2HF8A

Crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form, in complex with zinc
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
KDILKANKRLADKNRKLLNKHGVVAFDFMGAIGSGKTLLIEKLIDNLKDKYKIACIAGDVIAKFDAERMEKHGAKVVPLNTGKECHLDAHLVGHALEDLNLDEIDLLFIENVGNLICPADFDLGTHKRIVVISTTEGDDTIEKHPGIMKTADLIVINKIDLADAVGADIKKMENDAKRINPDAEVVLLSLKTMEGFDKVLEFIEKSVKEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable hydrogenase nickel incorporation protein hypB
publication title Structural insights into HypB, a GTP-binding protein that regulates metal binding.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase, metal binding protein
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hf8A00
3GJ6A 3QUSA 2QP4A 4RD1A 1W0JD 4YONB 3KJEA 3D6TB 4CW7A 3W8RA 2NTYC 1SXJB 4LOAA 2IYRA 2OCBA 4QHTA 2L0XA 5B64A 4TYPA 1XPUA 4FN5A 3G0HA 1P2UA 5JZVA 1BYIA 1Z47A 4BEJA 2C78A 4D4JA 2RGEA 1Z29A 3CR7A 2AD5A 5DO9A 1RVDA 3B1XA 3QVUA 3V9PA 2DFTA 5F3WB 2P65A 2GAOA 2N46A 1IY0A 4D4KA 1NVVR 1W4RA 2PMDA 3A58B 3TH5A 1ZIPA 3TJZA 2PJRA 4DLRA 3FVQA 4JYCA 5FL7A 5FOUA 3EW9A 5KOYA 2QA5A 3REFA 2ONKA 4JSTA 4TMKA 5SZJA 1PUIA 5FOWA 2W6JD 4JIMA 1YZGA 2IA5A 2PT7A 2WSMA 5CB8A 1HE8B 4IOKA 1Z07A 2FDCA 2C5LA 1BO6A 2F43B 4DLUA 4MQBA 4CT5A 5JSZA 1U99A 4RJLA 2DWPA 3EZ2A 5C2JB 2IYYA 3FMFA 5LD2B 3LBIA 3PUYA 4PAMA 1XRJA 2ZSEA 2O8CB 2AR7A 1E2GA 2AX4A 4WAUA 3VX4A 1JAHA 4KFTA 4LCBA 3H4MA 4NKRA 1SKQA 3QPVA 5FTNA 2IWHA 5JFGA 1XTSA 2RAPA 5KYKA 1IN6A 2OBNA 1RZ3A 2WAXA 5CK4A 2E9SA 1E2MA 4CEJA 2VP0A 2CJWB 2FFBA 3PENA 2ATXA 4OL0A 3K0EA 3TAHA 1E9DA 2CXXA 4TT3A 5DHAA 1TEVA 2N42A 1ZC3A 1NSFA 3EIHA 4F93B 4EPVA 2ZRHA 1DAKA 1TAGA 3M6AA 5KDOA 2XZPA 4MRPA 3B1WA 4BLSA 1JALA 3EPJA 1QVRA 2EW1A 2X2FA 3MG9A 4KSBA 2GF9A 1NSTA 1U9IC 2GCPA 3W6PA 1YRAA 3EZFA 4NDZA 4WZ6A 4HB2A 4LPKA 2RHMA 1Z0JA 4PPQA 3H0KA 1TQ6A 4AYTA 2WHXA 3W5IA 1UPTA 3BB3A 1T8UA 3EARA 4LC1A 4LHXA 2ERXA 2BEJA 2GJSA 1P73A 2GBLA 4I81A 5DSZA 5DIFA 3I62A 4B6FA 2UZIR 1TQ4A 4D6PA 4RKFA 2FFQA 2W2TA 1A1VA 4Q9IA 1TMKA 1M6NA 2ZRFA 1I4DD 2OFWA 5E7IA 3ADCA 5JWOA 1NN0A 1C9KA 1E0KA 2RCNA 2VSOA 3ZQ6A 3HU1A 2A3RA 2IS2A 4G5SA 4B34A 1XXHB 5E7MA 2GEUA 3TSWA 1XF9A 3CB4A 3LV8A 4HAYA 1KO4A 2MMCA 2F9LA 1R7RA 5EZ6B 3GLGA 3MUFA 4BFTA 3TVTA 1A2BA 2BIFA 4S35A 2GEDA 1G3RA 2GJAA 2JLRA 1R10A 1ZNYA 1NVXQ 4W5WA 5CM9C 3DOFA 3A1VA 1AZTA 1XXHE 4GZLA 3LWNA 5HR5A 2J45A 4B47A 1F48A 1XMJA 4PC7A 4YMVA 2R44A 3L43A 4RD6A 3EAQA 5DH9A 1MRNA 1W47A 4ZPXA 3RC3A 2QGZA 2CVFA 2QT0A 2ZJYA 3LVQE 2ZE6A 1F2UA 3BFXA 4QJ4A 1VTKA 2CK3D 4I1SA 1TPZA 4HYYA 3K0FB 2Q0HA 4ZIRA 4LGMA 1DEKA 3SZRA 3QKSB 3IQXA 2FNAA 3X2SA 4GP6A 1QBKC 1XCPA 4F92B 3TUZC 3U6BA 3H2YA 3NEYA 2JLXA 1E69A 2ANCA 1TU3A 2CLSA 1V5WA 3M4YA 2VLIA 4TL6A 3ADDA 2XTZA 3BAFA 2WTUA 2HV8A 5CLQA 1JXOA 5K8IA 1YR6A 5L3QA 5B2ZA 4LJ8A 4RZ2A 2CDNA 3SYNA 2QM8A 3C15C 1G6HA 1OH8A 4IEIA 4KODA 4XVQA 1E2EA 3UG6A 3WBJA 3AVWA 4X8MA 3VHLB 4BLQA 3K09C 3GFOA 3AF4A 1YR8A 2P3SA 2JLVA 1CJMA 2UVQA 1GIAA 1R8QA 4C0KA 4ZDJA 4PC2A 4UXIA 2V54A 4TMVA 1EG7A 3K70C 4DSNA 3B82A 3EXAA 1ZUIA 2IHBA 5B30A 2A7QA 2GK6A 3QE0A 1RJ9A 5CDFA 1OE0A 2E87A 4Z1MD 1NN3A 1RC8A 4IOJA 4CEHB 4K46A 2IEZA 1OB5A 4RD2A 1M8PA 3NBYC 1N5LA 1SGWA 2F6RA 2H8KA 1N0WA 4TZ6A 4JKIA 1Q1QA 2R65A 2Q3FA 4EFMA 4MKFA 5DN6D 2BMJA 1EESA 4B35A 2C9OA 2O8BA 3RS4A 2KSQA 4ZCMA 4JYBA 1G19A 1N6IA 5J4VA 1OLOA 4C0HA 3I61A 3B85A 4CEIA 5D3MA 1GRQA 3W8NA 4O2RA 4I99A 4C9BA 4Q4JB 1Q3TA 1EX6A 1HQYE 1SVWA 1XTRA 2NMVA 4KVAA 1WP9A 1ZYUA 3I5XA 3NH6A 4I4LA 1E1RD 2ZR0A 4Q19A 5GJVC 3UKDA 3IPYA 4A8JB 3BXZA 3BD9A 1E1QD 3HU3A 4HAUA 5J4KA 1FX0B 2ZSBA 3VNUA 4MYHA 4RCYA 1KAGA 2IT1A 4JLKA 4AWXA 4GP7A 4JLVA 2G9NA 3R7WB 1G8YA 1R2QA 1A4RA 2ZROA 5UKDA 2WOJA 4XVRA 1T3SA 2H1LA 1D2NA 1FQJA 4IHQA 5JCZA 2WMNB 1KSFX 2BJVA 2RGCA 2ZTSA 2XITA 1JR3E 3T15A 1RE0A 4DCVA 1XMVA 2ZIAA 1OFUX 1UBFA 4NZYA 5AWFC 3C16C 1VG1A 2F1HA 2YKGA 2JJ1D 2ZRIA 5CITA 3DKPA 3K0AB 1N6NA 4B75A 1F60A 2W0MA 2RGGA 1ZNZA 3GLIB 1PLLA 1EXMA 4S2EA 3AV0B 1GM5A 1VG9B 1WA5A 3AGQA 3GJ4A 1UDXA 5E7JA 2IEYA 1RIFA 1P75A 2VBCA 4RFSA 5TB5A 3VNVA 1QHXA 4N3NA 2XGJA 1Q20A 2PZGA 2G88A 4L5BA 3B9PA 3RSOA 4DXAA 1CS4C 2WKRA 4A0HA 1NJGA 2CHQA 521PA 1P2TA 1KO7A 4RD4A 4LBVA 2R6FA 3ETLA 4CRWB 3KB2A 4LYAA 3KFVA 4NCIA 3GLIE 1GKIA 2O0JA 2KE5A 3QVVA 2G0NA 4G5OA 2GA8A 2W00A 2R9VA 2FGJA 3QPWA 2IYTA 1WMSA 2VHUA 4B73A 2GZDA 3A1SA 4DB4A 4XIGS 1CJUC 2VP5A 3I1FA 1ANKA 3NG1A 2BBTA 2G1JA 2HCBA 3FOZA 5FL7D 5BN3A 3PITA 4Q7KA 2CNWA 1OYWA 3TBKA 1KKLA 1G291 5FPKA 3LLMA 1WRBA 4IDQA 5CJPA 3KFXA 2OXCA 4GBMA 1Z5ZA 2Q21A 4PTLA 1KSHA 4QJ3A 2FSHA 2PZFA 4PFSA 4TLAA 4B44A 3CRVA 3AGPA 1WB9A 4LK2A 4QM7A 4Q4AB 3UPUA 4LHVA 1P5ZB 3OIVA 2F1RA 3IHLA 1DAIA 2F3TA 4OI4A 2XJ4A 4EFNA 4JVLA 2XOKA 3KL4A 2GVZC 1KO8A 4NCHA 4PQYA 4Q1CA 1W4AA 1W4BA 3Q3JB 3GJ3A 3UXMA 1TX4B 1D6JA 1OXSC 1AM4D 1SVMA 1GL9B 3FWYA 4NONA 3MD0A 2FWRA 1PV4A 4JKYA 2GCOB 4G1UC 4KV9A 3W3ZB 1KDTA 1R0YA 4L15A 3U3OA 3DZ8A 5JJIA 3IIJA 3LFUA 2GNOA 3K09A 2HJGA 5TY0A 1UBCA 1VIYA 3CNOA 3M1IA 2ZSFA 3SNHA 1OYYA 4OQNA 5EP1A 1N5JA 1GRNA 3L0OA 4KITB 2C8VA 3F8TA 2NOAA 4TL7A 4TYNA 1F2TB 2VF8A 4KVGA 1J99A 4PAQA 4LYJA 2C77A 4DSTA 2QGNA 3PUWA 4TMZA 2DYKA 2O0HA 5KNDA 4IJMA 4B3FX 4PXAA 3KTAA 1TF2A 2GDJA 5JEDA 4GL2A 1XNJA 2FE4A 2Z6VA 3FKQA 3GJ0A 1NRJB 3LX8A 2XAUA 4OHZA 2X1VA 4EKDA 5TMPA 3DMNA 4A36A 2FJUA 5HE8A 1V43A 3RABA 2YWHA 3TR0A 3THWB 4KI0A 5FTJA 5LB4A 3KKQA 5FL3A 3PEWA 5H70A 4A15A 1YJ5A 4LDJA 2GILA 4UXJA 1CR1A 1GNPA 2IBMA 1W36C 1HYQA 3OEHD 5J5CA 4TQAA 3PCRB 2OCYC 4LHYA 2P5SA 2E1RA 4MYCA 2FG5A 2AK3A 4Z8YA 1VCOA 3B7GA 3KXIA 1HQCA 1MT0A 2C99A 3LD9A 1OFTA 1GOTA 3OF5A 4M9ZA 2P6UA 2WICA 2YOGA 2DHRA 1YZQA 2A5YB 2IL1A 3FHCB 4RZXA 3WMGA 3GLHB 5JRZA 2IX3A 5FUYA 4AK9A 3W3AA 2V6IA 4IOLA 3A1UA 1E99A 1RPZA 2XZLA 2IUSA 1G9XA 1CR0A 3BFVA 2C9CA 3G5UA 4LV6A 3MMPA 3TSOA 4B3XA 4OBEA 3K9NA 3ASZA 2A5FA 3OE7A 4JSYA 1LF5A 2J7PA 1NVUQ 5KU1A 3FMPB 2PX0A 4DHEA 1AK2A 2REOA 3GP8A 3NVAA 2CCJA 4DLSA 3GLHE 4K81B 4DIDA 1AS3A 1EFHA 4YMWA 4AY2A 1QG2A 2QN6A 2ZUDA 3CPHA 4QBFA 1E2KA 3ICEA 5JBQA 3DPUA 3Q7QA 3UIEA 3L8YA 3KB1A 4CGZA 2RGBA 3QXHA 4V0ME 5FOXA 1JJ7A 2FZLA 1XZPA 3K0CC 5FFMA 1TUEA 1UKYA 1DBSA 1U2RA 2VTKA 2ZRMA 5DE3A 1M34E 4Q7JB 1AS0A 5G3YA 1KMHA 4OHYA 3WBKA 1G1MA 1J8YF 5JEEA 1AJEA 1G64A 1U0LA 2QROA 3ZLJA 2JJ8A 2EFCB 4PPNA 4TLBA 2HF9A 3TGPA 4NCKA 3ZVMA 2ZRBA 3CONA 4DB2A 3FMOB 2BKUA 3QEJA 4U5XA 1L7VC 1N3BA 2DFKB 2HT6A 3SJZA 2O8FA 3R8CA 4AI6A 3VU9B 4R2HA 3R9IA 2ZI9A 1S1MA 1DG3A 4QC2A 3U6KA 3QG5A 1K5DA 3LQQA 1YZTA 3KUDA 2QU8A 3C14C 2QE7D 3BH0A 1MABA 1HV8A 4QG7A 1E3MA 5EP3A 1KO5A 1UFQA 4O0MA 5F98A 2AK2A 4ZCIA 2A9KA 3GLFE 1E2IA 4HAXA 4HZUA 2WJIA 2P5TB 3A1WA 2XXAB 2QT1A 3TKLA 4E22A 4BRWA 1KGDA 2FGKA 1KJYA 1BH2A 4C0SA 2DY1A 1P9RA 4F91B 1LB1B 5SZIA 4DVGA 2WJYA 3R20A 2WV9A 3K8YA 2AHOA 5A5GA 2XB2A 2FPLA 3OFNA 3THYB 5E3HA 1CJKC 1E4VA 3RRNA 5KDLA 4US0R 2YOFA 3GLFA 1WDTA 2OE2A 3L0SA 1OB2A 1VCMA 1NBMA 1AQUA 1I2MA 2J46A 4V0KA 5FBVB 4EQ6A 1Y3AA 4BUJA 2G77B 4BFYA 4HUQA 1G16A 2QM7A 3KZ1E 1HA3A 1VCIA 5BYKA 4OK5A 3AKEA 3LH5A 4UNQA 2C95A 1QVAA 1UEIA 1XMIA 2ZJ2A 1LFDB 5AUOB 1E2HA 2A5JA 3SE0A 2GBLC 3PIRA 4GSYA 2WOOA 3MGCA 4KYIB 4MGIR 4P4TA 1CR2A 3RHFA 3SS8A 4Z54A 3BB1A 2FX3A 4JLPA 1TADA 4QOSA 3CWQA 4HLCA 6Q21A 3Q72A 3EPLA 2ZI3A 1LTQA 1ZMXA 3RS3A 3AVPA 2EFDB 3A1TA 5JRJA 2GK7A 2H7VA 4P3YA 4A82A 3W6OA 4YDHB 2OAP1 4FCTA 1FUKA 3D3QA 4O3MA 4CVNA 1J7KA 3B9QA 1NG1A 1KZ7B 2W6IA 1GVNB 4TLDA 4LBZA 2JCSA 3DVLA 5AJWA 4ZKEA 5TXGA 1E94E 1EK0A 2OV2A 3ONWA 3SEAA 4R71A 1AGRA 2QNRA 1XTKA 5FUWA 3EWSA 4D0NA 4DCSA 4WA7A 2QP9X 1MO3A 3HR7A 2J87A 3TUJC 4XTCS 3JZMA 5B58C 2ZR7A 4ESVA 4KJZA 3MLEA 2ZRNA 5FOSA 1G41A 2WWFA 2BBSA 4L16A 4N0DA 4QHYA 1ETUA 1NLFA 2ZE5A 3E1SA 2QPAA 4PPFA 1LS1A 1NMZA 4QBGB 2W2XA 4YDSA 3PUXA 2ZM5A 3K9LA 5DISB 4QFMA 4ZDWA 1CJTC 2CNWD 1OH6A 1M74A 4EJSB 2EU8A 2WWXA 3DM5A 3ZDQA 4LBWA 4B71A 2VSFA 1Z0KA 2PCJA 4XD7D 2QAJA 3CRRA 4E07A 3HPRA 1OIVA 4DLZA 2AD1A 4F4CA 3VR2A 2O52A 2FZ4A 1KY2A 3U7GA 2QRNA 4N1AA 2BEKA 5EE1A 2ODWA 1YHNA 4IFEA 4WBSA 4BFVA 1NMYA 3AM1A 1Z3IX 2RGXA 1W48A 3CF2A 3CZQA 1NY6A 1R4AA 2UKDA 3B78A 3SYLA 3K0CA 3NTUA 1G7SA 4PZLA 3VFDA 2OBMA 2XOKD 4M1YA 4M1SA 2VP9A 4JS0A 2F3RA 4M22A 4US2R 1QDEA 1GNRA 4NP6A 4C7OA 1OIWA 3HPQA 1CU1A 3BJIC 4TSFA 1OXVA 4IEEA 5FI0B 1T8TA 2ZI5A 1BMFD 4TLEA 2JLUA 2WJVA 4R9UC 4JBYA 2D74A 1VG0B 1P9NA 3FB4A 3VR1A 4LV5B 3OZXA 4B2IA 2WWYA 2HXYA 1XTJA 1E9CA 4GRAA 4AC9A 1IN8A 4Q66C 2QMHA 4QBHA 2J9RA 3QBTA 1R6BX 4OQMA 1NP6A 2WSSA 4OHWA 4PPGA 1ESMA 3TUIC 3SR0A 3U4QB 1EFRA 2PT5A 1GL7A 5SZKB 3K70D 4JLBA 3W6NA 5EE3A 1SXJE 1ZC4A 3AVVA 3QKTA 4E5UA 1GITA 1EFTA 5JMTA 4KAXA 3CX6A 2V4ZA 1Q57A 2HEIA 4FD2A 3AVUA 2O8EA 1XEWX 2VA8A 3SOPA 1QHHA 1SULA 2YJTD 3SFZA 5BN4A 5E95A 1OHHA 3Q85A 3VR5A 5L3RA 2J0UA 2JAQA 1NLYA 2HUPA 2FOLA 4XTRA 4AIIA 4D2IA 2LKDA 3B8HA 1W0KA 2ZSAA 3VTKA 3GEIA 3GPLA 2H16A 1AKEA 5ANRB 1KKMA 1SXJA 2D7DA 2R6DA 3OHMA 2NQ2C 5L3SB 2DWQA 1JQJC 4V02A 1G6OA 2JLQA 2XSZA 2XTMA 4PAOA 5AUNB 2OUKA 5KTYA 3EZ6A 4QGAA 3IEUA 1SVLA 4A6XA 4HB3A 1A82A 1W4CA 2QAGB 1G3IA 3CX8A 3I72A 3KJHA 3PVSA 4L4UA 2ORVA 2FEOA 1FNNA 1XBTA 2BM1A 3I32A 4HDCA 2QI9C 2VIIA 1W46A 3DDCA 2GXAA 1LF0A 1HY3A 3CZPA 3Q8XB 3P32A 1E0AA 5DGXA 3I8XA 2H17A 3CUEF 5IK2D 3R9XA 1IY2A 2QPTA 1DADA 1F3OA 1E2FA 1RRFA 3T1OA 4C2UA 3ZJYA 3OE7D 2J7PD 3QKRB 3I92A 4US1R 4BRUA 1SHZA 4BPBA 1FL9A 3E2IA 2IXFA 3A8TA 1XDBA 1G8GA 1AQYA 2F43A 1R0ZA 4Q1DA 5JJLA 4LX0A 2J5XA 5JI2E 1P60A 2ZVQX 2JASA 1N6OA 4C3ZA 2O8CA 4ZCLA 5KNCA 2RGNC 4JBWA 1T5LA 2IUUA 4LJYA 3T1TA 2CE2X 3V4FA 3RRMA 3EA0A 3R9WA 2QPOA 1KK2A 5CYPA 3SQXA 3KQHA 3ZD6A 1G3QA 4URWR 4Y0AA 2V7QD 4PSVA 3BERA 2CJWA 2ZRLA 4BE7B 5EQTA 1NIPA 1R0XA 1VPLA 3IUYA 1ZM4A 2QQ0A 1R5OA 3FKSA 1F5NA 1Z6YA 4P4SB 3WHKA 5BQ5A 1OKKA 1WCV1 3JZAA 4ASUA 2OEPA 2JLSA 4PO8A 1EFUA 2C2HA 3IPXA 3Q5DA 1UKVY 1NLZA 3DEFA 3A36A 3LW7A 2JLYA 1H8HA 4R7ZA 5J40A 3REGA 4LV8B 1YRBA 2V9PA 5IT5A 3U7HB 3IBGA 4QGFA 2KBFA 1UEJA 1W2GA 1XMSA 1S3SA 5EUQB 1B23P 4F4IA 4RZUA 3DZDA 3P26A 4M1MA 3EWAA 2ZRPA 4CYMA 1JPJA 4IDHA 4GZMA 3VR3A 4FW9A 4OI0A 2ZUCA 4X8HA 2D2EA 3GD7A 3PUVA 1ZCAA 3NIBA 4KCGA 1YZUA 2HXSA 2IHYA 2P0EA 1T4GA 2YC4C 1XXHA 2FH5B 5EE9A 2X77A 3ND8A 4LRWA 3EIQA 3KXLA 3WYFA 4D26A 1VKJA 1CXZA 4P4UA 4JVSB 4ARZB 2DFNA 3TRFA 1Z0DA 4PHFA 5K8UA 4HUTA 4Q00A 1JPNA 2V55B 2B8WA 2ZJZA 2DFLA 3ZVLA 2Y8EA 1EWRA 3QBVA 2NO9A 4LJ4A 1DG1G 1JEDA 4WXRA 1VDZA 4BFXA 4Q1BA 2CVHA 3ZZTA 4HATA 1NBMD 5FTKA 1N0VC 4G5QA 3LBNA 4MRRA 1WF3A 4UJ5A 3TMKA 421PA 4DEYA 3CF0A 3P20A 2IWRA 2ZYVX 2YVUA 1E2DA 3NHAA 3LXXA 4MKGA 4UJ3A 2YZ2A 2B7CA 5CB6A 3I4LA 5G40A 3VR4A 2ORWA 3U3RA 1XZQA 1E9RA 2QENA 4G0NA 2R2AA 2N1BA 4KSCA 4B2PA 1S0UA 3RS7A 4Q7MB 1KDRA 1HEIA 1X8JA 4D80A 1DAMA 3K0FA 2ZXUA 2G6BA 3GJ8A 3QKSA 4AG6A 4BLTA 2JIZD 5C18A 2GXUA 2XTNA 3C8UA 3Q5EA 2JJ2A 3AF2A 3N5CA 5EP2A 5FOVA 1OFHA 4JZKA 4PC3A 1KI3A 1P6XA 4HB4A 1JB1A 4ACBA 1OH5A 1HUQA 4GOJA 3LRPA 5HE9A 2AXPA 1T9HA 1KI6B 4A2WA 4JLNA 4YXWD 3JVUA 1ZNWA 3KQNA 2W6ID 2ZRGA 1I4LD 3TK1A 1VHLA 1W36D 1UKZA 2GVDC 3NKVA 3ZGXA 4PC6A 2QEQA 4QM6A 5FUVA 1IY1A 2I1QA 1US8B 1KI2A 3MWYW 1G3MA 3V4RA 2GXSA 1CR4A 1OXTA 4B2LA 4FINA 5CYOA 4OI2A 3P1JA 4AKEA 2Z43A 4LHZA 3NBFA 1XCGB 1XEXB 4MYUA 2YC2C 3E5HA 1ZD8A 2X19A 2ZI6A 2H5EA 4CEHA 5FPHA 1P4SA 1CULC 1KDOA 3FYHA 2PMKA 4IVQA 4CDGA 4DUGA 2A5GA 5G53C 1DTSA 3MJRA 1IN4A 3TVDA 3EPHA 1ZIOA 4M1OA 2CL7X 4DWJA 5L3VA 1KOFA 2JDIA 2QMEA 2ANBA 2F7SA 1XD2B 1P61B 4BEBA 1XPOA 3RSLA 1A5TA 4D4LA 5FTLA 4BLRA 2F55A 2ZPTX 3OAAD 2REXB 4FMCF 3L2OB 2CL0X 3L0IB 3ZZUA 4FWIB 5AJXA 1LVGA 3SQWA 3EC2A 2ZAMA 1T6NA 3LNCA 3LY5A 1YZKA 4PHGA 1RRGA 4RFVA 4V0NA 2RGNA 1II8B 2FA9A 2QTFA 1E98A 1R5NA 3QY0A 1N6PA 5KSOA 1KJWA 1JR3A 4A8JA 3NC1C 3KUCA 2GHIA 4RY2A 2OLKA 4LY6A 3SBEA 4UNPA 5DI3B 1BIFA 1FX0A 4QGGA 3HR8A 5F2EA 3H1TA 4TSFD 1CTQA 1SVOA 4PO1A 3R7WA 4JLJA 1AIPA 2OM2A 2J59A 3QF4B 1DS6A 4FI3C 4C0JA 2VL7A 5HTKA 4CT4B 4A0GA 1G7RA 3KQLA 5EUMA 1P62B 1NG9A 2JEOA 1KZGB 4NTZA 5EJEA 5JJKA 3AB3A 2BBWA 4W5HA 4QXAA 2GXQA 2RMKA 5IF9A 2IXGA 2OT3B 4EIWA 2WSSD 1U8ZA 3MWKA 4BLPA 2IYUA 2NIPA 2CLDX 2JA1A 3F0TA 1KIMA 4NPHA 1MKYA 1U8AA 4J0QA 4DDTA 4C4PA 3K0AA 1GKYA 1OPXA 1XX6A 4ZI2A 1Z0IA 1RW4A 1RYHA 1Z6XA 2ZRDA 4IDPA 1XWIA 1U94A 1L4YA 3FDIA 3CLVA 3GLIA 4BLOA 2V1UA 1IHUA 1OHHD 2KWIA 3B1ZA 4OJKA 3H84A 2F1JA 2FF7A 3MAAC 4FMDF 1PJRA 1Q0UA 1GFIA 2ZETA 4Q4HB 5FBWB 1D2EA 2V6JA 1W0KD 4LJ7A 3T06B 3U60B 2GF0A 2ZAOA 4MRNA 5DYGA 5C4MA 621PA 3UATA 1G20E 4XWAA 4N0EA 3U3KA 1YZLA 2YWFA 2WPDA 1FP6A 4JL6A 3T61A 5HKKA 2QP3A 1IM2A 4BWYA 1BS1A 1RYFA 2WIBA 2B21A 2MSEB 1BOFA 2XSZD 3F3YA 3DL0A 1JR6A 1YQTA 3K70B 5FBLB 3TQCA 2B7BA 2IYQA 3P4XA 5IHPA 3HP1A 4EAQA 2ZU0C 3ZYCA 5K8TA 3WYAA 2R8RA 5BYJA 4TT3D 2CL6X 2CEAA 1RFLA 2YWGA 2ZRAA 4DT1B 2ZSDA 5EXTA 2ZYUX 1FUUA 4QNRA 2QQEA 2ZE7A 4LYFA 3WP0A 2QUZA 1NN5A 3QG1A 3U5ZB 2QSYA 1E0JA 3QXXA 4TL9A 2Z0MA 2A30A 3KXKA 2J0VA 2CMKA 3AVXA 3WRYC 3VKWA 5D3QA 1OT3A 2QL6A 4QL3A 1J8MF 2XX3A 4Q4AA 1AS2A 5HZKA 1T0JB 2B92A 4LSGA 4TL8A 4QKQA 1RRCA 3LLUA 1FZQA 1Z28A 1Q1BA 5SZHB 4NHOA 1FPMA 4ESHA 1W7AA 2ZJ8A 3AF3A 4TMXA 3IBYA 1G4UR 4ZDKA 3NH9A 2D7CA 3S1AB 4DLXA 4B74A 4W9MC 5GADl 2GCOA 4KBGA 1DO2A 2P67A 3GMTA 4FCVA 3VX3A 1XTQA 1TU4A 1OKKD 2W6JA 3O8CA 2VH5R 2P2LA 2IW3A 1L2TA 1JNYA 2FPMA 3ECCA 4MDEA 1W1WA 221PA 2V1XA 1D9XA 3ZVRA 2QORA 3C5HA 5AUPB 2AL7A 3I5YA 1ZNXA 1GRRA 4IRUB 1IAQA 4MDFA 2O0KA 3CPJB 2VRWA 1E9EA 3CR8A 2J7KA 1ZVQA 4HI0E 4ZV4A 2PL3A 1F2TA 3AEZA 2Q6TA 2FV8A 3PV0A 4MRVA 4CF7A 3AVTA 3RNLA 2CLCX 1YR9A 5G3ZA 1IOZA 2ECKA 3B1YA 4OKSA 4UNRA 1OV4A 1XU4A 1DAEA 3W34A 3C7KA 4LWZA 4OQLA 3LO5A 4NH0A 1E2PA 1MO5A 3MWLA 2JLZA 2HDNB 4HEJA 3THWA 3T34A 5FBRB 5BWMA 4PANA 4HDQB 4M9SA 1ZM3A 5KNBA 3ZQJA 4YC7A 1VIAA 1KAOA 1E2LA 1FMJA 3AP1A 1QHYA 4R98A 2IYZA 3CW2A 2QG6A 4JMPA 1G17A 2NO0A 1TF5A 1OF1A 2YHSA 4Q5IA 5EE0A 1UBGA 1ZRHA 3UG7A 4LUCA 1JAIA 4E09A 3THXB 3EASA 5F9FA 1N6RA 3WYGA 4NE2A 4OHXA 1XPRA 3U44B 4BFSA 4NYMR 1M1YE 2WM9B 3GLHA 1U0HC 3DMDA 3LBHA 1GTVA 3A4NA 3U3JA 2AFIE 4ACAA 1Z2CA 3QXJA 4JLAA 1D5CA 4V0MA 1Z63A 4P32A 2O8DB 4PHTA 5JHHB 4JVNA 2BM0A 2VP2A 3EC1A 4EJSC 3WNBA 5HCIA 3BGWA 3NBZC 3T5DA 1YVDA 2MSCB 1MO6A 3PG5A 4WVFA 3A4LA 3QQ5A 2FFHA 2GETA 4URYR 2RGDA 1D8TA 2H18A 3B1VA 2B8TA 4C30A 1VCNA 3AVOA 3GJ5A 1A2KC 1QG4A 4H1VA 1KYIA 3V00A 1P2SA 2JJ2D 4P33A 4FIDA 1VYTA 2BCGY 3UWKA 3X1WA 3AF0A 4F38A 4KU4A 4CZ2A 3R8FA 4B3CA 4DC9A 1SHKA 4EPWA 4U7DA 1VECA 1G3UA 1SXJC 2HLDA 1T3HA 4TQUS 1CBUA 1F6BA 2ODEA 3CKLA 1P9WA 4DZZA 4URVR 2QBYB 4UKDA 2QZ4A 1U90A 1QHIA 3RS2A 2XNDA 4BGDA 2BMDA 4MH0R 5TV2A 3UMFA 2AWNA 2Q3HA 3B13B 5FI1B 2G83A 4NYMQ 4MUBA 4DDWA 1Z2AA 3VU9A 2OCAA 4C2TA 3LAWA 2WZQA 3B6EA 1G5RA 3C5CA 1GKUB 3GCGA 2VHJA 5LDDC 1P3JA 1N0UA 2GWHA 4DUGD 1HTWA 1RKBA 3I8SA 5LBIA 5FH9A 1UAAA 1HH4A 2D06A 1SZPA 4Q1FA 2NG1A 3T12A 2VP4A 1OW3B 1T5IA 3D8BA 4Q18A 3NHBA 5B57C 5EE5B 3B2EA 4GT1A 3ZH9B 3ZS9A 4B6EA 1AKYA 1ZAKA 5FPTA 2X8AA 2XXAA 2HYDA 4G01B 2IF0A 2C04A 4NL4H 2MSDB 3AKCA 1OFIA 3NDPA 5LD2C 3C4JA 2WVJA 1E32A 5GJWC 2WJGA 4FMBB 1FOEB 2DB3A 4P0TA 2VHTA 3K53A 4EDHA 1O87A 3THYA 4PQFA 4Q9LA 1G8FA 1ZCBA 2ZANA 3OIUA 1II9A 2C03A 2QAGC 4FXPA 2XEXA 4HLUA 1CIPA 1JR3D 3GFTA 4HLQB 2XNSA 3QNUA 1IXRC 3NEJA 3WP1B 3Q9LA 1KDPA 3DO6A 3ZIAA 5FBQB 2NGRA 2FU5C 2DWOA 1JJVA 3E70C 2DBYA 4G5RA 4B3BA 1MH1A 2EWVA 2OG2A 2GZAA 4AG5A 1N6KA 4Y0VA 3NWJA 4XSHA 5KHOC 1K8RA 3ASYA 1XD8A 4BFWA 1O3YA 1XEWY 2G0TA 2LWIA 2IYVA 3RYTC 5AUQA 1COWA 1FMLA 2BMEA 2PZEA 2OESA 2WKPA 4TWZA 1E9AA 4Q1AA 2QY9A 1OSNA 4PZYA 3B5JA 1E9BA 3CNNA 3ZVNA 1E1RA 4L9SA 3MCAA 1ZU4A 4JT2A 4ZI3A 4YLGA 3KQKA 3PQCA 4WW0A 1X6VA 3SJAA 2EYQA 1KI4A 1TQDA 4LYHA 1JQLB 2VEDA 4YQFA 4A92A 3AUYA 4TLCA 2WWIA 1W5TA 1Z6AA 2BJWA 1U8YA 4I1UA 4Q9JA 3IKJA 3KKOA 2F9MA 4G3XA 4YMSA 1IBRA 1W5SA 2I4IA 1Q21A 3SHWA 3RC8A 2FSIA 2WPDD 4JVMA 4NU0A 3LDAA 4B43A 3KDSE 4A9AA 1UJ2A 5HKKD 4DKXA 4O2LA 1GNQA 1IJFA 5BW8A 4RKEA 3AQ4A 2D2FA 3DOEA 2KI5A 1PLJA 2ZYWX 4JL5A 4Q1EA 2JJ1A 3THOA 3LW8A 1ZM9A 1XJ0A 1ODFA 2EWWA 1U98A 2WJJA 4DSUA 5TVKA 3N2EA 3QI2A 4PQRA 5DHFA 1ONBA 3EX7C 3QKUA 2VP6A 1R0WA 3SBDA 4EJSA 1E2NA 5JSZB 1I4TD 1DE0A 1NNEA 4AKIA 2BHRA 2D4HA 1S1CA 3A37A 2YV5A 3PEUA 1T0HB 2C96A 2V8OA 4QJ5A 3GJ7A 4ON9A 4UNSA 4WIAA 3P4YA 4ABYA 3W90A 1XJCA 2DR3A 3MRSA 5H8WA 3BC1A 4DIEA 3RS0A 4DDUA 4L9WA 3BORA 4W7SA 4CEJB 2P6RA 1DAFA 2XB4A 4IDOA 5EXPA 4DLYA 1GG2A 1KMQA 2OCPA 3GEHA 3CPEA 4L8GA 1FFHA 1X8KA 2ASEA 3GJXC 2WAYA 2Z5FA 3KKPA 3OEEA 2VQSA 3BB4A 2OO7A 3CH4B 121PA 3QSYA 1KI9A 5M04A 1MRSA 4PR0A 1XEFA 3ICQB 1BYUA 3K1JA 2Q9BA 1X86B 1NF3A 2IYWA 3U61B 2W2VA 2OSBA 5TDHA 2I3BA 3U4QA 4QGHA 5AJYA 3CRQA 4D0GA 1T91A 4KBFA 4HSEA 5FOTA 3NBXX 1JI0A 2GRJA 5BXQC 3ZS8A 3TQFA 1XJQA 2J0QA 4RCZA 3FFBA 1Z6TA 1TUIA 1W2HA 4GDFA 1HURA 3AKDA 1WBBA 2IS6A 3C41J 3T35A 3ADBA 3CX7A 3OIWA 1HE1C 2IYLD 4JJZA 2IF2A 3IO5A 3TW8B 5GVSA 1EGAA 1L8QA 1TQ2A 2DPXA 3RAPR 5HZHA 3CRMA 3GLGB 2HT1A 3O8DA 5J4YA 3D31A 2GJ9A 3I73A 3WHLA 5L3SA 1VHTA 1Z22A 2YNMA 4IFBA 3LQRA 5HCNA 1M2OB 4YMTA 2RH5A 4TYWA 4IVRA 2RHDA 4Q48A 4GNKA 4A8JC 3OIYA 2QAGA 4R2IA 5FPYA 5CM8B 1FTNA 2CCKA 2X2EA 2OZEA 3EA5A 1CKEA 1KY3A 4B48A 2ATVA 2JGNA 1B0UA 4UXHA 3PR1A 3LVRE 1NVVQ 3RWOA 2ZR9A 1DAHA 3X1DA 3GLGE 4G5GA 3SDZA 2ZI4A 1PVOA 1QRAA 5P21A 4LZZA 1ZUNB 4BECA 3WY9A 4MYTA 4Q01A 1F2UB 1E79A 1NL3A 3QKRA 2BBOA 5KUTA 2W83A 3JVVA 2IYSA 3AF1A 2HJVA 4ZIRB 2FN4A 2H57A 3U7EB 3OEHA 3QXCA 1Q3HA 1UADA 4XOIA 2ORIA 4LJAA 1KK1A 4M1TA 4H9GA 3BS4A 2UZ3A 4PSKA 2P6NA 1H8EA 1XCMA 3FHOA 4DJTA 3QIAA 4XWOA 1W44A 3DM9B 3CO5A 4M1WA 3EZ9A 1II0A 4Z51A 4NYJR 2J3EA 4UNNA 2BC9A 4QRHA 1Z0FA 3U2QA 1OH7A 5L3QB 4QNMA 3SHFA 1IQPA 1DVRA 1XD9A 1E9FA 1ELOA 5KSYA 3EG5A 4M9QA 4P4SA 2HLDD 2BV3A 4C0QC 3KJIA 1K6MA 3A4MA 3OFND 4A2PA 4QHSA 1S4QA 2QSZA 5KSZA 4F7WA 2ZVPX 4POAA 2XNDD 4XSGA 1S8FA 4LBYA 4B32A 1RJ9B 1R5BA 3CNLA 3KQUA 1LV7A 3WNDA 1N25A 3PFIA 3K9GA 3Q7PA 3VQTA 4TZ0A 2ODBA 3BBPA 2A5DA 2Q9AA 1LW7A 1XFAA 4IDNA 4A0FA 3ADKA 1D2MA 1SQ5A 1ZD9A 2CBZA 4JBXA 4URZR 2WIAA 2PJZA 4NCJA 2O8BB 4GMXA 1BKDR 4K8OA 3WXMA 1KNXA 1GWNA 4NCNA 5CDFE 1R8SA 3QPUA 3UWOA 1E96A 4CEIB 5D3MB 1E9SA 3BK7A 3TW4A 1KNQA 4Z8XA 4TYQA 2QMUA 1NN1A 1GZSA 1KSJA 1EWQA 4OK3A 1LY1A 4LJ6A 2PEZA 1VYUA 4ARZA 4KO8A 2GESA 4TQ9A 1NY5A 5L8VA 2PCLA 1E0SA 3TE6A 2EFGA 1QHSA 4FCWA 4NYJQ 3IILA 3TAUA 3GEEA 4JLDA 1YE8A 3KJGA 4MKIA 2QE7A 5EP4A 2ZU6A 1EFCA 5EZ5A 721PA 3ZIAD 1G5PA 4JL8A 1X1SA 1HT1E 3CF6R 2QTVB 2ZYTX 4LJ9A 4XVUA 1NIJA 1A7JA 4ERNA 1E2JA 4TMTA 1N6LA 4B3GA 5ELXA 4E03A 1ZM7A 4TTQA 2PLRA 1E4YA 1GILA 3BFKA 4Q02A 1SVIA 1L4UA 3FFAA 5AJVB 4KLNA 4F4JA 1WBDA 3ZD7A 1M7GA 2BOVA 2OHFA 1FNMA 1X1RA 3W5JA 1COWD 1G4AE 821PA 5FPSA 1FQKA 1N5IA 1Q1EA 2FEMA 2Q3MA 4MA4A 4II7A 3FPAA 5JECA 4LHWA 1XP8A 3BOSA 1S9HA 2ONJA 4MUAA 4RFSB 3HYTA 3P27A 3QEOA 1KI6A 1Y63A 5DI9A 3B60A 3G82C 1QHGA 4XWKA 4BFZA 4Q4JA 1X3SA 2VHQA 1YR7A 4D25A 3N2IA 4IKEA 1AGPA 1XB2A 2RB4A 1U9IA 4OQFA 1US8A 1G18A 3BIFA 3U7FB 1PLKA 2SHKA 1CRQA 1GP2A 1XEXA 4LPSA 4X8OA 3GQBA 4NBSA 3CIOA 1S9DA 1ZJ6A 5C46F 4A1FA 2Z4SA 3VR6A 2IYXA 3O47A 4DSOA 3IGFA 2HCJB 3SYKA 1KK0A 4O25A 2ZRCA 4P31A 2ZUBA 2ZJ5A 1GAJA 5A0FA 2FMXA 1XD2A 1AN0A 1Z08A 3SFVA 1OJLA 3FMIA 3O8RA 4WXPA 1GL6A 4TMWA 1LNZA 1UF9A 5DLQC 1KI8A 1EFRD 2B6HA 1UM8A 3BE4A 4BZXA 2R62A 2J0SA 1IXSB 4HAZA 2ZE8A 4MITA 1PZNA 2ZJBA 2OLJA 2ZS7A 5CIQA 2W58A 3ZZ0A 4DRZA 1II8A 3OESA 1Q12A 3IDQA 3RLFA 2TMKA 1GSIA 1EX7A 2EFEB 4IXNA 4PSAA 2C9YA 3UK6A 5DI3A 2VSXA 2Z4RA 4OJQA 2YOHA 2BMFA 4PZZA 3IO3A 1SKYB 3SU8A 3I3SR 1SXJD 3LX5A 1NI3A 2ODNA 4EUNA 3IEVA 2HF8A 5CJ2A 5K8LA 3NDBB 4U00A 2NPFA 1OIXA 1JEEA 3OEED 1VYVA 3QF4A 5H68A 3X1YA 3X1ZA 2HYIC 5GJBA 2QMOA 1JBKA 2R6CA 4XD7A 1Z6GA 2W0SA 2JLWA 4ITRC 4A4DA 3BH7A 5KO2A 3RWMB 4U02A 4LJ5A 4ZDIA 2NO1A 4WZBE 4KLZA 3RS5A 2H92A 1S3GA 1TEXA 3KTAB 1SKYE 1ZW6A 1KI7A 1Q22A 2NZJA 2ZQ5A 2PEYA 5JWHA 2CHGA 1CRPA 3X1XA 4M2LA 3PUZA 1ZINA 4MKHA 1W0JA 4TYYA 4AYWA 3VKHA 3AH8A 4MGZR 3AUXA 5A4JA 1Z06A 2ZS8A 2GJ8A 2GEVA 1KJZA 1QF9A 1BMFA 5KPJA 4Q4HA 4ZKDA 1DAGA 2KJQA 5KSPA 1N5KA 5CIWA 3EZ7A 2CE7A 2PX3A 4EPYA 3CWZA 1C1YA 4Q9KA 2ZRKA 4UQOA 3SJCA 1XTIA 4TTPA 1DELA 4EFLA 4M4SA 2REBA 2YWEA 3WRXC 1U81A 1IN5A 4OQXA 4EPXA 1CEEA 2WMOB 1KI1A 4HLUC 2PBRA 4BFUA 2XZOA 4EPTA 3AVYA 1I2DA 2FPKA 2NZ8A 4HDOB 4XH9B 4AYXA 3CBQA 3KX2A 2R6GA 4OI1A 3FKSD 4KFSA 4PC1A 5FR2A 3L82B 4DT1A 2F1IA 2GCNA 3LA6A 4D82A 5GVRA 4M1KA 3WMEA 4A2QA 3NXSA 3SN6A 3HJNA 2WWWA 1UDWA 4ASUD 1NMXA 5JHGB 1MO4A 4GMDA 3T1VA 1E79D 1S96A 3KKNA 4H1UA 1LS6A 1ZBDA 1H8HD 4FWTA 1WXQA 1Q44A 1SVKA 1G7CA 2AWOA 4JLMA 1FP7A 4V0LA 3GFPA 3T1QA 4OYHA 4JJKA 1DO0A 1HT2E 1M7HA 3UANA 2BCJQ 4PHHA 4I1OA 5GJCA 5BN5A 1H65A 1H8ED 2GTPA 2ZS9A 3EIEA 8OHMA 1KMHB 3HWSA 3CH5A 1KK3A 4MGKR 4A6PA 5JS7A 3SJBA 5J47A 5IRCD 1M7BA 2AKAB 1MV5A 1IN7A 3WMFA 1G7TA 3RVBA 3S1AA 4LC0A 2JATA 1DPFA 5IK2A 4C0BA 4HAWA 1UKEA 2C98A 2J41A 2AXNA 4DCTA 2IK8A 1ZU5A 2ERYA 1WQ1R 3J81k 1ESNA 3DKVA 5FTMA 2O8FB 2CHVA 5C1BA 4C0LA 1NKSA 4IVPA 2ZREA 4NYIR 3TNFA 3HDTA 3IQWA 1VMAA 1MOZA 4A0RA 5FR1A 1MABB 1T3LA 3M0EA 5TARA 1G8HA 3PEVA 5EXSA 2OBLA 4URUR 2QRZA 4FMCB 3QJYA 4XJXA 1KTVA 1YKSA 5EXXA 1E2QA 3UMRA 5IDVA 1KHTA 4HZUB 2GJKA 4AKHA 4W5JA 2V7QA 1YU9A 3QOFA 1U0JA 5LB2A 1J70A 4D81A 2VPPA 2RGAA 1CP2A 4DLTA 3RANA 2VYFA 5AK0A 2O5VA 4D4MA 3QXSA 1C4OA 4JT4A 2ZRJA 3BRWD 4RZ3A 2BWJA 2NO6A 3VAAA 3T5GA 2OILA 2EYUA 1Q1ZA 2R6AA 1FW6A 4DBLC 2A78A 1NKTA 1K5GA 3FGNA 2WKQA 2ZI7A 2LKCA 3THXA 3GLFB 4KHZA 5JWRA 2YINC 3MFYA 3TR5A 4KXFB 4RD0A 2GKSA 3U44A 1AZSC 4KFUA 1CF4A 3TIFA 2IS4A 3BH6A 1NVWQ 3MSXA 5KPDA 2YYZA 1W49A 1S2MA 3AKYA 2I1VB 4WOPA 2VO1A 4EQ6B 5KDDA 4HB0A 2LCFA 4Q9HA 1G5TA 4HUQB 4M9XA 2VHCA 2IC5A 4BASA 4M21A 1JXMA 4GFDA 3CM0A 5CLLA 3HYRA 4OK6A 2O8DA 1P72A 2CK3A 3CRW1 2A2ZA 4TN1A 2ZJOA 1FTSA 1GDDA 4DEXA 4PO9A 4NYIQ 4C0AC 2Q9CA 1NBME 3F5FA 4KFRA 4FMDB 5G41A 2OFOA 5JS8A 1WE2A 2OAQ1 4IW3B 3KKMA 4Q47A 2VF7A 2Z83A 1ZM2A 3VMFA 4BQSA 1AA9A 1X8LA 3PEYA 4URXR 1J90A 1OXUA 3K9HA 2ZJAA 1JECA 4I1VA 3QF7A 3AP3A 4PX9A 2JDID 4JLOA 4Q21A 2BVNA 2WBLC 1IJEA 4IXMA 3PXGA 5JI3E 4HLDA 2DCUA 1N6HA 3FTQA 3QENA 1P2VA 4RVCA 4RSGA 2AFHE 1CJVC 3AVQA 3IIMA 3O8BA 4Q7LA 1W36B 3RRZA 1YZNA 3D7MA 1ZD1A 4D0LB 4M8NE 3VKGA 2QBYA 2K5UA 1GUAA 2EVWX 3WNCA 3A6PC 1TF7A 1N2CE 5H1YA 3W9YA 2KB0A 4LI0A 2IUTA 2IS1A 3RRYA 5J4HA 2FSGA 2WJHA 2IXEA 3DHWC 3IIKA 3L0PA 4Z1MA 2OFXA 4B3DA 4M53A 1UBEA 1MR3F 2D3WA 2GAAA 1Z0AA 4YMUA 2JIZA 1IONA 1QZXA 1KSGA 4NMMA 1ZUHA 1P7CA 5DN6A 5C4GB 4AD8A 2XJ9A 5CK5A 1PUJA 3MWJA 5DYIA 4KYUA 2PH1A 2NO7A 4GI7A 4HZIA 3N70A 3ND9A 1KO1A 2KBEA 3SI7A 2GZHA 3RDPA 4YXWA 3EPKA 3TLXA 2D62A 4GOXA 1TNDA 1NJFA 3AP2A 1TTTA 2J1LA 4M0LA 1Z8FA 4BZPA 2OXRA 4OHVA 3FE2A 4Q4LA 3VHXA 5HPYB 4B76A 2CCGA 2MMGA 1E1QA 2FSFA 1G8PA 4C7OB 4V03A 1DARA 1J2JA 4GPTA 5J4LA 2G1KA 5F9HA 1OXXK 5AR1A 1TL7C 2ZEJA 1VG8A 2G3YA 2EFHB 2RKOA 5AJZA 4ILEA 2ZITA 2EQBA 4EPRA 4DDVA 2QTHA 2BDTA 1IXZA 4MGYR 2NPIA 4AURA 4CIDA 4DLVA 4Q03A 2AN9A 3PJRA 5DNYB 4AKGA 4DCNA 3TSZA 3FHTA 3H86A 4GOKA 5E4FA 1D9ZA 4DLWA 4V0OA 5JLJA 2AKYA 3HU2A 1E6CA 1ZP6A 4QBIA 2PLFA 4TTRA 4ZO4A 1RRPA 3NC0C 4B33A 3IHWA 3OAAA 2WWGA 5LPNA 1QHNA 1G21E 1SVSA 3BWDD 1CLUA 3SC3A 3K0SA 4RD3A 4X8LA 2O8EB 3MJHA 2BKEA 4IOMA 4WZAE 2V3CC 3UMSA 2FFAA 1QHHB 4HAVA 3L8ZA 4MRSA 1Z83A 3LXRA 1DOAA 4DCUA 4BZQA 2J0UB 5JCPA 3U3MA 5FUXA 2WWHA
chains in the Genus database with same CATH superfamily
2WFMA 4ZO9A 4L02A 2QP4A 5F7JA 3BWCA 1HE5A 1QYVA 2H4HA 3E0QA 2Z1MA 2CF6A 4Z9XA 4G4JA 1KVRA 2J4DA 3D6TB 1NE7A 5BMVF 5IDQA 4G23A 4LOAA 2IYRA 4RPLA 1G21A 1H4VB 3HBLA 3QNWA 3LL4A 2L0XA 3M70A 1CE8B 4AO8A 4D43A 1XE3A 3PHIA 4YRBA 5B64A 2WKWA 4V1CA 1P2UA 5KOIA 1BYIA 3DULA 4W7HA 4JV5B 1RYDA 3OEYA 4RLQA 5EIXA 4GPAA 2QTMA 5FWYA 4ND5A 4YJHB 1Z29A 3U4HA 2AD5A 1ISHA 3B1XA 4Z2AA 1WMBA 2UYQA 1LD3A 1PHRA 1LWNA 1QHEA 1X1AA 2EP5A 2FPGB 2GAOA 2BE9A 2P65A 3CRNA 1W4ZA 1KEZA 4LGCA 2QV0A 4PN3A 4D4KA 2PMDA 2ENUA 3TH5A 3TJZA 1EVZA 4ENWA 4YUYA 4H1WA 3SQLA 4DR5B 1W581 1M6VA 3A9RA 4KYTA 1RM5A 1NYRA 5FOUA 3AUKA 4H2DA 5HILA 4P0QB 3TQHA 1T5HX 1PIWA 3WJ1A 5I7OA 1PUIA 1KY4A 2PYIA 1ISRA 1MZVA 2AQIA 1L7BA 1DB3A 1YZGA 2BGMA 1HRDA 2W6JD 2PT7A 3KEMA 4BNHA 3H65A 1HE8B 1M76A 2DUNA 2WFAA 3FZNA 4OQQA 1XKXA 2XB8A 3A6GA 2F43B 3MQ4A 4MQBA 3IPCA 3SWWA 1EFPA 1U99A 2YFKA 4RJLA 3EZ2A 3WAKA 5EJ7A 2Z58A 1XAIA 3LBIA 4MROA 4JH0A 1X87A 3GF4A 2CLIB 3TNLA 3VH4A 3ZE9A 4CM9D 2O8CB 4CQMD 1EWVA 3EN0A 3G79A 3VX4A 4KRYA 3NTRA 3H4MA 5FTNA 3AUUA 4AVYA 4GI5A 2D7JA 2A9PA 4NU6A 1IN6A 2OBNA 1RZ3A 2WAXA 2YRWA 3N6RA 5KYKA 3QX9A 2C2ZA 2FFBA 3JARB 3PENA 1V71A 4X7BA 1J21A 1RHUA 4XR4A 2J3JA 2Z3ZA 3ND6A 5ELLA 4RS3A 2WUGA 3ZY6A 4EPVA 2ZRHA 1TAGA 2XHZA 3IQHX 3IXMA 3M6AA 2XZPA 3H1GA 3NHSA 1HSOA 3B1WA 3EPJA 1JALA 2D1TA 1QVRA 2DWUA 4DLKA 4KSBA 4C4RA 2ABWA 3JAWA 2W6OA 2BHLA 1U9IC 2ZT8A 7ABPA 1YRAA 5BORA 4Z4HA 3AKZA 2XTAA 4LPKA 5BQ3A 2QTAA 5HOQA 1K6XA 3VVLA 3FSJX 1F06A 5KWIA 4M36A 1T8UA 2IYPA 1TT7A 2GJSA 4GM0A 4Y9UA 4CM5A 2FP3A 1TA0A 1VMKA 4RKFA 2FFQA 5T41A 2ZB3A 5JXIA 3NORA 4U7GA 1A1VA 2P5YA 1PEAA 4RMGA 1NFRA 4KE8A 1KF0A 2JCYA 2CHEA 1XSEA 1I4DD 4YP6A 3RCBA 3RI3A 2C7GA 1TDJA 1E0KA 1KYYA 1TUGA 2OP1A 2VDUE 2VSOA 3CH6A 2P6PA 3TEJA 3ZK7A 4DQLA 1DFHA 4F8YA 5ITSA 5F73A 3OG9A 4OIMA 5E7MA 4RK1A 4JMLA 1LEHA 2GYUA 3A3NA 1FNCA 2F9LA 4GD3Q 1R7RA 1MPTA 1SQGA 4YJGB 3LGXA 3N7UA 4ENUA 4ZYVA 3GLGA 1C1DB 1Y1TA 1SCBA 1M8JA 5DM2A 2VHZA 5B58T 4BFTA 2EP7A 3VDRA 2QY6A 1A2BA 1FYWA 3QV1A 4RQAA 2GEDA 3KQQA 1NRWA 1IZ0A 2JLRA 1Y5MA 1R10A 1JHPA 1C7QA 5EIFA 1QFMA 2VHEA 9GPBA 2P5UA 4W5WA 5CM9C 3ABSB 1GUYA 3H2KA 2XUJA 4HX9A 4X0EA 3H17A 4L4YA 4K1XA 3DV0B 1L4NA 3B2QA 5JARA 2BFCA 1ECGA 3NP9A 4PLFA 4YRJA 4F2DA 4B47A 2Q5FA 1NUAA 3L4KA 4RD6A 1ZLXA 4FPXA 4FE3A 3O9ZA 4OUDA 3QELB 1L1FA 2CVFA 1EAMA 5BN1A 1HZJA 4BTLA 1OFGA 2G08A 2Q1UA 1TCAA 2DFPA 2ZE6A 1F2UA 5FPQA 3ZY2A 2GN2A 5AESA 5IX8A 3D1LA 1FFEA 4Q6BA 1PQUA 4L4SA 1DEKA 3P96A 4PLTA 1Q7CA 3JYQA 3KSRA 4YNBA 1BA2A 5F21A 3SZRA 2V97A 4C3VA 4ZHQF 3A9UA 1JKFA 4FOLA 2EJTA 4F92B 1PR1A 2QW0X 1Q0PA 3WK8A 3O6VA 2JLXA 1UXOA 3CS3A 2CLSA 1V5WA 3IAXA 1F4VA 3GHHA 5AVOA 3ZUGA 1P5FA 1XTZA 3DPIA 3VYTB 3ADDA 2WTUA 3PXCX 4UM9D 1BJKA 3SSAA 2O1SA 3OWHA 4C20A 1P3DA 5K8IA 3ZHXA 4KGXA 5B2ZA 1ISJA 3TKYA 4Z3KA 3E48A 3Q2KA 2CDNA 4PWZA 4RZ2A 3UT5A 1G6HA 1I80A 1OH8A 4IEIA 3X2EA 1N77A 3WBJA 3R3VA 1AY0A 5EPOA 2P3SA 3CUWA 3GRCA 3OE4A 5L4LA 1R8QA 3NBKA 3O2NA 3IB3A 2JIPA 4V0SA 3KWLA 4PC2A 4M8KA 2CWDA 5ENZA 3ZWQA 3KDAA 2QIOA 1L8OA 5DWQA 1NDHA 3GLTA 4Q4CA 4WBNB 2A7QA 4GWKA 1BHSA 2A57A 5CXUA 3EZGA 3WHPA 4QDJA 1XAJA 3FSGA 2IYAA 3MCZA 1WDWB 4HQNA 3RODA 4CEHB 3H5RA 4DR4B 4K6GA 1O97C 3I2YX 3NBYC 4PSCA 3K15A 3I83A 5DLPA 2H8KA 5AIBA 3N86A 3GHYA 4D9IA 5F7OA 2JVJA 1E6LA 2XKBA 2R65A 2Q3FA 2DJ5A 3IBFA 2NNWB 5DCYA 4PIPA 2AG8A 2JC3A 2GBPA 3G1UA 3ISVA 4O2BA 3DLHA 1S4MA 3DDHA 3WL7A 3K30A 5DLEA 4MS1A 1YVUA 5CT5A 3QTLA 4ZO6A 3WGYA 2WNSA 2Q6KA 1RP7A 1U2EA 1H23A 2FFRA 3CR3C 1OLOA 5J4VA 5TJ9A 3GEGA 1ZK3A 2FXIA 1GRQA 1T1JA 2Z3WA 4O2RA 4Q4JB 1HLFA 1E6UA 4C3OB 4JI4B 4PEVA 5LMNB 4GC9A 4YP9A 1YS6A 2ZR0A 1FS5A 1KBOA 4MIKA 3TTXA 5LZ9A 4PGFA 2XYQA 1MJHA 1E1QD 4I5DA 2ZSBA 1N3IA 3QM1A 2NU8B 1VJ0A 1N32B 1KAGA 3L7IA 3VPXA 1HYBA 2X86A 1JQ5A 4GP7A 4HTAA 3R5TA 1I3KA 5LXTA 1N2GA 4Z7OB 1G8YA 5ALEA 5DYTA 2WOJA 4F9FA 1EKXA 1N9GA 3F1KA 3FXAA 5BO5A 3ZI4A 5L51A 3ZWVA 1NW3A 2Q6VA 1AD2A 2K7ZA 1J2YA 2ZTSA 4HQKA 3LQ2A 4MQ4A 3T15A 4AJPA 1DIRA 4WWHA 2XUZA 2R85A 4GNRA 3LHKA 3HUUA 1OFUX 2DAPA 4FTWA 5MN5A 4ZMBA 4NXMB 1V3VA 4ZAYA 3WGUA 3ZEIA 3VZCA 3A4YA 5CITA 5E1OA 4Y2UA 3B6ZA 5HFAA 4FX2A 4DWOA 4F5EA 1X0XA 2Q2VA 1F60A 3E81A 3FPEA 3HYCA 3KK0A 3ZJ4A 2PMCA 2RHOA 2RGGA 3HN2A 1Z62A 2X13A 1LVUA 2XWBF 1B00A 3QVWA 1GM5A 2XODA 1NXTA 5E9QA 1VG9B 3PI6A 3GJ4A 2P7IA 3SZOA 3V4SA 4AQ7A 4EGJA 1SFRA 3HB1A 4MR9A 2VBCA 4RFSA 4Y2JA 1U9ZA 5ALZA 1OX4A 1ZH2A 1D5WA 2PZGA 2FKNA 3OLCX 2G88A 2IU4A 3RSOA 3R23A 2H00A 3I52A 4CF5A 1SCQA 3CVYA 2EL9A 1QMGA 1L1RA 2WKRA 3M6VA 5JLAA 1NJGA 2ZJ6A 3CXUA 3C3PA 1KO7A 2IKQA 5B3JA 1ESZA 1LBHA 3P8ZA 2D1FA 3UAXA 1PYOA 3TXXA 4IGKA 2Q2WA 4LYAA 1LXCA 1GKIA 4IGEA 4BYMA 4TTTS 4XUDA 1K0FA 2WUFA 2PUVA 3MINB 3QVVA 2YQ5A 3QPWA 5K2MA 4PZ9A 3KD3A 4OREX 4LTMA 2PS3A 4B73A 1Y1KE 5AW1A 4DB4A 4W5OA 3HGMA 2Z4TA 3NG1A 3FOZA 2O50A 1QP7A 1MFZA 4M99A 3JZFA 2Q8PA 4PYKA 3UYLA 3HM9A 1PJLA 4NH4A 2WAOA 3QE4A 5FPKA 1E1CB 2MSNA 4FHCA 2HADA 2VH1A 3KOUA 4P93A 1HKUA 1UPUA 4OSEA 4R1PA 2YYYA 4ZOQI 1G42A 1KSHA 1KJQA 1W1UA 1W5EA 4NQRA 2PZFA 4PFSA 4TLAA 4FD3A 1AGYA 4OV6B 1AKWA 1T36B 3RVPA 4Q4AB 1E6MA 1NOKA 3T0GA 3T1HB 2W42A 4UREA 3OIVA 3WKEA 4M9CA 1F2DA 1DAIA 2P3QA 5DXFA 1DX6A 1SHJA 4MVJM 3AC0A 2PWBA 4JVLA 1RWBA 4RNDB 3MM4A 4OFBA 2BFEB 4NCHA 3KD2A 1VKZA 1U3UA 1NUQA 2GAIA 5HA5A 2C84A 1AM4D 2YWBA 1SVMA 1GL9B 3FWYA 1AK1A 3HYSA 2FWRA 4S1NA 4Z6KA 4E5SA 3FYTA 4MVJP 2QQGA 1R15A 5JVDF 3NIDB 2HRZA 2N75A 4WZBA 4MV0A 4WACA 4C89A 1KDTA 4UEQA 4WBXC 1BWPA 3UTCA 2PTHA 3DZ8A 5JJIA 3IIJA 4AY5A 2GNOA 3HP7A 4IS2A 2WSYB 4IS3A 1YTUA 4K1LA 1UBCA 5JFOA 1FUEA 2ZSFA 3II6X 2PRIA 3MERA 1OYYA 1HZZA 2BFAA 4GR5A 1UM9B 1V48A 1W30A 3NIGB 5EP1A 6CHYA 5IAAA 2EAUA 3BMCB 3L0OA 1D4ZA 1Y6QA 3F8TA 3ZE1B 2NOAA 1GQRA 1F2TB 3FFXA 1DDIA 1HSZA 1ZRSA 3DYBA 3PUWA 1N2JA 2GPJA 3CG4A 3O3OB 1QRRA 4IJMA 4G37A 4K40A 3KTAA 4P86A 4BO4A 4NHEA 1TF2A 1NU8A 2LIVA 3OP1A 3EFOA 4HDSB 5JEDA 1XNJA 5ICFA 1I5RA 2IU0A 2ZP1A 3NHZA 2WAMA 4TRRA 4BPRA 1NXPA 1V16B 2NU6B 2VTVA 3S7ZA 3U81A 3KR9A 3W5SA 3RABA 1RAEA 4MCHA 5AI0A 2HA7A 3P2KA 3H42B 1OFVA 1KXJA 1ESCA 3ESBA 5FTJA 1RLIA 3JZIA 4M8SA 4H4DA 5H70A 1JLSA 5DNWA 3CLKA 3V3KA 1VA4A 2Y27A 1BXGB 4D9FA 3ZJTA 2GILA 4MKXA 2CXOA 3HBNA 2YXDA 1CR1A 1GNPA 1GGKA 3FA2A 4M8IA 4UXJA 5EMJA 4FOTA 4B17A 3OEHD 2C07A 1PZHA 3CVWA 2Y68A 4PZDA 4DPMA 4LHYA 4OEHA 2CMGA 3BK1A 3WKBA 3WLRA 1OY1A 1XDDA 1CZHA 1VCOA 3KXIA 4HNHA 4Z8YA 2C29D 1CYEA 4EHKA 1OCEA 1ZSNA 1RBZA 3L0CA 3IJEB 2WICA 1XTUA 2DHRA 2IL1A 4RZXA 2IX3A 4LMBA 1DU4A 3CUKA 3Q3IA 2GZ1A 3OM9A 4Z0PA 4XGNA 4AZTA 2V7WA 1RPZA 2SNIE 3G2PA 2XZLA 2IUSA 1UOPA 4ZC1A 3BFVA 1HO3A 3GJZA 3D4IA 3THRA 4EGSA 2YHIB 2IZOA 4I4TB 3ZGYA 2J7PA 2AOXA 4LYDA 1QLWA 1QONA 1YA6A 4YV7A 5M2QA 3FMPB 4MS4B 5LZ2A 1VHWA 4EGFA 2X0DA 1I4EB 3NVAA 6AT1A 1XQVA 1AS3A 1X7DA 3BIXA 1LPNA 1V3QE 2P78A 1IMJA 1BKSB 2QN6A 2ZUDA 4I66A 3PNPA 5B2EA 1QF7A 2AFIB 2W2KB 3LWZA 4J1NA 4TT8A 3Q7SA 1Y89A 1UZUA 4X66B 5JBQA 4PNEA 3Q7QA 1MF7A 5G0UA 3KB1A 1YBVA 3AIKA 2RGBA 2R66A 3OHSX 4ZYYA 1TCUA 4PVCA 2G9UA 3A6FA 2DT5A 3CT6A 3ZHZA 1UKYA 4C6HA 1V47A 4JC4A 2VTKA 1KIAA 1A3CA 2O2DA 2ZRMA 3HI4A 3KTDA 1AS0A 4NAUA 4PU0A 3NDIA 2GD2A 4ZO7A 1NC1A 1L8LA 1J9EA 2IZ7A 1LBQA 2Q5HA 3F47A 2IOFA 1G64A 7MDHA 3OWOA 2QROA 1IZYA 3ZLJA 4XWWA 2A5LA 4PPNA 5DT2A 4RWZA 2HF9A 3TGPA 2YWDA 4B3HA 1SCAA 4GPEA 3FMOB 1PE0A 2VPQA 1L7VC 2VFAA 1UDBA 1N1EA 3EGXB 3LK6A 3PQ7A 4UATA 2F3UA 2O8FA 2APJA 2VKQA 2GH1A 3EAGA 4NULA 3R9IA 3VU9B 1S1MA 1DG3A 1Y8ZA 1VZ3A 3A70A 3R3JA 3QG5A 2JK1A 3LVBA 1K5DA 4MWCA 4OHKA 2DPHA 1FDVA 5DF1A 5IBQA 2PNJA 2HJSA 3KUDA 4EECA 4Z0NA 3CZAA 5C53B 3FSGD 4CCWA 1N7IA 2Y1WA 1KO5A 1HDGO 5F98A 3QQPA 3VSCA 3DLCA 1A76A 4ZCIA 3DZBA 1OWLA 1RBMA 2OC4A 3M3DA 1E2IA 4R40A 4HAXA 2NX2A 1UDAA 4HDAA 1CZKA 2NUAB 1YB5A 3A1WA 2QT1A 4NZOA 3KUXA 4BRWA 1BH2A 1R4MA 3AFGA 4F91B 2A33A 4NARA 1ZL0A 1UJMA 1HDXA 3ROPA 1XZEA 3R20A 2HWUA 1U1CA 3D7NA 2QM3A 3WWOA 1YCHA 1Y48E 1SPBS 1CJKC 1E4VA 2UU9B 1GA6A 1P4GA 3GCXA 5AKYA 5JC1A 1JFSA 4XYMA 4E15A 1VJCA 5IZCA 1SUAA 4KRXA 4US0R 3TOZA 4RH3A 1ZZGA 4AZVA 3CSDA 3AU8A 2DECA 2OE2A 4FSXA 3GAMA 2WJPA 3L0SA 1ZVJA 2D8AA 2H4FA 1O4WA 3B1KA 3VR6H 3QSGA 1LBEA 1AQUA 1I2MA 4V0KA 1N33B 3DMTA 1Y3AA 2G77B 2CNDA 1LPAB 4GOLD 1MNAA 1ZN9A 3GU3A 3I5MA 3KVVA 4HDNB 5DX1A 5F1OA 3ZCXA 4LF6B 5BYKA 1T4CA 1GVHA 4NI5A 4OK5A 3TX2A 5E0KB 4FBGA 1TKCA 2CL5A 3WLMA 2GR9A 5DNDA 3SCZA 1QPZA 2QXUA 4K9DA 1XMIA 1AXGA 3PD1A 2PD4A 3SHTA 4JXZA 3TZEA 5AUOB 3PL1A 5U9CA 1VSTA 1XRNA 2Z8YA 3SE0A 2W8BB 3ZCTA 1OLUB 2AFHA 3PIRA 4KYIB 3ZS8A 2UYYA 3CLTD 4JJGA 4JLPA 3IKLA 4QOSA 2FMHA 4BX3A 3AHEA 3HVIA 1T34A 3DCNA 4HLCA 3TLJA 3X0DA 4D9HA 4ENRA 4TRNA 2RGYA 3HM2A 3Q72A 2GZ3A 2WF6A 2O7VA 1X7YB 1ZMXA 2FR8A 4EHLA 4B0OA 1PG5A 4WCFA 4LF7B 3UBMA 4QYXA 3W6OA 1QB8A 3U0VA 3T4UA 5AM0A 1FUKA 3PQ3A 2OFFA 4WMLA 3U9SA 1J7KA 4GF5A 5BUZA 1NG1A 3F90A 3UMBA 2X9NA 1IY8A 3PYMA 4EVRA 4C4TA 2JCSA 3DVLA 1B7GO 3O2JA 4FS3A 5AJWA 4B4OA 1E94E 3MK31 4NE7A 4RENA 1VBMA 3AL2A 1TYBE 1GCAA 4PICA 1YS4A 3TW0A 1MO3A 2AJ8A 5FRDA 2J48A 5DHPA 4DM7A 4ISBA 4XTCS 4WJLA 4ISCA 5B58C 3STHA 1ZKMA 1N7JA 2PX2A 1WV0A 1I2ZA 2XB9A 1PT5A 1L5WA 2CKMA 2ZRNA 1QQAA 5CNMA 1GCUA 1NXXA 3KOZA 1G41A 4BO9A 4EI8A 1PQ4A 1SY7A 2H52A 4YCLA 3O94A 4MGEA 1KAMA 4QHYA 3B89A 4P6VF 3A7DA 3PDIA 2I22A 3D5EA 3E1SA 3MLBA 1HTTA 2QPAA 3HS3A 2WTBA 4E3WA 3NGXA 4CDNA 2ZM5A 1DLIA 1F5SA 2EX1A 5FORA 5TLSA 4QFMA 1EUQA 2CSUA 1OH6A 1M74A 1V11B 2EU8A 3ORYA 2WWXA 2VXCA 3Q2IA 3UKDA 3L7JA 5DHUA 5H16A 1MW8X 2VSFA 1Z0KA 2JI8A 3BHNA 1PDVA 3W6UA 3WLHA 10MHA 3AUAA 4E07A 1FFAA 2ZT6A 2AD1A 1QLJA 1YB1A 3GEPA 4UBKA 3WICA 3F8WA 4DAEA 5C37A 1RYYA 1UZLA 2FZ4A 2JFUA 2O52A 1XU9A 3MAJA 5LQDA 1RLUA 3WQSB 2CLLB 4N1AA 1MQSA 1TA9A 3QWBA 4O2BF 2ODWA 3KKZA 1L7AA 1NMYA 4BFVA 4I1IA 3KSUA 3MJTA 4HH3C 1HDEA 3K0CA 1G7SA 4IL5A 2JGJA 3W05A 3GW8A 4M1SA 3AJAA 4G97A 5AM3A 2QRMA 2OKGA 1KYTA 3JATA 2H1RA 3GBPA 3EQ7A 1L7XA 4MV3A 4LW8A 1OIWA 1YBAA 3HPQA 3BJIC 3EF3A 4TSFA 4IEEA 5AFSA 5BV8A 2UYOA 1BMFD 4IH4A 4XFDA 5AK3A 2JAPA 4JGGA 4R9UC 1E3IA 1P9NA 3FB4A 1TCCA 3QE2A 4IQGA 3VR1A 1SZJG 3E3AA 4I7EA 2HXYA 4IJUA 1Q19A 2A0KA 3NYIA 1SHTX 3RIHA 2WZCA 3AVWA 1JLMA 4FFRA 3GB9A 2HNAA 2QI9F 4G0VA 4Q66C 3HUFA 1AHIA 4J8PA 4OQMA 4QICA 1NP6A 2LVBA 5LXTF 5I51A 3TUIC 2X7XA 3V8MA 2V74B 2XE4A 2GN8A 2ZBUA 5AUPB 1KDZA 2PT5A 4QEDA 3K70D 4JLBA 3W6NA 4FZ5A 5F2NA 3UAGA 4KQEA 3SEQA 5MN6A 3VGPA 4G4SP 4IZIA 4JI0B 4A1OA 1BN6A 5JDIA 1Z12A 1L1QA 1GQYA 3B20A 1QHHA 4ZODA 2JLBA 3SOPA 5BN4A 4WXHA 3DP9A 2PX4A 3OTHA 1KETA 5DGTA 5L3RA 4AZSA 4K2AA 3V48A 5CBKA 2HUPA 1FB5A 3FRJA 5M3BA 1W0KA 3C7TA 2ZSAA 2AG1A 2Q0XA 5DHSA 2XCUA 2NP6A 4UUMA 2LUOA 2OFPA 2FEAA 1AKEA 1NJ1A 1KKMA 1UT8A 3FMVA 3H9UA 6ABPA 3QUAA 2D7DA 3OHMA 1L9XA 3OQVA 3AZQA 3GUZA 1Q91A 3ENVA 4YJFA 3G17A 1OZHA 4IUCS 1S2LA 4EL5A 4ZVOA 2X3FA 3P19A 2XSZA 7GPBA 2BEWB 1LW6E 1N57A 1YB2A 3GBSA 3JQDA 3EZ6A 5KTYA 3IEUA 4JXXA 2JH3A 4MVJE 3I72A 2X0NA 4I5FA 5EQJB 1S6YA 2FEOA 3I32A 5AYVA 1Z75A 4FUQA 4IQ0A 2K2WA 4LKRA 5KC9A 2I3AA 1QH1A 2XBUA 2FQQA 1HPLA 4J1TA 5D01A 4O1IA 1ZD3A 1D0VA 2GXAA 1IK6A 1AMUA 3CZPA 3Q8XB 4R8SA 2QLFA 2I2WA 1IZZA 2ODPA 5K8TA 4N5IX 1AB6A 5DNAA 1AKUA 1HI9A 1IY2A 2R5NA 3CLSC 3GC6A 3WFJA 1E58A 2V59A 4F04A 4CV2A 1RRFA 3K5IA 5JO9A 3T1OA 4C2UA 1OAOC 2ODTX 1S7CA 3FFWA 4D92A 2J7PD 3G9QA 2C57A 3QKRB 4H6XA 3AESB 4LZNA 4BRUA 4IKOA 3T3IA 1FL9A 1Z2PX 3E2IA 1R0BA 2IBSA 3A8TA 4RIEA 5I9MA 1SC4A 1AQYA 3CLUD 5CTJA 2FWJA 3I4CA 1T5TA 4OJTA 3ZD8A 3O4HA 1NULA 1WMAA 4KDRA 2FPUA 2JBAA 4MAFA 5JI2E 2RIRA 1LSUA 1KEPA 3P0JA 5JADA 1A9YA 3PX3A 2ZZMA 5KNCA 3WJ2A 4CDRA 4TLLB 2IUUA 1MVOA 3F97A 1HLGA 1J23A 2Q46A 3RRMA 3R9WA 1JKJA 1PL0A 4CCYA 1JBEA 1RD4A 4URWR 2V7QD 2YN0A 2QN2A 1NVMB 1PD0A 5CJJA 5EQTA 4ZQHA 1NIPA 3ZU2A 2NUTB 4GVXA 1A9XA 2QQ0A 2QUIA 3BRCA 4UZSA 3ZCPA 4Z4GA 1P0CA 2YVKA 1XTPA 2QUJA 2MT9A 3WHKA 4NLLA 5ALTA 3EDYA 3T8YA 1WCV1 4MW7A 2I03A 4Y2XA 3ZHCA 1DRVA 2W4IA 5FYDA 1OC2A 3B5EA 1X1TA 1NHWA 5JUWA 1ODSA 4DR2B 1LLDA 4KO1S 1NT2A 1U0EA 1SBTA 1HL3A 1K7XB 1UKVY 2FFJA 3PQ4A 5TPZA 2Q99A 1ZJJA 1U02A 4JT8A 4R7ZA 5J40A 3UMMA 3GI1A 3REGA 3FLBA 3GLRA 4RQUA 3WR5A 4FYXA 2V9PA 1EUDB 2OQVA 2KBFA 1X1QA 4LX8A 4HNUA 2A9OA 1JXQA 1W2GA 1Z38A 2GTHA 1PF7E 3CU5A 3HDGA 4J43A 1ND6A 1O08A 2P11A 5AP9A 2QPLA 4YK7A 4HQLA 3ER8A 2B1GA 1NI4A 1EVJA 1DEAA 1JPJA 3CNBA 3JSXA 3UHJA 3LT2A 3VR3A 1TVMA 5J5AA 3G49A 1KWGA 2RONA 3I6YA 1P29A 4TTAA 4X8HA 5IEBA 2D2EA 3PEEA 5HXAA 4JQSA 4TV8A 1VKHA 1ZCAA 3NIBA 2YY5A 4OXIA 5JE8A 4MHTA 3NYWA 1WCYA 1YZUA 2VNIA 2IHYA 4CWAA 4NAVA 4P54A 1C2YA 1TMOA 2Z9CA 2FP4B 1R00A 3O91A 2XCRB 4JJ7A 5DP1A 1CXZA 1D8AA 1AMNA 4LSMA 3ZLTA 1ZMOA 4JVSB 3EEQA 4GKVA 4RF2A 3H0CA 4RO0A 4QOEA 3KWMA 1VE7A 4QPZA 3D3WA 4UBLA 5BSWA 2QRUA 1T6XA 3TRFA 4CQNA 4BNLA 1I3MA 1G6KA 2YY7A 1WM1A 4H4CA 5FD8A 1Q83A 1VGRA 4LWQA 3SDBA 4D9CA 2P79A 2PX5A 5IBCA 1EWRA 3QBVA 4XYEA 1DG1G 1OGIA 1GGFA 1MTOA 1VDZA 4J7UA 4KKVA 4Q1BA 4HAOA 3ZZTA 5IKEA 2JI6A 2XVXA 2R47A 1WF3A 3K9QO 1WKCA 4DEYA 3I12A 3N75A 1WUJS 1CJSA 3X2FA 1OBFO 3EXHC 1EP1B 2XUGA 2CSXA 3NHAA 4FJ2A 4CR6A 2H2GA 1FFBA 3DLBA 1FP1D 3HCBA 3TQOA 2Z8XA 2VT3A 2BKAA 2ORWA 1XNHA 3FRHA 1RI4A 2QX7A 4LDNA 4HNGA 3VI4B 1S0UA 2PK3A 2VYND 4Q7MB 3ZLUA 3STUA 4B2PA 1DAMA 1MORA 2HLNA 5GY7A 3ZNQA 2QZSA 3SDSA 2PQMA 4ZQGA 3QKSA 2R8ZA 4R8MA 2QG4A 4TWRA 5TX7A 5CD9A 1FDRA 3GDOA 5BW5A 2XTNA 4X6YA 4RHCA 4QBKA 3N5CA 1ZWKA 5EP2A 3RVOA 5FOVA 4NMLA 2IV2X 2XBMA 4PC3A 3T95A 2HA3A 2YIMA 4IIXA 3H9BA 3A9SA 1VBNA 4R05A 2YTZA 3SKVA 4ACBA 3JQBA 1OH5A 1HUQA 1AA6A 1R6XA 1GNLA 2G8LA 2AJBA 1I0LA 2DQ4A 2ZIEA 4GMKA 1BGWA 2R6JA 3AIMA 5H59A 1RXWA 3P9SA 2XVAA 4RA9A 4JI3B 1OC4A 2O0MA 4D9GA 3ZGOA 3TBFA 4BP8A 3N2KA 1B0PA 1KAEA 3OCWA 1W36D 1MAVA 1UKZA 1NQVA 5AI8A 3NKVA 3BSFA 1J5PA 5AKGA 2QEQA 5FUVA 4YUAA 1O95D 2IOHA 2IVFA 1KI2A 1VM6A 1G3MA 3B6KA 3V4RA 2ZSKA 1SXPA 2GXSA 4LJRA 3G5AA 2DKNA 3TO5A 5CYOA 4OI2A 4QODA 4AKEA 4PYJA 4LHZA 3NBFA 3TTUA 2NVOA 3E5HA 3GQBB 4GVPA 3L5OA 3BWBA 4DL9A 2ZI6A 2PKEA 3STWA 5F2KA 3V8EA 3VRHA 1P4SA 1CULC 1W93A 1KDOA 1GHTA 1O54A 1RQ2A 3BXFA 4IVQA 4IM7A 1K0UA 1RLJA 4J4BA 4TKLA 5G53C 3K0HA 2WYOA 3RF6A 3THSA 2AE1A 3ZDCA 3MA0A 5L3VA 1XA4A 1KOFA 1ZGZA 3BMXA 5FADA 2ANBA 2JRLA 3WGMA 4BEBA 2YZNA 3NUGA 1PWXA 2IXBA 4E4YA 1A5TA 1PQPA 2X5NA 4MUYA 4M0PA 3SHVA 3SQNA 3E58A 4EB0A 2F55A 4C76A 2GGSA 3PXAA 2ZPTX 4N9QA 3P0HA 3OAAD 1ILWA 3F9CA 3MELA 3CBGA 1KAQA 2CL0X 1EJBA 3EIUA 4HH4A 3CTPA 4FWIB 4JQZA 3EC2A 2ZAMA 1EQAA 1SQFA 3QIVA 1YZKA 3R4VA 1D4AA 1RRGA 5B1DA 5HFJA 3SYMA 5I48A 4LZAA 1ZZEA 3QY0A 1U7OA 4DM4A 5CLIA 4YXFA 5C51B 1GXSA 1TT5A 3R0QA 4QASA 1KFEB 3D64A 1WU7A 4DZRA 5I9BA 1U3DA 1QGYA 2CW5A 2OLKA 1QGDA 4TWIA 1KEEA 4UNPA 5KBYA 1BIFA 3DAPA 3EUFA 4PM4A 4XB1A 5F2EA 4NCXA 4CFZA 4TSFD 1CTQA 1SVOA 3PWKA 2BSQA 4DY6A 4JLJA 5BWLA 1AUXA 5HJ7A 3Q40A 2J59A 2M6RA 2VR1A 1ZR4A 1CF2O 5AXAA 3HK2A 3DDWA 4M3NA 2ZCUA 4ONEA 4YQZA 5HTKA 4A0GA 4PG7A 3O3CA 1OI4A 1G66A 1VXRA 1P62B 3PXBA 3H5OA 3RQIA 4RTPA 1M66A 1OGYA 4S24A 5JJKA 3FOEC 3AB3A 4W5HA 5A1TA 4QXAA 2GXQA 3DG9A 5IF9A 4D9KA 2VJDA 5COAA 2Z98A 1B6SA 1GQQA 1GLGA 4ZEOA 3GJYA 1SWWA 3BWVA 3F0TA 3MF4A 1TW3A 4NPHA 2H6EA 4BATA 1N2OA 4BS9A 3QU7A 5IKOA 3SPXA 4KG7A 4DDTA 1GA1A 1L7EA 3HDVA 1O5IA 1PX2A 2HWXA 3K05A 2JZCA 4V3CA 1Z0IA 1Z6XA 1FUIA 1U1FA 4YY3B 1DQPA 2G5CA 2HN9A 3WMWA 1M1NB 2V1UA 3IV7A 3DVAB 3MJEA 4DF3A 2FPXA 2V7TA 5I9TA 3PWTA 2FF7A 3AW9A 4AU1A 3T3HA 1V4NA 2BD0A 3MXOA 1GFIA 2DGDA 2ZETA 5FBWB 4F9TA 1D2EA 1W0KD 3DAFA 3PSHA 3T7TA 2B8EA 1WHTA 4KWTA 5C4MA 1BQ3A 4OLHA 3UATA 1E5XA 1CK4A 3JQ6A 4N0EA 1C3OB 2EJWA 1P2GA 3RT9A 4RV4A 1FDUA 1JVNA 1VE9A 2WPDA 3D4PA 1QXSA 5FA6A 3RJMA 3T61A 5JAOA 2XSZD 2MSEB 2XT0A 1JR6A 2DU8A 5AOCA 2IYQA 4GPIB 4BNVA 3P4XA 1WSWA 3ND7A 4EEKA 2ZU0C 3ZYCA 5DYYA 4EYKA 3E23A 5JZOA 4TT3D 2VOJA 3MWDB 2CL6X 1RFLA 4PYQA 4UEJA 2YWGA 2VJBA 3AFHA 1PYDA 2YJZA 2ZSDA 1QS0A 2ZYUX 3DLTA 5AH0A 3OUZA 1FUUA 1TD1A 2OKCA 3S4YA 2QQEA 1UXHA 4ER0A 3O1IC 4LYFA 2P41A 4P2GA 5REQA 1NN5A 4P22A 3WP0A 4ZZ3A 4FB5A 4PYLA 3QXXA 4OFZA 1XELA 2ATCA 2Z0MA 2C0CA 4TL9A 1GN8A 5TS3A 3KXKA 2ETVA 2J0VA 2GHQA 5C7OO 5BSRA 5JAHA 3AVXA 1JHDA 1G5QA 3FCEA 3H1EA 3WRYC 1XUOA 2LPMA 1H0SA 4YMGA 2M32A 3JWIA 1I2BA 5LQKA 4PYIA 1J8MF 1JIQA 2VBGA 5SYNA 4OXYA 3SX0A 2J6HA 2I6FA 3ZV5A 4AX4A 3V8RA 3RASA 5FOQA 3DE4X 4ZAVA 3RVNA 4HGPA 2C20A 4E7OA 4DILA 4AT1A 2VDNB 1FZQA 4B5KA 4DMRA 1YR1A 3FYUB 5I9IA 2A58A 2CFTA 1JX6A 5SZHB 4H7DA 4WECA 5DTRA 3PT9A 2GFHA 3AF3A 1G4UR 4GC5A 2IJGX 1IDN1 3NH9A 1Y1PA 1ZW1A 2QMYA 2D7CA 3CWCA 1Q0SA 2AUMA 4B74A 4W9MC 2YXLA 4OYYA 2F17A 2GCOA 2UUOA 4KWIA 4MW0A 5LCXA 4KV7A 4JFRA 3KT8A 2AN3A 2G0AA 3K8ZA 3GMTA 3QW2A 1TU4A 2ID7A 1ONSA 3BMQB 4UBOA 1KU6A 3OJOA 4MDEA 2C2YA 4B1FA 2HLHA 3C24A 2FVYA 3ZVRA 1NDUA 2ID8A 4PS0A 3KPJA 4DIUA 1ZNXA 1GRRA 2JD2A 3N0TA 5IBRA 4ETNA 1LDYA 2VTEA 2PKRA 4L4ZA 1R3DA 2X5JO 5TPZD 2HFJA 3CR8A 2SCUB 1JU4A 2PL3A 3O1JC 1KMMA 3TXAA 4ZYTA 4EYEA 1JDSA 3OSUA 3PV0A 4MRVA 4RJJA 4D8TA 4CF7A 1L0BA 5AW4A 2OCDA 3IRUA 3TR6A 3B52X 2I3ZA 4UNRA 1HMPA 1XU4A 4P4NA 1DAEA 1ECCA 3JQCA 4PGMA 1P2DA 1CUHA 3C7KA 3V8NA 1TFUA 2O6LA 2X4LA 1YU6A 1U0OC 1WUYA 5HKBA 4DN6A 4A73A 3VR3D 3EY9A 5BNZA 1E2PA 1MO5A 3D6JA 5K01A 1VFNA 2IVZA 3AI7A 3TB6A 3F9RA 5FBRB 3K16A 4PANA 3ANYB 4HDQB 1T1GA 1UWKA 2R7LA 4WLFA 1R6AA 1VOTA 1Y80A 3EVTA 2WUWE 4Y6GB 3ZQJA 1T2CA 4UU0A 4YC7A 1WQ4A 1VIAA 1KAOA 4TWBA 3AFOA 1E2LA 1RLOA 3D7SA 3T7KA 4W5QA 1FMJA 3GVPA 4QXPA 3R7AA 4E14A 1QO0A 2C92A 1JRLA 1G17A 4NJMB 3WK7A 4JYZA 1YK0A 1OF1A 2QNBA 2GS9A 2WDPA 1ZRHA 2O3UA 2RCYA 3JASA 1PT9A 2B94A 3EASA 4IV8A 4P4LA 3G0IA 4L6AA 1PI3A 1REQA 4NE2A 3EHEA 1NBOA 3LRXA 2NVUB 4NYMR 4LKOA 5BOSB 2FHSA 2WM9B 4MRMA 5B5SA 4XX1A 3SLGA 3A4NA 3AG6A 1U11A 5EMKA 4INJA 4U6SA 2G7MC 4MPDA 3DV2A 4ACAA 5LDGA 1QFYA 1Z2CA 4JLAA 4LJLA 2XB6A 3A9VA 4G9EA 4DV2B 1A27A 2B3TA 3GUYA 1GZ6A 4V0MA 5DHTA 5KOHB 4EAAA 2RHRA 1R0SA 4D6XA 2BW0A 3B36A 2PKYX 3IHTA 4PHTA 5L7WA 5JHHB 4UHFA 4BRZA 1AUQA 4YRGA 1DBWA 4EJSC 1KVQA 4HUJA 3WNBA 2UXDB 1C4KA 5EJ9A 2NZXA 4EG3A 5CB0A 1GG9A 1MO6A