2HF7A

Transition state analogue of apha class b acid phosphatase/phosphotransferase (aluminium fluoride complex)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
211
structure length
211
Chain Sequence
SPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAGRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQWLQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The First Structure of a Bacterial Class B Acid Phosphatase Reveals Further Structural Heterogeneity Among Phosphatases of Haloacid Deahalogenase Fold
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Class B acid phosphatase
total genus 80
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hf7A00
4Y2TA 5AM0A 3E58A 1K1EA 1L7NA 2PR7A 2ZBGA 4OCZA 5ALEA 2R8EA 1U2TA 4DFDA 4DW8A 4J2TA 2B82A 5AM1A 4IG4A 1Z4PX 1TJ5A 4UATA 5AVRA 2B1RA 3EF0A 1RDFA 1RKQA 4QJBA 1Z4KA 3FM9A 3MN1A 3OCYA 3R09A 1YDFA 1Z5GA 5AW2A 2YJ4A 3A1CA 2ZXEA 4B6JA 5AI5A 1Y8AA 2JAWA 3I1YA 3DV9A 3L1VA 2WF5A 2ZOSA 2MSNA 4AS2A 2B30A 4OFZA 3B8EA 4L57A 3W5BA 2P27A 4C4RA 5AW1A 2G1AA 5AKGA 1NRWA 3N8GA 3ZUPA 2FPWA 5AKXA 3VAYA 4NAVA 5AVWA 3P96A 1Z4NA 2IOFK 4F71A 3AR7A 3BWVA 3S6JA 1JUDA 1WZCA 5AKEA 4YH1A 5A3SA 2HI0A 3AR4A 5AW5A 5ALSA 3AR6A 2I55A 4CNQA 3N07A 3SHQA 3ZW7A 5AW6A 1WR8A 5IS2A 2PKEA 3QU2A 2YN4A 5ALJA 3ZX4A 1WPGA 1LTQA 2G0AA 4OHFA 3MC1A 5E0OA 5ALGA 3ZX5A 1Z5UA 1VJ5A 2WF9A 3FPSA 4AS3A 3OCZA 4MWOA 3A1DA 5AVTA 2I34A 2QYHA 4RESA 1J8DA 5JJBA 4Y2XA 2RAVA 4JB3A 3KD3A 5AHXA 1CR6A 4UW9A 1U7OA 2AMYA 4CE6A 2OYCA 3EF1A 1YNSA 3KOOA 4C4TA 3IB6A 4YCLA 5AI4A 1Q91A 3SKYA 4UAVA 3RF6A 3DAOA 4BYGA 4HAIA 1AQ6A 3AR5A 2BY4A 4YCMA 1U2SA 4Y2VA 2OA0A 4CF3A 4FE3A 2GHQA 4BBJA 5ALHA 2Q5EA 1ZD2P 2NO4A 3L7YA 2HOQA 4YCNA 3I76A 4HGPA 3WGUA 2CFTA 1ZRNA 2C8KA 2HEGA 1XP5A 2D2VA 4J03A 5AESA 2EATA 4YIKA 2GHTA 3OPXA 2ZBFA 4KNVA 3PDWA 3WK5A 4BX0A 2G08A 2HF7A 3KZXA 3QYPA 4JDPA 1RC8A 2RBKA 3PGVA 4DWOA 3W5DA 4H1WA 3D6JA 2WF8A 1SU4A 3ZU6A 5ALFA 3ZVNA 1YV9A 2FEAA 4ZEVA 3NUQA 5ALDA 4KX5A 3A3YA 3L0BA 1F5SA 4KNWA 3SF0A 3ZVLA 4YGYA 2I7DA 2OBBA 4KN8A 2AGVA 3KBBA 2YY6A 3SLRA 5ALUA 5AI0A 1VFPA 2ZBEA 4C4SA 3A1EA 2G06A 1KYTA 1QQ7A 4UASA 4UMDA 5A3QA 4BEVA 3M9LA 4HYTA 5ALPA 3TLMA 3ESQA 2C8LA 2YFYA 5AIBA 2I54A 3QU5A 4XOUA 3NASA 5AVQA 4EZEA 4O8CA 3NRJA 4EEKA 3QUCA 5FP0A 1Z4LA 5ALTA 3UM9A 1L7MA 1RPZA 2P9JA 3EPRA 4UMEA 2FPXA 3E81A 3L5KA 2FPUA 3RFUA 4CF5A 1YMQA 3ESRA 3ZWDA 3U7GA 2JAOA 1ZD3A 3L0YA 1RQNA 2HHLA 3ZWKA 2P69A 1TJ4A 5AK3A 3U26A 5ALRA 3BA6A 2JGAA 2RARA 3NANA 4UMVA 1ZD4A 3ZTYA 2I33A 1RMTA 5AI9A 1X42A 4I9FA 2Q4TA 2ODAA 3NAMA 3AR9A 3QU9A 1QH9A 2WM8A 1QYIA 2CFSA 3NIWA 3OTQA 4FYPA 1Z4IA 3QLEA 4Y2JA 1S8OA 5ALKA 4MUMA 3B9RA 5AW0A 2YJ3A 1FEZA 2FUCA 2DQSA 1L8LA 1T9ZA 1EK2A 1MH9A 3OCXA 5IT0A 3DNPA 3NALA 1U02A 3IJ5A 3F9RA 3L0CA 4IFTA 5IT4A 2O2XA 5AVVA 2QLTA 3PGLA 2W4MA 3WK9A 2YMLA 1U7PA 3ONNA 4Y2SA 2FPSA 4QQFA 1QQ5A 3AR2A 5ALVA 5ALIA 2HCFA 3L8EA 3WKAA 5AVUA 3CNHA 4BEWA 3UMBA 5AM2A 4BX2A 2B8JA 4EENA 4DCCA 3KDPA 4PNHA 5ALOA 4F72A 1RLMA 3I28A 4EELA 4NFLA 2PQ0A 2AUTA 3L8FA 3SMVA 3UMCA 1L8OA 2R8YA 3ET4A 2X4DA 1RMQA 3L1UA 1T5SA 1RRCA 1PW5A 3QXGA 1TE2A 3M1YA 1ZS9A 1YS9A 3U7FB 2CN1A 5AM4A 1ZOLA 2FI1A 3ZVMA 1L6RA 3MPOA 3AR8A 5AKIA 4BKMA 3WKCA 1QQ6A 2HDOA 5ALQA 4UM5A 5AW9A 3R9KA 3OCVA 2G09A 1RLOA 3OCUA 4UMFA 1O03A 2O9JA 1Z4QA 4HGQA 4RETA 5AKZA 5AKLA 2YJ6A 5AICA 3U19A 4UU1A 3QU7A 4FFDA 4BNDA 1Z4JA 2IOHA 1LVHA 2HF2A 3N1UA 3QGMA 1XVIA 2Q4RA 4CF4A 2RB5A 1Z88A 2YBDA 3QX7A 1NNLA 3WK6A 5AVXA 3W5CA 2B0CA 3U7EB 5AW7A 4I9GA 1ZD5A 4NV0A 3W5AA 5AM5A 3ZTWA 2YMPA 2GFHA 5AK4A 2WFAA 4HGNA 4Y2PA 3EWIA 4E88A 5T41A 5AKYA 1RLTA 3N5KA 2ZBDA 2C4NA 3FPBA 4Y3UA 2HO4A 2EAUA 4OD0A 5ALZA 2GO7A 2OM6A 1YJ5A 3KC2A 5ALWA 3ED5A 3IRUA 3MMZA 4GXTA 2GMWA 3HLTA 3WK8A 2IOFA 4BX3A 2FDRA 4NWIA 5AVSA 5AM3A 1Z4OA 2C9MA 4Y2UA 3ZI4A 3L8HA 1ZJJA 2I6XA 2YJ5A 3N28A 3B9BA 4UAUA 2BDEA 2HSZA 4GIBA 5ALYA 1RMYA 4EX7A 3E8MA 4UU0A 5AW8A 3PCTA 3R4CA 2G07A 4AP9A 1WVIA 5A3RA 2WF7A 2W43A 5AKJA 2FPRA 2YMMA 1Q92A 4UARA 2G80A 2JARA 1NF2A 3GYGA 3QU4A 3WK4A 4Y2YA 4EX6A 4KX3A 5AKHA 1RKUA 2B1QA 4L6AA 2P11A 3OCWA 5AW4A 2NO5A 4UM7A 5AVZA 4KYTA 5AK5A 3QUTA 3U13A 5ALNA 5AW3A 2R8ZA 2BDUA 2JAUA 3L8GA 5ALXA 1T5TA 1EK1A 5AKKA 1CQZA 3AR3A 1SWVA 4YIHA 1L7PA 1L7OA 2YMQA 3SD7A 1RKVA 2B8EA 1Z4MA 3U7HB 3UMGA 2CFRA 3I6BA 1IWOA 4Y2RA 5AI8A 4XE5A 2ZG6A 2C88A 4BNDB 2R8XA 2HX1A 3E84A 4G63A 4XPZA 5AIAA 1RQLA 3ET5A 2WHEA 4NABA 2IA5A 1ZRMA 1VJRA 2EARA 4HGRA 4XQ0A 1SWWA 3QNMA 1N8NA 2WF6A 5ALLA 5AK6A 3WKEA 5AVYA 3J7TA 3QUQA 2AH5A 1XPJA 3DDHA 2NYVA 4ZEXA 2FUEA 1J97A 2VKQA 3CZ4A 4G9BA 4L6CA 3WGVA 3WK7A 3FVVA 3FGOA 3HYCA 5ALMA 3WKDA 2IYEA 4Y2QA 4HGOA 2W11A 3FZQA 1TJ3A 2MU1A 3WKBA 3K1ZA 1N9KA 1S2OA 5AI6A 1TA0A 3QUBA 3SKXA 4ZEWA 1O08A
chains in the Genus database with same CATH superfamily
4KVGA 1CULC 1OILA 2PGLA 3NX4A 1L7NA 3SNKA 4CR7A 2WD7A 1Q17A 5LLDA 2B69A 4UCXA 4HFJA 1G0OA 2UZAA 3IOEA 5LWHA 2VSFA 3PPWA 2WE7A 2ZPUA 2A58A 2GTHA 2ZZNA 1OFVA 3OIVA 2QZZA 4PHCA 3DT8A 4DM7A 4LF9B 2G1KA 4IV5A 4P0PB 1MUUA 3H19A 1CLUA 2GF9A 2IH4A 4ZMBA 1GV1A 2YN2A 4Z5XA 3RAFC 3AUJB 3VJLA 1XIVA 1L8QA 3H2SA 2YQ4A 2BTQB 3CZAA 4DDWA 1MAAA 1OR8A 2A86A 2YWRA 3CH7A 3M33A 1OD6A 2N75A 3KVRA 1ZCFA 4XGRA 1J0DA 2K2QB 1SKBA 3PWTA 5LP6F 3ZZ0A 2R84A 3I2GA 3EZNA 4I50F 3QVUA 1VCIA 4I55B 2YXDA 4TTJA 4ENQA 1LDEA 1FDRA 2E4UA 3R0ZA 1LLQA 4FMDB 5DN9A 4MEBA 5A5VA 2RAUA 2PXAA 4B6JA 4ZI7B 3KV3O 2HQBA 5EIBD 2JH9A 3IXMA 2DKNA 3MXTA 4R0NA 5ESWA 3V1MA 4D9CA 2OCYC 1RAEA 5DLDA 5FFFA 2WSBA 3RVJA 3F49S 2PWPA 2QTCA 1PYDA 1I2AA 1O95A 5FJIA 4D92A 1B6GA 2P3OA 2J5KA 3BGIA 5HCIA 3UCFA 3WIOA 5JYEA 3V4RA 3PHBE 1ZCBA 1C3OA 1VSTA 5JE8A 3IJRA 1UC4B 3COWA 2FFHA 1XZPA 1H8HD 3HO6A 5D7BA 3PLRA 4M53A 1BIFA 4FFWA 2ABWA 2BHNA 4BLQA 3O83A 3TIGA 5HZGA 2WTEA 4OH7A 4XDHA 6REQA 3K9HA 1UR5A 4O59O 2FOIA 2P0EA 2PBFA 4ZK2A 1AUXA 2OFWA 3K4HA 1EVJA 2FPKA 2IEBA 4HNQA 1I7DA 3OBBA 1OMOA 2LV8A 2NWQA 1RYBA 1YDGA 3V1LA 1OZFA 3IQGX 4KTVE 1T5DX 3UAYA 4A8JB 3RJZA 3GZJA 2P8SA 5KOYA 2PN1A 3FDIA 2NP6A 1X0XA 3ZCPA 1VECA 2NSHA 4Z3DA 2YINC 5F5LA 3FOAA 9GPBA 4NCBA 3U7IA 5BORA 1V37A 2IITA 4LK2A 2BWJA 2J5XA 3A06A 2JGEA 3JS5A 4DCOA 1NVVQ 2F8TA 2I8CA 3O7WA 3WYAA 2BBWA 3WWYA 3D2BA 5F35A 4A82A 4EPRA 5ALGA 5E9QA 4WZBA 3RO7A 4F3NA 4W4TA 5GY7A 5FULA 2H6EA 2OHIA 1GR0A 1ZUWA 4J0GA 3CEHA 5C8DA 4GBED 4M8KA 2XKJE 1XYYA 4X1IA 3TI7A 1CZNA 2ZULA 3BXFA 1FLVA 4CQMD 2FSPA 4Y2XA 4A9AA 2ISSD 1M2HA 2FJUA 3B1YA 2PL9A 3KK0A 1YR3A 4RX1A 4BNLA 3OEHD 1GG8A 4JLNA 2WKWA 2ZSEA 4JMPA 4NMWA 4B74A 3HU5A 4EB0A 3TSCA 3U1VA 2HEIA 1JEYA 1UKAA 2HF9A 3BF8A 5L7YA 4YDHB 2Q21A 4KRXA 4NZYA 5IN5A 5I7EA 3GC6A 4G24A 1Q91A 1TECE 5LQRA 1MP0A 3F5QA 1UXJA 1KSHA 1LLDA 1ZIPA 2DUNA 1VBNA 3AR5A 1MORA 3ILSA 4J6EA 1U2SA 3B1FA 1SQGA 2R11A 3MYRA 3H0CA 1FA9A 3KQTA 5M7EA 5T4HA 1HE2A 1ZJ4A 2FVYA 4OLAA 3H13A 2F3PA 3D4LA 3PGJA 2ZT5A 1Z33A 1P1JA 3K96A 4NESA 2DBYA 5KX5F 3VTAA 3L41A 1A3CA 3WFIA 2GN8A 4FXOA 3HMKA 4JGIA 4YBRA 1RWPA 3PXDA 3Q8WA 3SDSA 4PLVA 1JLHA 4QOFA 1VHTA 2AC7A 3CR3C 4W9MC 3CT4A 1ELOA 3IALA 4U3JA 2EIXA 2FWNA 3JQCA 3AI7A 4B3DA 4MWEA 4QL3A 1Q16A 5FNVB 2XMBA 3X2EA 4Y1FA 3D6MA 5GJBA 2A9QA 2XKBA 2R86A 3LOPA 2B2CA 4ABYA 4DMLA 3ZLUA 1UBCA 2R66A 2GD2A 4XUGB 2UAGA 3DAYA 2CLLB 4Q12A 4RLHA 4JYAB 2Z56A 2YASA 4P3PA 3G85A 2CXSA 5HILA 3HCEA 2GZ3A 3BHIA 3DL2A 3PGVA 4R2JA 1ILEA 1TVKB 4BFVA 3Q98A 3OZCA 1A5BB 3DLIA 4YP9A 3MEQA 4G25A 2V65A 3KQVA 4TMVA 2OP0A 3GJ6A 1LQTA 2RHTA 1NQ5A 4LYGA 3VH1A 1KIFA 3OUUA 4RAOA 3RE1A 3W3AD 3W78A 5DCLA 2C5AA 1BN6A 3GU3A 5EP3A 5IAEA 1C0KA 2B7LA 2XA9A 3WNCA 3ZCRA 2BYTA 2XSZD 1HEUA 1KYXA 2IEDA 2MYPA 2QUIA 4JQCA 3ABRB 4DN6A 5CAEA 4KUGA 2WQ7A 1QPBA 3GUUA 1FX0B 1HH4A 1QLJA 3LT4A 1W6RA 3KB8A 1M5TA 1BVUA 2ZBEA 3JAMA 3GLIB 1NQOA 3JD0A 1FDIA 5A4MS 1U2ZA 1CR0A 4HMQA 5EN4A 1GZVA 1XDUA 3QHQA 3THSA 1BX3A 3R6LA 4QBFA 2ZYGA 4UASA 2BC9A 3GMSA 1IJBA 1DFHA 2NZ2A 3MFQA 3TOCA 2P9CA 4DHEA 1HETA 1EVEA 2FP4B 3DE7X 1QHXA 3E9NA 4JLUA 3TSZA 3ZHOA 1SPBS 1XFDA 2BW0A 4RC9A 1UMBA 3AKDA 1BOOA 4HDRA 5HW0A 1HDZA 4RABA 2WPDD 3QSGA 2M6RA 4TKVB 4GOXA 3GJQA 1Z0FA 3DXYA 4ZOBA 5ILOA 4FQ7A 4JC0A 5DNAA 4HQLA 3TAXA 4KQ2A 4MKFA 2F48A 4QICA 4YCCA 5CCXA 4A0FA 3K9QO 2CNBA 2H1WA 3PUHA 3UM9A 2MMCA 4OLBA 1IWPB 1NJGA 2ERCA 4B5LA 4LECA 4UMEA 3U09A 5IM4A 1YULA 1SURA 3KVVA 3ROXA 1BROA 1QAMA 3INRA 2FHPA 1G8AA 4JSRA 3LHKA 3CNQS 1GU0A 1QANA 5AOVA 2OMKA 2JH8A 2WUWE 4NJEA 5IVKA 3ZLJA 3PXUA 2CSXA 1RC0A 3FF1A 1DS6A 2Q5IA 4RJKA 5HDQA 3VH4A 2R2GA 2VDWA 4OB6A 4ZHQA 4LF6B 1AMNA 3UXYA 1F8GA 3IUNA 1GG5A 5AYVA 1F2TB 1GYQA 3ZW9A 1RAFA 3KFVA 4X9XA 5K3SA 5EZQA 1R18A 4OQZA 3AVTA 1LUAA 4M1ZA 5EKUA 1QIKA 3PYLA 4DCSA 5KPJA 3B52X 2AQ8A 3UV6A 2PWBA 1DWUA 1SXJC 2QX7A 3HJNA 4PZPA 1OPXA 2B37A 7YASA 4OGGA 3RREA 2O0MA 3CH4B 2O2IA 1QGDA 2B98A 4QYXA 4RHCA 4ZOLB 1C0LA 2Q28A 2VSQA 4QARA 5MF6A 2C5EA 1Q7GA 4OYHA 2F00A 4EKYA 5LKRA 2UZ4A 4AQYB 2FDCA 4EHFA 3QU9A 2H1OA 3QPBA 4IH4A 2JL1A 4CIWA 5JXWA 1I24A 3KOMA 4UEKA 4QXAA 4A6DA 3GUHA 1QYIA 1WV0A 1AB5A 4UBIA 3AUYA 3LKBA 5CDSA 1BGVA 2ZT7A 4G1EB 4MQUA 4Z1OA 5M3BA 4FT4A 1AGNA 4MV4A 5TLSA 4MUMA 4FZJA 1XRMA 4MP8A 3WP0A 3D5EA 4MWCA 2BLNA 3RSGA 2A84A 3FVQA 2IYSA 4XX0A 4XWTA 4JHXA 1L8LA 1V5IA 2EC5A 2AVDA 3STUA 3AUTA 1A9PA 2WJHA 5F21A 4WLNA 1G21B 2E6UX 3TW8A 2AXPA 1F8UA 2MSKA 3KOUA 2IEZA 1P0PA 2H52A 1JVSA 4K87A 1IZZA 3G0DA 4PLFA 1E6LA 3FROA 1HGXA 2VP3A 4RNCA 1CQPA 3O2JA 1KFKB 1Y37A 3BWMA 3QVKA 1SBZA 4JB8A 4TMWA 5AVJA 4F3TA 4R1OA 1V16A 1BX0A 4IDHA 5EG5A 1OOEA 1VMDA 4WY2A 1LH0A 4HPJB 4YY3B 2Y76A 3ID6C 5C0OE 1NBHA 1T34A 3B2EA 3L18A 1BYIA 4KJXA 2WW8A 4X93A 1ZIYA 3FMFA 5AJYA 4P9NA 4ZVLA 2R60A 4MQEA 4F1KA 2BD0A 1Q2XA 4EL0A 3GJ0A 4B9AA 4ER3A 4FSDA 5G4KB 3RHTA 4ROSA 3NKVA 2QLJA 4NFLA 4TKUA 3GVHA 1ZIOA 2E4AA 1XAJA 3AXTA 2R6DA 1SVLA 1L8OA 2JJMA 2VA8A 2Z8YA 4YUZA 3KXLA 4F8YA 3AUXA 4NE7A 2PIDA 4AJ1A 1DRWA 2Y1DA 3TTYA 4I4LA 4P5DA 2X41A 2YKGA 2A9KA 4I6JA 1SUEA 5DK6A 5AM4A 4JJZA 2DULA 3WMEA 4C14A 4WHMA 2FMFA 4JP1A 1D0IA 5FJJA 1GNRA 3TNFA 3WLLA 2Q5LA 1KYQA 3F6EX 3RUAA 1ZH2A 2UZIR 4EG4A 5DIZA 2IPOA 1PR0A 3PZBA 4UBKA 1IPEA 3K8QA 2D0OB 1NNI1 3IULA 4EHIA 4DZRA 2HCRA 4GD3Q 5KNDD 3AUUA 3R9KA 1SHKA 4OKIA 3H4VA 1I51A 4MAMA 3ZJTA 5LP1A 5EGSA 1X77A 4EDFA 1ODIA 5IG2A 4OBBA 1ZAKA 2GTIA 2PSSA 3ABQB 2QZPA 2R1TA 3EMVA 5GM2A 5K0ZA 1H5QA 2FPIB 2GAIA 4CUZA 1ZM4A 1ZM7A 3JRNA 3ZQKA 1XCMA 4OO3A 2WMNB 4AN1A 3EEOA 2CJYA 3HFGA 4KTTE 3KDAA 3OZTA 3PSAA 1NSTA 2IXFA 1N7JA 2P67A 3AIMA 3OQJA 4FX2A 3TLYA 5J2UA 1O5IA 1UPAA 3A2MA 3VXKA 2PCLA 2QE7A 1WU7A 3JQAA 5FUXA 3H65A 1XWFA 2GYVA 1OBVA 4JI0B 2OKCA 5K0BA 2IF2A 3BDVA 3PNYA 5AK4A 1UPXA 4MTLA 3K2EA 5F76A 1IBKB 3OMXA 1WP4A 4PZCA 1EHIA 4HDAA 3EYWA 3RIEA 5A1JA 3IOCA 3CZRA 1UWLA 2X14A 3D0RA 3OWHA 3DGEC 4GGMX 2KJQA 1Z37A 2WKSA 4IIJF 4M0EA 3H87A 5IM5A 1WUJS 5ILQA 4OD0A 1N34B 1EXDA 3H2JA 1E1LA 2OECA 3AF6A 5F7XA 4J94A 3U49A 3WDSA 1VG1A 1TQ8A 1X7ZB 2VJDA 2JGNA 3EIWA 4NU0A 4HJRA 1W4BA 2A5DA 4RXUA 4TKVA 2PUAA 3RC7A 2WG0A 2C5FA 1ZWKA 4ARZA 3A58B 3I2JA 4U6QA 5LYJA 3GGPA 4QTTB 1E6EA 4FYMA 3SSMA 3RIYA 1NUSA 2VRNA 2XWBF 4XFDA 3RU7A 2CL7X 5KYNA 5AJTA 1YKSA 4FUQA 5JJIA 4GIBA 4BO2A 4DLRA 2P2NA 1FDVA 2BHRA 3PDIA 4Q3BA 1EKXA 4F93B 3WWZA 3ESXA 3NT4A 3ZCQA 5LDDC 3FSEA 2ZDHA 2I6FA 3DXZA 3FVRA 3KR0A 4HY3A 3OX2A 4MR8A 4ACAA 2X8LA 3MWDA 4S0ZA 4KGZA 4J43A 4RQTA 3ROKA 1PZXA 3ORSA 1D6NA 3ZK9A 3LCUA 2ZYUX 1HDCA 2C5BA 5H5JA 5REQB 2C58A 3NZEA 3W04A 4D5GA 3CUSA 4DPLA 1E3MA 5IKOA 3TKLA 4YBZA 2YVLA 4IIDA 4UQPA 3IMFA 1GFZA 2IYWA 1KDRA 3I39X 1W9MA 1NF2A 3BXGA 1TMKA 1I3OA 5BN4B 5JJCA 1TTHA 4OYYA 4W9NC 2F7SA 2Q99A 4PONA 1SC9A 4LBVA 3FOWA 5DW0A 1Z39A 5I7UA 2AW3A 2PDAA 3OMWA 2JA1A 3F7NA 2J3MA 2ZYHA 1KA9H 4FFLA 4NNJA 3HM9A 2AN5A 4BXOB 3RHSA 5A06A 5GGXA 1LWNA 3UJ7A 3EQ2A 3Q0TA 1RM3A 2YWEA 4MW0A 3WJ7A 3R3ZA 4X8LA 5IEJA 5IMBA 1B8PA 2DM6A 4QDJA 4YIHA 4LE2A 5FBZA 2YMQA 5DBHX 4B7UA 3M83A 5DNVA 3DMFA 4JU8A 4FMPA 3VBCA 2GA9A 2YV1A 4QPCA 3UMGA 1V8ZA 1G5FA 1O6GA 1P80A 2DECA 4LYJA 4Y6QA 3QI7A 4QWWA 3K9FC 2CNNA 1P0IA 2PLWA 4PG8A 3DE6X 1B93A 1EX6A 4FBGA 4NKRA 1Z2PX 3RASA 5DYWA 1UJMA 3C1TA 2YICA 4PYLA 2DH6A 3IDQA 4B2YA 4MR9B 3LLUA 2O19A 1UINA 2X40A 2IZZA 2H29A 3MLAA 1G8SA 4U9UA 1CERA 3ZBPA 2UXDB 3C74A 3KWJA 1XPJA 3LZDA 5HF5A 1KZHA 1EESA 2JCXA 2P6MA 3JQQA 3JQBA 1W2GA 3ZDXB 3P0RA 1J21A 1KTIA 5B64A 1MVOA 1ONPA 2AI2A 3VJKA 3R3SA 2QU8A 5JWOA 1TYZA 3DVRX 3PC8C 2BMJA 2FLWA 4K6KA 2FWPA 4UNNA 5DO9A 2VP9A 1BDHA 3NTQA 2GVDC 3CC8A 1YJXA 3VUFA 2GCEA 3F47A 1WE2A 5FUBA 4UUPA 1DXQA 3PDCA 3H84A 3MWFA 1F2VA 4DLVA 1PNVA 5TSDA 4J0KA 1NQWA 1E9DA 5JSQA 3PENA 4QX6A 2AHRA 4Y2TA 4R1TA 4YRTA 5EWJA 2AFHB 1V8BA 2V7UA 5AMXA 4PN3A 3SIRA 2Z3WA 3BTSA 2GVNA 2QZJA 2ZS7A 3PT9A 4BFYA 2ZT6A 3O94A 2PYIA 5G4LA 2VBIA 1R0BA 3BK7A 3L7OA 4GI3A 5KTKA 4AYWA 4DFDA 3JALA 4DW8A 4RJIA 1AMUA 2B82A 4TL9A 1TM7E 4BB0A 2WBLC 3PE3A 3O2NA 3ZWXA 2H8KA 2JC3A 4OGKA 5B58T 4AMVA 2WNSA 5KJ6A 3H99A 1J5XA 4UATA 3V2UA 2C4HA 5BY2A 4ZVOA 2HMYB 1OC4A 2B1RA 2QTWB 2XUFA 4GKJB 2JKYA 1UXKA 3H75A 2Y0DA 4K9RA 4CDMA 2VPQA 4LZNA 4ZO8A 2BMFA 3FM9A 4LNUA 5DYNA 5FORA 1E6WA 3TIIA 4UM9B 3OY7A 3TR0A 4E5YA 4RV5A 1QIGA 4Y67A 4LOJA 2XZLA 1UUFA 1XNGA 5HOEA 4X41A 4D79A 4A26A 5EUCA 1LBEA 3VNSA 2XRFA 3QKSB 4G4SP 4I4CA 1SOAA 4ZVQA 4EKNB 3Q1KA 1I1OA 3PJGA 4PN7A 2O8FA 1GN8A 4CT4B 2PV0A 5KYGA 1M2EA 3PHHA 3TLCA 3ZU2A 3GBSA 2P2ZA 4PLCA 3EGDA 3JQAB 2XODA 4ZICA 4W5NA 3MWEA 4W6QA 2ZU6A 2I4IA 1NPDA 5M5BA 2QQFA 1DBPA 4X0EA 4KBYA 1OBHA 4OQLA 1IB0A 1HY3A 1OLUA 1M0WA 2G1AA 2ILVA 5IC6A 1EEXB 3DMRA 1VDZA 3CKYA 1CCWA 3IOMA 4RYDA 4C6TA 4GMDA 2GO1A 3ZUPA 4DMCA 1SIWA 5FI1B 1Q1AA 1CFJA 4TT3D 2QVXX 3E35A 4F3CA 2X8WA 4P3KA 3QVWA 1S1CA 1U3GA 2CVPA 4XTRA 4WZAA 4ZYLA 2X0DA 1ZGCA 1NX6A 3O1HB 1CV2A 3QE3A 2J6HA 5CXSA 3EFEA 1MD9A 2GN4A 2NYUA 3HKBA 1NVAA 3K0HA 4HVAA 4QAJA 2GZSA 3MF4A 1SK9A 1I3CA 5F77A 1XLTC 3LOQA 1MHTA 4INAA 4AL4A 1VJ0A 3VJMA 4PX2A 4C4XA 1HOXA 4V0OA 3UWSA 1O8CA 4UTNA 5KNDA 1SO8A 2OC9A 3G8DA 3FPFA 1R88A 1HTTA 4JNKA 3HCOA 1ZCAA 4WBNA 5DCWA 1SELA 1XTVA 2F43B 4P6VF 2RKOA 1OPRA 5EQTA 4EAQA 2Q45A 4EW2A 2FSVC 4KSBA 4AS3A 4C88A 3GRPA 1P29A 2PEZA 2HTEA 2ONJA 1XMOB 3BHNA 3QX3A 4RESA 3TLXA 5EZ6B 4W5WA 5HOQA 3MJ4A 1IHXA 4MUGA 1L9XA 4L8FA 3IELA 1W49A 2A3RA 4JYBA 4OXIA 1R4ZA 2E4YA 3EW7A 5SZKB 2RHBA 4RMGA 4WLFA 1MO4A 2QG4A 3T7KA 4YCLA 1LI7A 1XDSA 3FSGA 4MH0R 1WLSA 2ZVDA 3QY9A 1KJZA 4LVUA 4UAVA 4GPEA 5EEHA 2PUVA 2CNOA 1WHTA 3QE9Y 2VZ9A 2PRSA 4HAIA 3O9VA 1Y1SA 3R7LA 4WKCA 3G6WA 4YT4A 1EE2A 4HQNA 2A0KA 1M6NA 2PD3A 5LP6B 3MJCA 3TIVA 3ZDZB 2WMDA 2Z5GA 1MEJA 4KR6A 1O9GA 1Z0DA 3IQWA 4I55F 3KR2A 4MWBA 5FB3A 3OM1A 3FDZA 3KJXA 4G4GA 1I9CA 2OLJA 1ISMA 4ZOLA 1QX4A 2HOQA 3CHYA 2I1WA 4MQFB 4C0SA 3BWBA 1HUQA 1HSOA 1MR3F 4KE8A 4HAYA 2CDBA 4RGBA 5CVEA 3RVKA 4AY6A 4IDGA 3ZUGA 4CN9A 1TCUA 2VYFA 1TCCA 3I05A 4BQNA 1BXRB 2AF4C 2D2VA 4N49A 2DPYA 5JNTA 1Z6YA 2QPTA 1K5DA 2WHRA 4GYKA 4YIKA 1GDDA 1SBHA 3AVVA 5L4LA 2QRVB 2Q6OA 2RGXA 2OHXA 4Z4CA 1KFJB 2VT2A 3VC3A 4OX9B 3JRWA 5KYXB 4NHEA 1EFCA 3PG5A 1Y8ZA 2XUKA 2DLCX 4G5YA 3W5DA 1MZPA 2GRUA 5DTEA 3Q2OA 1UOQA 5CCEA 2DFVA 2W58A 2FY8A 4G01B 3ETLA 4E2XA 5KHOC 5FFNA 4F2GA 2AJLI 2HXYA 1P2SA 1ZN7A 2FZVA 3EUWA 3K0KA 2ZAGA 3K8ZA 4RMNA 5IVDA 3WGOA 4AJOA 2H7VA 4FC6A 4PCVA 1BKDR 3RFXA 5E4TA 3WIUA 4CMIB 1XPUA 1RZRA 3ASVA 3IBSA 4FEEA 3D1VA 5KYUB 2P9YA 2PJUA 3QQ5A 3R6GA 4J3JA 1M2OA 1QNFA 1FFDA 1Y5NA 1T0PA 1R0SA 1II8B 2IVFA 2P68A 4MGIR 4WI1A 4D3ZA 1IIRA 3WICA 1JTEA 4L07A 5F2OA 3WBFA 1UKBA 1JKFA 1XI2A 2ZZKA 4WBNF 4JLPA 4ZKEA 3FNHA 4MHSA 3DKPA 2Z9CA 4ZVSA 5EXTA 5CA0A 4IIGA 5FOUA 4L2IB 3W1EA 5HG0A 3MUOA 1IJEA 3CS3A 2PX5A 3KKMA 4L22A 4G26A 4D4MA 4M1EA 1JJBA 3MRTA 4DSUA 5HSGA 4DA4A 3B1XA 4LJ4A 5ALPA 1D8AA 1RXUA 3UT5B 3UV3A 3W8EA 2QRLA 3MHTA 1GL9B 3HI6A 2OZLA 4AIRA 2GPBA 3WLTA 1FMLA 1XDWA 1C8KA 3DR3A 4I1UA 2CF5A 2GWRA 4I08A 2XOEA 3GDHA 2EG5A 3SE7A 3E23A 2HDNB 3PR1A 3MIIA 3LXMA 3LQ4A 4FIDA 3ZG6A 5KMGB 1HLFA 5DZSA 3VDRA 2RGGA 1L7EA 4XYMA 5DLQC 2YFHA 1AF7A 4EI9A 3E81A 2QKYA 4LRWA 4CF5A 1NT2A 3TEMA 2DHRA 2FFBA 5TGTA 1DQSA 1DV2A 1U3DA 1LK5A 3CRRA 3PNOA 2AUMA 5JC8A 3DO8A 1A8UA 3IQEA 3NM4A 3W34A 1PGJA 1IMOA 4AJJA 1R0LA 3IEIA 4X1IB 3V3KA 3RS0A 3M5PA 1HF3A 3CONA 3RYIA 1XZIA 1YFLA 5J1SB 3I5UA 1C7RA 3FTCA 3HVUA 4CMGA 4G5GA 2A30A 3SJUA 1GAJA 2GPWA 1HZJA 2ZYDA 4PEVA 5DBEX 4IBOA 3DVAB 1ECPA 1H6BA 4MMXB 1VIVA 3WNZA 4RV4A 3W5SA 2I99A 4GBJA 3RUDA 2O8CA 3OU7A 1NXQA 1R0YA 2PUHA 2ZCJA 1U1CA 2N46A 3VNRA 2NVOA 2QENA 4QD3A 5HIKA 2R68A 3ABZA 4RORA 3QVJA 2HQOA 3NP7A 1GQOA 4TMKA 1GFIA 2D8MA 2ODAA 3AR9A 1U63A 1GNLA 2QTTA 3E9RA 4S24A 1O8BA 1QHYA 2V3WA 5AT1A 1EZ1A 3TGPA 4X5OA 1QCCA 2BUCA 2A9JA 4A23A 3TRDA 4DA0A 1ZFNA 3EODA 3A9SA 3KSAC 4BCBA 3WS7A 5JNVA 1DKLA 4ZFNA 2RGUA 3A9CA 5CLFA 2J67A 2VT7A 4YYEA 4B47A 1GV0A 3KSUA 3OZSA 1ZGHA 5IP5A 3RKSA 4A1FA 4BN4A 4H16A 5GV7A 2IWRA 3G5TA 3SSAA 1G20E 5A04A 5I7FA 1D04A 1UEXC 2Z3ZA 2OFXA 3HKDA 2QSJA 4N41A 1VBKA 1K66A 4J4BA 2GPTA 5DCUA 1M72A 5DN6D 3L0CA 2PNJA 3UUGA 3BGDA 2AOXA 2UYCA 4BASA 3IPLA 5DXJA 4EB3A 4RZ3A 3PGLA 4JBLA 5BSKA 5DI3B 3ZGOA 3ZNPA 1IATA 4EOGA 4EITA 3NHMA 4JB0A 2EERA 4AZ3B 1BNCA 3LTEA 3SM9A 1XJWA 4ETIA 1W9HA 1UEJA 2X1MA 3PDIB 4TM8A 1D1SA 3C3JA 4FNAA 3WQQA 5ALIA 5ENDA 3T0GA 2J87A 3L8EA 1AUVA 1U8UA 2F3RA 4PBTA 4QPNA 3PF8A 4ZVTA 1IY1A 2GZMA 5F1OA 2C7GA 5IUNC 1ZINA 1R4MB 1XYGA 1EEHA 1NF3A 4N3GA 1EFRA 1K8QA 5AQEA 4ZT3A 4YAUA 3UKJA 4WKGA 3P94A 3RJ9A 4ARZB 1A71A 1A95A 4Q4AB 1L5QA 1B0ZA 1PL6A 3CX8A 4GPD1 4Q3NA 1UOOA 4B6SA 1TF7A 2GK3A 5FOTA 4TT3A 4X1YA 3ZE1B 4K9NA 3VR6H 2A5GA 2W2LA 3SXUB 5DULA 3B48A 2JFOA 1V9SA 1ZOOA 3LQYA 2E4WA 3KPVA 3I5AA 3DOOA 5SYAA 3ZV4A 4V2UA 4BC1A 3EOBI 5KTTA 1DUIA 1ZOLA 2C9DA 1XKXA 4HNAA 1R37A 1ML3A 3ZVMA 1NUPA 5AKIA 4ZAVA 1L7RA 1U8FO 4FFSA 4BKMA 5A71A 2HDOA 1GCAA 4AJHA 4BV2A 3RSLA 4S1VA 5FOWA 3HDYA 5REQA 4WCFA 1IZ9A 4TV8F 1XMPA 5JXIA 4UPEA 5F9FA 4NFHA 1BFDA 3GCDA 4OSPA 2LWIA 1M0EA 2P5SA 3TGWA 3O9ZA 4KPGA 1G41A 2H1SA 4CCYA 1R2QA 3HBLA 1VIMA 3R23A 4BU0A 4M4SA 4Z8YA 5E7QA 1S2IA 4EP1A 5C7IO 2R0QC 1Q12A 3GWGA 2YJNA 3GZNA 3ZGXA 4C78A 1G5QA 1YASA 4K6FA 2IIPA 1SUDA 2JAHA 2JGJA 3ZYCA 3RYHA 4BDTA 5BYJA 4XUDA 1RE0A 4AB1A 4LQLA 4BMYA 5MN5A 1Z88A 2V3VA 2BR4A 5BV1A 3H4IA 1DX9A 1QBGA 2RONA 3OJEA 1SCKA 2W70A 2EP8A 2QDXA 1B2RA 2ZYRA 1ZI6A 3OOJA 4NSNA 2VDJA 2WD7B 4NK4A 1JX6A 2QB5A 3C1UA 1L7BA 4O1MA 2VHJA 1E3WB 3T5GA 4RXMA 4RY8A 4AO7A 3LUAA 1XFAA 5FV7A 4YP5A 3B3GA 4EA7A 3AVPA 3GLTA 4CODB 3M9WA 3R9XA 2HV8A 5T57A 1BMQA 1CZRA 2NT4A 2WUFA 2VWQA 3BXOA 4KXVA 2IX9A 3DAPA 1MX5A 4AS1A 3B20A 7MHTA 2V58A 1KI6A 2GXUA 4WA8A 4FKMA 3WAJA 2FMTA 2IOFA 2AJ8A 4PLZA 3KAKA 1DARA 3A25A 3FG9A 3OJCA 3UO8B 4C7MA 5EHZA 2EFJA 1P0MA 1YZHA 1ZJ6A 1XRJA 2GCNA 2ZAYA 3BEOA 3MD0A 3QV1A 4ZQHA 1J2JA 4MSUA 4Q21A 4C1NA 2ZRFA 3OLVA 4PR0A 4RENA 4FUTA 3U4DA 2WP8J 3BIJA 4NBKA 2F1HA 1FXSA 2B9EA 1IY8A 1MX9A 1NXSA 3EIQA 1XZBA 3DOCA 2NUTA 4E14A 1H1TA 1NV8A 1S7GA 2GEKA 4QQRA 4MINA 3O8OA 3AUAA 5I7WA 1WCIA 2IS6A 4KYUA 2F8MA 1RZRD 1OAKA 3FNGA 3FWHA 1KI8A 1U8YA 4TV9A 2QN2A 2ZSIA 4G6ZA 1FXWA 1N2CB 1QF7A 3VMFA 1MH1A 3IDOA 2KHZA 3W6ZA 4X8MA 4AXBA 4JFRA 4EBFA 4AP6A 4MI6A 2PY6A 3QW4B 4B32A 5CCBA 4I8XA 6AT1A 2FU5C 3IDZA 3H9QA 3KVYA 4D6XA 3KEQA 4IIHA 1PGOA 2RH9B 3TCNA 3L0SA 4RDXA 3Q8KA 4IHAA 3I73A 3I5XA 3PQ8A 3BTUA 3ZJ5A 1XP8A 1I1QB 4F0JA 5A5GA 1OWOA 1QU3A 5INTA 3H3JA 4E5NA 1YQDA 3HCWA 3NJ4A 3NC1C 5AK5A 1U31A 1Q0SA 2CV0A 2H7YA 3CJTA 3QWHA 1EK1A 2A3NA 3GEIA 3B3QA 4EF5A 4UTRA 3JD2A 4ENUA 4TT8A 3Q8LA 4IQFA 4F1WA 2QXUA 1NVWQ 3CSDA 2Y8EA 2HLHA 2WM3A 1QVRA 1QXSA 1MKYA 3SPXA 3WLEA 4MCAA 1A4UA 1K7FB 2PH5A 3PFHA 4TOIA 4PAMA 4FD3A 2E1RA 3UFXB 1U0LA 1BYUA 1GT6A 3C4VA 2LZ0A 2WDZA 2QN6A 4O25A 3ZWAA 4C20A 3KQPA 3FJYA 1DNPA 3DFFA 3RI3A 2JNWA 1M5RA 2WF6A 1QZXA 2FETA 2RCNA 5B6IA 4G2TA 4JYPA 2VJCA 4MIKA 1AGYA 3WLSA 5GJCA 3DTNA 1J97A 1GQFA 5BYKA 2OZVA 3FHJA 3A4MA 1Z6XA 3V8MA 4G0VA 1RJEA 1VKOA 3AL0C 1XTKA 4YECA 2YWDA 4RD2A 3UJ6A 7MDHA 2IYZA 2EX4A 5ALMA 3E3NA 4A8TA 4NH0A 1Z8NA 3M4ZA 3UUFA 4KEAA 1DLJA 3W9UA 4FXPA 4KFTA 2O57A 2ZK7A 3N6XA 1WO8A 3IAXA 4BVHA 3O3OB 3DAHA 1CY8A 2KI5A 1ADJA 4LYHA 4WLOA 4HX5A 5LCXA 2G3YA 4Y6LA 2NO0A 3F5DA 4LDZA 4IKEA 1BHSA 2CJFA 2GF0A 2HADA 2Q2NA 3R09A 1Y6RA 3G5LA 4M9RA 5IKEA 3ZCVA 1XTUA 4LC0A 1P9NA 4DOMA 2ZBGA 1PQYA 3OQ1A 5KWEA 2O54A 1EFKA 1MBZA 3UB2A 3OZRA 5JJLA 1FS6A 3X2SA 4QTYA 1BFKA 1V5WA 1ZC3A 1S3GA 3HY4A 3PKZA 5LLSA 3PR2B 2OV3A 1G20B 5CB4A 2FWBA 2EQBA 1RSZA 1J99A 2AWOA 2DQZA 2GLUA 2RJ3A 4IG4A 4OHOA 3IHLA 3BKXA 2VL7A 1GZ4A 1C2YA 1NVDA 4N3BA 3KTAA 3L7LA 2RHDA 1F5NA 5H80A 4G86A 3UY4A 1YZUA 2GD6A 4LRXA 2NVUA 1KVRA 4QJBA 4KXQA 3OF5A 4YJFA 1OFUA 2R79A 4URUR 1LB1B 3RG2A 2J0VA 5H8WA 3UHAA 3NCHA 4Q34A 3SN6A 2YJ4A 3O73A 3C7DB 4OTZA 2C84A 4ZO4A 4KXYA 1K7CA 1YK0A 2GPYA 3K2BA 4J0JA 5AI5A 3TD2A 3EWSA 3WMXA 1HE4A 4L9SA 4YV7A 3OTIA 1KEPA 2PXCA 2QJRA 1BHQ1 3GEGA 4HTAA 1CYDA 4X61A 2B4YA 5FR2A 4TN5A 2O5EA 1W75A 1L5WA 4RQUA 5G1PA 1NC3A 4GS5A 1T0IA 4MGHA 2Q1UA 1PV2A 4TS9A 2ZUFA 1ZP6A 3W6PA 2ORWA 2OBLA 1SIOA 1FQJA 3LM8A 4ESEA 1FY2A 1KMMA 2FEPA 2VZ8A 6ADHA 4G89A 3HB1A 4CQMB 3TQIA 3VOAA 2HD4A 1Z13A 2DBQA 1YL7A 3Q0IA 1NW5A 3RIMA 4ER0A 1L5GB 1IOVA 2WKQA 4I19A 4BMPB 4BMZA 3CPHA 4NAVA 3D4OA 1GSIA 1DBQA 1Z4NA 3MT8A 4Z0NA 3R7SA 3ZCXA 4ED9A 3I52A 5JBIA 2WILA 4P4GA 4E07A 3BFVA 1W29A 4M22A 1NYLA 5I9BA 1P9OA 4F96A 3PJEA 1GO2A 4HAVA 5KEIA 4G0ZA 4V2IA 3IBYA 1DCKA 2I55A 4FCTA 3I01M 4TTSA 4DJJA 1IRXA 1YC2A 3QVXA 2Y4OA 4XYEA 4DRXB 4J6FA 4Y6PA 1XALA 5F3RA 1HQCA 2YN4A 1G7RA 4MV7A 1DAKA 3UW1A 1WHSB 1LTQA 2BOVA 4KFSA 2DSNA 1Q1GA 2BMDA 4KDFA 1DO8A 2PRIA 4FWTA 3A0UA 4GMKA 4C4YA 1QFJA 1T2UA 2BFDB 3JTMA 3DEKA 5A05A 3VR4D 4NOLA 2X15A 4M0CA 2R47A 1Y48E 2WVJA 3LKVA 3ISTA 3N8NA 5THQA 1C3EA 1TVKA 2C2ZA 1IXRC 3CEAA 1O1YA 4XQGA 4CN8A 5JXHA 2ODTX 2I34A 2QYHA 3S2EA 1FF9A 2VZ0A 3ZNQA 2ZWIA 1MC8A 4QQKA 1GKKA 3B13B 4AY2A 4PCLA 1XVVA 4P08A 1U7OA 1XVLA 3H1AA 3MCTA 1E4VA 3RC9A 1D1PA 4KI7A 4C4TA 4AQ7A 1ONOA 3ADOA 5JAOA 5FNVA 3LNTA 5EWLA 3B2NA 2BFBA 3HO8A 1K7YA 4O4IA 2V7XA 4IOLA 1KDPA 4YMHA 3QEBZ 2J0SA 2R1UA 4O4LB 3RF6A 4M55A 3N86A 5TJ9A 1ULSA 4D3DA 1SG6A 2F6RA 1COWA 3DFZA 3LOUA 1TKRA 4A2QA 4UE6A 1Z6GA 2NZVG 3H16A 3HB4X 4O4JA 3J80A 3QVVA 1LPBB 2DR0A 2GHQA 1CEYA 4WESB 2Q3LA 4WZ6A 1L5VA 3KM0A 3AETA 2PGNA 2P3LA 2QD2A 2ZR9A 3D81A 1F9AA 1Y1PA 3L1KA 3MOIA 4QEKA 4HDOB 1G3IA 1MAVA 2JJ8A 3FCEA 2ACKA 3EVEA 5K3EA 4HXGA 4D9EA 4PHGA 4DCTA 2DBRA 4URXR 4G4JA 2F67A 2DR2A 1KNXA 4OA5A 3V1NA 4B75A 5JV5A 1V1MA 2C8KA 1DAFA 5JCZA 1CEXA 4X7MA 1J4AA 1CUDA 4WECA 4RBNA 4W1RA 5ECYA 4DTIA 1YT5A 3UVEA 4C0XA 4FOPA 1NBAA 1OT5A 4DDTA 1NMZA 3QLUC 2AOUB 4RTJA 2CMFA 2G08A 3GRYA 3OP4A 1WXQA 1XLTA 3PI7A 2RH5A 3AY6A 1NXTA 3KL2A 4ND2A 2IQIA 1FTWA 3D6JA 4GG1A 2EP7A 5J2TF 1W0KD 2A7QA 2I76A 3UH0A 3ZVNA 4LV8B 2ZQYA 4Y1GA 3W8DA 1Q7EA 4LGVA 1WY7A 3G2HA 2QQ0A 1D9ZA 1Y4UA 1VLJA 1PGQA 2KLHA 1ZA2A 2I7DA 4G5HA 5G0UA 4BGUA 5D85A 1QDUA 2X6RA 3U4AA 3DL0A 4DMFA 5AH0A 3M1AA 2GVZC 4OGLA 1MZVA 4LSMA 1ZL0A 9LDBA 1IRIA 3TI9A 4C4SA 5FWYA 1TI7A 1TKAA 5CEEA 3C6XA 3OAAD 3L7DA 4G07A 5KHLB 3KETA 5HXAA 4CM6A 3PC3A 3AM4A 2AQHA 1FFAA 4L6IA 2IHKA 4XDZA 2QVLA 1B8OA 3KKOA 4Y7DA 2X1LA 3HSSA 4W1PA 3PFKA 2GK4A 1U4SA 2V3CC 2VYQA 4IEIA 3TN7A 2HT1A 4PO3X 4U7FA 2WP0A 1BN7A 4G0QA 4INPA 5ECDA 2P5UA 1XV5A 2Q6VA 4HYTA 3SFTA 2ZRJA 1EFVB 2ZQ5A 3NDRA 3G17A 1FMJA 1QP8A 3K5HA 1NOIA 1N3IA 1EFPA 3T35A 3Q0EA 4PS1A 3OFSA 1MA0A 2PH1A 4J2HA 1NV9A 1L7MA 4BLTA 5CHYA 1R4AA 2R65A 3ROPA 2V6IA 4NEQA 4ZO6A 4BTEA 4HNVA 3TJRA 1FJGB 1DO2A 5JPIA 3B1KA 2O6HA 4OQXA 2QTNA 3EGCA 3GR6A 2GF2A 4L5JA 1RKXA 2D1SA 3AFGA 4R68A 4G8JA 2EXXA 5WRFA 4P53A 3THXB 1Y82A 3MG9A 1M2VB 3AWIA 1NPYA 3EDMA 3JRXA 4V39A 4Y8VA 5D3KA 3WWOA 4CL8A 4DUZB 3DVLA 1I3LA 4HDQB 1CUJA 4I4TF 1KFCB 3WV5A 5C37A 1XQ9A 3JQGA 4IRUB 4ESVA 3V8RA 1MOZA 1RQNA 3QWAA 4W7SA 1SVKA 4CM1A 1CUSA 4CW7A 1PQUA 4DLWA 3E1KA 5CLGA 1XZQA 5FTKA 2O8EA 3STWA 3L0IB 5FOQA 1ND5A 1UBFA 3L4EA 3BQMB 4KL8S 1VE1A 1HXHA 5EINA 3SJCA 5A0TA 1JLKA 5TS2A 4OATA 2ZT8A 4JQYA 1BQEA 3D7LA 3VO2A 3UT0A 2WICA 1ZJWA 3H2GA 5H16A 3RANA 1VXOA 4D25A 3VO1A 1JEOA 2XCRB 2QLMA 4IM7A 3ZWNA 3FWNA 4QFMA 5EP2A 2OXIA 5FUQA 3RR2A 1WZUA 3AFHA 3NW9A 2FF7A 1JLRA 5A2GA 3K0BA 1ZGAA 3V33A 1SEPA 4DV2B 2WSLA 3V4FA 4PYJA 1GGMA 5L3SB 3D4NA 3E3LA 2FW6A 4F45A 3NP9A 4CEIB 3C0KA 3VJRA 1PX0A 4Q7LA 2BDTA 2KYRA 3OURA 4Q6WA 2I8LA 2W71A 3QLEA 1IHPA 4FYXA 5LPNA 1SB9A 3GFSA 3CBGA 2EEPA 4YT5A 2W8BB 3DPUA 2GEBA 2KBEA 3P9QA 3GLFA 3PI6A 3C7AA 1CW2B 2WKRA 4I1YA 5KYYA 2VPWA 1L3CA 3NBYC 3JQEA 1AZSC 1VM6A 2D3TA 2J5RA 1UODA 3B5EA 2PZJA 3BJRA 3HYNA 2CYCA 3NO4A 5JNSA 3GD7A 2LCIA 1JIQA 4ZMSA 1U99A 2XZDA 5CEFA 4HDSB 2VUUA 5JDIA 1J9ZA 4PQGA 2ZS9A 3LL7A 2QVCA 5E1DA 4YO7A 5G1NA 3WDLA 1SKAA 3P2IA 1EUDB 2CCJA 1KVSA 4DUYB 3P9SA 1PV1A 1ND6A 3PA8A 4GW3A 4J9VA 1HDRA 4EG8A 5AVVA 1QPGA 4GI5A 1KZ6A 1U7PA 2JCYA 3BFJA 3NH6A 1JG3A 2X8JB 1I4TD 1O95D 3SYKA 1T10A 2REOA 3EH2A 4NCJA 5AOBA 4RLQA 1XA3A 5F7OA 2F17A 6NULA 3UK1A 4D8VA 2IPMA 1X87A 3NR2A 3W2FA 5A9SA 3L4JA 2CXOA 1SXHA 3DQPA 4I1PA 3FF4A 3FUXA 4G5SA 3OUZA 4K9MA 1ICIA 2XUOA 4NF2A 3IKTA 5T67A 2VBGA 4FI3C 4UEJA 2X4DA 1K98A 3DV0A 2C4VA 4CKEB 1PW5A 3GL9A 5C1OA 2NUAB 2O07A 3NTRA 5CLQA 2VPXA 1JR3A 1JHVA 2WHPB 1ZW6A 3U31A 1H42A 3GNSA 2JD1A 4DSZA 1Y1RA 4V0SA 5KTNA 4J76A 4UHCA 2WHYA 4Z86A 4C9BA 4NHOA 2RB4A 5KTPA 1UKEA 1V11A 4I99A 4GM1A 3ELBA 2V6GA 1HFKA 3UPDA 1AURA 3WYEA 2B1JA 2VI5A 3IE2A 4M87A 4E1BA 5CVDA 3NVDA 1TPYA 1W44A 2I2AA 2UXBB 1S6YA 3IVCA 4YPVA 5FPYA 1UQUA 3PJRA 1A5TA 1OLXA 2CLHB 3MS2A 1LY1A 3O4JA 3PEEA 4IGEA 1PGPA 2W2KB 5BW8A 5J2TA 3C1OA 3H1BA 3BXHA 4BL5A 3FMOB 3ZGZA 1JU4A 3RVOA 4DSOA 2I3GA 4IDNA 3RS3A 4A3SA 4DLKA 4NICA 5A5DA 1AO0A 3BD9A 3S5UA 2Z43A 2O0LA 3OEHA 4O2RA 5TV2A 3T3NA 5K3AA 4E5SA 4FINA 5F3WB 5G3YA 4JIMA 1KDVA 3SBEA 2CK3D 2A5LA 2HU7A 2PVSA 2XQGA 5CT4A 4MVJA 3T5BA 1YL5A 3W9BA 3ZWQA 4HSGA 4GEKA 2ZUTA 5KNDH 2I7VA 4AZTA 1VXRA 1ZXXA 1FRVA 3ZTWA 3PV0A 2JB9A 1HQDA 1XMSA 5H4HA 4TTVA 3E82A 1EVKA 1X1RA 1W5SA 2BGUA 2I4MA 3VVLA 3AILA 4E7OA 3HCPA 5BO5A 2PUWA 3PICA 4HDMA 4KBFA 1H85A 1GPNA 2A6PA 1WBJB 4K26A 4N3CA 3TLEA 5ANRB 3VDNB 1ZGGA 3TJMA 1X15A 2V74B 2YOHA 3DOIA 3O8CA 1GQRA 3A8TA 4MP6A 1CUHA 4Z7OB 4CCWA 3HEMA 4MV9A 2CL5A 5BUQA 4GXTA 1ECBA 4ZU3A 2ZWVA 3BULA 1YZKA 3QLVA 3O8NA 2FDRA 4R71A 2FUKA 2N42A 2V9ZA 4YRIA 5HX7A 4UCWA 5TB5A 3L8MA 1GZ7A 2C9MA 2WLSA 2FQ1A 3JD1A 3RYCA 4GL2A 2E18A 2K6GA 3DYIA 3DZDA 2ZJ4A 3FYUB 1GXSB 2I1VB 2BAGA 4H7HA 1IIBA 5FX2A 3FYTA 2BDEA 2F9MA 3OJWA 3OZUA 4QOJA 4GZ6A 2XQIA 2OZLB 2WSYB 3CWQA 4GGOA 1GLGA 1ZR2A 5HK8A 2XMPA 4C2TA 1U8XX 4OAPA 4BZZA 5KSOA 1YZVA 1N77A 1BTOA 2XYHA 4LI0A 1DO0A 3IVRA 4CU5A 4HX2A 2DLNA 4DSAA 1SUIA 1GFWA 2IKQA 5CYPA 5BXYA 2O4UX 2GM4A 1QORA 3WGYA 2PTHA 2ZRNA 3RDPA 2VP5A 2O59A 4QHSA 1G17A 2M2IA 4DV1B 2ZJBA 3RK1A 1DFIA 3AUKA 1ZZGA 4JD5A 3RUPA 4EFMA 4NCIA 4PLTA 5GVSA 1OFGA 2F4NA 1HM5A 2QAGC 1FFXA 2Y9PB 4KX3A 3WFJA 4EUSA 1RW4A 2GBCA 2OAGA 2WDPA 3L6BA 5DHAA 3IUSA 2P9FA 1SXPA 5AJXA 1M9NA 3OCWA 2BH9A 1G8PA 2R8RA 4HDSA 2JBAA 2B3TA 4TZ0A 2I2XB 4EPWA 2FE1A 3KELA 3RJTA 3SR0A 3K9GA 4FDMA 4MYHA 2XRZA 4GLJA 4Q9IA 4GLFA 3JYQA 2QN3A 1JQLB 1PJ3A 4MYTA 1J8YF 4E5UA 5AFSA 5JANA 4PLYA 5K5EA 1DFGA 1QU2A 3QZUA 1AVTA 3H2IA 1DTEA 1YSCA 4C7OA 4YWHA 1YVRA 3CUEF 1XXHE 3FY4A 3P8ZA 1HI9A 3HYRA 3P0IA 3U3ZA 4ALKA 1SC3A 4PSDA 2HWUA 2YHAA 1P5FA 1JNYA 3K31A 4W1QA 2QTHA 3GLVA 3SDBA 3SJBA 4E03A 3HJGA 2LCQA 2EIHA 2R8XA 2PRZA 4YQYA 5C3UA 3UJHA 5TF0A 4A91A 4CEJB 1T3HA 5K45A 1U0EA 1YDEA 1NE7A 3SC2A 4XJXA 5B5SA 3VNUA 4XQ0A 4GNRA 3OPQA 3M6LA 4ZCLA 1PDOA 2B4QA 1DIAA 2YRFA 3UOGA 2QMQA 1N8NA 5HE9A 1D3AA 5IUKC 4TKUB 5LMZA 2PKWA 2AH5A 3QUQA 4KSCA 1HA3A 1WQ3A 3L7IA 1C30B 2X8JA 4BZQA 4QPJC 5G0VA 1YFKA 2A9RA 4EUNA 8LDHA 5JZOA 3EZ2A 1R50A 2CVOA 3T3GA 4BVEA 4C4OA 1SIUA 3A70A 3NEYA 1JMKC 3FVVA 5JH7A 5FTJA 3G2KA 2PS9A 2VWPA 1IM2A 4TVBA 5C35A 1P7WA 4AM8A 2VG8A 3TQSA 3I61A 4TXNA 3BVPA 1OU0A 5AD1A 3OLCX 5C5EA 1UH5A 4P0TA 3SS8A 3EQ8A 1N9KA 4M99A 1SC6A 4QU0A 4C06A 2PQ2A 4P4SA 1T5HX 2HBYA 5JHHB 4ISBA 2O23A 4TKZA 4ACBA 3KKZA 2QM3A 1YOBA 1HDOA 1K1EA 2GEUA 2BV3A 2RK4A 4P3NA 4UXHA 1P1IA 1UPCA 4LJ9A 3W1VA 1QQTA 2DUUA 3G8YA 4I3FA 4O3FA 4YJ2B 5H9VA 521PA 2O7RA 4BRWA 4DDVA 3HB7A 5KWVA 4K9OA 2BL4A 1SCDA 3INGA 3WA7A 3AEYA 4NOMA 4B0OA 3ADBA 2WR8A 3RVRA 3OESA 2WY2D 4KRFA 5FR1A 4NL4H 4PLHA 3W77A 1Z74A 4D9MA 4ZI3A 4QPPA 4EGSA 3L4BC 3VKGA 1KAOA 1Q74A 2AOTA 4ITRC 4DDUA 3VSCA 3O21A 1N33B 4V0ME 1ULUA 13PKA 1VJ1A 1W30A 4N48A 4GRAA 3EFBA 2PL5A 3O38A 5LQUA 1NBWB 4IXWA 1Z5GA 3R3WA 3HBJA 3A6EA 4I1RA 3MZ0A 2HLDD 2ZXEA 4LX8A 1U0HC 5DVZA 4F4CA 5I47A 3GPLA 3P9ZA 4W82A 1TIPA 3D0OA 4J91A 5B2FA 3TZEA 2SNIE 4FJ1A 3RK0A 1PQ4A 5EMJA 5EESA 2H1LA 3FW1A 4HEA1 2NUPB 2WF5A 1L4LA 5EE1A 5LNK1 2PWAA 4OEHA 4AS2A 3RBAA 1CJCA 3ONFA 4PC3A 4QU5A 3RIGA 1E6MA 3IVMA 1SCQA 2B99A 4L57A 1NU6A 3GUZA 3LUHA 5BP7A 2HYIC 3H1TA 1YCDA 5ERYA 3IP1A 5JS6A 2QN7A 1VP9A 1KEZA 1H1LB 3BMOA 3IR6A 3I04M 3CKMA 2HGZA 4CCAA 1YBFA 4NAUA 2QYSA 1ID1A 2EKLA 1WXDA 3OJFA 4HZUA 4K7JA 4B7ZA 3HCBA 3NTUA 5C31A 5LQKA 2ZRCA 3S1AA 3WB2A 1FTGA 2W6ID 2EX1A 2WYHA 3BWVA 5FOSA 1WZCA 1N2GA 3HRKA 2AOTB 3V97A 3BD8A 1LLFA 3A9RA 3AJ8A 3E7XA 4R05A 4YH1A 4BKQA 4M0KA 1WTAA 4ZV4A 4BPBA 2L42A 3TZLA 3A4VA 1JBKA 2GAFA 5A6SB 3NBAA 3NWEA 4DCVA 2NTYC 1WZEA 1XDGA 2IUSA 2R4QA 3R3XA 3AKZA 2BFFB 1TAHA 4Y98A 2XCTB 3U9TA 5JCXA 4N39A 3WNQA 1KGSA 2PH3A 3UBTA 4IGIA 3BWXA 5K4HA 4NOKA 1EP3B 4GLOA 1P75A 1EX1A 1R9JA 4LS3A 4OHFA 2JVIA 3N2ZB 4FCWA 1G6HA 1ZBQA 1DWPA 1FFCA 2PZFA 3IDFA 3HV0A 1NN5A 3TLKA 5KUTA 2XCSB 4DLBA 2DKFA 5L9AA 3R6DA 1PAUA 1QG2A 2E21A 1VSVA 3E22B 4B7AA 4ZT5A 1GVHA 3TQRA 1WDMA 4GT1A 2DT5A 4L4UA 1N7IA 4AKEA 3F71A 4JYCA 1J8DA 5IJ9A 3RVBA 3K05A 2CXTA 2OOSA 2CBXA 2P1ZA 2B8WA 4JQZA 3ZXXA 1NTRA 3ZHTA 2G9UA 2W90A 5HIAA 4BCCA 4D99A 1GAWA 1AS2A 2POQX 3EF1A 3ASUA 3KOOA 2JEOA 1NMQA 3G13A 1K89A 4MVJD 2OLKA 3LUJA 1PKXA 1K63A 4GX2A 1NRIA 3TSWA 3PXBA 5K3BA 3VDQA 5ICSA 2WOJA 4PR3A 1AXRA 4XGQA 3ZH9B 3I37X 3ENQA 4TSKA 2XDQB 2E1PA 3GJXC 3QKSA 3KL4A 4RANA 2O1WA 3BXEA 4LFCB 5IF9A 4QUGA 1QP4A 3RU9A 2Q3FA 3OZWA 5ALHA 5DWQA 5EHIA 2VWGA 3VHXA 3LL4A 5ITZB 1IPHA 5DTJA 2YX1A 5CA1F 2ISCA 4I3GA 1ZJ5A 3JATA 3CR8A 3LK6A 4HGPA 1YA4A 3CTPA 5JRZA 4MWGA 1C3XA 1RI4A 1YJQA 1PJLA 1JSZA 1Z2DA 2FW0A 1R9MA 1RE1A 2HEGA 4LSWA 5HKKA 4TTAA 1GTSA 4M76B 3RC8A 5F2NA 3R3UA 5AESA 3LCCA 2Z1NA 3HGMA 4LZPA 3JV7A 4UUQA 2HIMA 1RNLA 4FGZA 1OV4A 2BCGY 3U7QA 3W9SA 4DRYA 1L8AA 2OHHA 1NY5A 1K08A 3PC8A 3D6VA 1RXWA 5DFAA 3HM2A 3Q3HA 1VCOA 3AI2A 3KAQA 1XRPA 3WLIA 3DBVO 5KNCD 2VYND 5FNZA 1O0BA 3LBYA 4N5HX 5A4JA 2KQUA 2P5TB 1QGOA 4J0IA 1G8YA 3NVMB 3OECA 4I81A 4CR6A 5TMPA 4DR5B 1X1TA 2ZYAA 3HCNA 1SCJA 3ZI0A 3F7TA 1HURA 2R7LA 2QN1A 2BGMA 2ZJ5A 3MWJA 1VJCA 1JFSA 5JMOA 3L9XA 1J23A 1T9CA 4U7TB 2W48A 1QFZA 4QEZA 1GGKA 1SB8A 3N2KB 3EY4A 1H6AA 4FD2A 4YI3A 1M2JA 4LSGA 1KQFA 2GILA 1W85A 1U8EA 1KBZA 1L4NA 2GZ2A 2NO7A 3BSYA 3JWEA 3LPAA 4PRLA 3HA2A 5KAMA 5CFMA 1D2NA 4QG7A 3USCS 5JCPA 3R7FA 1VP3A 4TL6A 2G06A 3D0KA 3T7TA 4CL0A 4WCFC 4BTVA 4DLAA 4EHAA 4OF4A 1Z2EA 5L8VA 3EZFA 3MUFA 3R9IA 3OX1A 3C6BA 4EF6A 3MSXA 4HQFA 1W87A 1E9CA 3OG9A 4MPDA 1KI1A 2GD0A 2YHIB 4R9NA 2NN3C 4CF6A 1QQBA 3ZDFA 2Q0QA 3NRBA 3HA5A 5FXMA 3EK2A 2ANBA 2X3FA 4ZU6X 1ZEJA 1RC1A 1EP1B 1PL0A 2JGDB 4K2HA 5BQPA 1JQAA 4GL4A 3DDOA 5DHFA 5EAIA 5EXPA 1P0FA 4UVIA 2I54A 3WJ2A 4YMUA 3I3SR 3NASA 3G0IA 4EYKA 3FTEA 3DBRA 5THXA 4AY3A 1VBFA 2VP4A 1HG0A 2OQIA 3PXXA 2IYNA 4WXPA 5ALTA 4OHCA 4EHHA 4ETMA 5JAHA 1N5OX 2X19A 3EXHB 2SICE 4RYLA 1YVEI 1EVLA 1CP2A 5FKJA 5KQLA 1UL1X 1T3ZA 2VHEA 3PXAA 1G7TA 2AZXA 3SX2A 1KIMA 1SCUB 3F73A 2AG1A 4Q9KA 4QFDA 1NVTA 1EFTA 2VUIB 4O1HA 2L19A 4IDAA 2WAAA 5IJZA 2HHLA 4F86A 1KO7A 3BX1A 4PY2A 3INTA 3H11A 2ZXFA 1TJ4A 3AHFA 3P7MA 3PBKA 3QEJA 1TQHA 4PV7A 5CDUA 5CK5A 1J5EB 2EW2A 3EPJA 2XEXA 1KRWA 4REQA 1OXUA 1TL7C 1VL1A 5DX8A 5KINB 3HGTA 4UNIA 5JNLA 4AW9A 2BGJA 2PMFA 4FHCA 4IIEA 5ISMA 3TOSA 1N5DA 3NFRA 3NAZA 3CLVA 1GUZA 2YIDA 3L6CA 3MJTA 4H1TA 4MPJA 1USVA 5KJEA 5TGDA 1Y4SA 5LZ5A 4BFXA 1UANA 1NSYA 3CGWA 4JI5B 3D6NB 1GUAA 1GIAA 2LRHA 4WOKA 2X0EA 3TLGA 3A1WA 4POAA 4C21A 5C8XA 5C9ZA 2Q5FA 1KIAA 3C5WP 1SUAA 2O2CA 1H2RS 1WDKA 2CMDA 3DTVD 3VHXB 4P2GA 3EUFA 5UKDA 2CZGA 3WL5A 5L51A 2O2SA 1Z4IA 3HABA 4K9SA 3P0HA 1X9IA 1YRYE 4Y2JA 3M3HA 2WIBA 2OQ2A 1NR5A 1YDMA 3Q6IA 1ZK4A 4K6CA 4KFRA 1HPLA 1PZGA 1W36C 3F67A 3FDZB 4IJMA 4IWNA 3UA3A 4BLPA 5JAUA 1R10A 2AJCA 3NEJA 1R8XA 2IP4A 3EB9A 4ZA2A 3EZLA 4RK5A 4WMLA 2FPGA 3DO5A 5GONB 4ZYZA 4KQIA 3TINA 4CLRB 4OUKX 1D2GA 1S8FA 4L5BA 2OCPA 2J6CA 3RUFA 1E3JA 1IG0A 2VTDA 3G6KA 3OLQA 1XUOA 3PL5A 4MKGA 4CTKA 5KVVA 2K7FA 1JFRA 1NJ6A 4LZAA 1E63A 2D7JA 1U6IA 2UYYA 3IR7A 1L4KA 5K4AA 1AS0A 3NHFA 1CDZA 2W22A 4DA9A 1PTKA 1VJGA 2H5JA 2P5YA 1N2CA 1XCBA 1R8JA 2VQSA 1O77A 2X8BA 2Y3IA 1AO3A 1Y9EA 2V6BA 2QW8A 3A2NA 2BSXA 3C8HA 3FLMA 3PVCA 4R2IA 4MLCA 4Z99A 4Q3DA 5K0SA 3CRW1 3OLZA 8AT1A 1KHHA 4B40A 1LK7A 4CMJA 4ZDWA 1Z83A 1NW9B 1SAYA 2EJBA 2AG0A 3ESYA 4QTZA 4U7HA 1UBRS 4BO8A 1SVWA 1IDN1 4DVGA 1M83A 2XVYA 2ZRGA 2FUG6 5F98A 4K9KA 2PTGA 4EKEA 4JVNA 2W6IA 1WU8A 3BS4A 1TQ6A 4Q1DA 3QXGA 3AHEA 3PNLA 4IR7A 1W8IA 1ZOIA 5F5XA 2WTXA 2WTMA 2CN1A 1D2MA 5E4FA 4GOLD 1N6RA 1RCFA 1YR7A 1YUNA 1AH2A 3OCJA 3GG2A 5FO1A 5C8ZA 2ONYA 3FWZA 1Z5VA 3KZOA 4X20A 3OVMA 1T9BA 5ESXA 5TT1A 2XA1A 4UM5A 4DPMA 1V9LA 1E0SA 3O8DA 2IHNA 1T3LA 1K2WA 4P4UA 2CZCA 5P21A 5IZ4A 4NZZA 1WF3A 3C7TA 3LX5A 4AZ0A 2AN1A 3REFA 1IY2A 3FD8A 3VYVA 2BELA 2ZEJA 2J0UA 4J8PA 3DUFB 4ZAFA 2D7DA 2GOYA 4ON9A 4OHYA 1YZ3A 4YMIA 4ERNA 4NCHA 3TZBA 2C2YA 2VP0A 3LPLA 3ZS9A 3PPXA 1YJCA 2G17A 2PSDA 2QXYA 4C6RA 1DIRA 5J9FA 1WSBA 2HRDA 5JBNA 621PA 2C7VA 4ZVPA 3EEYA 2V7GA 2Q4RA 2CE7A 5FDFA 3W5CA 1I13A 5BVGB 3UB3A 3U7EB 3W90A 3MLBA 5JRJA 1J39A 5A0FA 3KSBC 3AF0A 3KUUA 2YMPA 4X8OA 1SUFA 1Z73A 1RRGA 4ARBA 2WFAA 3IA2A 1P2GA 1SBYA 1Z75A 4BE9A 1I3NA 1VPWA 3G8CA 4PCUA 4LY0A 4UC0A 1EH5A 2C4NA 1EDZA 3TBFA 5JNWA 2E48A 4KR7A 2BTEA 5BN1A 3A6ZA 2K4MA 1YTLA 2ZITA 1YQGA 2HO4A 3IUEA 4IOMA 5KQPA 1LBTA 4MLDA 3GLKA 3KHTA 2P8JA 2HNAA 3ZHBA 1H9BA 2PEYA 5CBKA 1S8NA 1BS2A 2ZETA 3L4SO 1PG5A 3MMZA 3NDIA 4Q7KA 1A9YA 1CFZA 4BNGA 4QUEA 4D3XA 4YV2A 1Q22A 2Y93A 4DREA 1OLOA 3H5OA 2QL9A 4X44A 5CVCA 3N53A 5BOVA 1ZRHA 5HZHA 4Y2UA 1UMKA 3JQDA 3SGLA 1NYTA 3ZI4A 1W5EA 3RF7A 5JARA 2AXNA 3BMQB 1M8FA 5I7OA 1E6KA 1EQ2A 4K6MA 1CJKC 1IAVA 1TGYA 3V9AA 4F3YA 3JD4A 3COVA 3T38A 3D8HA 3WAGA 1RLJA 2C94A 3C41J 4CQJA 4D9HA 1GOTA 3NOQA 2I0FA 1H65A 3NMUF 3DEAA 3KQOA 1JDPA 3AF4A 2O0JA 3BXXA 4WZAB 1Q0TA 4KR9A 4YAFA 2G07A 3AB8A 2F4VB 4QVGA 2NTJA 1WVIA 2O3UA 2HK8A 3AESA 3OZFA 3W3AA 4AP9A 2D4AA 5IRCD 3FPCA 4KITB 5A5EA 2F1KA 1BG6A 1XZHA 2PX4A 3QA9A 1EWKA 3W2EA 4D80A 1QK5A 2ODNA 5BSUA 3GLFE 3WBBA 4Q4LA 3B1VA 2OB2A 1GY8A 2NU7A 3CO5A 2EFEB 4OGWA 4J90A 4KLNA 5AKHA 3ZYZA 3ER9A 1ID8A 3EBLA 3O7MA 2F8LA 4ZVVA 3T7JA 1U9IC 4KQMA 1ODTC 5LWQA 4GLLA 2VJBA 4X95A 1YB4A 5THKA 1KI4A 4GYWA 1QKJA 4MJXA 4JA2A 3OZEA 3ZJVA 3KT3A 2JAUA 2DY1A 1VQ1A 5IZCC 1ZEMA 3RH0A 4LXUA 4D4JA 1UK6A 1UZNA 5JT1A 1DZIA 3AERB 1B73A 3SZOA 2F90A 1RQRA 5FPPA 1RHMA 5I8ZA 4FOLA 5KCZA 3VSBA 2A1UA 5EJAA 3QPWA 3BC1A 3TZQA 1DG1G 1EXMA 4CMKA 4ZD6A 2XQJA 4S2UA 4IUYA 5EIEA 2XDWA 1RWQA 2BZGA 4FFVA 4QOSA 3T1QA 3B3AA 4Z3OA 3ET5A 1QP7A 4JJFA 4BNYA 4XW2A 4I2NA 2IA5A 3HNOA 4NBNA 1ADGA 1AQIA 5TT0A 4ZVKA 5LQMA 1QZTA 2BI4A 2JIZD 4RL6A 4BQFA 4N9WA 4E5KA 4V1CB 1JU3A 1PT7A 4DR1B 3KXDA 4HMPA 1BXKA 2OCAA 2Z4SA 3EVCA 3F90A 1XZ8A 4UFPA 4JBHA 4GSKA 3LLMA 3PFGA 3FSRA 4HB4A 1G6OA 4BZXA 1SUPA 2JAXA 2E9SA 4G0XA 4I5FA 3FHTA 1X70A 2I22A 4FYIA 2ZPAA 3WGVA 4WK4B 4BBPA 3VNBA 4L3WA 2AX4A 1FYFA 3FGOA 1HNXB 4QYTA 4MA4A 4MV8A 3WKDA 2FPPB 4P54A 3FCSB 3HXPA 3I64A 3CZ5A 5IYZB 1JA1A 4AX4A 3NTXA 3ORRA 4Q3EA 1J06A 4IX1A 5CA0B 2G5GX 1RQXA 3SKXA 4QUJA 3AZOA 1RZUA 4TYMA 3I9V1 3A6DA 2HA3A 5JSZB 3DTVA 3WDMA 4AAYA 5BWBA 3CW9A 1SPXA 2WUDA 3V00A 1OB2A 3EAFA 3OKCA 5F7JA 3WIVA 5COQA 2JIRA 2FFAA 2XXAA 2X7XA 3BD7A 3QITA 1SG9A 2BGLA 1E3TA 3U3KA 2XW6A 4JXZA 3UF0A 3UWDA 3D7NA 4P80A 5C4MA 4H1HA 1RKQA 3VV3A 5KO2A 5KOHA 3CRVA 3WYDA 3LRTA 4HH3C 3H0EA 2IH2A 1LBHA 4NC9A 3D59A 4BNNA 3F4BA 4PYNA 4MVJG 2NG1A 1RXYA 1YDFA 4O0MA 1JKXA 5AHOA 4B3RB 2CXRA 1C1DB 1THMA 1ITZA 1IPFA 3S5JA 4N3NA 1QOQB 3TRHA 1LF0A 3KUXA 3RYIB 3I34X 1CS0A 2ZRAA 2GGSA 2C5SA 2KS6A 2VF8A 1E7QA 1RHRA 1WUHS 2Q5JA 2YIJA 5AWFC 3C2QA 3UMFA 1XT6A 3DMNA 1I7NA 3I2FA 4N7BA 4ZZ1A 3FCUB 2JLQA 3DEFA 3RSZA 5AW1A 2ZKLA 5F4BA 2QJOA 1J24A 4PWZA 3BRQA 4CM3A 2IVZA 2OCIA 3IP3A 4LVNA 5AKXA 5TMEA 4B76A 4XLLA 4CDGA 1KOGA 3ZGVA 3K94A 3ME5A 5GTDA 4TQ9A 1ZG3A 3I3OA 5AKEA 4ZT7A 4MV0A 1N0HA 2RAPA 3BGSA 3EISA 5T4EA 3UAGA 2GZ1A 3Q7TA 2VKTA 2FKAA 1FDUA 3LXRA 1U6JA 2HNKA 1XEWX 3F3YA 4G1UC 4KIWA 1J42A 1PWHA 1SUSA 4LSZA 4ALLA 1MJGA 2QDKA 3I53A 3K0AB 4GLBA 4NPCA 4RA9B 4ZRMA 4ZVRA 3W3AH 4UZEA 3GIDA 2B1IA 3ETDA 2JCSA 1DXHA 1RCTE 2G0AA 3SX4A 3LX8A 1GLNA 2YTZA 5A2QA 4TV9B 5K8CA 4N0PA 2OM2A 2EOAA 1EYZA 3ZX5A 3HU1A 3O1IC 3FFTA 2UKDA 3D6FA 4IINA 1NONA 4WACA 4C5CA 1HSZA 4CRWB 4G1VA 4HYYA 2J5QA 1U3WA 3KD3A 4RKYA 1FP6A 3EIOA 1Z2OX 2FR1A 2OYCA 3ZLBA 4FB5A 5E9WA 2QE7D 3QOYA 1OYVA 3CXUA 1YJ8A 1SD2A 2YS6A 4HQKA 2ODEA 2PLFA 1NUUA 3EULA 1KO8A 2FRDA 3STTA 3G9UA 3GWZA 2ZE8A 4TQAA 4ZXFA 4KPUA 5CGQB 3SLGA 3U4HA 3S29A 1ZHOA 3TSAA 5IK2A 1I6WA 3UHPA 3ZJ4A 5IUJC 2G6TA 2NU8A 1C7QA 3C24A 4KRYA 1SK8A 2A88A 2EYQA 2P9ZA 3CUUA 3DUFA 3WBKA 1T0BA 3QYAA 3R2JA 2Q4DA 3I45A 2HL6A 4FX5A 3RRYA 2ATIA 3SZRA 1B23P 4WJZA 4IGAA 2ZRIA 1Q95A 3L0OA 4F21A 5IABA 3ZHZA 2C9CA 3FSJX 2QRZA 4DEXA 3IO3A 4PZLA 1OVMA 4C01A 2OORC 3COSA 1OLUB 3DBOB 3EDOA 2BHTA 4FLMA 4GMXA 2JLXA 1CK4A 1RPNA 2IYPA 4BMXA 3FFAA 3SR4A 3EVTA 2D5AA 3T4EA 4CWAA 2X86A 1GD1O 3RTCA 1W35A 4JMLA 4P7BA 3ANNA 4TYQA 4UE3S 2EATA 3DR5A 4MW9A 2XE8A 2FZEA 1T6BY 3L0ZA 1UT5A 2E3JA 1UKYA 4DQUA 1TT7A 3FFWA 5ENZA 5F73A 5AXBA 1M73E 1QYCA 2QI9F 2RBKA 3H5AA 4D4LA 1JZQA 3O0TA 1S2LA 2H1CA 3KTFA 4WKPA 3U16A 2G83A 3ITNA 2DGDA 1XK6A 2WC1A 3DOEA 4TV8B 5HBRA 4OP2A 4KWIA 5DE3A 2AFIB 2J9ZB 1N1EA 1INLA 1JSLA 4KXXA 1YIAA 1VCMA 3UAWA 3IV7A 2NU8B 1TRKA 1ZGBA 2XQKA 3QPVA 3V5NA 4YUAA 3SF0A 1FFYA 1FNDA 3ODPA 1Z15A 2IDJA 5IJAA 4QJ3A 3SLRA 5ED4A 1RHJA 2FMXA 1N9GA 2WU1A 4DQDA 4OKSA 4NJEB 1NKSA 2I29A 4RTRA 3JSAA 1QKIA 3KKNA 4C4PA 4WNYA 2OXTA 2PD4A 1SXQA 5DM70 3R0XA 2H11A 2ZS8A 3ONDA 2JAQA 4OM7A 1IY9A 4UMDA 3KUDA 4EMBA 2ACVA 1RFGE 2WVGA 3RS5A 5A3QA 2EBHX 4AWAA 4BIMA 1L8XA 5E7MA 4FNGA 3S2SA 3AEQB 4NLLA 4BNKA 1WVMA 5C80A 4CLRA 1RPAA 1TO1E 5F78A 4G1FA 3EG5A 4LUCA 1XG5A 5K03A 3ERCA 4Z54A 2FK8A 4QLOA 4URZR 1AGRA 3W2TA 4ZEMA 5AIBA 5KJFA 2W2MA 4RPGA 4C3OB 1DJLA 3W05A 4RXTA 1BFUA 4LJ6A 3TD6A 3EMKA 4Y6GB 3TW4A 4JI4B 4BVGA 4KNYA 1NXOA 4E6EA 2A2ZA 2R7MA 1KDZA 5BR8B 1PNOA 1WA5A 1OA0A 1CLEA 1UMCB 1VMAA 5DIFA 5DOVA 5DWDA 2RGDA 2DBZA 3FZGA 2GAJA 2VQ3A 4NQRA 4RJJA 4F12A 4TXJA 3ER8A 3GAMA 5CR9A 2CZQA 2P9HA 3VPCA 3FE2A 1L4UA 2IUFA 4OBXA 3N87A 2JIZA 1ST2A 4UNSA 3ZWDA 1N3YA 2DLDA 4IJKA 5CLIA 2Q41A 4ZDIA 5KTOA 3JZIA 1L5ZA 2HJWA 4XJVA 4YXWA 5LOVA 1B15A 2WT4A 2XJ9A 3O4HA 4P4NA 1MB4A 4W5JA 3ZWKA 2WJZB 3VZSA 4B33A 3HJFA 3WE7A 2C4TA 2CXHA 5A7HA 3LG2A 1GTVA 3PNMA 4JOCA 1FCJA 1T9DA 3CJRA 3FHLA 3KHSA 4OUDA 4WRRA 3DCYA 1NQAO 1V26A 1XK7A 3QJ5A 4EYEA 2HUPA 2XHEA 2O2DA 4RHEA 1OXMA 3BQ9A 2XB4A 5E1MA 2AJTA 3RJMA 5BRNA 1FU8A 1EVZA 1SXGA 2WE8A 2IU3A 3F6RA 2PA0A 4ANFA 4HDMB 3F96A 4UBMA 2QVBA 2FXIA 1TCBA 3UJNA 3R5TA 3HHEA 3LKDA 2LPMA 1MO6A 4P84A 3CYFA 1NA5A 1LDYA 1KE1A 2X1VA 1XZNA 4MRAA 3C3MA 5CW2A 4DV3B 4U4AA 5LQCA 4U9HS 1H0SA 3VGPA 1CXZA 1D8TA 1BEUB 3DWGA 1LU9A 3ELYA 3NIWA 2FWIA 4BEJA 1U7ZA 2W0SA 2W2NA 3I42A 3KJEA 2IYVA 1A2KC 4YYZA 1V11B 3BE6A 3A05A 4B8WA 3EHDA 2JD0A 3LYUA 4IJUA 5CX4A 2CUZA 3OBIA 4RE5A 1LTKA 3C1AA 3U0BA 1J90A 3VV2A 1ZK0A 2PO7A 4W9RA 4HT3B 3UPTA 1PR4A 3CLHA 2EFYA 1X39A 4R5HA 1P7PA 1UXIA 4EYQA 4J1QA 3UJ9A 5BSTA 3T7DA 4E6PA 4HAXA 5BNZA 1U80A 3K16A 4NYJR 3ASZA 2HU2A 3F9RA 4ZRNA 4HFNA 1CUEA 4FPXA 4PGMA 2YMLA 3F97A 1TIBA 3OUTA 3EZXA 3HKCA 4INZA 1FYXA 1M6VB 2JLZA 1VYUA 3HUDA 4K1XA 5DW3A 4D46A 2CT8A 2W6ZA 4P7GA 2O2ZA 2F2TA 3N2IA 1K7EB 5JAZA 3MCZA 2JGKA 3KDSE 2OGZA 5LJIA 2E5WA 4RM2A 3ORFA 1QHHB 1YHZA 4IHJB 4Q1EA 5AVUA 3DP9A 3BEDA 5KWIA 2HPZA 4RS4A 4MR9A 4OY3A 1AV7A 4AIIA 4ONEA 4LOLA 1WSDA 4EENA 4B82A 1R8SA 1ZZEA 4L9AA 1Q1QA 3LT0A 4BV3A 1W581 1DRJA 2BGKA 3SMVA 5AHWA 4YFVA 1KY3A 3CZCA 1FMTA 3WYGA 2OXCA 2JANA 4JLAA 1EWYA 4KVAA 4PZUA 1CPYA 4B31A 4CM8B 3RAJA 1RXCA 2PMCA 5IFKA 3K9CA 1FRZA 2HF8A 2QNBA 3KLPX 2O8CB 4TWJA 3NS7A 3M5DA 3SP1A 1BAPA 5J47A 1P2DA 1JSXA 4V1CI 3D2AA 3AUSA 1QQ6A 2IHZA 4EFDA 2NSLA 4ZOCA 1NJ8A 2BBSA 1MAHA 2O7NA 2XDYA 3K0FB 1BWPA 1DQZA 4TMYA 1S96A 3M49A 4Z8XA 3W8NA 1FP4A 1OB5A 1U3FA 2UUPA 3H8SA 4LDQA 3JXEA 4JL5A 1HT1E 4KQ1A 4JVLA 3CVWA 5COBA 3RAEC 3WQSB 1SC4A 4J16A 1IYZA 1YR1A 3O4RA 4RVCA 3D64A 4GZMA 4UD6A 2JVJA 1BMFA 3Q3IA 4OSOA 5LMUB 5IT5A 3GMTA 1WMEA 1DXYA 2B92A 5FWDA 3DOFA 2Q5HA 3RWOA 3DF7A 4FFDA 4PAQA 1F48A 1C1XA 2J7PA 5G40A 3FPHA 2J33A 1D4FA 1VYTA 3KB6A 1XMJA 4OXQA 3CGGA 1QUFA 4J75A 5CHEA 2DR3A 4DCPA 4BKPA 4FJ0A 5FV4A 2JHCA 4N5NA 1Y7TA 4YRGA 3IIEA 4YP7A 5A4DA 4MGEA 4HATA 1VKRA 1M2NA 4ZHSA 2C78A 2X5KO 2ZWOA 4BC0A 1QMPA 2R5FA 2C2MA 3ENVA 1NUTA 1FB5A 4CL3A 1PFGA 4G1CA 2I67A 4Q00A 3L8ZA 3CRNA 3O5AA 1E1CA 4GP7A 4HDKA 4HRAA 3UENA 1MO3A 3MGCA 4AZ0B 1NP7A 5LA6A 1PJSA 1YRBA 3S7TA 4ZAWA 2QP3A 3PDHA 1SULA 4RZHA 4UDOA