2heuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2heuA02
5ICQA 2VP1A 3H6TA 3PMXA 2UVIA 5CRYA 4H8IA 1N04A 4F3GA 2P0SA 1D3KA 4YMAA 5B7DA 4K3FA 2ZYKA 1B46A 4E0WA 4PFWA 3U8QA 1MY3A 2Z23A 2RINA 5EHSA 2VOZA 3VDFA 1SYHA 4H8JA 4EQBA 4POWA 1KWHA 5I57A 4R2FA 1ZMGA 3ILUB 4GFRA 2Q2AA 3IOWA 4ESXA 5JK4A 1LFGA 2XXRA 4IGTA 1URGA 2P1SA 1RYXA 1LAGE 3EHTA 4RK9A 1LCTA 3RGYA 3LR1A 5DEXA 2OJTA 4X48A 1CE2A 4IY6A 4R73A 5AA2D 5K2XA 5ICTA 4RPOA 1MXXA 3S2VA 3KZGA 4RK2A 3FD3A 3FV2A 1CB6A 3VE1B 2V93A 4XKQA 1A99A 1S50A 4LZ5A 1JW1A 4FECA 4TQUQ 1OLCA 3G3GA 4KCCA 3T9UA 3S4UA 3Q28A 1QW0A 3C33A 2YPNA 4G68A 4GQOA 1B3GA 4OETA 3RQTA 2FYIA 5I59A 4QFLA 2V3UA 4I1DA 2F6GA 1H43A 1Y3PA 5AA4A 4ND9A 1ANFA 3K00A 3H6WA 5I2KA 3CFXA 3MPLA 3VXCA 1IITA 3USDA 4OFJA 2XXIA 1POTA 2XX7A 2I4CA 5I56B 2B65A 4F1UA 4NF8B 3TFLA 4YAHX 2Q89A 2I48A 1SW4A 5KDTB 2DSFA 2ESNA 3N6TA 1M5BA 3SDFA 4NWCA 2ABHA 4M4GA 3O9PA 1JVXA 4F3BA 1GV8A 4PE5B 3KN8A 1ELJA 1Z7ME 3G3KA 3O6GA 3SEUA 3PV0E 1JEVA 1OVTA 1H44A 4F29A 1JNFA 2PT1A 4QSEA 3O29A 3UK4A 5JEIA 4YKJA 2B3FA 3TQWA 3K02A 4KYSA 1XT8A 5TPAB 1Y1ZA 5L9MA 1LGBC 3TYHA 5CMCA 1DTZA 2O51A 1AIVA 4GXSB 4KYEA 3Q29A 3KEIA 3MVXA 2DE2A 3K1PA 3QUJA 1Q1KA 3K6WA 3PPRA 1IZ1A 4DE8A 1R9LA 5CBSA 3KN7A 1PEBA 3FZVA 4IO7A 2V3TA 3C36A 3CG3A 2RC9A 1LBCA 2I0BA 1PDAA 2XX8A 1B1HA 3VVFA 4JWYA 1LLSA 4BDRA 1N84A 4R75A 1Y4CA 4X9TA 3C9HA 4EQ9A 2GH9A 5CBRA 3I3VA 3M3KA 5J1DA 4F31B 4H65A 1ZKBA 1VFDA 3CFZA 3RT6B 2XXUA 2RC8A 3LSLA 1XVYA 4FE8A 2Y7RA 4JBZA 1IIWA 3A3UA 1UQWA 5AA3A 4U23A 4ELQA 1UTBB 3TTLA 4DXCA 4I9DA 4KD5A 1BIYA 3PUYE 3K6VA 5I84A 1WODA 3CG1A 1UTHA 4GVOA 3U72A 3MWBA 4NMYA 1B5JA 1P1NA 2I6EA 1B7HA 1I6QA 3AXFA 3G3HA 4LA9A 2F35A 5AE4A 1R6ZA 2HAUA 5ELVA 3SEXA 1A7LA 3IO6A 1US5A 1N3XA 3RTFB 4PQJA 1FTOA 1Y3QA 3K6XA 2F78A 4P0IA 3U93A 2HFBA 1MDQA 3T9VA 1EZPA 4NF6A 4QFKA 4DCYA 4OERA 3G3JA 1NNPA 1EU8A 3JV9A 5I2NA 2I3WA 1MQGA 2Q2CA 3SESA 2AL5A 4QSCA 1VR5A 4GOTA 5I58B 5L9SA 2D5WA 3CSGA 1TFAA 1B0HA 3PPPA 1SDXA 1LAHE 4XKPA 3GBBA 1LB8A 1OQGA 1USYE 3OSRA 4OESA 1B4HA 1IQ7A 1B3FA 1NH8A 3HN0A 1MXWA 3SERA 3TCGA 2HAVA 1QUJA 3VLVA 2B3BA 1B6HA 4QF9A 1S7YA 2ZYMA 4X1DA 4G8NA 4BLAA 1QULA 5CMKA 1I6AA 2IEEA 5ITPA 2NXOA 1LAFE 1ZU0A 4KR5A 4H67A 1A55A 1FTLA 2A5TA 1JETA 1QKAA 2ZMBA 4XIGQ 3MPKA 2F36A 2I49A 5TP9B 5H8SA 3LSWA 2DXYA 4Z7EA 3FGSA 2XXPA 3T9HB 3QAXA 4U22A 3MZ9A 3CI8A 3CR9A 1FQDA 5A5XA 3FJ7A 1P1QA 1I6BA 4YKKA 4ZECA 1M5FA 5DT6A 4DDDA 1B7UA 2ZNTA 1QUIA 2H98A 3F11A 2CMOA 3GLBA 4WEDA 4G2ZA 1R1NA 5B70A 4YB6A 4DCXA 3OD7A 2XXXA 4NF5B 5H8QB 3H03A 4FEBA 3U92A 4I62A 3V83A 1QUKA 2DS9A 5JTYB 1Y1MA 4PFTA 3DP8A 4ELRA 4QFOA 1MXYA 3ZKLA 4EQ7A 3TCFA 4F19A 2X26A 2OWSA 3N26A 5ITOA 3RLFE 4Q8RA 4JSOA 1JQFA 2ONKE 4P11A 1A40A 1R9QA 2HZKA 3BFTA 3K1MA 3HV1A 1TXFA 1D4NA 1WVJA 3H6VA 3UIFA 3OELA 1H45A 4IO4A 4LONB 3QK6A 5H8HA 4DZ1A 3G3IA 4JXIA 1MDP1 1SQYA 3LC8A 2OBGA 3K0VA 1B40A 4R9FA 5IKBA 5DEXB 2QS4A 2HZLA 4OZ9A 3H06B 4NE4A 4C0RA 4DLDA 3TCHA 2NVUB 1FTJA 4F1YA 3O6IA 3QXMA 4H6DA 1B1XA 3CFLA 4OMBA 3FJMA 3GBAA 4IO3A 1EZ9A 4U1OA 3PD9A 3KSJA 4IGRA 4ZEDA 4YKPA 3SETA 4EXKA 1VSOA 2ONSA 1HSEA 3ODBA 1MPBA 4LATA 4MBPA 3Q27A 4PFUA 4R2BA 1B3HA 3D4GA 1P99A 2UVGA 2LAOA 3VXBA 1NNFA 1FCKA 1FW0A 2DQVA 3TUSA 3TDJA 4DXBA 5I59B 3CVGA 1QKBA 1SW5A 4YMBA 3VLUA 3OO8A 5L8DA 5KCJA 4EDPA 5AA4B 1XOCA 2G29A 3OSQA 2A5SA 4GF8A 5I2KB 4Q5TA 4U2RA 4OENA 5BWJA 3FVOA 3JZJA 4GRKA 4BDNA 1H3DA 1IXIA 2HXWA 2ZNUA 3DP4A 4RA1A 1FTKA 2R71A 4Q0CA 1NNKA 3S9NC 3VVDA 1EH3A 3IX1A 1ZLQA 2OCUA 4BDQA 1ZIUA 1SI0A 1B05A 4ZEBA 3T66A 2VD2A 4YB5A 2RCBA 3T22A 2GRVA 3KN3A 4MLQA 1URSA 5I56A 3SEWA 5CM6A 4I8CA 4NF8A 2GFEA 1Y3NA 4F22A 2HEUA 4XKNA 3CIJA 4U4SA 2NWJA 4G8MA 5FTIA 1Q35A 2ALUA 2V84A 1MPDA 3PUVE 4NF4B 3HCQA 3MP6A 2VGQA 3A3CA 4DIGA 3H7MA 3TELA 2DXRA 1AL3A 1SW1A 1MQHA 1DSNA 1OVBA 4KQPA 3UA8A 3QSLA 4QFPA 1RKMA 2Z8EA 1B51A 3O66A 3UGWA 4GIZA 1MH4A 1LB9A 1UIVA 2Q9TA 3FASA 1QVSA 4LQ5A 3N94A 4R6HA 4AB6A 3B6TA 3MVWA 3OEMA 2XHDA 4H0WA 3BFUA 5EHMA 3PMVA 5TPAA 4BDMA 1MH3A 3OO9A 1S9TA 1VE4A 2Z8DA 1MQJA 1B5HA 2AYSA 3O6HA 2F7CA 1SW2A 1P1WA 1WDNA 4ESWA 4QRZA 1MPCA 3G7WA 4GXAA 5DVFA 3MVYA 1Z7NE 2Y7PA 4RJZA 5BUUA 4RNSA 3TTMA 1Y4TA 4MH5A 4EF1A 1NH7A 3L6HA 5FTHA 4ELPA 3R6UA 3E3KA 1HSLA 1UTHB 4P0GA 4ZE8A 3GXAA 3PMWA 1FQAA 5TU0A 3ILTB 1JW4A 1GTKA 2YJPA 1MY1A 1LAXA 4QFNA 2NUVA 1MY2A 2O6AA 1XVXA 1HSJA 4JWXA 3WAFA 2XXVA 2CZLA 3H4ZA 3LBSA 4FIMA 3W9VA 5H8FA 3IO4A 1FQFA 1M5DA 4NEDA 1UTBA 1IXGA 4KCDA 4ONYA 4PFYA 1NMUA 3TTKA 4HTGA 1PB8A 3S9MC 4UA8A 3KFMA 1B52A 4GLIA 2DWHA 4RYAA 1L5TA 4ECFA 3IB2A 3W15C 4YICA 2X7PA 2Y7KA 1DPEA 1POY1 4MLVA 4H5GA 3K01A 3QIMA 3HSTA 4LUBA 5K2YA 1ZTYA 3KGCA 3FVKA 3VV5A 2BJJX 3IAZA 3E13X 1LCFA 4U21A 2O7UA 3A09A 3C35A 2R9JA 3OO7A 3MQ9A 3UP9A 2REJA 5I58A 5ISUA 2Q88A 4ISUA 1O63A 3H6UA 4L17A 2QS3A 2QSXA 2QRYA 3QUFA 4H1XA 3PGFA 4OWDA 4WXJA 4ELOA 1NL5A 4UACA 1LFIA 4R6KA 2THIA 3TTNA 4HCYA 4RXLA 2A5TB 4OYVA 4GWOA 4ZE9A 3B6QA 4ZS9A 3TEPA 1AH5A 4KHZE 2REGA 4C1UA 2RCAA 3EHUA 1PB9A 3FVGA 1Y20A 4HCWA 4YU0A 4N13A 3N6UA 3PPQA 3B7DA 1AOVA 1SI1A 3HHGA 4KPTA 1SVXB 4RPNA 2QS1A 3OEKA 2FNCA 4Z0IA 4O3AA 1RYOA 1NNTA 3K4UA 5AA1A 1B3LA 1Y9UA 4IY5A 2Z22A 1UIUA 5AA2A 2Y7IA 2O7IA 2OLBA 4OFOA 4OEUA 3WAEA 3SEYA 1M5CA 3RN8A 2QJEA 3IK6B 1FQBA 5H8NB 3S9EA 3OXNA 3LUYA 2XXQA 3IJXB 2W7YA 2DYXA 3IOVA 3K2DA 4HW8A 1N7XA 3T93B 4WEPA 1EZOA 1YCJA 1MRPA 2PMSA 1ATGA 3PU5A 3CRBA 3RTWB 3HO7A 5CMMA 4MFIA 4TOZA 2H9BA 1GVCA 4BDOA 5DVIA 4FAJA 3H3GA 3TAJA 1M5EA 3HHFA 4FORA 1N3WA 3O2AA 4XKRA 5DVJA 3DLNA 2DE3A 5F1QA 5H8QA 4GD5A 4OEVA 2V25A 4M1VA 5I57B 1B58A 5JTYA 2O1LA 2F97A 5FHNA 3FXQA 4U4XA 2QL3A 4OVJA 5FHMA 2XD2A 1N0TA 4JWOA 5H8HB 1XS5A 2RF1A 4O3BA 5L9OA 5HBCA 4NWDA 4F2QA 4KFQA 1MG1A 3C31A 3TODA 2F8DA 3T96B 3TKDA 3O97A 3QYTA 2H5YA 2F7AA 1A8FA 3IB1A 4THIA 3MJNA 1DPPA 2D21A 4FATA 3FVNA 3V8XB 5LOMA 2Y84A 4F18A 3E4RA 2ONRA 2H4IA 3O28A 3MAMA 2V3QA 4AB5A 2QMXA 3B6WA 1QJMA 3FXUA 4R74A 5IAIA 1YPNA 4POXA 3DP6A 4ZEIA 1TT1A 1URDA 2I58A 4HS7A 3R26A 2DWIA 2XXWA 3K6UA 2DVCA 2F6PA 4OXVA 4QSDA 3UORA 3KJTA 1MXZA 1B4ZA 4G68B 2AIXA 1ZBMA 4IO5A 3SEVA 1OIBA 3C32A 4IO2A 1DOTA 1ZJLA 5KCJB 1MM7A 1SD3A 4X1BA 3EN3A 4G68C 1DTGA 4F3PA 1TWYA 2DOJA 2DWJA 4PETA 2P2AA 2Y7WA 1XC1A 4OTEA 3JYRA 1A54A 2YLNA 4G8HA 1D9YA 3ECRA 2PVUA 2ZYNA 3N5LA 1SBPA 3MP8A 1B3EA 4F1VA 4FJPA 2WKYA 3IB0A 2UXAA 3P7IA 5CMBA 2PT2A 4BDLA 2UYFA 1NFTA 1LSTA 3T9XB 2GHBA 1FTMA 1OQHA 3TZAA 2PX1A 4N6PA 5CC2A 3OMBA 4YKIA 3SKPA 2XXYA 3KOTA 3L6GA 1P1UA 3ONMA 2RKMA 3PUXE 2ANJA 2R6GE 3EF7A 4JSDA 3IOTA 1FQCA 2HCAA 3W9WA 2I4BA 2O1MA 3U94A 3IR1A 4EXLA 1B0LA 1MQIA 1H76A 4R6YA 5KDTA 4LVQA 2ZNSA 3PUZE 4ZZEA 3FATA 3LSXA 4IO6A 3KSXA 1OMPA 4O3CA 1PC3A 1PB7A 1GR2A 2HQ0A 3LSFB 1JW5A 3IORA 2F5XA 4YZZA 4NTLA 4NF4A 3RNNA 4TLMB 1BKAA 4DXUA 3RY3A 1O64A 3CSBA 3KJ7A 4G77A 4U1ZA 2GHAA 1LBBA 4H5FA 2DWAA 1IEJA 2UVJA 1USYH 2DE4A 1XHYA 4RY1A 3MC2A 4KYDA 2XX9A 1LFHA 2O84X 3D4CA 3RPWA 4TLLB 3FJGA 1MXVA 2VD3A 4N07A 1PBQA 3DELB 4F39A 2PYYA 2O69A 3TQLA 3BBRA 4PP0A 3OO6A 1T0KA 3PD8A 1IXCA 3KOSA 3THIA 4R9GA 2XXTA 3VFJA 3KG2A 1D9VA 3BKIB 5EYFA 1MY4A 2F34A 3EHSA 4ZEFA 4R72A 4G4PA 3M8UA 2OK2A 3EPEA 3Q26A 3C4MA 3OOAA 3R7XA 2QPQA 2ZYOA 4ZZAA 2E1SA 3U1OA 4LZ8A 1DMBA 2XD3A 2DP8A 3PPOA 3KBRA 3GZGA 4OHNA 3FUZA 4YB7A 4WKMA 5H8FB 5CI5A 2KLFA 3FV1A 1N7WA 5HM4B 3UN6A 5FHOA 3FIRA 2X7QA 5HPQA 4NF6B 2QS2A 3RT8A 1TFDA 2M8CA 1IXHA 2ZXTA 3MZBA 4XXUA 3TTRA 2AL4A 4ZDMA 3FXRA 5I2NB 4AQ4A 1B32A 2UVHA 4XTCQ 2XXHA 3TPAA 4F3SA 1J1NA 1IUDA 3K1NA 1YAEA 3IJOB 1BLFA 4JB7A 1MS7A 4F2OA 1O7TA 1NKXA 3TMGA 4JDFA 5DYHA 4LP2B 1YTVA 1MXUA 3ZS6A 1JVYA 1N76A 2O68A 1BP5A 3OENA 3C34A 2OWTA 2D3IA 3E9XA 3M3FA 4QHQA 2Q8JA 1MQDA 2DVZA 3MZ1A 1BTJA 5KZTA 1MM6A 1PBPA 2FA7A 3IOUA 3S9LC 3ZSFA 3ZKKA 4E0XA 4IB2A 3VLWA 5DTBA 5M2VA 2IA4A 3I5OA 4LZ7A 3MVZA 1AMFA 1B9JA 3MBPA 3G3FA 1B5IA 1JEUA 1A8EA 1SYIA 2H25A 4ZEKA 3PUWE 4LQ2A 4C1TA 2QMWA 4Q30B 4MF3A 2F7BA 1GGGA 4FEDA 5A5XB 1VFEA 2PBWA 3HPIA 2G93A 5AA2B 2RC7A 4KI0E 4EUOA 5TP9A 3VVEA 1FQEA 3IL1B 3EQ1A 3MUQA 4EF2A 1B7ZA 1US4A 2VHAA 1MY0A 4OFLA 2UYEA 3Q25A 3V5AA 3RUMA 4GL0A 1II5A 2I0CA 3MW0A 2I3VA 3PPNA 3V89B 1OLAA 1F9BA 1B2HA 4OQOA 1P1OA 3DM0A 5H8NA 3MP1A 2Z8FA 3I6VA 2OZZA 4GL8A 1I69A 2E0SA 5F7VA 2H99A 2NOOA 3M3LA 4NF5A
chains in the Genus database with same CATH superfamily
5ICQA 2VP1A 3H6TA 1FBDA 4PFRA 3PMXA 2UVIA 5CRYA 4H8IA 4G61A 1K9ZA 1N04A 3A29A 3E79A 4F3GA 2P0SA 1D3KA 4YMAA 5B7DA 4K3FA 2HHMA 2ZYKA 1G0IA 1B46A 2QVVA 5EQ7A 4E0WA 4PFWA 3U8QA 1MY3A 2Z23A 2RINA 5EHSA 2VOZA 3VDFA 1SYHA 4H8JA 4EQBA 4POWA 1KWHA 4GX6A 3HFUA 5I57A 2VPNA 4R2FA 1ZMGA 3ILUB 4GFRA 4N4UA 5T3JA 2Q2AA 3IOWA 5ET6A 4ESXA 5JK4A 4I40A 1LFGA 2XXRA 4IGTA 4MEVA 1URGA 2P1SA 1RYXA 3RYDA 1LAGE 3EHTA 4RK9A 1LCTA 3RGYA 3LR1A 5DEXA 2OJTA 1FPDA 4X48A 1CE2A 4IY6A 4R73A 5AA2D 5K2XA 5ICTA 4RPOA 1MXXA 2WYKA 3S2VA 3KZGA 2QFLA 4RK2A 3FD3A 3FV2A 1CB6A 3VE1B 2V93A 3GYYA 4XKQA 1A99A 2L5VA 1S50A 4LZ5A 1FBPA 1JW1A 4FECA 4TQUQ 1OLCA 3G3GA 4KCCA 3T9UA 3S4UA 3Q28A 1QW0A 3C33A 2YPNA 4G68A 4GQOA 1B3GA 4OETA 3RQTA 2FYIA 5I59A 4QFLA 2V3UA 4PF6A 4I1DA 2F6GA 4HXVA 1H43A 2XWVA 1Y3PA 5AA4A 4ND9A 1ANFA 3K00A 3H6WA 5I2KA 3CFXA 3MPLA 3VXCA 1IITA 3USDA 4OFJA 2XXIA 2FHYA 4PC9A 1INPA 1POTA 2XX7A 2I4CA 5I56B 2B65A 1LBYA 4F1UA 4NF8B 3TFLA 4YAHX 2Q89A 5F24A 2I48A 2Y5KA 1SW4A 5KDTB 2DSFA 2ESNA 3N6TA 5IM2A 1M5BA 3SDFA 4NWCA 2ABHA 4M4GA 3O9PA 1JVXA 1LBXA 4F3BA 1GV8A 4PE5B 3KN8A 1ELJA 1Z7ME 3G3KA 3O6GA 3SEUA 3PV0E 1NUZA 1JEVA 1OVTA 1H44A 4F29A 1JNFA 2PT1A 1FBCA 4QSEA 3O29A 3UK4A 5JEIA 4YKJA 2B3FA 3TQWA 3K02A 4KYSA 2QVRA 1XT8A 5TPAB 1Y1ZA 5L9MA 4P8BA 1LGBC 3TYHA 5CMCA 4O94A 1DTZA 1FBFA 2O51A 1AIVA 4GXSB 4KYEA 1IMEA 3Q29A 3KEIA 4DI4B 3MVXA 2DE2A 3K1PA 5IGAA 3QUJA 1Q1KA 3K6WA 3PPRA 1IZ1A 4AS5A 4DE8A 1R9LA 4MIJA 5CBSA 3KN7A 1PEBA 3FZVA 4IO7A 2V3TA 1IMAA 4PAKA 3C36A 3CG3A 2RC9A 1EYKA 1LBCA 2CZKA 2I0BA 1PDAA 2XX8A 1B1HA 3VVFA 2KQZA 4NF0A 4JWYA 1LLSA 4BDRA 3FXBA 1N84A 1K9YA 4R75A 1Y4CA 4X9TA 3C9HA 4EQ9A 2GH9A 5CBRA 3ROJA 3I3VA 3M3KA 3IFCA 5J1DA 4F31B 4H65A 1ZKBA 1VFDA 3CFZA 3RT6B 2XXUA 4PAIA 2RC8A 1XVYA 3LSLA 4FE8A 2Y7RA 4JBZA 1IIWA 3A3UA 1NV5A 1UQWA 5AA3A 4U23A 4ELQA 1UTBB 4OVPA 3TTLA 4DXCA 4I9DA 4KD5A 1BIYA 3PUYE 3K6VA 5I84A 1WODA 3CG1A 1UTHA 4GVOA 4P3LA 2Y5LA 3U72A 2FVZA 3MWBA 4NMYA 1B5JA 1P1NA 2I6EA 1B7HA 4NN3A 4UABA 1I6QA 5IZ1A 2QVUA 3AXFA 3G3HA 4LA9A 2F35A 5AE4A 5IZZA 1R6ZA 5EQ8A 2HAUA 5ELVA 3SEXA 1A7LA 5FBPA 1NUXA 3IO6A 1US5A 1N3XA 3RTFB 4PQJA 1FTOA 1Y3QA 1VDWA 3K6XA 4GWUA 2F78A 4MX6A 4P0IA 1D9QA 3U93A 2HFBA 1MDQA 4I3EA 3T9VA 1EZPA 4NF6A 4QFKA 4DCYA 4OERA 1FPBA 3G3JA 1NNPA 3MYUA 1EU8A 3JV9A 4X04A 5I2NA 2I3WA 1MQGA 2Q2CA 3SESA 2AL5A 4QSCA 1VR5A 4GOTA 5I58B 5L9SA 2D5WA 3KC0A 4H45A 3CSGA 1TFAA 1B0HA 3PPPA 1SDXA 1LAHE 4XKPA 3GBBA 1LB8A 1OQGA 1USYE 3OSRA 1IMCA 4OESA 1B4HA 1IQ7A 1B3FA 1NH8A 3HN0A 1MXWA 3SERA 2BJIA 3TCGA 2HAVA 1QUJA 3VLVA 2B3BA 1B6HA 4QF9A 4DI3D 1S7YA 2ZYMA 4X1DA 4G8NA 4BLAA 1QULA 5CMKA 1I6AA 2IEEA 5ITPA 2XWOA 3LV0A 2NXOA 1LAFE 1ZU0A 2JJKA 4H67A 4KR5A 1A55A 1FTLA 2A5TA 1JETA 1QKAA 2ZMBA 4XIGQ 3MPKA 2F36A 2I49A 5TP9B 5H8SA 3LSWA 4IR8A 2DXYA 4Z7EA 3FGSA 2F3DA 2XXPA 3T9HB 3QAXA 2V4CA 1DCUA 4U22A 3MZ9A 2CZHA 3CI8A 3CR9A 1FQDA 1NUYA 5A5XA 3FJ7A 1P1QA 5I7IA 1I6BA 4YKKA 4ZECA 1M5FA 5DT6A 2MKZA 4DDDA 2XA5A 1B7UA 2ZNTA 1SPIA 1QUIA 4MMPA 2H98A 3F11A 5EQ9A 2CMOA 3GLBA 4WEDA 3CHGA 2DDKA 5IZ3A 4G2ZA 1R1NA 5B70A 4YB6A 3B8BA 4DCXA 3OD7A 3T0JA 2XXXA 4NF5B 5H8QB 3H03A 4FEBA 3U92A 4I62A 3V83A 1QUKA 2DS9A 5JTYB 1Y1MA 4PFTA 3DP8A 4ELRA 4HE2A 4QFOA 2P3VA 1MXYA 3ZKLA 4EQ7A 3TCFA 4F19A 2X26A 2OWSA 3N26A 5ITOA 3RLFE 4Q8RA 1NV6A 4JSOA 1JQFA 2ONKE 4P11A 1A40A 1R9QA 2HZKA 3BFTA 3K1MA 3HV1A 1TXFA 1D4NA 1WVJA 3H6VA 4GWYA 3UIFA 3OELA 4PGNA 1H45A 4IO4A 4LONB 3QK6A 5H8HA 4DZ1A 3G3IA 4JXIA 1MDP1 1SQYA 4X8RA 3LC8A 2OBGA 3K0VA 1B40A 4R9FA 5IKBA 5DEXB 2QS4A 3MSTA 5ET7A 2HZLA 4OZ9A 3H06B 4NE4A 4C0RA 4DLDA 3TCHA 2NVUB 1FTJA 4F1YA 3O6IA 3QXMA 4H6DA 4PDHA 1B1XA 3CFLA 4OMBA 3FJMA 3GBAA 3NOHA 4IO3A 1EZ9A 4U1OA 3PD9A 3KSJA 4PFBA 4IGRA 4ZEDA 5LDZA 4YKPA 3SETA 4EXKA 1VSOA 2ONSA 1HSEA 1EYIA 3ODBA 1MPBA 4LATA 4MBPA 3Q27A 4PFUA 4R2BA 1B3HA 3D4GA 4GBVA 1P99A 2CZIA 2B4MA 2UVGA 2OX3A 2LAOA 3VXBA 1NNFA 1FCKA 1FPKA 1FW0A 2DQVA 3TUSA 3TDJA 1FPLA 4DXBA 5I59B 3CVGA 1QKBA 1SW5A 4YMBA 3VLUA 3OO8A 5L8DA 5KCJA 4EDPA 5AA4B 1XOCA 2GQ1A 4MHFA 2G29A 3OSQA 4JVCA 2A5SA 4GF8A 5I2KB 1NI9A 4Q5TA 4U2RA 4OENA 5BWJA 3FVOA 3JZJA 4GRKA 4BDNA 1H3DA 1FPJA 1IXIA 2HXWA 2ZNUA 3DP4A 4RA1A 1FTKA 2R71A 1LBWA 4Q0CA 1NNKA 3S9NC 3VVDA 1EH3A 2PCRA 3IX1A 1ZLQA 2OCUA 4BDQA 1ZIUA 1SI0A 4PE3A 1B05A 4ZEBA 3T66A 2VD2A 4YB5A 2RCBA 4N8YA 3T22A 3QMFA 2GRVA 3KN3A 4MLQA 1URSA 5I56A 3SEWA 5CM6A 4I8CA 4NF8A 2GFEA 1Y3NA 4F22A 1CNQA 2HEUA 4XKNA 3CIJA 4U4SA 2NWJA 4G8MA 5FTIA 1Q35A 2ALUA 2V84A 1MPDA 3PUVE 4NF4B 3HCQA 3MP6A 2VGQA 3A3CA 2HXRA 4DIGA 1FPEA 3H7MA 3TELA 2DXRA 1AL3A 4HE0A 1SW1A 1MQHA 1DSNA 5DW8A 1OVBA 4KQPA 1KA1A 3UA8A 3QSLA 4QFPA 1RKMA 2Z8EA 3FBPA 1B51A 3O66A 3UGWA 4GIZA 1MH4A 1FJ6A 1LB9A 1UIVA 2Q9TA 3FASA 1QVSA 4LQ5A 3N94A 4R6HA 4AB6A 3B6TA 3MVWA 3OEMA 2XHDA 4H0WA 3BFUA 5EHMA 3PMVA 2XWKA 5TPAA 4BDMA 1MH3A 3OO9A 1S9TA 1DK4A 1VE4A 2Z8DA 4KXPA 1MQJA 1AWBA 1B5HA 2AYSA 3O6HA 1G0HA 2F7CA 1SW2A 1P1WA 1FPIA 1YXIA 5ET8A 1WDNA 4ESWA 4QRZA 1MPCA 3G7WA 4PF8A 4GXAA 5DVFA 4XEQA 3MVYA 1Z7NE 3D1RA 2Y7PA 4RJZA 4GX3A 5BUUA 4RNSA 3TTMA 1Y4TA 4MH5A 4EF1A 1NH7A 3L6HA 1QGXA 5FTHA 4ELPA 3R6UA 3E3KA 1HSLA 1UTHB 4P0GA 4ZE8A 3GXAA 3PMWA 1FQAA 5TU0A 3ILTB 1JW4A 1GTKA 1FPFA 2YJPA 1MY1A 1LAXA 5ET5A 4QFNA 4OA4A 2NUVA 1MY2A 2O6AA 1XVXA 1HSJA 4JWXA 3WAFA 2XXVA 2CZLA 3H4ZA 3LBSA 4FIMA 3W9VA 5H8FA 3IO4A 1FQFA 1M5DA 4NEDA 1UTBA 1IXGA 3RPLB 1NV0A 4KCDA 1FTAA 4ONYA 4NQ8A 4O7IA 4PFYA 1NMUA 2OWZA 3TTKA 4HTGA 1NV3A 1PB8A 3S9MC 4UA8A 3KFMA 1B52A 4GLIA 2DWHA 4RYAA 1L5TA 3IFAA 4ECFA 3IB2A 3W15C 2P3NA 4PFIA 4YICA 2X7PA 2Y7KA 1DPEA 1POY1 4MLVA 4H5GA 3K01A 4MNCA 1FJ9A 3QIMA 3HSTA 4LUBA 5K2YA 1ZTYA 3KGCA 3E78A 3FVKA 3VV5A 2BJJX 3IAZA 3E13X 1LCFA 4U21A 3BIGA 2O7UA 3A09A 3C35A 4PAFA 2R9JA 3OO7A 3PTYA 3MQ9A 2XXKA 2F3BA 3UP9A 2REJA 5I58A 5ISUA 2Q88A 4ISUA 1O63A 3H6UA 4LN5A 4L17A 1KZ8A 2QS3A 4NG7A 1YYZA 2QSXA 2QRYA 4GWSA 3QUFA 4H1XA 2VT5A 3PGFA 4OWDA 4N6KA 4WXJA 4ELOA 4AS4A 1NL5A 4UACA 1LFIA 4R6KA 2THIA 3TTNA 4PDDA 4HCYA 2WX9A 4OVQA 4RXLA 2A5TB 4OYVA 4GWOA 4ZE9A 3B6QA 4ZS9A 2HPGA 3TEPA 1AH5A 4KHZE 2REGA 4C1UA 2RCAA 3EHUA 1PB9A 4N15A 4MCOA 3FVGA 1Y20A 4HCWA 1IMBA 4N13A 3N6UA 4YU0A 3PPQA 3B7DA 1AOVA 1NV4A 1SI1A 3HHGA 4KPTA 1KA0A 1SVXB 4RPNA 2QS1A 3OEKA 2FNCA 4Z0IA 4O3AA 1RYOA 1NNTA 3K4UA 4XF5A 5AA1A 1RDXA 1B3LA 1Y9UA 4IY5A 2Z22A 1UIUA 5AA2A 1LEVA 2Y7IA 2O7IA 2OLBA 4OFOA 4OEUA 3WAEA 3SEYA 1M5CA 4I3YA 3RN8A 5IZ3B 2QJEA 3ISPA 3IK6B 1FQBA 5H8NB 3S9EA 1EYJA 3OXNA 3LUYA 2XXQA 4MNPA 3IJXB 2W7YA 2DYXA 3IOVA 3K2DA 4HW8A 1N7XA 3T93B 4WEPA 1EZOA 1YCJA 1MRPA 2PMSA 1ATGA 3PU5A 3CRBA 3RTWB 3HO7A 5CMMA 2Q74A 4MFIA 4TOZA 2H9BA 1GVCA 4BDOA 5DVIA 4FAJA 3H3GA 3TAJA 1M5EA 3HHFA 4FORA 1N3WA 3O2AA 4XKRA 5DVJA 3DLNA 2DE3A 5F1QA 5H8QA 4GD5A 4OEVA 2V25A 4M1VA 5I57B 1B58A 5JTYA 2O1LA 2F97A 5FHNA 3FXQA 4U4XA 2QL3A 4OVJA 5FHMA 1NUWA 2XD2A 1N0TA 4JWOA 5H8HB 1XS5A 2RF1A 4O3BA 5L9OA 5HBCA 4NWDA 4F2QA 4KFQA 4QXDA 1MG1A 4O8MA 3C31A 4XFEA 4OVTA 3TODA 2F8DA 4NAPA 3T96B 3TKDA 3O97A 3QYTA 2H5YA 2F7AA 2PFZA 4P56A 1A8FA 3IB1A 4THIA 3MJNA 1DPPA 2D21A 4FATA 3FVNA 3V8XB 5LOMA 2Y84A 4F18A 3E4RA 4N81A 2ONRA 2H4IA 3O28A 3MAMA 2V3QA 4AB5A 2QMXA 3B6WA 1QJMA 4OVRA 3FXUA 3BIHA 4R74A 5IAIA 1YPNA 4POXA 5EYGA 4PBHA 3DP6A 4ZEIA 1TT1A 1URDA 2I58A 4HS7A 4N17A 3R26A 2DWIA 2XXWA 3K6UA 1RDYA 2DVCA 2F6PA 4OXVA 4QSDA 2WEFA 3UORA 3KJTA 1MXZA 1B4ZA 2FBPA 4G68B 2AIXA 1ZBMA 3KBZA 4IO5A 3SEVA 1OIBA 3C32A 4IO2A 1DOTA 1ZJLA 5KCJB 1MM7A 1SD3A 1LBVA 4X1BA 4NX1A 3EN3A 3EKIA 4G68C 1DTGA 1TWYA 4F3PA 4PETA 2DOJA 2DWJA 3LUZA 2P2AA 2Y7WA 1XC1A 4OTEA 5LTCA 3JYRA 4O7MA 1A54A 2YLNA 2FIEA 4G8HA 1D9YA 4OANA 3ECRA 2PVUA 2ZYNA 3N5LA 1SBPA 3MP8A 1B3EA 4F1VA 4FJPA 2WKYA 3IB0A 4GWZA 2UXAA 3P7IA 5CMBA 2PT2A 4BDLA 2UYFA 1NFTA 4P1EA 1LSTA 3T9XB 2GHBA 1FTMA 1OQHA 3TZAA 2PX1A 4N6PA 5CC2A 5EQAA 3OMBA 4YKIA 3SKPA 2XXYA 3KOTA 3L6GA 1P1UA 3ONMA 2RKMA 2FIXA 3PUXE 2ANJA 2R6GE 3EF7A 4JSDA 3IOTA 1FQCA 2HCAA 3W9WA 2I4BA 2O1MA 3U94A 3IR1A 4EXLA 1B0LA 1MQIA 1H76A 4R6YA 5KDTA 4LVQA 2ZNSA 3PUZE 4ZZEA 4P1LA 3FATA 1JP4A 3LSXA 4IO6A 4P47A 4JVIA 3KSXA 1OMPA 4O3CA 1PC3A 4FBPA 1PB7A 1GR2A 2HQ0A 3LSFB 1JW5A 3IORA 4H46A 4MNIA 2F5XA 4YZZA 4NTLA 4N6DA 4OVSA 4NF4A 1FBEA 3RNNA 4TLMB 1BKAA 4DXUA 5A5LA 3RY3A 1O64A 3CSBA 3KJ7A 4G77A 4U1ZA 2GHAA 1LBBA 4H5FA 2DWAA 1IEJA 2UVJA 1XI6A 1USYH 2DE4A 1XHYA 5ESYA 4RY1A 3MC2A 4KYDA 2XX9A 1LFHA 2O84X 3D4CA 3RPWA 1Q9DA 1LBZA 1NV7A 4TLLB 3FJGA 4N91A 1MXVA 2VD3A 4N07A 1PBQA 3DELB 4F39A 2PYYA 2O69A 3TQLA 3BBRA 1NV1A 4PP0A 3OO6A 1T0KA 3PD8A 1IXCA 3KOSA 3THIA 4R9GA 1NV2A 2XXTA 3VFJA 2PFYA 2ZZVA 3KG2A 1D9VA 2VPOA 3BKIB 5EYFA 1MY4A 2F34A 3EHSA 4ZEFA 4R72A 4PCDA 4G4PA 3M8UA 2ZZWA 2OK2A 3EPEA 3Q26A 3C4MA 1IMFA 3OOAA 3R7XA 2QPQA 4GBWA 2ZYOA 4PTKA 4ZZAA 2E1SA 3U1OA 4LZ8A 1DMBA 2XD3A 2DP8A 3PPOA 3KBRA 4PGPA 5I5PA 4MAGA 4GWXA 3GZGA 4OHNA 3FUZA 5J16A 2KR0A 4YB7A 4WKMA 5H8FB 5CI5A 2KLFA 3FV1A 2ZZXA 1N7WA 5HM4B 2WYPA 3UN6A 5FHOA 3FIRA 2X7QA 1FRPA 5HPQA 4NF6B 2QS2A 4P9KA 3RT8A 1TFDA 2M8CA 1IXHA 2ZXTA 3MZBA 4XXUA 3TTRA 2AL4A 4ZDMA 3FXRA 5I2NB 4AQ4A 2CEXA 1B32A 2UVHA 3RPLA 4XTCQ 2XXHA 4N8GA 3TPAA 4F3SA 1J1NA 1IUDA 3K1NA 3T1BA 1YAEA 3IJOB 1BLFA 4JB7A 1MS7A 4F2OA 1O7TA 1NKXA 3TMGA 4JDFA 3B50A 2R8TA 5DYHA 4LP2B 4GX4A 1YTVA 1FSAA 1MXUA 3ZS6A 1JVYA 1N76A 2O68A 1BP5A 3OENA 3C34A 2OWTA 2D3IA 3E9XA 3M3FA 4QHQA 2Q8JA 1MQDA 2DVZA 3MZ1A 1BTJA 4JVDA 5KZTA 1MM6A 1PBPA 2FA7A 3IOUA 3S9LC 3ZSFA 3ZKKA 4HE1A 4E0XA 1BK4A 4IB2A 1FPGA 3VLWA 5DTBA 3U65A 5M2VA 2IA4A 1DBZA 3I5OA 4LZ7A 3MVZA 1AMFA 1B9JA 3MBPA 3G3FA 1B5IA 1JEUA 1A8EA 4NGUA 1SYIA 2H25A 4ZEKA 4NHBA 3PUWE 4LQ2A 4C1TA 2QMWA 4Q30B 4MF3A 1RDZA 2F7BA 1GGGA 4FEDA 5A5XB 1VFEA 3HPIA 2PBWA 2G93A 5AA2B 2RC7A 4KI0E 4EUOA 2XWIA 4QBAA 2CEYA 5TP9A 1FBGA 3VVEA 1FQEA 1IMDA 3IL1B 3EQ1A 3MUQA 2B4LA 2WBDA 1FBHA 4EF2A 1B7ZA 1US4A 2WBBA 2VHAA 1MY0A 3KC1A 4OFLA 2UYEA 3Q25A 3V5AA 3RUMA 3SZPA 4GL0A 1II5A 2I0CA 3MW0A 2I3VA 1YZ0A 3PPNA 4MJOA 3V89B 1OLAA 5EYHA 1F9BA 1B2HA 2Q8MA 4OQOA 4PBQA 1P1OA 3DM0A 5H8NA 3MP1A 2Z8FA 3I6VA 2OZZA 4GL8A 4GWWA 1I69A 2E0SA 5I3SA 5F7VA 2H99A 2NOOA 3M3LA 4NF5A
chains in the Genus database with same CATH topology
5ICQA 2VP1A 3H6TA 3PMXA 2UVIA 5CRYA 4H8IA 1N04A 4F3GA 2P0SA 1D3KA 4YMAA 5B7DA 4K3FA 2ZYKA 1B46A 4E0WA 4PFWA 3U8QA 1MY3A 2Z23A 2RINA 5EHSA 2VOZA 3VDFA 1SYHA 4H8JA 4EQBA 4POWA 1KWHA 5I57A 4R2FA 1ZMGA 3ILUB 4GFRA 2Q2AA 3IOWA 4ESXA 5JK4A 1LFGA 2XXRA 4IGTA 1URGA 2P1SA 1RYXA 1LAGE 3EHTA 4RK9A 1LCTA 3RGYA 3LR1A 5DEXA 2OJTA 4X48A 1CE2A 4IY6A 4R73A 5AA2D 5K2XA 5ICTA 4RPOA 1MXXA 3S2VA 3KZGA 4RK2A 3FD3A 3FV2A 1CB6A 3VE1B 2V93A 4XKQA 1A99A 1S50A 4LZ5A 1JW1A 4FECA 4TQUQ 1OLCA 3G3GA 4KCCA 3T9UA 3S4UA 3Q28A 1QW0A 3C33A 2YPNA 4G68A 4GQOA 1B3GA 4OETA 3RQTA 2FYIA 5I59A 4QFLA 2V3UA 4I1DA 2F6GA 1H43A 1Y3PA 5AA4A 4ND9A 1ANFA 3K00A 3H6WA 5I2KA 3CFXA 3MPLA 3VXCA 1IITA 3USDA 4OFJA 2XXIA 1POTA 2XX7A 2I4CA 5I56B 2B65A 4F1UA 4NF8B 3TFLA 4YAHX 2Q89A 2I48A 1SW4A 5KDTB 2DSFA 2ESNA 3N6TA 1M5BA 3SDFA 4NWCA 2ABHA 4M4GA 3O9PA 1JVXA 4F3BA 1GV8A 4PE5B 3KN8A 1ELJA 1Z7ME 3G3KA 3O6GA 3SEUA 3PV0E 1JEVA 1OVTA 1H44A 4F29A 1JNFA 2PT1A 4QSEA 3O29A 3UK4A 5JEIA 4YKJA 2B3FA 3TQWA 3K02A 4KYSA 1XT8A 5TPAB 1Y1ZA 5L9MA 1LGBC 3TYHA 5CMCA 1DTZA 2O51A 1AIVA 4GXSB 4KYEA 3Q29A 3KEIA 3MVXA 2DE2A 3K1PA 3QUJA 1Q1KA 3K6WA 3PPRA 1IZ1A 4DE8A 1R9LA 5CBSA 3KN7A 1PEBA 3FZVA 4IO7A 2V3TA 3C36A 3CG3A 2RC9A 1LBCA 2I0BA 1PDAA 2XX8A 1B1HA 3VVFA 4JWYA 1LLSA 4BDRA 1N84A 4R75A 1Y4CA 4X9TA 3C9HA 4EQ9A 2GH9A 5CBRA 3I3VA 3M3KA 5J1DA 4F31B 4H65A 1ZKBA 1VFDA 3CFZA 3RT6B 2XXUA 2RC8A 3LSLA 1XVYA 4FE8A 2Y7RA 4JBZA 1IIWA 3A3UA 1UQWA 5AA3A 4U23A 4ELQA 1UTBB 3TTLA 4DXCA 4I9DA 4KD5A 1BIYA 3PUYE 3K6VA 5I84A 1WODA 3CG1A 1UTHA 4GVOA 3U72A 3MWBA 4NMYA 1B5JA 1P1NA 2I6EA 1B7HA 1I6QA 3AXFA 3G3HA 4LA9A 2F35A 5AE4A 1R6ZA 2HAUA 5ELVA 3SEXA 1A7LA 3IO6A 1US5A 1N3XA 3RTFB 4PQJA 1FTOA 1Y3QA 3K6XA 2F78A 4P0IA 3U93A 2HFBA 1MDQA 3T9VA 1EZPA 4NF6A 4QFKA 4DCYA 4OERA 3G3JA 1NNPA 1EU8A 3JV9A 5I2NA 2I3WA 1MQGA 2Q2CA 3SESA 2AL5A 4QSCA 1VR5A 4GOTA 5I58B 5L9SA 2D5WA 3CSGA 1TFAA 1B0HA 3PPPA 1SDXA 1LAHE 4XKPA 3GBBA 1LB8A 1OQGA 1USYE 3OSRA 4OESA 1B4HA 1IQ7A 1B3FA 1NH8A 3HN0A 1MXWA 3SERA 3TCGA 2HAVA 1QUJA 3VLVA 2B3BA 1B6HA 4QF9A 1S7YA 2ZYMA 4X1DA 4G8NA 4BLAA 1QULA 5CMKA 1I6AA 2IEEA 5ITPA 2NXOA 1LAFE 1ZU0A 4KR5A 4H67A 1A55A 1FTLA 2A5TA 1JETA 1QKAA 2ZMBA 4XIGQ 3MPKA 2F36A 2I49A 5TP9B 5H8SA 3LSWA 2DXYA 4Z7EA 3FGSA 2XXPA 3T9HB 3QAXA 4U22A 3MZ9A 3CI8A 3CR9A 1FQDA 5A5XA 3FJ7A 1P1QA 1I6BA 4YKKA 4ZECA 1M5FA 5DT6A 4DDDA 1B7UA 2ZNTA 1QUIA 2H98A 3F11A 2CMOA 3GLBA 4WEDA 4G2ZA 1R1NA 5B70A 4YB6A 4DCXA 3OD7A 2XXXA 4NF5B 5H8QB 3H03A 4FEBA 3U92A 4I62A 3V83A 1QUKA 2DS9A 5JTYB 1Y1MA 4PFTA 3DP8A 4ELRA 4QFOA 1MXYA 3ZKLA 4EQ7A 3TCFA 4F19A 2X26A 2OWSA 3N26A 5ITOA 3RLFE 4Q8RA 4JSOA 1JQFA 2ONKE 4P11A 1A40A 1R9QA 2HZKA 3BFTA 3K1MA 3HV1A 1TXFA 1D4NA 1WVJA 3H6VA 3UIFA 3OELA 1H45A 4IO4A 4LONB 3QK6A 5H8HA 4DZ1A 3G3IA 4JXIA 1MDP1 1SQYA 3LC8A 2OBGA 3K0VA 1B40A 4R9FA 5IKBA 5DEXB 2QS4A 2HZLA 4OZ9A 3H06B 4NE4A 4C0RA 4DLDA 3TCHA 2NVUB 1FTJA 4F1YA 3O6IA 3QXMA 4H6DA 1B1XA 3CFLA 4OMBA 3FJMA 3GBAA 4IO3A 1EZ9A 4U1OA 3PD9A 3KSJA 4IGRA 4ZEDA 4YKPA 3SETA 4EXKA 1VSOA 2ONSA 1HSEA 3ODBA 1MPBA 4LATA 4MBPA 3Q27A 4PFUA 4R2BA 1B3HA 3D4GA 1P99A 2UVGA 2LAOA 3VXBA 1NNFA 1FCKA 1FW0A 2DQVA 3TUSA 3TDJA 4DXBA 5I59B 3CVGA 1QKBA 1SW5A 4YMBA 3VLUA 3OO8A 5L8DA 5KCJA 4EDPA 5AA4B 1XOCA 2G29A 3OSQA 2A5SA 4GF8A 5I2KB 4Q5TA 4U2RA 4OENA 5BWJA 3FVOA 3JZJA 4GRKA 4BDNA 1H3DA 1IXIA 2HXWA 2ZNUA 3DP4A 4RA1A 1FTKA 2R71A 4Q0CA 1NNKA 3S9NC 3VVDA 1EH3A 3IX1A 1ZLQA 2OCUA 4BDQA 1ZIUA 1SI0A 1B05A 4ZEBA 3T66A 2VD2A 4YB5A 2RCBA 3T22A 2GRVA 3KN3A 4MLQA 1URSA 5I56A 3SEWA 5CM6A 4I8CA 4NF8A 2GFEA 1Y3NA 4F22A 2HEUA 4XKNA 3CIJA 4U4SA 2NWJA 4G8MA 5FTIA 1Q35A 2ALUA 2V84A 1MPDA 3PUVE 4NF4B 3HCQA 3MP6A 2VGQA 3A3CA 4DIGA 3H7MA 3TELA 2DXRA 1AL3A 1SW1A 1MQHA 1DSNA 1OVBA 4KQPA 3UA8A 3QSLA 4QFPA 1RKMA 2Z8EA 1B51A 3O66A 3UGWA 4GIZA 1MH4A 1LB9A 1UIVA 2Q9TA 3FASA 1QVSA 4LQ5A 3N94A 4R6HA 4AB6A 3B6TA 3MVWA 3OEMA 2XHDA 4H0WA 3BFUA 5EHMA 3PMVA 5TPAA 4BDMA 1MH3A 3OO9A 1S9TA 1VE4A 2Z8DA 1MQJA 1B5HA 2AYSA 3O6HA 2F7CA 1SW2A 1P1WA 1WDNA 4ESWA 4QRZA 1MPCA 3G7WA 4GXAA 5DVFA 3MVYA 1Z7NE 2Y7PA 4RJZA 5BUUA 4RNSA 3TTMA 1Y4TA 4MH5A 4EF1A 1NH7A 3L6HA 5FTHA 4ELPA 3R6UA 3E3KA 1HSLA 1UTHB 4P0GA 4ZE8A 3GXAA 3PMWA 1FQAA 5TU0A 3ILTB 1JW4A 1GTKA 2YJPA 1MY1A 1LAXA 4QFNA 2NUVA 1MY2A 2O6AA 1XVXA 1HSJA 4JWXA 3WAFA 2XXVA 2CZLA 3H4ZA 3LBSA 4FIMA 3W9VA 5H8FA 3IO4A 1FQFA 1M5DA 4NEDA 1UTBA 1IXGA 4KCDA 4ONYA 4PFYA 1NMUA 3TTKA 4HTGA 1PB8A 3S9MC 4UA8A 3KFMA 1B52A 4GLIA 2DWHA 4RYAA 1L5TA 4ECFA 3IB2A 3W15C 4YICA 2X7PA 2Y7KA 1DPEA 1POY1 4MLVA 4H5GA 3K01A 3QIMA 3HSTA 4LUBA 5K2YA 1ZTYA 3KGCA 3FVKA 3VV5A 2BJJX 3IAZA 3E13X 1LCFA 4U21A 2O7UA 3A09A 3C35A 2R9JA 3OO7A 3MQ9A 3UP9A 2REJA 5I58A 5ISUA 2Q88A 4ISUA 1O63A 3H6UA 4L17A 2QS3A 2QSXA 2QRYA 3QUFA 4H1XA 3PGFA 4OWDA 4WXJA 4ELOA 1NL5A 4UACA 1LFIA 4R6KA 2THIA 3TTNA 4HCYA 4RXLA 2A5TB 4OYVA 4GWOA 4ZE9A 3B6QA 4ZS9A 3TEPA 1AH5A 4KHZE 2REGA 4C1UA 2RCAA 3EHUA 1PB9A 3FVGA 1Y20A 4HCWA 4YU0A 4N13A 3N6UA 3PPQA 3B7DA 1AOVA 1SI1A 3HHGA 4KPTA 1SVXB 4RPNA 2QS1A 3OEKA 2FNCA 4Z0IA 4O3AA 1RYOA 1NNTA 3K4UA 5AA1A 1B3LA 1Y9UA 4IY5A 2Z22A 1UIUA 5AA2A 2Y7IA 2O7IA 2OLBA 4OFOA 4OEUA 3WAEA 3SEYA 1M5CA 3RN8A 2QJEA 3IK6B 1FQBA 5H8NB 3S9EA 3OXNA 3LUYA 2XXQA 3IJXB 2W7YA 2DYXA 3IOVA 3K2DA 4HW8A 1N7XA 3T93B 4WEPA 1EZOA 1YCJA 1MRPA 2PMSA 1ATGA 3PU5A 3CRBA 3RTWB 3HO7A 5CMMA 4MFIA 4TOZA 2H9BA 1GVCA 4BDOA 5DVIA 4FAJA 3H3GA 3TAJA 1M5EA 3HHFA 4FORA 1N3WA 3O2AA 4XKRA 5DVJA 3DLNA 2DE3A 5F1QA 5H8QA 4GD5A 4OEVA 2V25A 4M1VA 5I57B 1B58A 5JTYA 2O1LA 2F97A 5FHNA 3FXQA 4U4XA 2QL3A 4OVJA 5FHMA 2XD2A 1N0TA 4JWOA 5H8HB 1XS5A 2RF1A 4O3BA 5L9OA 5HBCA 4NWDA 4F2QA 4KFQA 1MG1A 3C31A 3TODA 2F8DA 3T96B 3TKDA 3O97A 3QYTA 2H5YA 2F7AA 1A8FA 3IB1A 4THIA 3MJNA 1DPPA 2D21A 4FATA 3FVNA 3V8XB 5LOMA 2Y84A 4F18A 3E4RA 2ONRA 2H4IA 3O28A 3MAMA 2V3QA 4AB5A 2QMXA 3B6WA 1QJMA 3FXUA 4R74A 5IAIA 1YPNA 4POXA 3DP6A 4ZEIA 1TT1A 1URDA 2I58A 4HS7A 3R26A 2DWIA 2XXWA 3K6UA 2DVCA 2F6PA 4OXVA 4QSDA 3UORA 3KJTA 1MXZA 1B4ZA 4G68B 2AIXA 1ZBMA 4IO5A 3SEVA 1OIBA 3C32A 4IO2A 1DOTA 1ZJLA 5KCJB 1MM7A 1SD3A 4X1BA 3EN3A 4G68C 1DTGA 4F3PA 1TWYA 2DOJA 2DWJA 4PETA 2P2AA 2Y7WA 1XC1A 4OTEA 3JYRA 1A54A 2YLNA 4G8HA 1D9YA 3ECRA 2PVUA 2ZYNA 3N5LA 1SBPA 3MP8A 1B3EA 4F1VA 4FJPA 2WKYA 3IB0A 2UXAA 3P7IA 5CMBA 2PT2A 4BDLA 2UYFA 1NFTA 1LSTA 3T9XB 2GHBA 1FTMA 1OQHA 3TZAA 2PX1A 4N6PA 5CC2A 3OMBA 4YKIA 3SKPA 2XXYA 3KOTA 3L6GA 1P1UA 3ONMA 2RKMA 3PUXE 2ANJA 2R6GE 3EF7A 4JSDA 3IOTA 1FQCA 2HCAA 3W9WA 2I4BA 2O1MA 3U94A 3IR1A 4EXLA 1B0LA 1MQIA 1H76A 4R6YA 5KDTA 4LVQA 2ZNSA 3PUZE 4ZZEA 3FATA 3LSXA 4IO6A 3KSXA 1OMPA 4O3CA 1PC3A 1PB7A 1GR2A 2HQ0A 3LSFB 1JW5A 3IORA 2F5XA 4YZZA 4NTLA 4NF4A 3RNNA 4TLMB 1BKAA 4DXUA 3RY3A 1O64A 3CSBA 3KJ7A 4G77A 4U1ZA 2GHAA 1LBBA 4H5FA 2DWAA 1IEJA 2UVJA 1USYH 2DE4A 1XHYA 4RY1A 3MC2A 4KYDA 2XX9A 1LFHA 2O84X 3D4CA 3RPWA 4TLLB 3FJGA 1MXVA 2VD3A 4N07A 1PBQA 3DELB 4F39A 2PYYA 2O69A 3TQLA 3BBRA 4PP0A 3OO6A 1T0KA 3PD8A 1IXCA 3KOSA 3THIA 4R9GA 2XXTA 3VFJA 3KG2A 1D9VA 3BKIB 5EYFA 1MY4A 2F34A 3EHSA 4ZEFA 4R72A 4G4PA 3M8UA 2OK2A 3EPEA 3Q26A 3C4MA 3OOAA 3R7XA 2QPQA 2ZYOA 4ZZAA 2E1SA 3U1OA 4LZ8A 1DMBA 2XD3A 2DP8A 3PPOA 3KBRA 3GZGA 4OHNA 3FUZA 4YB7A 4WKMA 5H8FB 5CI5A 2KLFA 3FV1A 1N7WA 5HM4B 3UN6A 5FHOA 3FIRA 2X7QA 5HPQA 4NF6B 2QS2A 3RT8A 1TFDA 2M8CA 1IXHA 2ZXTA 3MZBA 4XXUA 3TTRA 2AL4A 4ZDMA 3FXRA 5I2NB 4AQ4A 1B32A 2UVHA 4XTCQ 2XXHA 3TPAA 4F3SA 1J1NA 1IUDA 3K1NA 1YAEA 3IJOB 1BLFA 4JB7A 1MS7A 4F2OA 1O7TA 1NKXA 3TMGA 4JDFA 5DYHA 4LP2B 1YTVA 1MXUA 3ZS6A 1JVYA 1N76A 2O68A 1BP5A 3OENA 3C34A 2OWTA 2D3IA 3E9XA 3M3FA 4QHQA 2Q8JA 1MQDA 2DVZA 3MZ1A 1BTJA 5KZTA 1MM6A 1PBPA 2FA7A 3IOUA 3S9LC 3ZSFA 3ZKKA 4E0XA 4IB2A 3VLWA 5DTBA 5M2VA 2IA4A 3I5OA 4LZ7A 3MVZA 1AMFA 1B9JA 3MBPA 3G3FA 1B5IA 1JEUA 1A8EA 1SYIA 2H25A 4ZEKA 3PUWE 4LQ2A 4C1TA 2QMWA 4Q30B 4MF3A 2F7BA 1GGGA 4FEDA 5A5XB 1VFEA 2PBWA 3HPIA 2G93A 5AA2B 2RC7A 4KI0E 4EUOA 5TP9A 3VVEA 1FQEA 3IL1B 3EQ1A 3MUQA 4EF2A 1B7ZA 1US4A 2VHAA 1MY0A 4OFLA 2UYEA 3Q25A 3V5AA 3RUMA 4GL0A 1II5A 2I0CA 3MW0A 2I3VA 3PPNA 3V89B 1OLAA 1F9BA 1B2HA 4OQOA 1P1OA 3DM0A 5H8NA 3MP1A 2Z8FA 3I6VA 2OZZA 4GL8A 1I69A 2E0SA 5F7VA 2H99A 2NOOA 3M3LA 4NF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICQ A;  2VP1 A;  3H6T A;  3PMX A;  2UVI A;  5CRY A;  4H8I A;  1N04 A;  4F3G A;  2P0S A;  1D3K A;  4YMA A;  5B7D A;  4K3F A;  2ZYK A;  1B46 A;  4E0W A;  4PFW A;  3U8Q A;  1MY3 A;  2Z23 A;  2RIN A;  5EHS A;  2VOZ A;  3VDF A;  1SYH A;  4H8J A;  4EQB A;  4POW A;  1KWH A;  5I57 A;  4R2F A;  1ZMG A;  3ILU B;  4GFR A;  2Q2A A;  3IOW A;  4ESX A;  5JK4 A;  1LFG A;  2XXR A;  4IGT A;  1URG A;  2P1S A;  1RYX A;  1LAG E;  3EHT A;  4RK9 A;  1LCT A;  3RGY A;  3LR1 A;  5DEX A;  2OJT A;  4X48 A;  1CE2 A;  4IY6 A;  4R73 A;  5AA2 D;  5K2X A;  5ICT A;  4RPO A;  1MXX A;  3S2V A;  3KZG A;  4RK2 A;  3FD3 A;  3FV2 A;  1CB6 A;  3VE1 B;  2V93 A;  4XKQ A;  1A99 A;  1S50 A;  4LZ5 A;  1JW1 A;  4FEC A;  4TQU Q;  1OLC A;  3G3G A;  4KCC A;  3T9U A;  3S4U A;  3Q28 A;  1QW0 A;  3C33 A;  2YPN A;  4G68 A;  4GQO A;  1B3G A;  4OET A;  3RQT A;  2FYI A;  5I59 A;  4QFL A;  2V3U A;  4I1D A;  2F6G A;  1H43 A;  1Y3P A;  5AA4 A;  4ND9 A;  1ANF A;  3K00 A;  3H6W A;  5I2K A;  3CFX A;  3MPL A;  3VXC A;  1IIT A;  3USD A;  4OFJ A;  2XXI A;  1POT A;  2XX7 A;  2I4C A;  5I56 B;  2B65 A;  4F1U A;  4NF8 B;  3TFL A;  4YAH X;  2Q89 A;  2I48 A;  1SW4 A;  5KDT B;  2DSF A;  2ESN A;  3N6T A;  1M5B A;  3SDF A;  4NWC A;  2ABH A;  4M4G A;  3O9P A;  1JVX A;  4F3B A;  1GV8 A;  4PE5 B;  3KN8 A;  1ELJ A;  1Z7M E;  3G3K A;  3O6G A;  3SEU A;  3PV0 E;  1JEV A;  1OVT A;  1H44 A;  4F29 A;  1JNF A;  2PT1 A;  4QSE A;  3O29 A;  3UK4 A;  5JEI A;  4YKJ A;  2B3F A;  3TQW A;  3K02 A;  4KYS A;  1XT8 A;  5TPA B;  1Y1Z A;  5L9M A;  1LGB C;  3TYH A;  5CMC A;  1DTZ A;  2O51 A;  1AIV A;  4GXS B;  4KYE A;  3Q29 A;  3KEI A;  3MVX A;  2DE2 A;  3K1P A;  3QUJ A;  1Q1K A;  3K6W A;  3PPR A;  1IZ1 A;  4DE8 A;  1R9L A;  5CBS A;  3KN7 A;  1PEB A;  3FZV A;  4IO7 A;  2V3T A;  3C36 A;  3CG3 A;  2RC9 A;  1LBC A;  2I0B A;  1PDA A;  2XX8 A;  1B1H A;  3VVF A;  4JWY A;  1LLS A;  4BDR A;  1N84 A;  4R75 A;  1Y4C A;  4X9T A;  3C9H A;  4EQ9 A;  2GH9 A;  5CBR A;  3I3V A;  3M3K A;  5J1D A;  4F31 B;  4H65 A;  1ZKB A;  1VFD A;  3CFZ A;  3RT6 B;  2XXU A;  2RC8 A;  3LSL A;  1XVY A;  4FE8 A;  2Y7R A;  4JBZ A;  1IIW A;  3A3U A;  1UQW A;  5AA3 A;  4U23 A;  4ELQ A;  1UTB B;  3TTL A;  4DXC A;  4I9D A;  4KD5 A;  1BIY A;  3PUY E;  3K6V A;  5I84 A;  1WOD A;  3CG1 A;  1UTH A;  4GVO A;  3U72 A;  3MWB A;  4NMY A;  1B5J A;  1P1N A;  2I6E A;  1B7H A;  1I6Q A;  3AXF A;  3G3H A;  4LA9 A;  2F35 A;  5AE4 A;  1R6Z A;  2HAU A;  5ELV A;  3SEX A;  1A7L A;  3IO6 A;  1US5 A;  1N3X A;  3RTF B;  4PQJ A;  1FTO A;  1Y3Q A;  3K6X A;  2F78 A;  4P0I A;  3U93 A;  2HFB A;  1MDQ A;  3T9V A;  1EZP A;  4NF6 A;  4QFK A;  4DCY A;  4OER A;  3G3J A;  1NNP A;  1EU8 A;  3JV9 A;  5I2N A;  2I3W A;  1MQG A;  2Q2C A;  3SES A;  2AL5 A;  4QSC A;  1VR5 A;  4GOT A;  5I58 B;  5L9S A;  2D5W A;  3CSG A;  1TFA A;  1B0H A;  3PPP A;  1SDX A;  1LAH E;  4XKP A;  3GBB A;  1LB8 A;  1OQG A;  1USY E;  3OSR A;  4OES A;  1B4H A;  1IQ7 A;  1B3F A;  1NH8 A;  3HN0 A;  1MXW A;  3SER A;  3TCG A;  2HAV A;  1QUJ A;  3VLV A;  2B3B A;  1B6H A;  4QF9 A;  1S7Y A;  2ZYM A;  4X1D A;  4G8N A;  4BLA A;  1QUL A;  5CMK A;  1I6A A;  2IEE A;  5ITP A;  2NXO A;  1LAF E;  1ZU0 A;  4KR5 A;  4H67 A;  1A55 A;  1FTL A;  2A5T A;  1JET A;  1QKA A;  2ZMB A;  4XIG Q;  3MPK A;  2F36 A;  2I49 A;  5TP9 B;  5H8S A;  3LSW A;  2DXY A;  4Z7E A;  3FGS A;  2XXP A;  3T9H B;  3QAX A;  4U22 A;  3MZ9 A;  3CI8 A;  3CR9 A;  1FQD A;  5A5X A;  3FJ7 A;  1P1Q A;  1I6B A;  4YKK A;  4ZEC A;  1M5F A;  5DT6 A;  4DDD A;  1B7U A;  2ZNT A;  1QUI A;  2H98 A;  3F11 A;  2CMO A;  3GLB A;  4WED A;  4G2Z A;  1R1N A;  5B70 A;  4YB6 A;  4DCX A;  3OD7 A;  2XXX A;  4NF5 B;  5H8Q B;  3H03 A;  4FEB A;  3U92 A;  4I62 A;  3V83 A;  1QUK A;  2DS9 A;  5JTY B;  1Y1M A;  4PFT A;  3DP8 A;  4ELR A;  4QFO A;  1MXY A;  3ZKL A;  4EQ7 A;  3TCF A;  4F19 A;  2X26 A;  2OWS A;  3N26 A;  5ITO A;  3RLF E;  4Q8R A;  4JSO A;  1JQF A;  2ONK E;  4P11 A;  1A40 A;  1R9Q A;  2HZK A;  3BFT A;  3K1M A;  3HV1 A;  1TXF A;  1D4N A;  1WVJ A;  3H6V A;  3UIF A;  3OEL A;  1H45 A;  4IO4 A;  4LON B;  3QK6 A;  5H8H A;  4DZ1 A;  3G3I A;  4JXI A;  1MDP 1;  1SQY A;  3LC8 A;  2OBG A;  3K0V A;  1B40 A;  4R9F A;  5IKB A;  5DEX B;  2QS4 A;  2HZL A;  4OZ9 A;  3H06 B;  4NE4 A;  4C0R A;  4DLD A;  3TCH A;  2NVU B;  1FTJ A;  4F1Y A;  3O6I A;  3QXM A;  4H6D A;  1B1X A;  3CFL A;  4OMB A;  3FJM A;  3GBA A;  4IO3 A;  1EZ9 A;  4U1O A;  3PD9 A;  3KSJ A;  4IGR A;  4ZED A;  4YKP A;  3SET A;  4EXK A;  1VSO A;  2ONS A;  1HSE A;  3ODB A;  1MPB A;  4LAT A;  4MBP A;  3Q27 A;  4PFU A;  4R2B A;  1B3H A;  3D4G A;  1P99 A;  2UVG A;  2LAO A;  3VXB A;  1NNF A;  1FCK A;  1FW0 A;  2DQV A;  3TUS A;  3TDJ A;  4DXB A;  5I59 B;  3CVG A;  1QKB A;  1SW5 A;  4YMB A;  3VLU A;  3OO8 A;  5L8D A;  5KCJ A;  4EDP A;  5AA4 B;  1XOC A;  2G29 A;  3OSQ A;  2A5S A;  4GF8 A;  5I2K B;  4Q5T A;  4U2R A;  4OEN A;  5BWJ A;  3FVO A;  3JZJ A;  4GRK A;  4BDN A;  1H3D A;  1IXI A;  2HXW A;  2ZNU A;  3DP4 A;  4RA1 A;  1FTK A;  2R71 A;  4Q0C A;  1NNK A;  3S9N C;  3VVD A;  1EH3 A;  3IX1 A;  1ZLQ A;  2OCU A;  4BDQ A;  1ZIU A;  1SI0 A;  1B05 A;  4ZEB A;  3T66 A;  2VD2 A;  4YB5 A;  2RCB A;  3T22 A;  2GRV A;  3KN3 A;  4MLQ A;  1URS A;  5I56 A;  3SEW A;  5CM6 A;  4I8C A;  4NF8 A;  2GFE A;  1Y3N A;  4F22 A;  2HEU A;  4XKN A;  3CIJ A;  4U4S A;  2NWJ A;  4G8M A;  5FTI A;  1Q35 A;  2ALU A;  2V84 A;  1MPD A;  3PUV E;  4NF4 B;  3HCQ A;  3MP6 A;  2VGQ A;  3A3C A;  4DIG A;  3H7M A;  3TEL A;  2DXR A;  1AL3 A;  1SW1 A;  1MQH A;  1DSN A;  1OVB A;  4KQP A;  3UA8 A;  3QSL A;  4QFP A;  1RKM A;  2Z8E A;  1B51 A;  3O66 A;  3UGW A;  4GIZ A;  1MH4 A;  1LB9 A;  1UIV A;  2Q9T A;  3FAS A;  1QVS A;  4LQ5 A;  3N94 A;  4R6H A;  4AB6 A;  3B6T A;  3MVW A;  3OEM A;  2XHD A;  4H0W A;  3BFU A;  5EHM A;  3PMV A;  5TPA A;  4BDM A;  1MH3 A;  3OO9 A;  1S9T A;  1VE4 A;  2Z8D A;  1MQJ A;  1B5H A;  2AYS A;  3O6H A;  2F7C A;  1SW2 A;  1P1W A;  1WDN A;  4ESW A;  4QRZ A;  1MPC A;  3G7W A;  4GXA A;  5DVF A;  3MVY A;  1Z7N E;  2Y7P A;  4RJZ A;  5BUU A;  4RNS A;  3TTM A;  1Y4T A;  4MH5 A;  4EF1 A;  1NH7 A;  3L6H A;  5FTH A;  4ELP A;  3R6U A;  3E3K A;  1HSL A;  1UTH B;  4P0G A;  4ZE8 A;  3GXA A;  3PMW A;  1FQA A;  5TU0 A;  3ILT B;  1JW4 A;  1GTK A;  2YJP A;  1MY1 A;  1LAX A;  4QFN A;  2NUV A;  1MY2 A;  2O6A A;  1XVX A;  1HSJ A;  4JWX A;  3WAF A;  2XXV A;  2CZL A;  3H4Z A;  3LBS A;  4FIM A;  3W9V A;  5H8F A;  3IO4 A;  1FQF A;  1M5D A;  4NED A;  1UTB A;  1IXG A;  4KCD A;  4ONY A;  4PFY A;  1NMU A;  3TTK A;  4HTG A;  1PB8 A;  3S9M C;  4UA8 A;  3KFM A;  1B52 A;  4GLI A;  2DWH A;  4RYA A;  1L5T A;  4ECF A;  3IB2 A;  3W15 C;  4YIC A;  2X7P A;  2Y7K A;  1DPE A;  1POY 1;  4MLV A;  4H5G A;  3K01 A;  3QIM A;  3HST A;  4LUB A;  5K2Y A;  1ZTY A;  3KGC A;  3FVK A;  3VV5 A;  2BJJ X;  3IAZ A;  3E13 X;  1LCF A;  4U21 A;  2O7U A;  3A09 A;  3C35 A;  2R9J A;  3OO7 A;  3MQ9 A;  3UP9 A;  2REJ A;  5I58 A;  5ISU A;  2Q88 A;  4ISU A;  1O63 A;  3H6U A;  4L17 A;  2QS3 A;  2QSX A;  2QRY A;  3QUF A;  4H1X A;  3PGF A;  4OWD A;  4WXJ A;  4ELO A;  1NL5 A;  4UAC A;  1LFI A;  4R6K A;  2THI A;  3TTN A;  4HCY A;  4RXL A;  2A5T B;  4OYV A;  4GWO A;  4ZE9 A;  3B6Q A;  4ZS9 A;  3TEP A;  1AH5 A;  4KHZ E;  2REG A;  4C1U A;  2RCA A;  3EHU A;  1PB9 A;  3FVG A;  1Y20 A;  4HCW A;  4YU0 A;  4N13 A;  3N6U A;  3PPQ A;  3B7D A;  1AOV A;  1SI1 A;  3HHG A;  4KPT A;  1SVX B;  4RPN A;  2QS1 A;  3OEK A;  2FNC A;  4Z0I A;  4O3A A;  1RYO A;  1NNT A;  3K4U A;  5AA1 A;  1B3L A;  1Y9U A;  4IY5 A;  2Z22 A;  1UIU A;  5AA2 A;  2Y7I A;  2O7I A;  2OLB A;  4OFO A;  4OEU A;  3WAE A;  3SEY A;  1M5C A;  3RN8 A;  2QJE A;  3IK6 B;  1FQB A;  5H8N B;  3S9E A;  3OXN A;  3LUY A;  2XXQ A;  3IJX B;  2W7Y A;  2DYX A;  3IOV A;  3K2D A;  4HW8 A;  1N7X A;  3T93 B;  4WEP A;  1EZO A;  1YCJ A;  1MRP A;  2PMS A;  1ATG A;  3PU5 A;  3CRB A;  3RTW B;  3HO7 A;  5CMM A;  4MFI A;  4TOZ A;  2H9B A;  1GVC A;  4BDO A;  5DVI A;  4FAJ A;  3H3G A;  3TAJ A;  1M5E A;  3HHF A;  4FOR A;  1N3W A;  3O2A A;  4XKR A;  5DVJ A;  3DLN A;  2DE3 A;  5F1Q A;  5H8Q A;  4GD5 A;  4OEV A;  2V25 A;  4M1V A;  5I57 B;  1B58 A;  5JTY A;  2O1L A;  2F97 A;  5FHN A;  3FXQ A;  4U4X A;  2QL3 A;  4OVJ A;  5FHM A;  2XD2 A;  1N0T A;  4JWO A;  5H8H B;  1XS5 A;  2RF1 A;  4O3B A;  5L9O A;  5HBC A;  4NWD A;  4F2Q A;  4KFQ A;  1MG1 A;  3C31 A;  3TOD A;  2F8D A;  3T96 B;  3TKD A;  3O97 A;  3QYT A;  2H5Y A;  2F7A A;  1A8F A;  3IB1 A;  4THI A;  3MJN A;  1DPP A;  2D21 A;  4FAT A;  3FVN A;  3V8X B;  5LOM A;  2Y84 A;  4F18 A;  3E4R A;  2ONR A;  2H4I A;  3O28 A;  3MAM A;  2V3Q A;  4AB5 A;  2QMX A;  3B6W A;  1QJM A;  3FXU A;  4R74 A;  5IAI A;  1YPN A;  4POX A;  3DP6 A;  4ZEI A;  1TT1 A;  1URD A;  2I58 A;  4HS7 A;  3R26 A;  2DWI A;  2XXW A;  3K6U A;  2DVC A;  2F6P A;  4OXV A;  4QSD A;  3UOR A;  3KJT A;  1MXZ A;  1B4Z A;  4G68 B;  2AIX A;  1ZBM A;  4IO5 A;  3SEV A;  1OIB A;  3C32 A;  4IO2 A;  1DOT A;  1ZJL A;  5KCJ B;  1MM7 A;  1SD3 A;  4X1B A;  3EN3 A;  4G68 C;  1DTG A;  4F3P A;  1TWY A;  2DOJ A;  2DWJ A;  4PET A;  2P2A A;  2Y7W A;  1XC1 A;  4OTE A;  3JYR A;  1A54 A;  2YLN A;  4G8H A;  1D9Y A;  3ECR A;  2PVU A;  2ZYN A;  3N5L A;  1SBP A;  3MP8 A;  1B3E A;  4F1V A;  4FJP A;  2WKY A;  3IB0 A;  2UXA A;  3P7I A;  5CMB A;  2PT2 A;  4BDL A;  2UYF A;  1NFT A;  1LST A;  3T9X B;  2GHB A;  1FTM A;  1OQH A;  3TZA A;  2PX1 A;  4N6P A;  5CC2 A;  3OMB A;  4YKI A;  3SKP A;  2XXY A;  3KOT A;  3L6G A;  1P1U A;  3ONM A;  2RKM A;  3PUX E;  2ANJ A;  2R6G E;  3EF7 A;  4JSD A;  3IOT A;  1FQC A;  2HCA A;  3W9W A;  2I4B A;  2O1M A;  3U94 A;  3IR1 A;  4EXL A;  1B0L A;  1MQI A;  1H76 A;  4R6Y A;  5KDT A;  4LVQ A;  2ZNS A;  3PUZ E;  4ZZE A;  3FAT A;  3LSX A;  4IO6 A;  3KSX A;  1OMP A;  4O3C A;  1PC3 A;  1PB7 A;  1GR2 A;  2HQ0 A;  3LSF B;  1JW5 A;  3IOR A;  2F5X A;  4YZZ A;  4NTL A;  4NF4 A;  3RNN A;  4TLM B;  1BKA A;  4DXU A;  3RY3 A;  1O64 A;  3CSB A;  3KJ7 A;  4G77 A;  4U1Z A;  2GHA A;  1LBB A;  4H5F A;  2DWA A;  1IEJ A;  2UVJ A;  1USY H;  2DE4 A;  1XHY A;  4RY1 A;  3MC2 A;  4KYD A;  2XX9 A;  1LFH A;  2O84 X;  3D4C A;  3RPW A;  4TLL B;  3FJG A;  1MXV A;  2VD3 A;  4N07 A;  1PBQ A;  3DEL B;  4F39 A;  2PYY A;  2O69 A;  3TQL A;  3BBR A;  4PP0 A;  3OO6 A;  1T0K A;  3PD8 A;  1IXC A;  3KOS A;  3THI A;  4R9G A;  2XXT A;  3VFJ A;  3KG2 A;  1D9V A;  3BKI B;  5EYF A;  1MY4 A;  2F34 A;  3EHS A;  4ZEF A;  4R72 A;  4G4P A;  3M8U A;  2OK2 A;  3EPE A;  3Q26 A;  3C4M A;  3OOA A;  3R7X A;  2QPQ A;  2ZYO A;  4ZZA A;  2E1S A;  3U1O A;  4LZ8 A;  1DMB A;  2XD3 A;  2DP8 A;  3PPO A;  3KBR A;  3GZG A;  4OHN A;  3FUZ A;  4YB7 A;  4WKM A;  5H8F B;  5CI5 A;  2KLF A;  3FV1 A;  1N7W A;  5HM4 B;  3UN6 A;  5FHO A;  3FIR A;  2X7Q A;  5HPQ A;  4NF6 B;  2QS2 A;  3RT8 A;  1TFD A;  2M8C A;  1IXH A;  2ZXT A;  3MZB A;  4XXU A;  3TTR A;  2AL4 A;  4ZDM A;  3FXR A;  5I2N B;  4AQ4 A;  1B32 A;  2UVH A;  4XTC Q;  2XXH A;  3TPA A;  4F3S A;  1J1N A;  1IUD A;  3K1N A;  1YAE A;  3IJO B;  1BLF A;  4JB7 A;  1MS7 A;  4F2O A;  1O7T A;  1NKX A;  3TMG A;  4JDF A;  5DYH A;  4LP2 B;  1YTV A;  1MXU A;  3ZS6 A;  1JVY A;  1N76 A;  2O68 A;  1BP5 A;  3OEN A;  3C34 A;  2OWT A;  2D3I A;  3E9X A;  3M3F A;  4QHQ A;  2Q8J A;  1MQD A;  2DVZ A;  3MZ1 A;  1BTJ A;  5KZT A;  1MM6 A;  1PBP A;  2FA7 A;  3IOU A;  3S9L C;  3ZSF A;  3ZKK A;  4E0X A;  4IB2 A;  3VLW A;  5DTB A;  5M2V A;  2IA4 A;  3I5O A;  4LZ7 A;  3MVZ A;  1AMF A;  1B9J A;  3MBP A;  3G3F A;  1B5I A;  1JEU A;  1A8E A;  1SYI A;  2H25 A;  4ZEK A;  3PUW E;  4LQ2 A;  4C1T A;  2QMW A;  4Q30 B;  4MF3 A;  2F7B A;  1GGG A;  4FED A;  5A5X B;  1VFE A;  2PBW A;  3HPI A;  2G93 A;  5AA2 B;  2RC7 A;  4KI0 E;  4EUO A;  5TP9 A;  3VVE A;  1FQE A;  3IL1 B;  3EQ1 A;  3MUQ A;  4EF2 A;  1B7Z A;  1US4 A;  2VHA A;  1MY0 A;  4OFL A;  2UYE A;  3Q25 A;  3V5A A;  3RUM A;  4GL0 A;  1II5 A;  2I0C A;  3MW0 A;  2I3V A;  3PPN A;  3V89 B;  1OLA A;  1F9B A;  1B2H A;  4OQO A;  1P1O A;  3DM0 A;  5H8N A;  3MP1 A;  2Z8F A;  3I6V A;  2OZZ A;  4GL8 A;  1I69 A;  2E0S A;  5F7V A;  2H99 A;  2NOO A;  3M3L A;  4NF5 A; 
#chains in the Genus database with same CATH topology
 5ICQ A;  2VP1 A;  3H6T A;  1FBD A;  4PFR A;  3PMX A;  2UVI A;  5CRY A;  4H8I A;  4G61 A;  1K9Z A;  1N04 A;  3A29 A;  3E79 A;  4F3G A;  2P0S A;  1D3K A;  4YMA A;  5B7D A;  4K3F A;  2HHM A;  2ZYK A;  1G0I A;  1B46 A;  2QVV A;  5EQ7 A;  4E0W A;  4PFW A;  3U8Q A;  1MY3 A;  2Z23 A;  2RIN A;  5EHS A;  2VOZ A;  3VDF A;  1SYH A;  4H8J A;  4EQB A;  4POW A;  1KWH A;  4GX6 A;  3HFU A;  5I57 A;  2VPN A;  4R2F A;  1ZMG A;  3ILU B;  4GFR A;  4N4U A;  5T3J A;  2Q2A A;  3IOW A;  5ET6 A;  4ESX A;  5JK4 A;  4I40 A;  1LFG A;  2XXR A;  4IGT A;  4MEV A;  1URG A;  2P1S A;  1RYX A;  3RYD A;  1LAG E;  3EHT A;  4RK9 A;  1LCT A;  3RGY A;  3LR1 A;  5DEX A;  2OJT A;  1FPD A;  4X48 A;  1CE2 A;  4IY6 A;  4R73 A;  5AA2 D;  5K2X A;  5ICT A;  4RPO A;  1MXX A;  2WYK A;  3S2V A;  3KZG A;  2QFL A;  4RK2 A;  3FD3 A;  3FV2 A;  1CB6 A;  3VE1 B;  2V93 A;  3GYY A;  4XKQ A;  1A99 A;  2L5V A;  1S50 A;  4LZ5 A;  1FBP A;  1JW1 A;  4FEC A;  4TQU Q;  1OLC A;  3G3G A;  4KCC A;  3T9U A;  3S4U A;  3Q28 A;  1QW0 A;  3C33 A;  2YPN A;  4G68 A;  4GQO A;  1B3G A;  4OET A;  3RQT A;  2FYI A;  5I59 A;  4QFL A;  2V3U A;  4PF6 A;  4I1D A;  2F6G A;  4HXV A;  1H43 A;  2XWV A;  1Y3P A;  5AA4 A;  4ND9 A;  1ANF A;  3K00 A;  3H6W A;  5I2K A;  3CFX A;  3MPL A;  3VXC A;  1IIT A;  3USD A;  4OFJ A;  2XXI A;  2FHY A;  4PC9 A;  1INP A;  1POT A;  2XX7 A;  2I4C A;  5I56 B;  2B65 A;  1LBY A;  4F1U A;  4NF8 B;  3TFL A;  4YAH X;  2Q89 A;  5F24 A;  2I48 A;  2Y5K A;  1SW4 A;  5KDT B;  2DSF A;  2ESN A;  3N6T A;  5IM2 A;  1M5B A;  3SDF A;  4NWC A;  2ABH A;  4M4G A;  3O9P A;  1JVX A;  1LBX A;  4F3B A;  1GV8 A;  4PE5 B;  3KN8 A;  1ELJ A;  1Z7M E;  3G3K A;  3O6G A;  3SEU A;  3PV0 E;  1NUZ A;  1JEV A;  1OVT A;  1H44 A;  4F29 A;  1JNF A;  2PT1 A;  1FBC A;  4QSE A;  3O29 A;  3UK4 A;  5JEI A;  4YKJ A;  2B3F A;  3TQW A;  3K02 A;  4KYS A;  2QVR A;  1XT8 A;  5TPA B;  1Y1Z A;  5L9M A;  4P8B A;  1LGB C;  3TYH A;  5CMC A;  4O94 A;  1DTZ A;  1FBF A;  2O51 A;  1AIV A;  4GXS B;  4KYE A;  1IME A;  3Q29 A;  3KEI A;  4DI4 B;  3MVX A;  2DE2 A;  3K1P A;  5IGA A;  3QUJ A;  1Q1K A;  3K6W A;  3PPR A;  1IZ1 A;  4AS5 A;  4DE8 A;  1R9L A;  4MIJ A;  5CBS A;  3KN7 A;  1PEB A;  3FZV A;  4IO7 A;  2V3T A;  1IMA A;  4PAK A;  3C36 A;  3CG3 A;  2RC9 A;  1EYK A;  1LBC A;  2CZK A;  2I0B A;  1PDA A;  2XX8 A;  1B1H A;  3VVF A;  2KQZ A;  4NF0 A;  4JWY A;  1LLS A;  4BDR A;  3FXB A;  1N84 A;  1K9Y A;  4R75 A;  1Y4C A;  4X9T A;  3C9H A;  4EQ9 A;  2GH9 A;  5CBR A;  3ROJ A;  3I3V A;  3M3K A;  3IFC A;  5J1D A;  4F31 B;  4H65 A;  1ZKB A;  1VFD A;  3CFZ A;  3RT6 B;  2XXU A;  4PAI A;  2RC8 A;  1XVY A;  3LSL A;  4FE8 A;  2Y7R A;  4JBZ A;  1IIW A;  3A3U A;  1NV5 A;  1UQW A;  5AA3 A;  4U23 A;  4ELQ A;  1UTB B;  4OVP A;  3TTL A;  4DXC A;  4I9D A;  4KD5 A;  1BIY A;  3PUY E;  3K6V A;  5I84 A;  1WOD A;  3CG1 A;  1UTH A;  4GVO A;  4P3L A;  2Y5L A;  3U72 A;  2FVZ A;  3MWB A;  4NMY A;  1B5J A;  1P1N A;  2I6E A;  1B7H A;  4NN3 A;  4UAB A;  1I6Q A;  5IZ1 A;  2QVU A;  3AXF A;  3G3H A;  4LA9 A;  2F35 A;  5AE4 A;  5IZZ A;  1R6Z A;  5EQ8 A;  2HAU A;  5ELV A;  3SEX A;  1A7L A;  5FBP A;  1NUX A;  3IO6 A;  1US5 A;  1N3X A;  3RTF B;  4PQJ A;  1FTO A;  1Y3Q A;  1VDW A;  3K6X A;  4GWU A;  2F78 A;  4MX6 A;  4P0I A;  1D9Q A;  3U93 A;  2HFB A;  1MDQ A;  4I3E A;  3T9V A;  1EZP A;  4NF6 A;  4QFK A;  4DCY A;  4OER A;  1FPB A;  3G3J A;  1NNP A;  3MYU A;  1EU8 A;  3JV9 A;  4X04 A;  5I2N A;  2I3W A;  1MQG A;  2Q2C A;  3SES A;  2AL5 A;  4QSC A;  1VR5 A;  4GOT A;  5I58 B;  5L9S A;  2D5W A;  3KC0 A;  4H45 A;  3CSG A;  1TFA A;  1B0H A;  3PPP A;  1SDX A;  1LAH E;  4XKP A;  3GBB A;  1LB8 A;  1OQG A;  1USY E;  3OSR A;  1IMC A;  4OES A;  1B4H A;  1IQ7 A;  1B3F A;  1NH8 A;  3HN0 A;  1MXW A;  3SER A;  2BJI A;  3TCG A;  2HAV A;  1QUJ A;  3VLV A;  2B3B A;  1B6H A;  4QF9 A;  4DI3 D;  1S7Y A;  2ZYM A;  4X1D A;  4G8N A;  4BLA A;  1QUL A;  5CMK A;  1I6A A;  2IEE A;  5ITP A;  2XWO A;  3LV0 A;  2NXO A;  1LAF E;  1ZU0 A;  2JJK A;  4H67 A;  4KR5 A;  1A55 A;  1FTL A;  2A5T A;  1JET A;  1QKA A;  2ZMB A;  4XIG Q;  3MPK A;  2F36 A;  2I49 A;  5TP9 B;  5H8S A;  3LSW A;  4IR8 A;  2DXY A;  4Z7E A;  3FGS A;  2F3D A;  2XXP A;  3T9H B;  3QAX A;  2V4C A;  1DCU A;  4U22 A;  3MZ9 A;  2CZH A;  3CI8 A;  3CR9 A;  1FQD A;  1NUY A;  5A5X A;  3FJ7 A;  1P1Q A;  5I7I A;  1I6B A;  4YKK A;  4ZEC A;  1M5F A;  5DT6 A;  2MKZ A;  4DDD A;  2XA5 A;  1B7U A;  2ZNT A;  1SPI A;  1QUI A;  4MMP A;  2H98 A;  3F11 A;  5EQ9 A;  2CMO A;  3GLB A;  4WED A;  3CHG A;  2DDK A;  5IZ3 A;  4G2Z A;  1R1N A;  5B70 A;  4YB6 A;  3B8B A;  4DCX A;  3OD7 A;  3T0J A;  2XXX A;  4NF5 B;  5H8Q B;  3H03 A;  4FEB A;  3U92 A;  4I62 A;  3V83 A;  1QUK A;  2DS9 A;  5JTY B;  1Y1M A;  4PFT A;  3DP8 A;  4ELR A;  4HE2 A;  4QFO A;  2P3V A;  1MXY A;  3ZKL A;  4EQ7 A;  3TCF A;  4F19 A;  2X26 A;  2OWS A;  3N26 A;  5ITO A;  3RLF E;  4Q8R A;  1NV6 A;  4JSO A;  1JQF A;  2ONK E;  4P11 A;  1A40 A;  1R9Q A;  2HZK A;  3BFT A;  3K1M A;  3HV1 A;  1TXF A;  1D4N A;  1WVJ A;  3H6V A;  4GWY A;  3UIF A;  3OEL A;  4PGN A;  1H45 A;  4IO4 A;  4LON B;  3QK6 A;  5H8H A;  4DZ1 A;  3G3I A;  4JXI A;  1MDP 1;  1SQY A;  4X8R A;  3LC8 A;  2OBG A;  3K0V A;  1B40 A;  4R9F A;  5IKB A;  5DEX B;  2QS4 A;  3MST A;  5ET7 A;  2HZL A;  4OZ9 A;  3H06 B;  4NE4 A;  4C0R A;  4DLD A;  3TCH A;  2NVU B;  1FTJ A;  4F1Y A;  3O6I A;  3QXM A;  4H6D A;  4PDH A;  1B1X A;  3CFL A;  4OMB A;  3FJM A;  3GBA A;  3NOH A;  4IO3 A;  1EZ9 A;  4U1O A;  3PD9 A;  3KSJ A;  4PFB A;  4IGR A;  4ZED A;  5LDZ A;  4YKP A;  3SET A;  4EXK A;  1VSO A;  2ONS A;  1HSE A;  1EYI A;  3ODB A;  1MPB A;  4LAT A;  4MBP A;  3Q27 A;  4PFU A;  4R2B A;  1B3H A;  3D4G A;  4GBV A;  1P99 A;  2CZI A;  2B4M A;  2UVG A;  2OX3 A;  2LAO A;  3VXB A;  1NNF A;  1FCK A;  1FPK A;  1FW0 A;  2DQV A;  3TUS A;  3TDJ A;  1FPL A;  4DXB A;  5I59 B;  3CVG A;  1QKB A;  1SW5 A;  4YMB A;  3VLU A;  3OO8 A;  5L8D A;  5KCJ A;  4EDP A;  5AA4 B;  1XOC A;  2GQ1 A;  4MHF A;  2G29 A;  3OSQ A;  4JVC A;  2A5S A;  4GF8 A;  5I2K B;  1NI9 A;  4Q5T A;  4U2R A;  4OEN A;  5BWJ A;  3FVO A;  3JZJ A;  4GRK A;  4BDN A;  1H3D A;  1FPJ A;  1IXI A;  2HXW A;  2ZNU A;  3DP4 A;  4RA1 A;  1FTK A;  2R71 A;  1LBW A;  4Q0C A;  1NNK A;  3S9N C;  3VVD A;  1EH3 A;  2PCR A;  3IX1 A;  1ZLQ A;  2OCU A;  4BDQ A;  1ZIU A;  1SI0 A;  4PE3 A;  1B05 A;  4ZEB A;  3T66 A;  2VD2 A;  4YB5 A;  2RCB A;  4N8Y A;  3T22 A;  3QMF A;  2GRV A;  3KN3 A;  4MLQ A;  1URS A;  5I56 A;  3SEW A;  5CM6 A;  4I8C A;  4NF8 A;  2GFE A;  1Y3N A;  4F22 A;  1CNQ A;  2HEU A;  4XKN A;  3CIJ A;  4U4S A;  2NWJ A;  4G8M A;  5FTI A;  1Q35 A;  2ALU A;  2V84 A;  1MPD A;  3PUV E;  4NF4 B;  3HCQ A;  3MP6 A;  2VGQ A;  3A3C A;  2HXR A;  4DIG A;  1FPE A;  3H7M A;  3TEL A;  2DXR A;  1AL3 A;  4HE0 A;  1SW1 A;  1MQH A;  1DSN A;  5DW8 A;  1OVB A;  4KQP A;  1KA1 A;  3UA8 A;  3QSL A;  4QFP A;  1RKM A;  2Z8E A;  3FBP A;  1B51 A;  3O66 A;  3UGW A;  4GIZ A;  1MH4 A;  1FJ6 A;  1LB9 A;  1UIV A;  2Q9T A;  3FAS A;  1QVS A;  4LQ5 A;  3N94 A;  4R6H A;  4AB6 A;  3B6T A;  3MVW A;  3OEM A;  2XHD A;  4H0W A;  3BFU A;  5EHM A;  3PMV A;  2XWK A;  5TPA A;  4BDM A;  1MH3 A;  3OO9 A;  1S9T A;  1DK4 A;  1VE4 A;  2Z8D A;  4KXP A;  1MQJ A;  1AWB A;  1B5H A;  2AYS A;  3O6H A;  1G0H A;  2F7C A;  1SW2 A;  1P1W A;  1FPI A;  1YXI A;  5ET8 A;  1WDN A;  4ESW A;  4QRZ A;  1MPC A;  3G7W A;  4PF8 A;  4GXA A;  5DVF A;  4XEQ A;  3MVY A;  1Z7N E;  3D1R A;  2Y7P A;  4RJZ A;  4GX3 A;  5BUU A;  4RNS A;  3TTM A;  1Y4T A;  4MH5 A;  4EF1 A;  1NH7 A;  3L6H A;  1QGX A;  5FTH A;  4ELP A;  3R6U A;  3E3K A;  1HSL A;  1UTH B;  4P0G A;  4ZE8 A;  3GXA A;  3PMW A;  1FQA A;  5TU0 A;  3ILT B;  1JW4 A;  1GTK A;  1FPF A;  2YJP A;  1MY1 A;  1LAX A;  5ET5 A;  4QFN A;  4OA4 A;  2NUV A;  1MY2 A;  2O6A A;  1XVX A;  1HSJ A;  4JWX A;  3WAF A;  2XXV A;  2CZL A;  3H4Z A;  3LBS A;  4FIM A;  3W9V A;  5H8F A;  3IO4 A;  1FQF A;  1M5D A;  4NED A;  1UTB A;  1IXG A;  3RPL B;  1NV0 A;  4KCD A;  1FTA A;  4ONY A;  4NQ8 A;  4O7I A;  4PFY A;  1NMU A;  2OWZ A;  3TTK A;  4HTG A;  1NV3 A;  1PB8 A;  3S9M C;  4UA8 A;  3KFM A;  1B52 A;  4GLI A;  2DWH A;  4RYA A;  1L5T A;  3IFA A;  4ECF A;  3IB2 A;  3W15 C;  2P3N A;  4PFI A;  4YIC A;  2X7P A;  2Y7K A;  1DPE A;  1POY 1;  4MLV A;  4H5G A;  3K01 A;  4MNC A;  1FJ9 A;  3QIM A;  3HST A;  4LUB A;  5K2Y A;  1ZTY A;  3KGC A;  3E78 A;  3FVK A;  3VV5 A;  2BJJ X;  3IAZ A;  3E13 X;  1LCF A;  4U21 A;  3BIG A;  2O7U A;  3A09 A;  3C35 A;  4PAF A;  2R9J A;  3OO7 A;  3PTY A;  3MQ9 A;  2XXK A;  2F3B A;  3UP9 A;  2REJ A;  5I58 A;  5ISU A;  2Q88 A;  4ISU A;  1O63 A;  3H6U A;  4LN5 A;  4L17 A;  1KZ8 A;  2QS3 A;  4NG7 A;  1YYZ A;  2QSX A;  2QRY A;  4GWS A;  3QUF A;  4H1X A;  2VT5 A;  3PGF A;  4OWD A;  4N6K A;  4WXJ A;  4ELO A;  4AS4 A;  1NL5 A;  4UAC A;  1LFI A;  4R6K A;  2THI A;  3TTN A;  4PDD A;  4HCY A;  2WX9 A;  4OVQ A;  4RXL A;  2A5T B;  4OYV A;  4GWO A;  4ZE9 A;  3B6Q A;  4ZS9 A;  2HPG A;  3TEP A;  1AH5 A;  4KHZ E;  2REG A;  4C1U A;  2RCA A;  3EHU A;  1PB9 A;  4N15 A;  4MCO A;  3FVG A;  1Y20 A;  4HCW A;  1IMB A;  4N13 A;  3N6U A;  4YU0 A;  3PPQ A;  3B7D A;  1AOV A;  1NV4 A;  1SI1 A;  3HHG A;  4KPT A;  1KA0 A;  1SVX B;  4RPN A;  2QS1 A;  3OEK A;  2FNC A;  4Z0I A;  4O3A A;  1RYO A;  1NNT A;  3K4U A;  4XF5 A;  5AA1 A;  1RDX A;  1B3L A;  1Y9U A;  4IY5 A;  2Z22 A;  1UIU A;  5AA2 A;  1LEV A;  2Y7I A;  2O7I A;  2OLB A;  4OFO A;  4OEU A;  3WAE A;  3SEY A;  1M5C A;  4I3Y A;  3RN8 A;  5IZ3 B;  2QJE A;  3ISP A;  3IK6 B;  1FQB A;  5H8N B;  3S9E A;  1EYJ A;  3OXN A;  3LUY A;  2XXQ A;  4MNP A;  3IJX B;  2W7Y A;  2DYX A;  3IOV A;  3K2D A;  4HW8 A;  1N7X A;  3T93 B;  4WEP A;  1EZO A;  1YCJ A;  1MRP A;  2PMS A;  1ATG A;  3PU5 A;  3CRB A;  3RTW B;  3HO7 A;  5CMM A;  2Q74 A;  4MFI A;  4TOZ A;  2H9B A;  1GVC A;  4BDO A;  5DVI A;  4FAJ A;  3H3G A;  3TAJ A;  1M5E A;  3HHF A;  4FOR A;  1N3W A;  3O2A A;  4XKR A;  5DVJ A;  3DLN A;  2DE3 A;  5F1Q A;  5H8Q A;  4GD5 A;  4OEV A;  2V25 A;  4M1V A;  5I57 B;  1B58 A;  5JTY A;  2O1L A;  2F97 A;  5FHN A;  3FXQ A;  4U4X A;  2QL3 A;  4OVJ A;  5FHM A;  1NUW A;  2XD2 A;  1N0T A;  4JWO A;  5H8H B;  1XS5 A;  2RF1 A;  4O3B A;  5L9O A;  5HBC A;  4NWD A;  4F2Q A;  4KFQ A;  4QXD A;  1MG1 A;  4O8M A;  3C31 A;  4XFE A;  4OVT A;  3TOD A;  2F8D A;  4NAP A;  3T96 B;  3TKD A;  3O97 A;  3QYT A;  2H5Y A;  2F7A A;  2PFZ A;  4P56 A;  1A8F A;  3IB1 A;  4THI A;  3MJN A;  1DPP A;  2D21 A;  4FAT A;  3FVN A;  3V8X B;  5LOM A;  2Y84 A;  4F18 A;  3E4R A;  4N81 A;  2ONR A;  2H4I A;  3O28 A;  3MAM A;  2V3Q A;  4AB5 A;  2QMX A;  3B6W A;  1QJM A;  4OVR A;  3FXU A;  3BIH A;  4R74 A;  5IAI A;  1YPN A;  4POX A;  5EYG A;  4PBH A;  3DP6 A;  4ZEI A;  1TT1 A;  1URD A;  2I58 A;  4HS7 A;  4N17 A;  3R26 A;  2DWI A;  2XXW A;  3K6U A;  1RDY A;  2DVC A;  2F6P A;  4OXV A;  4QSD A;  2WEF A;  3UOR A;  3KJT A;  1MXZ A;  1B4Z A;  2FBP A;  4G68 B;  2AIX A;  1ZBM A;  3KBZ A;  4IO5 A;  3SEV A;  1OIB A;  3C32 A;  4IO2 A;  1DOT A;  1ZJL A;  5KCJ B;  1MM7 A;  1SD3 A;  1LBV A;  4X1B A;  4NX1 A;  3EN3 A;  3EKI A;  4G68 C;  1DTG A;  1TWY A;  4F3P A;  4PET A;  2DOJ A;  2DWJ A;  3LUZ A;  2P2A A;  2Y7W A;  1XC1 A;  4OTE A;  5LTC A;  3JYR A;  4O7M A;  1A54 A;  2YLN A;  2FIE A;  4G8H A;  1D9Y A;  4OAN A;  3ECR A;  2PVU A;  2ZYN A;  3N5L A;  1SBP A;  3MP8 A;  1B3E A;  4F1V A;  4FJP A;  2WKY A;  3IB0 A;  4GWZ A;  2UXA A;  3P7I A;  5CMB A;  2PT2 A;  4BDL A;  2UYF A;  1NFT A;  4P1E A;  1LST A;  3T9X B;  2GHB A;  1FTM A;  1OQH A;  3TZA A;  2PX1 A;  4N6P A;  5CC2 A;  5EQA A;  3OMB A;  4YKI A;  3SKP A;  2XXY A;  3KOT A;  3L6G A;  1P1U A;  3ONM A;  2RKM A;  2FIX A;  3PUX E;  2ANJ A;  2R6G E;  3EF7 A;  4JSD A;  3IOT A;  1FQC A;  2HCA A;  3W9W A;  2I4B A;  2O1M A;  3U94 A;  3IR1 A;  4EXL A;  1B0L A;  1MQI A;  1H76 A;  4R6Y A;  5KDT A;  4LVQ A;  2ZNS A;  3PUZ E;  4ZZE A;  4P1L A;  3FAT A;  1JP4 A;  3LSX A;  4IO6 A;  4P47 A;  4JVI A;  3KSX A;  1OMP A;  4O3C A;  1PC3 A;  4FBP A;  1PB7 A;  1GR2 A;  2HQ0 A;  3LSF B;  1JW5 A;  3IOR A;  4H46 A;  4MNI A;  2F5X A;  4YZZ A;  4NTL A;  4N6D A;  4OVS A;  4NF4 A;  1FBE A;  3RNN A;  4TLM B;  1BKA A;  4DXU A;  5A5L A;  3RY3 A;  1O64 A;  3CSB A;  3KJ7 A;  4G77 A;  4U1Z A;  2GHA A;  1LBB A;  4H5F A;  2DWA A;  1IEJ A;  2UVJ A;  1XI6 A;  1USY H;  2DE4 A;  1XHY A;  5ESY A;  4RY1 A;  3MC2 A;  4KYD A;  2XX9 A;  1LFH A;  2O84 X;  3D4C A;  3RPW A;  1Q9D A;  1LBZ A;  1NV7 A;  4TLL B;  3FJG A;  4N91 A;  1MXV A;  2VD3 A;  4N07 A;  1PBQ A;  3DEL B;  4F39 A;  2PYY A;  2O69 A;  3TQL A;  3BBR A;  1NV1 A;  4PP0 A;  3OO6 A;  1T0K A;  3PD8 A;  1IXC A;  3KOS A;  3THI A;  4R9G A;  1NV2 A;  2XXT A;  3VFJ A;  2PFY A;  2ZZV A;  3KG2 A;  1D9V A;  2VPO A;  3BKI B;  5EYF A;  1MY4 A;  2F34 A;  3EHS A;  4ZEF A;  4R72 A;  4PCD A;  4G4P A;  3M8U A;  2ZZW A;  2OK2 A;  3EPE A;  3Q26 A;  3C4M A;  1IMF A;  3OOA A;  3R7X A;  2QPQ A;  4GBW A;  2ZYO A;  4PTK A;  4ZZA A;  2E1S A;  3U1O A;  4LZ8 A;  1DMB A;  2XD3 A;  2DP8 A;  3PPO A;  3KBR A;  4PGP A;  5I5P A;  4MAG A;  4GWX A;  3GZG A;  4OHN A;  3FUZ A;  5J16 A;  2KR0 A;  4YB7 A;  4WKM A;  5H8F B;  5CI5 A;  2KLF A;  3FV1 A;  2ZZX A;  1N7W A;  5HM4 B;  2WYP A;  3UN6 A;  5FHO A;  3FIR A;  2X7Q A;  1FRP A;  5HPQ A;  4NF6 B;  2QS2 A;  4P9K A;  3RT8 A;  1TFD A;  2M8C A;  1IXH A;  2ZXT A;  3MZB A;  4XXU A;  3TTR A;  2AL4 A;  4ZDM A;  3FXR A;  5I2N B;  4AQ4 A;  2CEX A;  1B32 A;  2UVH A;  3RPL A;  4XTC Q;  2XXH A;  4N8G A;  3TPA A;  4F3S A;  1J1N A;  1IUD A;  3K1N A;  3T1B A;  1YAE A;  3IJO B;  1BLF A;  4JB7 A;  1MS7 A;  4F2O A;  1O7T A;  1NKX A;  3TMG A;  4JDF A;  3B50 A;  2R8T A;  5DYH A;  4LP2 B;  4GX4 A;  1YTV A;  1FSA A;  1MXU A;  3ZS6 A;  1JVY A;  1N76 A;  2O68 A;  1BP5 A;  3OEN A;  3C34 A;  2OWT A;  2D3I A;  3E9X A;  3M3F A;  4QHQ A;  2Q8J A;  1MQD A;  2DVZ A;  3MZ1 A;  1BTJ A;  4JVD A;  5KZT A;  1MM6 A;  1PBP A;  2FA7 A;  3IOU A;  3S9L C;  3ZSF A;  3ZKK A;  4HE1 A;  4E0X A;  1BK4 A;  4IB2 A;  1FPG A;  3VLW A;  5DTB A;  3U65 A;  5M2V A;  2IA4 A;  1DBZ A;  3I5O A;  4LZ7 A;  3MVZ A;  1AMF A;  1B9J A;  3MBP A;  3G3F A;  1B5I A;  1JEU A;  1A8E A;  4NGU A;  1SYI A;  2H25 A;  4ZEK A;  4NHB A;  3PUW E;  4LQ2 A;  4C1T A;  2QMW A;  4Q30 B;  4MF3 A;  1RDZ A;  2F7B A;  1GGG A;  4FED A;  5A5X B;  1VFE A;  3HPI A;  2PBW A;  2G93 A;  5AA2 B;  2RC7 A;  4KI0 E;  4EUO A;  2XWI A;  4QBA A;  2CEY A;  5TP9 A;  1FBG A;  3VVE A;  1FQE A;  1IMD A;  3IL1 B;  3EQ1 A;  3MUQ A;  2B4L A;  2WBD A;  1FBH A;  4EF2 A;  1B7Z A;  1US4 A;  2WBB A;  2VHA A;  1MY0 A;  3KC1 A;  4OFL A;  2UYE A;  3Q25 A;  3V5A A;  3RUM A;  3SZP A;  4GL0 A;  1II5 A;  2I0C A;  3MW0 A;  2I3V A;  1YZ0 A;  3PPN A;  4MJO A;  3V89 B;  1OLA A;  5EYH A;  1F9B A;  1B2H A;  2Q8M A;  4OQO A;  4PBQ A;  1P1O A;  3DM0 A;  5H8N A;  3MP1 A;  2Z8F A;  3I6V A;  2OZZ A;  4GL8 A;  4GWW A;  1I69 A;  2E0S A;  5I3S A;  5F7V A;  2H99 A;  2NOO A;  3M3L A;  4NF5 A; 
#chains in the Genus database with same CATH homology
 5ICQ A;  2VP1 A;  3H6T A;  3PMX A;  2UVI A;  5CRY A;  4H8I A;  1N04 A;  4F3G A;  2P0S A;  1D3K A;  4YMA A;  5B7D A;  4K3F A;  2ZYK A;  1B46 A;  4E0W A;  4PFW A;  3U8Q A;  1MY3 A;  2Z23 A;  2RIN A;  5EHS A;  2VOZ A;  3VDF A;  1SYH A;  4H8J A;  4EQB A;  4POW A;  1KWH A;  5I57 A;  4R2F A;  1ZMG A;  3ILU B;  4GFR A;  2Q2A A;  3IOW A;  4ESX A;  5JK4 A;  1LFG A;  2XXR A;  4IGT A;  1URG A;  2P1S A;  1RYX A;  1LAG E;  3EHT A;  4RK9 A;  1LCT A;  3RGY A;  3LR1 A;  5DEX A;  2OJT A;  4X48 A;  1CE2 A;  4IY6 A;  4R73 A;  5AA2 D;  5K2X A;  5ICT A;  4RPO A;  1MXX A;  3S2V A;  3KZG A;  4RK2 A;  3FD3 A;  3FV2 A;  1CB6 A;  3VE1 B;  2V93 A;  4XKQ A;  1A99 A;  1S50 A;  4LZ5 A;  1JW1 A;  4FEC A;  4TQU Q;  1OLC A;  3G3G A;  4KCC A;  3T9U A;  3S4U A;  3Q28 A;  1QW0 A;  3C33 A;  2YPN A;  4G68 A;  4GQO A;  1B3G A;  4OET A;  3RQT A;  2FYI A;  5I59 A;  4QFL A;  2V3U A;  4I1D A;  2F6G A;  1H43 A;  1Y3P A;  5AA4 A;  4ND9 A;  1ANF A;  3K00 A;  3H6W A;  5I2K A;  3CFX A;  3MPL A;  3VXC A;  1IIT A;  3USD A;  4OFJ A;  2XXI A;  1POT A;  2XX7 A;  2I4C A;  5I56 B;  2B65 A;  4F1U A;  4NF8 B;  3TFL A;  4YAH X;  2Q89 A;  2I48 A;  1SW4 A;  5KDT B;  2DSF A;  2ESN A;  3N6T A;  1M5B A;  3SDF A;  4NWC A;  2ABH A;  4M4G A;  3O9P A;  1JVX A;  4F3B A;  1GV8 A;  4PE5 B;  3KN8 A;  1ELJ A;  1Z7M E;  3G3K A;  3O6G A;  3SEU A;  3PV0 E;  1JEV A;  1OVT A;  1H44 A;  4F29 A;  1JNF A;  2PT1 A;  4QSE A;  3O29 A;  3UK4 A;  5JEI A;  4YKJ A;  2B3F A;  3TQW A;  3K02 A;  4KYS A;  1XT8 A;  5TPA B;  1Y1Z A;  5L9M A;  1LGB C;  3TYH A;  5CMC A;  1DTZ A;  2O51 A;  1AIV A;  4GXS B;  4KYE A;  3Q29 A;  3KEI A;  3MVX A;  2DE2 A;  3K1P A;  3QUJ A;  1Q1K A;  3K6W A;  3PPR A;  1IZ1 A;  4DE8 A;  1R9L A;  5CBS A;  3KN7 A;  1PEB A;  3FZV A;  4IO7 A;  2V3T A;  3C36 A;  3CG3 A;  2RC9 A;  1LBC A;  2I0B A;  1PDA A;  2XX8 A;  1B1H A;  3VVF A;  4JWY A;  1LLS A;  4BDR A;  1N84 A;  4R75 A;  1Y4C A;  4X9T A;  3C9H A;  4EQ9 A;  2GH9 A;  5CBR A;  3I3V A;  3M3K A;  5J1D A;  4F31 B;  4H65 A;  1ZKB A;  1VFD A;  3CFZ A;  3RT6 B;  2XXU A;  2RC8 A;  3LSL A;  1XVY A;  4FE8 A;  2Y7R A;  4JBZ A;  1IIW A;  3A3U A;  1UQW A;  5AA3 A;  4U23 A;  4ELQ A;  1UTB B;  3TTL A;  4DXC A;  4I9D A;  4KD5 A;  1BIY A;  3PUY E;  3K6V A;  5I84 A;  1WOD A;  3CG1 A;  1UTH A;  4GVO A;  3U72 A;  3MWB A;  4NMY A;  1B5J A;  1P1N A;  2I6E A;  1B7H A;  1I6Q A;  3AXF A;  3G3H A;  4LA9 A;  2F35 A;  5AE4 A;  1R6Z A;  2HAU A;  5ELV A;  3SEX A;  1A7L A;  3IO6 A;  1US5 A;  1N3X A;  3RTF B;  4PQJ A;  1FTO A;  1Y3Q A;  3K6X A;  2F78 A;  4P0I A;  3U93 A;  2HFB A;  1MDQ A;  3T9V A;  1EZP A;  4NF6 A;  4QFK A;  4DCY A;  4OER A;  3G3J A;  1NNP A;  1EU8 A;  3JV9 A;  5I2N A;  2I3W A;  1MQG A;  2Q2C A;  3SES A;  2AL5 A;  4QSC A;  1VR5 A;  4GOT A;  5I58 B;  5L9S A;  2D5W A;  3CSG A;  1TFA A;  1B0H A;  3PPP A;  1SDX A;  1LAH E;  4XKP A;  3GBB A;  1LB8 A;  1OQG A;  1USY E;  3OSR A;  4OES A;  1B4H A;  1IQ7 A;  1B3F A;  1NH8 A;  3HN0 A;  1MXW A;  3SER A;  3TCG A;  2HAV A;  1QUJ A;  3VLV A;  2B3B A;  1B6H A;  4QF9 A;  1S7Y A;  2ZYM A;  4X1D A;  4G8N A;  4BLA A;  1QUL A;  5CMK A;  1I6A A;  2IEE A;  5ITP A;  2NXO A;  1LAF E;  1ZU0 A;  4KR5 A;  4H67 A;  1A55 A;  1FTL A;  2A5T A;  1JET A;  1QKA A;  2ZMB A;  4XIG Q;  3MPK A;  2F36 A;  2I49 A;  5TP9 B;  5H8S A;  3LSW A;  2DXY A;  4Z7E A;  3FGS A;  2XXP A;  3T9H B;  3QAX A;  4U22 A;  3MZ9 A;  3CI8 A;  3CR9 A;  1FQD A;  5A5X A;  3FJ7 A;  1P1Q A;  1I6B A;  4YKK A;  4ZEC A;  1M5F A;  5DT6 A;  4DDD A;  1B7U A;  2ZNT A;  1QUI A;  2H98 A;  3F11 A;  2CMO A;  3GLB A;  4WED A;  4G2Z A;  1R1N A;  5B70 A;  4YB6 A;  4DCX A;  3OD7 A;  2XXX A;  4NF5 B;  5H8Q B;  3H03 A;  4FEB A;  3U92 A;  4I62 A;  3V83 A;  1QUK A;  2DS9 A;  5JTY B;  1Y1M A;  4PFT A;  3DP8 A;  4ELR A;  4QFO A;  1MXY A;  3ZKL A;  4EQ7 A;  3TCF A;  4F19 A;  2X26 A;  2OWS A;  3N26 A;  5ITO A;  3RLF E;  4Q8R A;  4JSO A;  1JQF A;  2ONK E;  4P11 A;  1A40 A;  1R9Q A;  2HZK A;  3BFT A;  3K1M A;  3HV1 A;  1TXF A;  1D4N A;  1WVJ A;  3H6V A;  3UIF A;  3OEL A;  1H45 A;  4IO4 A;  4LON B;  3QK6 A;  5H8H A;  4DZ1 A;  3G3I A;  4JXI A;  1MDP 1;  1SQY A;  3LC8 A;  2OBG A;  3K0V A;  1B40 A;  4R9F A;  5IKB A;  5DEX B;  2QS4 A;  2HZL A;  4OZ9 A;  3H06 B;  4NE4 A;  4C0R A;  4DLD A;  3TCH A;  2NVU B;  1FTJ A;  4F1Y A;  3O6I A;  3QXM A;  4H6D A;  1B1X A;  3CFL A;  4OMB A;  3FJM A;  3GBA A;  4IO3 A;  1EZ9 A;  4U1O A;  3PD9 A;  3KSJ A;  4IGR A;  4ZED A;  4YKP A;  3SET A;  4EXK A;  1VSO A;  2ONS A;  1HSE A;  3ODB A;  1MPB A;  4LAT A;  4MBP A;  3Q27 A;  4PFU A;  4R2B A;  1B3H A;  3D4G A;  1P99 A;  2UVG A;  2LAO A;  3VXB A;  1NNF A;  1FCK A;  1FW0 A;  2DQV A;  3TUS A;  3TDJ A;  4DXB A;  5I59 B;  3CVG A;  1QKB A;  1SW5 A;  4YMB A;  3VLU A;  3OO8 A;  5L8D A;  5KCJ A;  4EDP A;  5AA4 B;  1XOC A;  2G29 A;  3OSQ A;  2A5S A;  4GF8 A;  5I2K B;  4Q5T A;  4U2R A;  4OEN A;  5BWJ A;  3FVO A;  3JZJ A;  4GRK A;  4BDN A;  1H3D A;  1IXI A;  2HXW A;  2ZNU A;  3DP4 A;  4RA1 A;  1FTK A;  2R71 A;  4Q0C A;  1NNK A;  3S9N C;  3VVD A;  1EH3 A;  3IX1 A;  1ZLQ A;  2OCU A;  4BDQ A;  1ZIU A;  1SI0 A;  1B05 A;  4ZEB A;  3T66 A;  2VD2 A;  4YB5 A;  2RCB A;  3T22 A;  2GRV A;  3KN3 A;  4MLQ A;  1URS A;  5I56 A;  3SEW A;  5CM6 A;  4I8C A;  4NF8 A;  2GFE A;  1Y3N A;  4F22 A;  2HEU A;  4XKN A;  3CIJ A;  4U4S A;  2NWJ A;  4G8M A;  5FTI A;  1Q35 A;  2ALU A;  2V84 A;  1MPD A;  3PUV E;  4NF4 B;  3HCQ A;  3MP6 A;  2VGQ A;  3A3C A;  4DIG A;  3H7M A;  3TEL A;  2DXR A;  1AL3 A;  1SW1 A;  1MQH A;  1DSN A;  1OVB A;  4KQP A;  3UA8 A;  3QSL A;  4QFP A;  1RKM A;  2Z8E A;  1B51 A;  3O66 A;  3UGW A;  4GIZ A;  1MH4 A;  1LB9 A;  1UIV A;  2Q9T A;  3FAS A;  1QVS A;  4LQ5 A;  3N94 A;  4R6H A;  4AB6 A;  3B6T A;  3MVW A;  3OEM A;  2XHD A;  4H0W A;  3BFU A;  5EHM A;  3PMV A;  5TPA A;  4BDM A;  1MH3 A;  3OO9 A;  1S9T A;  1VE4 A;  2Z8D A;  1MQJ A;  1B5H A;  2AYS A;  3O6H A;  2F7C A;  1SW2 A;  1P1W A;  1WDN A;  4ESW A;  4QRZ A;  1MPC A;  3G7W A;  4GXA A;  5DVF A;  3MVY A;  1Z7N E;  2Y7P A;  4RJZ A;  5BUU A;  4RNS A;  3TTM A;  1Y4T A;  4MH5 A;  4EF1 A;  1NH7 A;  3L6H A;  5FTH A;  4ELP A;  3R6U A;  3E3K A;  1HSL A;  1UTH B;  4P0G A;  4ZE8 A;  3GXA A;  3PMW A;  1FQA A;  5TU0 A;  3ILT B;  1JW4 A;  1GTK A;  2YJP A;  1MY1 A;  1LAX A;  4QFN A;  2NUV A;  1MY2 A;  2O6A A;  1XVX A;  1HSJ A;  4JWX A;  3WAF A;  2XXV A;  2CZL A;  3H4Z A;  3LBS A;  4FIM A;  3W9V A;  5H8F A;  3IO4 A;  1FQF A;  1M5D A;  4NED A;  1UTB A;  1IXG A;  4KCD A;  4ONY A;  4PFY A;  1NMU A;  3TTK A;  4HTG A;  1PB8 A;  3S9M C;  4UA8 A;  3KFM A;  1B52 A;  4GLI A;  2DWH A;  4RYA A;  1L5T A;  4ECF A;  3IB2 A;  3W15 C;  4YIC A;  2X7P A;  2Y7K A;  1DPE A;  1POY 1;  4MLV A;  4H5G A;  3K01 A;  3QIM A;  3HST A;  4LUB A;  5K2Y A;  1ZTY A;  3KGC A;  3FVK A;  3VV5 A;  2BJJ X;  3IAZ A;  3E13 X;  1LCF A;  4U21 A;  2O7U A;  3A09 A;  3C35 A;  2R9J A;  3OO7 A;  3MQ9 A;  3UP9 A;  2REJ A;  5I58 A;  5ISU A;  2Q88 A;  4ISU A;  1O63 A;  3H6U A;  4L17 A;  2QS3 A;  2QSX A;  2QRY A;  3QUF A;  4H1X A;  3PGF A;  4OWD A;  4WXJ A;  4ELO A;  1NL5 A;  4UAC A;  1LFI A;  4R6K A;  2THI A;  3TTN A;  4HCY A;  4RXL A;  2A5T B;  4OYV A;  4GWO A;  4ZE9 A;  3B6Q A;  4ZS9 A;  3TEP A;  1AH5 A;  4KHZ E;  2REG A;  4C1U A;  2RCA A;  3EHU A;  1PB9 A;  3FVG A;  1Y20 A;  4HCW A;  4YU0 A;  4N13 A;  3N6U A;  3PPQ A;  3B7D A;  1AOV A;  1SI1 A;  3HHG A;  4KPT A;  1SVX B;  4RPN A;  2QS1 A;  3OEK A;  2FNC A;  4Z0I A;  4O3A A;  1RYO A;  1NNT A;  3K4U A;  5AA1 A;  1B3L A;  1Y9U A;  4IY5 A;  2Z22 A;  1UIU A;  5AA2 A;  2Y7I A;  2O7I A;  2OLB A;  4OFO A;  4OEU A;  3WAE A;  3SEY A;  1M5C A;  3RN8 A;  2QJE A;  3IK6 B;  1FQB A;  5H8N B;  3S9E A;  3OXN A;  3LUY A;  2XXQ A;  3IJX B;  2W7Y A;  2DYX A;  3IOV A;  3K2D A;  4HW8 A;  1N7X A;  3T93 B;  4WEP A;  1EZO A;  1YCJ A;  1MRP A;  2PMS A;  1ATG A;  3PU5 A;  3CRB A;  3RTW B;  3HO7 A;  5CMM A;  4MFI A;  4TOZ A;  2H9B A;  1GVC A;  4BDO A;  5DVI A;  4FAJ A;  3H3G A;  3TAJ A;  1M5E A;  3HHF A;  4FOR A;  1N3W A;  3O2A A;  4XKR A;  5DVJ A;  3DLN A;  2DE3 A;  5F1Q A;  5H8Q A;  4GD5 A;  4OEV A;  2V25 A;  4M1V A;  5I57 B;  1B58 A;  5JTY A;  2O1L A;  2F97 A;  5FHN A;  3FXQ A;  4U4X A;  2QL3 A;  4OVJ A;  5FHM A;  2XD2 A;  1N0T A;  4JWO A;  5H8H B;  1XS5 A;  2RF1 A;  4O3B A;  5L9O A;  5HBC A;  4NWD A;  4F2Q A;  4KFQ A;  1MG1 A;  3C31 A;  3TOD A;  2F8D A;  3T96 B;  3TKD A;  3O97 A;  3QYT A;  2H5Y A;  2F7A A;  1A8F A;  3IB1 A;  4THI A;  3MJN A;  1DPP A;  2D21 A;  4FAT A;  3FVN A;  3V8X B;  5LOM A;  2Y84 A;  4F18 A;  3E4R A;  2ONR A;  2H4I A;  3O28 A;  3MAM A;  2V3Q A;  4AB5 A;  2QMX A;  3B6W A;  1QJM A;  3FXU A;  4R74 A;  5IAI A;  1YPN A;  4POX A;  3DP6 A;  4ZEI A;  1TT1 A;  1URD A;  2I58 A;  4HS7 A;  3R26 A;  2DWI A;  2XXW A;  3K6U A;  2DVC A;  2F6P A;  4OXV A;  4QSD A;  3UOR A;  3KJT A;  1MXZ A;  1B4Z A;  4G68 B;  2AIX A;  1ZBM A;  4IO5 A;  3SEV A;  1OIB A;  3C32 A;  4IO2 A;  1DOT A;  1ZJL A;  5KCJ B;  1MM7 A;  1SD3 A;  4X1B A;  3EN3 A;  4G68 C;  1DTG A;  4F3P A;  1TWY A;  2DOJ A;  2DWJ A;  4PET A;  2P2A A;  2Y7W A;  1XC1 A;  4OTE A;  3JYR A;  1A54 A;  2YLN A;  4G8H A;  1D9Y A;  3ECR A;  2PVU A;  2ZYN A;  3N5L A;  1SBP A;  3MP8 A;  1B3E A;  4F1V A;  4FJP A;  2WKY A;  3IB0 A;  2UXA A;  3P7I A;  5CMB A;  2PT2 A;  4BDL A;  2UYF A;  1NFT A;  1LST A;  3T9X B;  2GHB A;  1FTM A;  1OQH A;  3TZA A;  2PX1 A;  4N6P A;  5CC2 A;  3OMB A;  4YKI A;  3SKP A;  2XXY A;  3KOT A;  3L6G A;  1P1U A;  3ONM A;  2RKM A;  3PUX E;  2ANJ A;  2R6G E;  3EF7 A;  4JSD A;  3IOT A;  1FQC A;  2HCA A;  3W9W A;  2I4B A;  2O1M A;  3U94 A;  3IR1 A;  4EXL A;  1B0L A;  1MQI A;  1H76 A;  4R6Y A;  5KDT A;  4LVQ A;  2ZNS A;  3PUZ E;  4ZZE A;  3FAT A;  3LSX A;  4IO6 A;  3KSX A;  1OMP A;  4O3C A;  1PC3 A;  1PB7 A;  1GR2 A;  2HQ0 A;  3LSF B;  1JW5 A;  3IOR A;  2F5X A;  4YZZ A;  4NTL A;  4NF4 A;  3RNN A;  4TLM B;  1BKA A;  4DXU A;  3RY3 A;  1O64 A;  3CSB A;  3KJ7 A;  4G77 A;  4U1Z A;  2GHA A;  1LBB A;  4H5F A;  2DWA A;  1IEJ A;  2UVJ A;  1USY H;  2DE4 A;  1XHY A;  4RY1 A;  3MC2 A;  4KYD A;  2XX9 A;  1LFH A;  2O84 X;  3D4C A;  3RPW A;  4TLL B;  3FJG A;  1MXV A;  2VD3 A;  4N07 A;  1PBQ A;  3DEL B;  4F39 A;  2PYY A;  2O69 A;  3TQL A;  3BBR A;  4PP0 A;  3OO6 A;  1T0K A;  3PD8 A;  1IXC A;  3KOS A;  3THI A;  4R9G A;  2XXT A;  3VFJ A;  3KG2 A;  1D9V A;  3BKI B;  5EYF A;  1MY4 A;  2F34 A;  3EHS A;  4ZEF A;  4R72 A;  4G4P A;  3M8U A;  2OK2 A;  3EPE A;  3Q26 A;  3C4M A;  3OOA A;  3R7X A;  2QPQ A;  2ZYO A;  4ZZA A;  2E1S A;  3U1O A;  4LZ8 A;  1DMB A;  2XD3 A;  2DP8 A;  3PPO A;  3KBR A;  3GZG A;  4OHN A;  3FUZ A;  4YB7 A;  4WKM A;  5H8F B;  5CI5 A;  2KLF A;  3FV1 A;  1N7W A;  5HM4 B;  3UN6 A;  5FHO A;  3FIR A;  2X7Q A;  5HPQ A;  4NF6 B;  2QS2 A;  3RT8 A;  1TFD A;  2M8C A;  1IXH A;  2ZXT A;  3MZB A;  4XXU A;  3TTR A;  2AL4 A;  4ZDM A;  3FXR A;  5I2N B;  4AQ4 A;  1B32 A;  2UVH A;  4XTC Q;  2XXH A;  3TPA A;  4F3S A;  1J1N A;  1IUD A;  3K1N A;  1YAE A;  3IJO B;  1BLF A;  4JB7 A;  1MS7 A;  4F2O A;  1O7T A;  1NKX A;  3TMG A;  4JDF A;  5DYH A;  4LP2 B;  1YTV A;  1MXU A;  3ZS6 A;  1JVY A;  1N76 A;  2O68 A;  1BP5 A;  3OEN A;  3C34 A;  2OWT A;  2D3I A;  3E9X A;  3M3F A;  4QHQ A;  2Q8J A;  1MQD A;  2DVZ A;  3MZ1 A;  1BTJ A;  5KZT A;  1MM6 A;  1PBP A;  2FA7 A;  3IOU A;  3S9L C;  3ZSF A;  3ZKK A;  4E0X A;  4IB2 A;  3VLW A;  5DTB A;  5M2V A;  2IA4 A;  3I5O A;  4LZ7 A;  3MVZ A;  1AMF A;  1B9J A;  3MBP A;  3G3F A;  1B5I A;  1JEU A;  1A8E A;  1SYI A;  2H25 A;  4ZEK A;  3PUW E;  4LQ2 A;  4C1T A;  2QMW A;  4Q30 B;  4MF3 A;  2F7B A;  1GGG A;  4FED A;  5A5X B;  1VFE A;  2PBW A;  3HPI A;  2G93 A;  5AA2 B;  2RC7 A;  4KI0 E;  4EUO A;  5TP9 A;  3VVE A;  1FQE A;  3IL1 B;  3EQ1 A;  3MUQ A;  4EF2 A;  1B7Z A;  1US4 A;  2VHA A;  1MY0 A;  4OFL A;  2UYE A;  3Q25 A;  3V5A A;  3RUM A;  4GL0 A;  1II5 A;  2I0C A;  3MW0 A;  2I3V A;  3PPN A;  3V89 B;  1OLA A;  1F9B A;  1B2H A;  4OQO A;  1P1O A;  3DM0 A;  5H8N A;  3MP1 A;  2Z8F A;  3I6V A;  2OZZ A;  4GL8 A;  1I69 A;  2E0S A;  5F7V A;  2H99 A;  2NOO A;  3M3L A;  4NF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...