2HF8A

Crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form, in complex with zinc
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
211
structure length
211
Chain Sequence
b'KDILKANKRLADKNRKLLNKHGVVAFDFMGAIGSGKTLLIEKLIDNLKDKYKIACIAGDVIAKFDAERMEKHGAKVVPLNTGKECHLDAHLVGHALEDLNLDEIDLLFIENVGNLICPADFDLGTHKRIVVISTTEGDDTIEKHPGIMKTADLIVINKIDLADAVGADIKKMENDAKRINPDAEVVLLSLKTMEGFDKVLEFIEKSVKEVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable hydrogenase nickel incorporation protein hypB
publication title Structural insights into HypB, a GTP-binding protein that regulates metal binding.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Hydrolase, metal binding protein
total genus 77
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hf8A00
3FYHA 4Q19A 2ZYUX 4JLBA 2DFKB 3TW8B 5FI1B 5B58C 3K70B 5KDDA 1Q21A 4Q7LA 3RC3A 4M1SA 3KKMA 3E70C 2JLVA 4LYAA 4KBFA 4YMTA 1YU9A 3MRSA 1ZUHA 2YHSA 4GMDA 4M53A 2ZRCA 4MRVA 4U00A 2IXEA 3WBJA 5EXXA 3S1AA 1FUUA 3D3QA 1PLJA 3HR8A 4TYYA 1OKKA 1XPUA 1L8QA 1ZBDA 3U7FB 3REFA 2WBLC 1BOFA 2J59A 4M4SA 1LF5A 1KO4A 4RCYA 5D3MA 1FQJA 4ZIRA 5F3WB 4P4SB 5KPDA 3O8RA 3HDTA 2WWYA 3U44B 4NCJA 2WPDD 4DDWA 3KJEA 4V0MA 1HQYE 4B33A 1G3MA 3L0SA 4R2HA 4C3ZA 2CEAA 4IDOA 3VNVA 4DLTA 4Q1DA 1VHLA 1CJUC 2PLRA 5EUMA 3K0SA 2JCSA 4JS0A 4IOKA 3VAAA 1G8HA 4BWYA 2AL7A 1A5TA 3R9XA 5KSOA 2YJTD 4BEBA 4QJ5A 2O8EB 4E07A 2BBWA 2B6HA 2ZRHA 1WP9A 4QM7A 4TL7A 2A5JA 2ODBA 1PZNA 2VF8A 4NTZA 2GAOA 3G82C 1SKQA 3THYB 1ZMXA 3DKVA 4BE7B 3B1WA 1DS6A 2HJVA 2CXXA 2YWGA 5BN3A 5EZ6B 1G5PA 3HWSA 2P67A 1OXVA 1XTJA 2AHOA 4BRWA 3AUXA 4IFEA 4JLAA 4HAWA 3VR1A 3GLFB 2JEOA 4IXNA 4B71A 5BW8A 1YRAA 3MWJA 3NEJA 1XFAA 4CEHB 3A1VA 2WJYA 4AD8A 1G41A 1CJMA 3C5HA 2IL1A 2NMVA 4HLDA 4HAZA 4LJ4A 1Z0DA 3Q9LA 3C8UA 3HPQA 3RABA 3FMIA 1G3QA 2WWIA 4PAOA 4V0ME 3RS0A 3WMFA 4URXR 4C0JA 3GLIB 4D0GA 4XTRA 1NVUQ 2BIFA 2GZDA 1KO8A 1OB5A 4POAA 5DHAA 1X8JA 2VP4A 3CX6A 4R7ZA 2G6BA 1BH2A 2QMEA 4JKIA 3SJBA 2ZVPX 2QPOA 2RGNA 4LHZA 3H0KA 4NPHA 5E7MA 2DWQA 1NY5A 4DIDA 4OHXA 4YONB 4JBWA 1SKYE 1F2TA 4RFVA 2YOHA 3E2IA 3AH8A 5JS8A 3NG1A 4S35A 4Z1MA 2E1RA 2V55B 1E9DA 1Z0JA 5LDDC 3FTQA 3TGPA 3BERA 3LVRE 3TQCA 1S2MA 2KBEA 2RGDA 2V3CC 3EG5A 2IS1A 3R8FA 1W49A 2BCJQ 3GJ6A 4II7A 4DWJA 2BJWA 2O8CB 2IHYA 3HP1A 1E4VA 1G8PA 1VCMA 1VKJA 1DAMA 3A8TA 2ZR9A 3QE0A 3SI7A 4A8JC 2XGJA 2QA5A 4UNRA 1U0HC 2WWGA 4DSNA 2CLDX 3EPJA 2FZLA 3ZD7A 1YKSA 2G0NA 4C0LA 2LKCA 1W44A 3P32A 3WMEA 1NRJB 2RAPA 4I1VA 5HCIA 2WAYA 1G7CA 3GEIA 3HYTA 1XMIA 4US1R 2D7CA 3LW8A 1I4LD 1SVOA 2IYTA 2ZROA 5TY0A 2F7SA 4IKEA 2XSZD 3LV8A 3GFOA 3LLUA 3AEZA 2ATVA 1F2UA 5TDHA 3WYFA 1GILA 1DAFA 4H1UA 5L3SA 3MMPA 4V0KA 2PL3A 2IYWA 2CK3D 1J90A 1ZIPA 4MYHA 2WVJA 2Z0MA 5FPSA 1NIJA 1TAGA 1Z6XA 2QQEA 1RFLA 3L0OA 4FI3C 1NN1A 3GFTA 4C2TA 3OZXA 1CP2A 5JWHA 4L9WA 2PJRA 1X6VA 1E98A 1W4BA 2REXB 3OEEA 2QMUA 4IJMA 5TXGA 4DDUA 3H86A 3MD0A 2C98A 3ZIAD 1P7CA 4QOSA 1E9AA 3TAUA 3CNNA 1VIAA 4OBEA 2IYQA 4A2PA 2B7CA 2W2VA 4MUBA 2FU5C 5HR5A 2GDJA 2NO0A 1ZINA 2JDID 4E09A 2WIBA 2AK2A 4PC2A 4K81B 1GVNB 1DAHA 2OV2A 1NG9A 3PITA 4DSUA 5EXSA 4QGAA 2WOJA 4BFSA 3GJ0A 1AS2A 3OF5A 3B78A 4CZ2A 2R6DA 2BEKA 1ZC4A 2GBLC 1G16A 4UNSA 4CF7A 1NBME 2CHVA 1E9FA 2GEUA 1Z2AA 4LJYA 4IVQA 2HYDA 4HSEA 2DWOA 4HAYA 2BJVA 5ANRB 3A1UA 1IXZA 3LLMA 4ITRC 2C96A 1DEKA 1JI0A 5LB2A 3BH0A 4LGMA 4BZPA 1L2TA 4PSAA 1NN3A 1P60A 5F9FA 3NBYC 2CCKA 5H8WA 3I62A 4B3DA 1C4OA 5JECA 3Q5DA 2BVNA 2W00A 3NC0C 2Z4SA 5GVSA 2Q21A 4YXWA 1G1MA 4LC0A 3HYRA 3B60A 4DVGA 3UMSA 3TBKA 1XTKA 1U8ZA 4NL4H 1RKBA 1TUIA 1T91A 2PJZA 1R7RA 1GL7A 2LWIA 2Q3FA 1GRNA 4AWXA 1R5BA 4ARZB 3B85A 3QPUA 1G4UR 1XD9A 2QNRA 4V0NA 2EU8A 3QPVA 4B6FA 5H70A 1HH4A 2O8BB 2E9SA 5FL3A 3RAPR 3D31A 2XNDD 2QPAA 5HKKA 2J7KA 2WKRA 5FUWA 1N25A 2NQ2C 4URVR 1JR6A 4RZUA 1QHHB 1D9ZA 1S1CA 1E1RA 1VCOA 3L43A 2H7VA 1HQCA 4GZMA 2F1IA 2H16A 2LKDA 2REBA 3W3ZB 2GJSA 4JL5A 4PC6A 1MOZA 3ZDQA 2ZETA 2RGCA 2RGNC 4NCKA 2FA9A 2Z43A 5SZJA 1L7VC 5FL7A 4QKQA 4LJ5A 2J41A 2O0KA 3NBXX 1EGAA 1XMVA 4EPXA 2EFCB 2A2ZA 5JHHB 4Q00A 1XBTA 2VSOA 3OESA 4URZR 1WQ1R 1IY1A 4Q47A 3RS2A 1UEJA 5FTNA 1FMLA 421PA 2ZYWX 2O8FA 3AF2A 3DOFA 3AVVA 1RZ3A 2UZIR 2R9VA 1JAIA 3N2IA 4EFMA 2JIZD 4Q5IA 5B2ZA 1U98A 5L3QB 1HY3A 4MKHA 4TMVA 5CK4A 4UNQA 5DSZA 4IXMA 1N5KA 1TNDA 4LBWA 3WXMA 2BWJA 5J4HA 1YZLA 1QHSA 4Q4LA 1XCGB 5FBVB 1ODFA 2IYZA 3TRFA 2ZRMA 5KUTA 1Z22A 1FX0B 5CIWA 2ZE5A 2AXPA 2ZRPA 3FMFA 1U81A 1EFTA 2J45A 1SVSA 3GLGA 4OL0A 3PG5A 1A7JA 2QMHA 4KODA 2QE7A 4NCHA 2ZRBA 3KXKA 2F3RA 1HT1E 1KK2A 5TV2A 3KQKA 4M9ZA 1W4RA 1KHTA 1N6KA 2GXUA 2YWFA 1J99A 1NLFA 1HTWA 2ORIA 3QF7A 4GOXA 2GF0A 1R0WA 1E2DA 2YNMA 1F48A 3CO5A 4B2PA 2QSZA 3KX2A 2FSGA 3B1YA 3IPXA 2REOA 4PHFA 3Q72A 1T8UA 2ZXUA 4B44A 4NZYA 1Z6TA 3CZQA 2ZS9A 1RJ9A 2CHQA 2CL7X 4M1OA 2ECKA 4X8OA 4YMVA 2MSCB 3F0TA 4LV6A 3OEHA 4BLTA 2FFBA 2RB4A 2R8RA 1XEWX 2RH5A 2EFGA 5BYKA 2A3RA 1UBGA 3I1FA 1VG1A 4W7SA 5HCNA 3DL0A 4I1SA 4QG7A 2ZYVX 3BAFA 4PC1A 3CF6R 1Q22A 4XIGS 2GETA 2HXSA 3WP1B 4BEJA 4TT3D 2A9KA 2QRZA 4Q9IA 1W47A 3VNUA 3OIWA 1YZKA 4PTLA 3SJAA 3EAQA 2I4IA 1J8YF 1Z08A 2IUSA 2OESA 2P2LA 2P6NA 2W6JA 5CLQA 3VX3A 4JVNA 2IUUA 2Q9AA 2WSMA 5L3SB 2ZTSA 4QL3A 1GM5A 3SU8A 1NN5A 3B1XA 5KTYA 5AJWA 3T1QA 3EZFA 1F3OA 3GLGE 1E2QA 1D8TA 1E0AA 1JAHA 1FNMA 1GDDA 1NN0A 1U94A 2QBYA 4GP6A 3IBGA 2QI9C 1QG2A 1DOAA 3K1JA 3WRYC 3THOA 2C2HA 4IEEA 2IBMA 1P75A 4D4LA 1ZIOA 2YWEA 3NXSA 1IM2A 4ESHA 1RYFA 4Q1EA 2C77A 4ZO4A 5J40A 1G9XA 5FOVA 5LBIA 4Q48A 1WBDA 4LUCA 3BD9A 2ZJZA 1SVKA 2HF8A 3EZ2A 3UKDA 1KDPA 1FMJA 1S9DA 2YINC 1RVDA 4UJ3A 4OJQA 4F93B 2QP4A 4JT2A 4RVCA 2ZRFA 4QNRA 3UMFA 2HLDA 2X77A 1JR3D 4W5WA 4JLDA 4HB4A 4OHWA 1QG4A 5HPYB 4UXIA 4OHVA 4CDGA 1E2MA 2GWHA 1B0UA 3QXXA 3KKNA 3SJCA 4FMCF 4F4IA 4XWKA 2D06A 4TLCA 4A36A 1O3YA 5C4GB 3I8XA 4D4MA 4PZLA 3BB3A 4JBXA 3QENA 3AF3A 4DUGA 4XWOA 4U7DA 1JNYA 2WV9A 2WKQA 2RCNA 4TLAA 1SQ5A 3UWOA 2C03A 1WA5A 3BORA 3CM0A 2SHKA 4FMCB 2BBSA 2I1VB 2WMOB 2Q6TA 3V00A 1KI2A 4K46A 4HUQA 4KFUA 5F2EA 4EPYA 2ZYTX 1HURA 2IF2A 1HE8B 2PBRA 3SEAA 2VP6A 2X8AA 3BFVA 4TMXA 2BC9A 3M0EA 3SYNA 2ZUDA 5A5GA 3VHLB 1E2KA 2R6GA 5DN6A 2JATA 4HLUA 3PUWA 3TNFA 3TIFA 2AD1A 5J4VA 4GMXA 1CRQA 2ONKA 4NMMA 3VHXA 2XXAB 4A4DA 1IN5A 1QHXA 3TUIC 3DDCA 2VHCA 2NO1A 3UIEA 5GADl 2H92A 3FKQA 2VIIA 3CW2A 2F3TA 4M22A 4QFMA 2ZVQX 4QC2A 3AVXA 1JQJC 1HYQA 1TQ4A 5AUOB 1E2JA 1W2HA 4TMZA 3NHBA 4Z54A 2XZOA 2D74A 3VR5A 3B5JA 1DBSA 2O0JA 1Z6GA 3EXAA 1ETUA 4Q1CA 3SBDA 3AVUA 5GVRA 1XU4A 2IS2A 3C14C 2XJ9A 2BV3A 2XZLA 2QTFA 1NNEA 2PCLA 4XOIA 2V54A 1HE1C 3QEJA 4TSFD 1Z06A 5JEEA 3OAAA 3U4QB 3QXSA 3FHTA 4Q9LA 3RANA 1FOEB 4TTRA 2GAAA 2GCOB 2MMGA 2IT1A 3K0EA 1R8QA 2XOKA 4ACBA 5CIQA 2RHMA 1OIVA 2OFWA 4DLRA 2IEYA 1NMZA 3M1IA 2TMKA 5DI9A 2X2EA 4C7OA 2ZU6A 3LNCA 2BMJA 4BECA 2OILA 3IEUA 4OQFA 4AI6A 1HUQA 3X1WA 3GPLA 4PHHA 1C9KA 1QF9A 4DRZA 1OKKD 1PV4A 4RSGA 4BLSA 3THXB 4I4LA 2CE2X 1E0JA 4MGKR 1MKYA 1G7RA 4Q18A 5EZ5A 3SQWA 3K0AA 4JYBA 1XEFA 2WWWA 3CX7A 3OIVA 4FD2A 1ESMA 2PZEA 1KY2A 1CR0A 2ZJ5A 3AVPA 4D4JA 4PR0A 1II8A 1UKYA 1CULC 1S3GA 3VX4A 3B1ZA 2WHXA 4YMSA 2VPPA 1ZUIA 2DFTA 2IWHA 1K8RA 4PHGA 1UAAA 4PZYA 2OCBA 2HXYA 2HT6A 1KMQA 4BFUA 2ZRJA 5B57C 4MQBA 3BB1A 5FOWA 1I2DA 1TF5A 4UNPA 3LBHA 2BMDA 4UXHA 5KNCA 5A4JA 1OH5A 1E2FA 3RS5A 1ZM3A 3GQBA 2F1HA 5IK2D 3IQWA 3AGQA 3BK7A 1SHKA 2GESA 2QT1A 1P2VA 2GHIA 3E5HA 1P2UA 4JLPA 1W4CA 4LHWA 5DE3A 4PQFA 5JI3E 3EZ6A 4X8LA 2F1RA 3ZZTA 2ZITA 1YRBA 2PEYA 3K9NA 3PEWA 3HJNA 4H1VA 3VFDA 1YZUA 3BS4A 4QXAA 1EFRA 3SR0A 1KZ7B 1ZJ6A 2I3BA 4Q4JB 4JJZA 5G41A 3QEOA 2G1JA 2N46A 4BFVA 3FKSA 3LRPA 4MYCA 5DGXA 3SDZA 1E1QD 3I5XA 4EJSA 2ZRKA 3FVQA 4FWIB 4BGDA 1UF9A 2IC5A 3P26A 2ZUCA 5KOYA 2FV8A 2ZSFA 1GKYA 4XVUA 3KFXA 3UPUA 1SVMA 5TVKA 1KI9A 2HV8A 2R2AA 2AKYA 4PX9A 1DAIA 3RRNA 2VHQA 3CRQA 2AFIE 3WNCA 2FZ4A 4CRWB 4QJ4A 4N0EA 2ZI6A 4LX0A 3IEVA 2LCFA 3RLFA 1OHHD 3IO3A 3LD9A 3V9PA 1I4TD 1E9RA 1JJVA 1XMSA 1TADA 4DCSA 3EC1A 3LW7A 5EXTA 3B8HA 5B64A 4G3XA 5FTJA 1T3HA 4Z1MD 2GXQA 4B75A 1VYVA 2RHDA 3TUJC 2HUPA 3BH7A 1JEEA 3QQ5A 1UKVY 4MDEA 1EESA 1Z5ZA 2EFEB 2J0UB 1US8A 4HLUC 4OI4A 3EIQA 3EC2A 4MGIR 2A78A 1OFTA 1GNQA 2KB0A 2RKOA 3QKSA 3H2YA 4MRRA 2XZPA 4JKYA 3MWKA 3NH9A 4Q4AA 2H17A 5BQ5A 1EG7A 1GRQA 3ZS8A 3EA5A 3ZJYA 4C9BA 1I4DD 4LHVA 4DB2A 2V9PA 4JLKA 1OH8A 1Q0UA 4P4TA 2YC4C 1PUIA 2CJWB 1N3BA 1II9A 3NBFA 1UDWA 1NVXQ 1LTQA 1G3RA 4DLWA 1OXUA 3DZ8A 1NKSA 2VL7A 5DI3B 4JL8A 2X2FA 3LWNA 2ZUBA 4ZCIA 5H1YA 2ZE7A 1G3UA 1NLYA 5EXPA 1JXOA 1W1WA 4Q9JA 1TQDA 4JSYA 3ZH9B 1XPRA 1SXJA 1KAGA 2VHUA 2JJ2A 4GBMA 4KO8A 3SZRA 3SOPA 5K8TA 2R44A 3VKWA 3PUYA 4URYR 4ZKEA 3EASA 4G1UC 1XZPA 1XCMA 2OXCA 4V0OA 3QI2A 1QZXA 3OEED 4B76A 4A15A 3WP0A 1G21E 3R9WA 2ZRDA 4LK2A 3DZDA 3VU9A 3GLHA 1Z3IX 2FE4A 4CYMA 1B23P 4HZUA 1WCV1 4XWAA 3A4LA 8OHMA 4HLQB 4PC7A 2YV5A 3PQCA 3IO5A 1TU3A 2CHGA 3UANA 4MGZR 3FMPB 4LJ9A 2Z83A 3U3OA 3ADBA 1KTVA 2ZREA 4I1OA 1CTQA 5CB6A 1V5WA 1SULA 5TMPA 4PSKA 1R0YA 4GL2A 1XD2A 5JMTA 4CEJA 521PA 1H8HA 4ZKDA 4DB4A 4WZ6A 4MDFA 3RSOA 2ZM5A 3T35A 2OCYC 3ND8A 4WXPA 2BEJA 2X19A 1O87A 4RFSA 1YHNA 5FOSA 1RYHA 4C0KA 2OSBA 3U7EB 2RGBA 3QBTA 1OIXA 4IDNA 2ZANA 2VTKA 3FMOB 1NMYA 1G8FA 1XEXB 3K53A 1KK3A 1SXJE 1IHUA 5KDOA 2V1XA 4B6EA 3K0AB 1IONA 1CIPA 3CZPA 4YXWD 1XJCA 4GP7A 1NY6A 3L82B 4M9SA 4IDHA 4P4UA 1FQKA 3EWSA 1VPLA 1CRPA 4I81A 3NDBB 4FWTA 4X8HA 3DMDA 1Q1BA 3AUYA 5EE9A 3W9YA 1MO4A 3DVLA 1E94E 1XDBA 2IYYA 3GLHE 4L9SA 2FSHA 1XB2A 3PUVA 1HT2E 3A4NA 3KXLA 4LI0A 5FOXA 1VG8A 1ZYUA 3QKUA 5E4FA 3PUXA 2J0QA 2QGNA 2PMKA 3ICQB 4YMWA 2VRWA 5EE1A 5FOUA 2KSQA 2H18A 4NYIQ 4KYUA 2P0EA 5JI2E 4JT4A 1UKEA 2GJKA 2JLZA 3KXIA 5JRJA 1UPTA 5FPHA 5CYPA 5HKKD 2BM0A 1S8FA 1HEIA 5FBWB 1GRRA 1KGDA 2AXNA 4DEXA 1X86B 4LJ7A 1CXZA 4WZAE 2CL0X 1BMFA 3CRVA 3EX7C 1EFHA 2WM9B 4CEIA 4RD1A 1E2PA 2H1LA 4A9AA 5FBRB 2MSEB 1IQPA 2QZ4A 2VYFA 4EKDA 3K0FB 3REGA 2NOAA 4ESVA 5FL7D 1ELOA 1NBMA 3U60B 2XB4A 3BOSA 4DJTA 5DNYB 3AP2A 4KV9A 5P21A 3SE0A 1RRGA 4BRUA 2ZAMA 3Q3JB 4KYIB 4C2UA 1N6IA 4RD6A 2JAQA 3U7GA 1ZD8A 3OIUA 3EIHA 3QKRA 1A2BA 2EFHB 1VG0B 4EPVA 4FMBB 1RE0A 4NYMQ 2QUZA 4RZ2A 3D7MA 3N70A 1Z83A 4PANA 4A82A 4LPKA 2Y8EA 3UATA 4A8JB 3B13B 1HA3A 2XB2A 1ZRHA 4WIAA 1Z63A 4GDFA 3BE4A 4QBHA 5FH9A 2ZI5A 1OSNA 4LOAA 2ODEA 4OK6A 3RYTC 4C0QC 4R9UC 2GILA 4KSCA 1GP2A 4JJKA 2GCPA 5AJVB 4MRPA 5AJXA 5DLQC 5CYOA 1CJKC 4QHTA 1XF9A 1XWIA 1Z0AA 2Q9CA 5LB4A 2WPDA 2FSIA 2Q3MA 3OFNA 1G17A 3CNLA 4LJ6A 4M1WA 2QE7D 3VR3A 2J0VA 1IN7A 3HU3A 1W2GA 2HEIA 1CR4A 2BBTA 2NPIA 4HDCA 3EZ9A 3P27A 1WB9A 4KCGA 2OCAA 3CH4B 3LXXA 1N5JA 721PA 2W58A 2CCGA 2VHJA 4Q4AB 5FFMA 4AK9A 3B7GA 4B3FX 4W5HA 2IK8A 5HE9A 1QHYA 4JIMA 3CKLA 4EPTA 2JA1A 4MRSA 4KVAA 1KSHA 1W36C 2Q3HA 2ZSBA 3OEHD 4PO1A 2P6RA 2AX4A 3S1AB 1E2GA 1LW7A 3RC8A 1M7BA 2CNWA 4FMDB 3LX8A 1HV8A 2OHFA 5HE8A 1AQUA 3RVBA 5FTKA 4JMPA 2F43A 5D3MB 2ZSEA 3Q85A 4ZIRB 1J7KA 2FWRA 3QSYA 2QG6A 4Q7JB 1VHTA 2D62A 2AD5A 2P5SA 1IOZA 1EFCA 2NZ8A 2DY1A 2V4ZA 4NYIR 3MFYA 4PQRA 1IN4A 4JLVA 4E5UA 1GKUB 2W6JD 2EQBA 3ZQJA 3QXCA 1W36B 1M7HA 2G77B 4CGZA 2GCNA 1GTVA 1NSFA 2PZGA 4BFYA 1M2OB 2QP3A 2IW3A 5FUYA 4TYPA 1BO6A 3A4MA 1N5LA 1XP8A 4LHXA 1SKYB 1SVIA 3TSWA 2YYZA 3R20A 4JLNA 4FCWA 4L8GA 4O0MA 3UWKA 2HYIC 3ICEA 1G8GA 1YJ5A 4JVLA 4WOPA 4C0SA 1DTSA 4G5GA 5FR1A 2B92A 2N1BA 2RGEA 4GFDA 4LCBA 2DFNA 3MJRA 4NYMR 4ABYA 2AN9A 2IF0A 4TLDA 1DAGA 4O2RA 4LYHA 2CL6X 3P1JA 3EZ7A 5CM9C 4ZV4A 1IY0A 3T12A 3AF0A 5JSZA 2GNOA 4Z51A 1X1SA 1DO2A 3GJ5A 4M8NE 1XTSA 2O8DA 4B73A 4MYUA 3LBIA 3THWA 4TYWA 1YR9A 1Q3TA 1ZU4A 1T8TA 4M21A 4DUGD 2BCGY 3KQHA 4DLSA 4KFTA 4D0LB 2OG2A 3LQQA 4B3CA 1KI8A 2FX3A 4Q7KA 2ZJBA 1FL9A 1CS4C 2YC2C 1NIPA 1GITA 1II0A 1OFHA 2GEDA 4OQNA 2W0MA 3MLEA 4FXPA 2XEXA 3RS7A 1Q44A 5EP1A 5DN6D 1F2TB 3FGNA 2H8KA 1F60A 4KAXA 2ZQ5A 3TSZA 2JLWA 3IDQA 1AZSC 1W46A 1K5DA 4OQXA 3QF4A 5C4MA 3L0PA 4XSGA 1X3SA 1YR8A 1E9BA 3C5CA 3ND9A 1FPMA 1Y63A 3TVDA 4DT1A 4D26A 4US2R 4EFNA 3KQNA 4FW9A 1CU1A 3SFZA 4ASUA 1OFUX 1ZVQA 1Q3HA 1S1MA 4GI7A 4LC1A 4KXFB 5BWMA 2D7DA 2GJ8A 2ZRGA 1UADA 3PVSA 4OQLA 5HZHA 3GP8A 4RKEA 2ZAOA 1S9HA 5JFGA 5CDFE 1P5ZB 3BBPA 1P9WA 2O5VA 2OEPA 5TB5A 3BWDD 2CVHA 1P73A 3DM5A 1XRJA 2JDIA 4KFRA 4TTQA 3X1YA 4F4JA 1OFIA 4YDSA 4LY6A 4AIIA 4URUR 1KI6A 2HCBA 1KJZA 1L4YA 4PFSA 4RKFA 4S2EA 5CITA 4Z8YA 2XOKD 4Q66C 5AR1A 1D2EA 4OHYA 4MYTA 3LQRA 1IXSB 1GAJA 2D2EA 4HI0E 1BYIA 1F2UB 1H65A 2A5GA 1J70A 1GWNA 2F1JA 2K5UA 3WHKA 4KITB 1KDRA 1XZQA 2ORVA 3OE7A 4RJLA 2P6UA 5FBQB 1NJFA 1XTQA 4O25A 1TX4B 4QJ3A 4OK3A 2VO1A 4YDHB 3TR0A 5JJLA 3GCGA 4TQUS 1P2TA 3U2QA 1G8YA 2ZRLA 1M8PA 1CJTC 4IRUB 1GFIA 4AYXA 1G20E 3K0CA 3AVWA 4IVRA 1MABA 3O8BA 2B21A 3EIEA 3KKQA 221PA 4QGHA 2F6RA 1KZGB 3GEHA 3WRXC 1UBFA 1KO7A 4R98A 1S4QA 2AR7A 2ZS7A 5J4LA 1JXMA 1MT0A 4GZLA 4TZ0A 4Q1BA 1U99A 3E1SA 3TQFA 3JZMA 2FN4A 3WHLA 2FEMA 1W0KA 2QU8A 1KSGA 1G6HA 3T61A 1E2EA 2EFDB 1N0WA 3RS3A 5DYIA 1ANKA 4MKFA 3SN6A 4RD3A 3J81k 4P0TA 1DAEA 1K5GA 4LPSA 3OIYA 4UNNA 2ODNA 5FOTA 2A5DA 4OI0A 2VP2A 4PPNA 5CB8A 1Q20A 1VG9B 2FSFA 4ON9A 4V02A 2VH5R 3T1TA 4CW7A 2W6IA 1NF3A 4EQ6A 4RCZA 1W5SA 1WXQA 4ZPXA 4WVFA 1EFRD 4RZ3A 1DG3A 1XXHA 3FFBA 4HUTA 3U7HB 3FKSD 3DOEA 3MUFA 1N6HA 3Q7PA 3SFVA 2R65A 1GG2A 4FIDA 1JPNA 4OI1A 4CVNA 2ZI4A 5CK5A 5FPTA 4Q1FA 4YLGA 1G3IA 1KAOA 2FMXA 3T5DA 4M1TA 3A6PC 1I2MA 2OBNA 5L8VA 2JJ1A 3BGWA 3H4MA 3IIKA 3CF2A 3G5UA 5CM8B 1G5TA 3GJ8A 1ZD9A 2JGNA 2GK7A 5GJCA 3KUDA 1G4AE 1X1RA 4NKRA 3T1VA 1OLOA 2ZRIA 4IW3B 3K09A 5IDVA 5A0FA 2ZI3A 1Z0IA 1KJYA 3Q7QA 4FN5A 1DVRA 3HU1A 2QAJA 1E2LA 3U44A 2OAQ1 4DXAA 1XX6A 1V43A 3FWYA 2JLRA 2WAXA 3HU2A 4BFWA 2WIAA 3AKCA 2GXSA 4O2LA 1P72A 1R5NA 1G291 2BM1A 2CLCX 2ZR0A 1VECA 3LXRA 3A1SA 5EE3A 3PENA 3TK1A 3AVTA 4HB0A 4GNKA 5JJKA 4U02A 4N0DA 3ZS9A 1W7AA 3EPKA 1FW6A 3B6EA 4FINA 4D0NA 5AK0A 1AJEA 2O8FB 2PEZA 1LF0A 1XXHE 5AJZA 3EW9A 1GIAA 1NLZA 3QUSA 3CPEA 4JLOA 2C99A 4IHQA 2QTHA 5GJVC 1LVGA 4MRNA 2V7QA 3C15C 2BBOA 3WYGA 6Q21A 3THYA 3CPHA 4HDOB 4CIDA 4HAUA 1N0VC 2XITA 2VSFA 4PQYA 5DHFA 3W34A 4F7WA 4E03A 4J0QA 4Q01A 3ZVLA 4OHZA 1W48A 3TSOA 5H68A 2NO6A 3KB1A 2FFHA 3CRMA 1T6NA 3FDIA 5G40A 3GLGB 2IS4A 1RIFA 1J8MF 3GLFA 1OE0A 1E2NA 1ZP6A 3GEEA 3KFVA 5L3VA 3QF4B 4CEHA 2N42A 4Q7MB 4XVRA 4TMKA 4A92A 3SYKA 3MAAC 2JJ2D 1FTSA 1WE2A 1W36D 4C30A 3CONA 3ECCA 1XJ0A 1KDTA 1W0JA 3SS8A 4MH0R 4BPBA 1VTKA 1NVVQ 1SHZA 1KK0A 2CCJA 4AURA 1U0JA 1RJ9B 1T5IA 2C9OA 2W2TA 5LD2C 2J7PA 3GLIA 3QXHA 2G0TA 3A1WA 2WSSA 1E79A 4P32A 1G64A 5JCPA 3P4XA 5SZHB 3CWQA 1EX6A 2BOVA 2GEVA 4P3YA 1OH6A 3AP1A 1KKLA 5B30A 5C18A 2FOLA 4B2IA 1TEXA 3Q5EA 1UDXA 4WAUA 2KWIA 2ZU0C 3FFAA 1GL6A 1U2RA 3AV0B 4Q9HA 1E9SA 2J46A 1LS1A 2HDNB 2C9YA 1G5RA 4F38A 2ZJAA 1JR3A 3PFIA 3W5JA 1PLKA 3EPHA 3W6NA 1KOFA 3TR5A 1VCNA 1H8HD 1VCIA 1K6MA 1NSTA 3X1DA 4M9QA 4V03A 4G5OA 4PSVA 4LZZA 4M9XA 4PPQA 1KSJA 5UKDA 3KB2A 3U6BA 4B34A 2IYSA 2IA5A 3VKGA 1E69A 4P33A 4DLXA 3GLFE 4DIEA 4DCTA 2CMKA 2O8CA 1NMXA 3DPUA 2QBYB 3DEFA 4EAQA 3GJXC 5E95A 2QM7A 4G01B 3I8SA 1U8AA 3CRRA 3ZVRA 4AKEA 2ANCA 4D81A 5ELXA 4XD7A 2FH5B 1H8EA 2PCJA 2ZIAA 3PR1A 3WY9A 4EIWA 2RGGA 2FFQA 2OO7A 5AJYA 1SVLA 3C16C 3LX5A 3U3MA 3GLIE 1ZNXA 3H1TA 1F6BA 1Z6AA 4DSOA 3NIBA 4Q4HA 5TARA 3A1TA 3PIRA 4WXRA 2F9LA 1R0XA 3GJ3A 3PEYA 3WYAA 3WNBA 1EX7A 3LDAA 4PPFA 3TW4A 4B47A 1FTNA 4NP6A 3PXGA 2BKEA 2PLFA 1AZTA 3IIJA 3M4YA 4LBVA 1IJEA 1P3JA 3TVTA 3WMGA 1N6RA 4TTPA 1M74A 1RRFA 4NCNA 2F9MA 2YOFA 1BIFA 1JR3E 2CDNA 2BDTA 1XTIA 1CBUA 1N6NA 3ADKA 3O8DA 4PPGA 1QHGA 1A4RA 2QORA 1RRCA 3I3SR 4P31A 4BASA 4AG5A 2QM8A 3B9PA 1RC8A 1BMFD 2VP5A 5KYKA 2OFOA 3LY5A 4HUQB 3NH6A 4BUJA 1AIPA 2CBZA 3X2SA 3NKVA 1DAKA 4V0LA 3QOFA 1ZM4A 3GMTA 3BJIC 1D9XA 4TLBA 4URWR 4ZDJA 5DIFA 5SZIA 1E96A 1Z47A 4G0NA 2Q9BA 4HZIA 4OI2A 5J4YA 1NBMD 2OXRA 1CJVC 3BH6A 1R10A 3K09C 3BXZA 4LBZA 1NVVR 5AWFC 1GL9B 4YMUA 1LNZA 5KSYA 3B82A 2OT3B 5KSPA 3JVVA 1ESNA 1R5OA 4QRHA 1U0LA 2NPFA 1U90A 1D2MA 1XMJA 1LB1B 2ASEA 1RW4A 2FG5A 4DZZA 5IF9A 2OZEA 1COWA 2QQ0A 1NKTA 1YZQA 2VBCA 4NDZA 2BMFA 5IRCD 1KKMA 3KQUA 4PZZA 1T4GA 5BYJA 4F91B 3ADCA 1XNJA 2ERXA 4DBLC 1T3SA 4DLZA 4PO9A 4QHSA 5K8LA 1FP6A 3SBEA 5EUQB 5L3RA 1DARA 5KO2A 4HYYA 1T0HB 1ZUNB 3RWOA 4N3NA 1G6OA 1AQYA 2Q0HA 2RGAA 2IWRA 4PHTA 3I61A 4FCTA 1DELA 3OFND 3SJZA 2GBLA 5EE5B 2GXAA 2A5FA 4ZI3A 3C7KA 3T1OA 2FEOA 1JQLB 3K8YA 1S96A 1KY3A 4JSTA 2FJUA 3RS4A 3NVAA 4ARZA 2D4HA 4UQOA 1JECA 1AK2A 1KK1A 4DKXA 3RWMB 1TUEA 1CLUA 4A0HA 4BFZA 2OUKA 1AA9A 2D2FA 2O8BA 3CLVA 3AB3A 4C7OB 2VLIA 3NEYA 3QXJA 5E7IA 1ZNZA 1N2CE 4QNMA 5KDLA 2G9NA 3VR2A 5IK2A 1J2JA 1D2NA 3AQ4A 3B1VA 3R9IA 1AGRA 3U5ZB 4EDHA 2O0HA 3R7WA 2KJQA 2CNWD 4M1KA 2DYKA 2KBFA 2HCJB 1QHHA 4MITA 4B43A 2PX3A 5J4KA 2HF9A 1E6CA 4R2IA 3SNHA 1VYTA 1BS1A 4FCVA 2EWWA 4XH9B 2NTYC 1VIYA 1E99A 1OH7A 1AKYA 2GVDC 1IAQA 4IOJA 4JL6A 2AWNA 2G83A 3RNLA 4BQSA 2WJVA 1DPFA 1II8B 1TL7C 1E1QA 1Z2CA 1XCPA 2JLSA 2ODWA 4HDQB 4NE2A 4C0AC 3BRWD 4ZCLA 5AUQA 4OKSA 2P65A 4AKIA 1U8YA 2ZJOA 3LH5A 4NHOA 5JCZA 2AWOA 1ONBA 2B8TA 1FUKA 1N6LA 3DKPA 2J1LA 3UG7A 3ZGXA 1KI1A 2W83A 1NP6A 1KO5A 4AYTA 4A0GA 2B8WA 2DCUA 3IPYA 1KMHA 1NI3A 4EJSC 3CR7A 5L3QA 4KFSA 1X8KA 1P6XA 1WRBA 2DB3A 821PA 1FFHA 1Z6YA 3ZZUA 1RPZA 4B2LA 4QGGA 1OHHA 2ZEJA 1UEIA 1DE0A 1E1RD 1R6BX 3N2EA 3UG6A 3X1ZA 1FX0A 1DO0A 1R0ZA 2A5YB 3AKEA 1ZM9A 3NC1C 2XNSA 3RRYA 1Z8FA 3OHMA 4ZI2A 4B35A 2OE2A 3I73A 3EA0A 1OXXK 1OYYA 2Z5FA 4TWZA 1KNXA 3F8TA 1SVWA 2HJGA 1CR2A 4H9GA 1U9IA 3QBVA 5JJIA 3W8NA 4EJSB 3A37A 2QTVB 1Z28A 4ZCMA 2C04A 5JZVA 1QVAA 2IYLD 2R6CA 2WJHA 3ETLA 3W8RA 4AKGA 1MRSA 2YWHA 3G0HA 2WJIA 2EW1A 1XJQA 3AGPA 2P5TB 2H5EA 1KYIA 1FP7A 4DSTA 5HZKA 4R71A 1KDOA 4PXAA 4WBSA 4RZXA 4Q21A 2C9CA 2XTZA 2QY9A 3MG9A 2A7QA 2ZE6A 1ZD1A 4HB3A 3TKLA 2OBLA 3CRW1 1KIMA 2NO7A 1ZW6A 4Q4HB 4RD2A 2FF7A 3W5IA 3QG5A 4QBFA 3ZLJA 2FFAA 3VTKA 3ZD6A 121PA 1N6PA 2DBYA 4MGYR 2PX0A 3LAWA 2J9RA 3RHFA 1BYUA 4B32A 2IXGA 1E2IA 2J0SA 1M7GA 4A6PA 1US8B 3T15A 5EP4A 4PO8A 1N0UA 2A30A 3P20A 5J5CA 5EJEA 4XVQA 4B3XA 3QKSB 2BHRA 4ASUD 1P9NA 2CLSA 4TN1A 1M6NA 4FMDF 4XJXA 4AYWA 1SXJC 3BIFA 3AVYA 1KI4A 3BFKA 4JVMA 2ZSDA 3KJIA 4L4UA 5KSZA 4GOJA 4B3BA 3KTAA 2UZ3A 3PCRB 4BLPA 1EXMA 3ZVMA 1GOTA 1LV7A 2OM2A 1PUJA 4XTCS 2PZFA 1G7SA 3I5YA 5KNBA 2NZJA 4NBSA 4Q03A 2QAGA 2YZ2A 1EFUA 1XD8A 3SHWA 621PA 3D8BA 5F9HA 1T9HA 3O47A 1NJGA 1YZNA 3I72A 3LA6A 4TLEA 4A2QA 2ZI7A 1IJFA 4KHZA 1EWQA 2DHRA 2QPTA 3IIMA 1M34E 3DM9B 4Y0AA 1IN8A 3CNOA 1SXJB 2C78A 3DO6A 1YZTA 5BXQC 4QHYA 1G19A 4BFTA 4LJ8A 2UKDA 1OF1A 1ZM7A 3K9GA 2JLUA 2FDCA 3OE7D 4BFXA 2QL6A 2XX3A 1TEVA 1X8LA 2FNAA 3I32A 1DG1G 2DFLA 3BC1A 3PEVA 4IDQA 4NYJQ 2QT0A 4LV5B 3KL4A 2FPLA 2ZRNA 5EE0A 4A0FA 3M6AA 3VU9B 5IT5A 1E32A 3GLHB 3QY0A 1OV4A 3EWAA 1N6OA 4HZUB 1Z29A 5JBQA 1OIWA 4TL8A 4CT4B 3L8YA 3AKYA 2CE7A 2IEZA 4HAVA 1OJLA 2OLJA 1GUAA 1XEWY 3F3YA 4X8MA 2GTPA 3R8CA 1MO6A 1LY1A 2ZR7A 4M1MA 4C0BA 2WJJA 3NDPA 2ANBA 2IXFA 4DHEA 2W2XA 2J87A 3IKJA 4ZDWA 1G18A 1UM8A 2QRNA 1ZU5A 2XXAA 1FZQA 1XD2B 4D82A 2ZJYA 4CEJB 2HLDD 2VA8A 2WMNB 3FPAA 1TMKA 1N5IA 4IVPA 1VYUA 1ZNWA 4D4KA 1W0KD 5KPJA 1NL3A 5EP2A 4HLCA 1UBCA 3RRZA 1VMAA 5CDFA 4RFSB 3H84A 2QMOA 3TE6A 3R7WB 4CT5A 1MR3F 3U3KA 3TUZC 4RY2A 3SQXA 1GSIA 3KZ1E 1P62B 4BZXA 4AY2A 3V4FA 1D6JA 2JLXA 4MA4A 4KSBA 5C2JB 1Q1QA 4OYHA 2NIPA 4TQ9A 1M1YE 4OQMA 1JBKA 4LJAA 1CEEA 2QN6A 2XAUA 2L0XA 3QNUA 4I1UA 1P4SA 1QVRA 3ZYCA 5F98A 4DCVA 1OW3B 2VHTA 4NONA 5K8UA 5E3HA 3FB4A 2W6ID 1E2HA 2YVUA 3U4QA 2G3YA 5J47A 4D80A 4ERNA 1E3MA 4K8OA 3VR4A 2GCOA 1S0UA 2ZJ2A 1ZCBA 3MSXA 3IHLA 3MJHA 4UJ5A 2IYUA 4A6XA 1QRAA 2XSZA 2E87A 3QVVA 1Z07A 2O52A 4MKGA 1UBEA 2J5XA 5FR2A 3K70D 2PMDA 1A2KC 3KKPA 4NCIA 3MGCA 4M2LA 1ZCAA 2GJAA 4EFLA 4IDPA 2QROA 3BFXA 1U9IC 4LYFA 1OYWA 2JJ1D 2V6JA 1KMHB 2CK3A 3B2EA 4HATA 3TMKA 2EWVA 1LS6A 2IS6A 5JS7A 3X1XA 5JEDA 3LFUA 4JBYA 4UKDA 3THXA 3ZIAA 4TMTA 3VR6A 2IYRA 5E7JA 3ZQ6A 2IYVA 1KSFX 2NG1A 4W9MC 4CEIB 3IBYA 1G7TA 3I4LA 3UK6A 4DCUA 2W0SA 4EPWA 5KNDA 3IUYA 3EPLA 1F5NA 4F92B 4PAQA 1JEDA 1AS3A 2VP0A 4PAMA 1D5CA 4RD0A 2IHBA 2V1UA 3C41J 3OAAD 4JLMA 4JLJA 1P61B 4TQAA 3AVQA 2WOOA 4Y0VA 4NYJR 1C1YA 1MV5A 3PEUA 3LBNA 3TAHA 3B9QA 1WF3A 3QKRB 2WWHA 1L4UA 3WBKA 5AUNB 3U3JA 1XPOA 2FPKA 2BKUA 3ASZA 2G88A 1PLLA 1Q1EA 3BB4A 2AKAB 3UMRA 5D3QA 2GK6A 2ZE8A 3KJHA 1IY2A 4RD4A 2V6IA 2V7QD 4U5XA 1TQ6A 3IILA 2FGJA 1E0SA 2JLQA 3VKHA 1E0KA 3GD7A 2QSYA 2XJ4A 3QIAA 4OK5A 2C8VA 3A36A 5IHPA 1Q57A 3VMFA 3TH5A 2ORWA 5DO9A 2GJ9A 4L15A 1R4AA 3ZVNA 1RRPA 1GKIA 4YQFA 2ZSAA 2YKGA 2VP9A 1AM4D 4LRWA 4Q4JA 5CJ2A 5EP3A 2ZI9A 5JWRA 1IN6A 4AG6A 2QAGC 4LBYA 3RSLA 4KI0A 4IOMA 2PT5A 4Q1AA 1SGWA 4F4CA 2HT1A 4D25A 1QBKC 2IX3A 4EPRA 4PC3A 4QGFA 2B7BA 4BLRA 1W0JD 3PJRA 3GJ4A 2GRJA 2G1KA 3F5FA 1MO3A 1YR7A 1E4YA 2X1VA 3CB4A 3NTUA 4JZKA 1OXTA 1WMSA 2J7PD 2OLKA 3JVUA 4D6PA 5C46F 2WSSD 1E79D 2H57A 2NO9A 2XNDA 3JZAA 4Q9KA 3TJZA 3KTAB 3AM1A 4IOLA 5CLLA 3KUCA 1UJ2A 2RMKA 2EYQA 1A82A 3CH5A 3DMNA 4WA7A 1GZSA 4KLNA 3A58B 1CKEA 4C4PA 3FOZA 2QAGB 2KE5A 1TF7A 2R62A 2F43B 5BN4A 4JYCA 4YC7A 4ACAA 1NVWQ 3U6KA 4GSYA 2FPMA 5JLJA 4Q02A 2WTUA 1W4AA 2AFHE 2ONJA 4IFBA 3EARA 3MWLA 4M1YA 1A1VA 2RGXA 2XTNA 1VDZA 2GF9A 2VSXA 2NGRA 3K9HA 2J0UA 4MUAA 2PH1A 5SZKB 1TF2A 1WBBA 3QVUA 3W6OA 5M04A 4GPTA 2IYXA 1E9CA 1Q12A 4DC9A 4G5RA 1YVDA 2R6AA 4TYQA 4TMWA 2GKSA 2UVQA 3CBQA 1DADA 1R8SA 2JIZA 1XTRA 3W3AA 4B3GA 1P2SA 4JVSB 2EYUA 1WDTA 4DDTA 4XD7D 5FI0B 1CR1A 4E22A 4L5BA 2CJWA 1H8ED 2ZS8A 2KI5A 1PVOA 4C0HA 3ADDA 5FTLA 1MO5A 1YZGA 1Z0FA 5FPYA 2GVZC 5DI3A 3CR8A 3IGFA 1EWRA 4P4SA 1QDEA 3CF0A 4TL9A 1P9RA 1ZM2A 3PV0A 4HAXA 3CPJB 3GJ7A 5JSZB 5DISB 2OAP1 3U3RA 1EK0A 1GNPA 1UFQA 1ZAKA 3NHAA 3W6PA 2O8DB 1AS0A 1YE8A 3FE2A 2WICA 5K8IA 3THWB 5FUXA 3RDPA 4A2WA 2BMEA 3L0IB 5JRZA 3N5CA 3ONWA 1T3LA 3AKDA 4QBIA 5FBLB 2P3SA 1AKEA 1T0JB 3IQXA 2JLYA 2O8EA 3KKOA 2QENA 3AF1A 3KDSE 3SHFA 4OJKA 4EUNA 4D2IA 3DHWC 2QP9X 4WW0A 5DYGA 4GT1A 4L16A 3TLXA 2DR3A 2GA8A 1E9EA 3GFPA 4G5SA 3QJYA 1JJ7A 1QHNA 1KO1A 1T5LA 1OB2A 1TPZA 3QKTA 3IHWA 2F55A 4KU4A 3MWYW 3ZZ0A 5JWOA 4TT3A 3QG1A 1GNRA 1Y3AA 3VQTA 5FUVA 5G3YA 4BZQA 3D6TB 4NU0A 5GJWC 4DDVA 3V4RA 1Q1ZA 3KJGA 4XSHA 2EVWX 5FTMA 2D3WA 4LSGA 3SYLA 1SXJD 2Z6VA 3LO5A 1R2QA 4TZ6A 1COWD 4NH0A 4DT1B 2R6FA 4LWZA 3L8ZA 1NG1A 1Z0KA 2WWFA 3K9LA 4WZBE 4DLVA 3WNDA 4B74A 1XEXA 2VEDA 2AK3A 2ZRAA 3PUZA 4N1AA 3P4YA 2MMCA 1TTTA 5C1BA 1IBRA 4QBGB 2QEQA 5LPNA 4IEIA 1JB1A 4ILEA 3O8CA 2GZAA 4HEJA 1QHIA 4AC9A 4UXJA 1KI6B 4W5JA 2WZQA 2JJ8A 3KQLA 5BN5A 5AUPB 3AVOA 3SC3A 4GOKA 1ZNYA 2Z4RA 3K0CC 4DEYA 3HR7A 1OPXA 3W90A 2ATXA 3QPWA 4O3MA 4QM6A 2XTMA 3T5GA 4HB2A 4KVGA 4LV8B 5DH9A 1ZC3A 1PJRA 4KLZA 4MKIA 5FPKA 5LD2B 1OXSC 3RRMA 4AKHA 2JASA 1KJWA 1SZPA 4LDJA 1UKZA 2ERYA 3MCAA 1IXRC 2OBMA 1TU4A 2WJGA 2MSDB 3NWJA 4G5QA 2IUTA 2YOGA 4KJZA 2VQSA 2I1QA 2WKPA 5G3ZA 4B48A 4ZDKA 5CJPA 4M0LA 2OCPA 1AN0A 2FGKA 5EQTA 4BLOA 3CWZA 2C5LA 2QGZA 4TYNA 1TQ2A 3K0FA 3U61B 4DLUA 1MABB 4A1FA 1LFDB 1BKDR 2OFXA 3HPRA 5HTKA 3ASYA 3AP3A 4BLQA 2ZPTX 4US0R 1MRNA 1KI7A 1KI3A 3CIOA 4KBGA 4DLYA 4ZDIA 3T06B 2VF7A 3L2OB 5GJBA 5KU1A 2GZHA 1CF4A 1S3SA 1W5TA 3FHOA 4I99A 4A8JA 1MH1A 2DPXA 4Z8XA 3AF4A 3K70C 2WWXA 3FHCB 5G53C 4A0RA 4LYJA 4DCNA 5JHGB 2V8OA 3NBZC 2DWPA 1OT3A 1FNNA 3T34A 3I92A 3LVQE 1AGPA 2C95A 3CUEF 4TL6A 2ZJ8A 4TSFA 2J3EA 3Q8XB 2PT7A 4EQ6B 4GRAA 3UXMA 2CVFA 4LHYA 1KNQA 3C4JA 1JALA 1XXHB 1YR6A 1JPJA 3CX8A 5KHOC 1YQTA
chains in the Genus database with same CATH superfamily
2C4NA 4LX8A 2ZYUX 3FPBA 1SH7A 1ACJA 1UBNA 1Z2OX 2ATIA 2WIKA 3TPFA 3AJRA 2COUA 1QJCA 3TW8B 3AUKA 3JTMA 3O95A 5FI1B 1GPKA 3LY9A 4ETMA 4V1CI 4NNOA 4Q7LA 5KDDA 3LUHA 4JQCA 2B78A 3KETA 4ILKA 2CD9A 3EGCA 3WSVA 3ZCXA 4ENWA 4H31A 3ZJ4A 4YMTA 5B3JC 5KJCA 1JSLA 1LK0A 3FIJA 4X93A 1ST2A 4N7MA 1FS4A 2IXEA 1HE2A 3DT8A 4G1EB 1FUUA 3D3QA 1CUHA 1J5XA 1IZ9A 1M2VA 1OKKA 1PLJA 1L8QA 1ZBDA 2O4CA 3KLOA 5DCLA 1U6JA 3WADA 1AKTA 3QLUC 1GGKA 5CH3A 1B6RA 4JITA 4JR2A 4GD3Q 2WBLC 2J59A 4K9LA 5H0IA 1GUDA 1LSOA 2FEWB 1J1ZA 1LF5A 1KO4A 3DGFC 3DKIA 2PUTA 1FQJA 2XUAA 4NATA 3WLJA 4TPKA 4ZIRA 4C22A 3LCUA 4O5AA 1Y9AA 3E7WA 3HDTA 1YZYA 2WG0A 3U44B 3IKLA 4OXYA 3L0BA 2ID7A 5PNTA 1IZYA 2IHVA 5ALPA 2AZXA 3HCDA 2J9ZB 3QNWA 3U31A 3L0SA 3RVJA 4R2HA 2CEAA 5DULA 3KSAC 2KYRA 4IDOA 3RYIA 1FYEA 2NXWA 3LM8A 1CJUC 2PLRA 4NEHB 1P7YA 1GTZA 3NBMA 3Q9NA 2JCSA 1Z62A 3E3OA 2X22A 4FDVA 1RMYA 3VAAA 1G8HA 3ZNOA 4QQKA 3HH8A 4R81A 5DCUA 5EHGA 4HP8A 4ZI7F 2Z9DA 1J49A 3IUPA 4BEBA 1H23A 5B1HA 3TL2A 4PE5B 4G0VA 1VL6A 2DUWA 4AO6A 3IMKA 1JHUA 2W6MA 4PZAA 2PKEA 2ONZA 4WKOA 5BUZA 1BCRA 5CEJA 4QM7A 2X4LA 3KAQA 1RYZA 3QA3E 4Y6OA 4NTZA 3G82C 4MUIA 3O9ZA 2AXQA 4EG4A 5CAEB 1S2NA 2CXXA 4BRZA 4DIKA 3MJTA 4WBXC 5D01A 2PR2A 2ENUA 5AKIA 5BN3A 4KPYA 1DC4A 1SBTA 1BAPA 5M5BA 2EATA 2P67A 1OXVA 3JQ6A 1XTJA 2B4TO 2Q5LA 4M9RA 3AUXA 3T0GA 4MCJA 5F7ZA 2VK8A 4ENSA 3K94A 1L8AA 3KSZO 1ODLA 4HNGA 4RADA 1SPXA 4B71A 2H0AA 4E4RA 4F04A 2LXNA 5DM0A 3C1OA 3VBEA 4OBBA 1GD1O 1ECPA 4LZOA 4WRRA 1XVAA 1G41A 4M38A 1GJRA 2GKOA 1YO6A 2DQZA 2XRFA 3HRHA 4KUGA 5C5DA 3EN0A 1ZL0A 1NVDA 2IL1A 4BJ1A 1WV0A 3W5VA 3F97A 1WDKA 3HKDA 1JZSA 1JPUA 1YU6A 1SUIA 1QIMA 2BUBA 3E35A 1BW9A 1UJ5A 4U7GA 5DJ5A 5REQA 2I9KA 2ZAGA 3C3JA 2WWIA 4V0ME 1FFGA 1POWA 2LDXA 3ADPA 4OLFA 4GGPA 4KXNA 3GLIB 2V9ZA 4D0GA 3E15A 3WJ1A 5KYWA 3QLTA 1RRVA 1KO8A 2DHEA 1CE8B 2J67A 3H0EA 4GF5A 2XNKA 3CX6A 2AQ8A 2DKNA 9LDTA 2G6BA 1P7WA 2HK7A 4LEIA 3P9PA 4JKIA 4XYLA 5JZ9A 1U3WA 4LHZA 5IS2A 1J8DA 1M73E 3AI3A 1Z7WA 2B61A 4Q15A 4QUGA 3USES 1UKAA 3A11A 1V9SA 2JGRA 3DLAA 5IN5A 5E4YA 1R6UA 1BE8A 4A10A 2FPOA 2GD0A 1YASA 5JS8A 1U31A 3NG1A 4S35A 2PSEA 5ARCA 5KC8A 3OOHA 2LP4Y 4KQJA 1O9BA 4UEQA 1B26A 3RJZA 3DJYA 4Q9NA 2BFOA 4OQZA 1Z0JA 2YV1A 3FTQA 3TQCA 1I3CA 4FD3A 5BSKA 8ADHA 3WAKA 1C7EA 2V3CC 1C1XB 1NX6A 2PX6A 5ALGA 1QV6A 3GNTA 2HMYB 3WIUA 4F46A 3R8FA 3CUSA 1X7WB 3WQBA 2O23A 5I5EA 3NWOA 3LX4A 5CW1A 4DWJA 4AFNA 3RTCA 4AO8A 3HP1A 1E4VA 2WM8A 1RWNA 1ZK4A 3A8TA 4N3AA 3AJEA 4B1FA 4R3NA 3ED5A 1CUGA 2QA5A 3USZA 1RLTA 3GDFA 4DSNA 1M5TA 2PAFA 1Q14A 3CWCA 4UBOA 1LA2A 3ZD7A 1YKSA 3RBVA 1QPGA 2LKCA 4NQZA 1W44A 4C0LA 5JR3A 1YR1A 3P32A 2VYND 4DR2B 2RAPA 4I9UA 5DEIA 1RWKA 3BDIA 3D4PA 3O92A 4ZRMA 1VRCA 2NZ2A 1A0OA 1WB5A 2JLBA 2X5JO 3HYTA 5B6JA 2VUSA 2XQJA 3TW0A 1ABBA 1NRXA 3K4QA 3RT7A 3PK0A 3CSDA 1LLUA 3O4JA 1OFUA 3SDSA 2ZT6A 2QW0X 3I2GA 1QAMA 2A0UA 1HLGA 4R8KA 2O48X 3OBIA 2WQZA 1O8BA 2X7HA 2XMDA 5L3SA 4V0KA 3DV0B 3F5QA 2CK3D 1DFHA 1UIMA 4FT4A 5JNSA 4LFAB 1DRKA 1B8VA 1T2CA 2IEAA 1Z6XA 2QQEA 2WKWA 3DEKA 3KG2A 1K8XB 4D9JA 4KMSA 5MFZA 3DMPA 1L9XA 1W4BA 4Z6KA 1RC1A 4WBNB 5LA6B 1RQNA 1GAWA 5DHUA 4F5EA 2NTVA 5HBRA 2D5LA 3CNNA 4NZOA 4UUMA 3WIOA 2IYQA 4A2PA 4HGYA 5BSRA 2B7CA 2R7KA 4MUBA 4ZOCA 3DMRA 5AW0A 3EEIA 3P9KA 4ZT3A 4HV4A 3FLEA 3TI7A 1MVNA 1L5ZA 2H07A 1JSXA 3I1YA 4XVHA 1N9GA 2OV2A 1DAHA 2B4YA 4O02B 3PITA 1RI5A 4F9GA 1HT0A 5EXSA 2QQFA 5B53A 4BLWA 4LXIA 4OKIA 1SIUA 2QY6A 3JWIA 3OF5A 4DC1A 1XZEA 5EVJA 4RS4A 2ACKA 4UNSA 2X2PA 1YI0A 3MERA 3B3GA 5E8JA 4CF7A 2DPGA 2NM0A 4W6ZA 1V7ZA 2C07A 1YZFA 3DTTA 3FPCA 5BMVA 1QTIA 1V7QA 2GEUA 1Z2AA 2OC9A 1Z68A 1WCWA 2X0KA 4LJYA 5GM2A 3TD6A 4YPVA 4HSEA 1L7NA 5ANRB 5EEHA 3FBWA 3REOA 5LB2A 1IXZA 5LBTA 2RJOA 1JI0A 3A9UA 1AQ6A 2C2KA 2G5GX 4PO3X 3EXIB 4PSAA 2GOYA 1D7OA 1P60A 3Q1KA 5F9FA 5TMEA 2UUBB 2I29A 3R0JA 1JFVA 3I6YA 2KLHA 4AF7A 4IDAA 1C4OA 3TTXA 4QUEA 3Q5DA 4YJ3A 2OYSA 2W00A 3VPAA 4EKIA 2Z4SA 5CD9A 3NIWA 3VH3A 4RWEA 3ZZ1A 3MS4A 3QEKA 4OL9A 3UMSA 3TBKA 1SQSA 4GX5A 3HDGA 3JX9A 3I6BA 1YK1A 1WXXA 1Z3CA 2Q3FA 1R7RA 3BRWA 5K2MA 1N77A 5BNZA 3GLSA 5JY6A 2QR2A 3BUSA 3QPUA 4R6WA 1LVUA 3K2BA 1PZEA 1UP4A 4FNAA 3GJQA 4XUEA 5FI3A 5B1IA 4ZMRA 5KINB 3QPVA 2BGMA 1QNFA 4GUAA 5H70A 4B6FA 1HH4A 1M6WA 5D8DA 2H0QA 3H1FA 4B40A 4DQKA 2O8BB 1YBFA 3RAPR 4D8UA 4AUMA 5JAMA 3DTVB 1JKJB 3PR3A 2B1RA 2UAGA 2XNDD 3SICE 3UYLA 4R9VA 4E30A 1CD5A 2BF7A 2C2MA 5SY9A 2JI4A 1Z37A 2XUDA 3T3NA 2WQ6A 4YLEA 1E1RA 3L43A 5HM8A 3Q9UA 2W2KA 2QNIA 4P3NA 4Y1RA 5K0EA 3V8RA 4B3IA 2F1IA 2LKDA 3PGXA 4QZVA 3W3ZB 4KO2S 4PONA 4IIBA 1XQWA 4P1ZA 2YXLA 5CXSA 5D51S 4CHTA 1FW8A 4X97A 1ZISA 1YBAA 4PBRA 1WCIA 4LJSA 5H3CA 2VPTA 5FL7A 1ZWKA 3HVUA 3W3AH 4QKQA 5DLPA 1DKQA 5AK5A 3H18A 4Y30A 2JVKA 1FLVA 4EPXA 4H7EA 2A2ZA 4IJVA 4CR8A 4RDXA 1POXA 4UMDA 1V3VA 4GS5A 1XBTA 4NDNE 1BW9B 3A3PA 1LEHA 1IY1A 3L6OO 3N8NA 1J0AA 4UCXA 1FMLA 4MVYA 4KPFC 1LJLA 1BKSB 4ZO8A 3ZI4A 5EJ4A 3N0XA 4M0CA 4KUEA 3WOHA 1LX6A 2A3NA 2RH8A 4RK1A 1SCBA 2DXIA 1RZ3A 2BZ1A 3EF0A 4EFMA 5CCDA 3EBOA 5HG0A 1PR6A 3OM0A 4OQYA 3QE9Y 5JXIA 5CK4A 2E4UA 2JFWA 3SVTA 1NV9A 4S2UA 3T41A 1YZLA 2JFZA 4Q4LA 3DVSX 1SCUB 2K2WA 4B45A 1Z4IA 2IIVA 2XLBA 1Q91A 2KS6A 2WF6A 1Z22A 4MI1A 1PD1A 2ZE5A 2AXPA 1T8SA 2FVXA 3A27A 2O1XA 2J45A 2DBVO 1L7XA 3SAJA 3GLGA 3LC2O 5KI6A 2ZUEA 4NCHA 2R8XA 4MZXA 1HT1E 2EZTA 3TZ6A 1G9SA 1KK2A 2JB9A 3HVHA 3PGMA 5TV2A 2R25B 4CL8A 5M29A 3AMVA 5C7YA 4O6VA 1V1RA 3S81A 2GXUA 1KPHA 1Y37A 3TM4A 3K1YA 4GOXA 3UK0A 4B2PA 3LF1A 1R0WA 2J5QA 3CO5A 4KKXB 4WK2B 4BN4A 1MTZA 2QSZA 3KZKA 3O1IC 3IPXA 3NEAA 4WHMA 3Q72A 4EBBA 2O7VA 1T8UA 4BQFA 5FLEX 4JZYA 3IQHX 4ML3A 1IWBB 1RJ9A 4J7CA 3JD4A 1A8QA 2CHQA 4O4HF 4OIMA 4B2YA 4G65A 4TMFA 3ST7A 1TA4A 4X8OA 2J5BA 4ZPJA 3ORFA 3LWDA 1XU9A 3EXHA 4R1QA 3E48A 4QULA 3H1GA 5CDHA 3SCZA 2EFGA 4RHYA 4L5AA 1M34B 5BYKA 1UBGA 1KRHA 2JCVA 3BTOA 2YDYA 4RHUA 4EARA 1L5FA 3UC5A 2Q5HA 2V7GA 1PHRA 3PNSA 4PC1A 1V2GA 1OLXB 2GETA 2HXSA 4D9NA 3UHJA 1JB9A 4Q9IA 4LMAA 3HEBA 4ZT2A 5FLXA 1O57A 4L9RA 1R00A 2EJBA 1Y98A 2AC4A 4NABA 2PFSA 1KQPA 1QE5A 1VHWA 3OTIA 4IILA 2W6JA 2EGUA 2IUUA 2F8LA 5L3SB 4LWPA 5IDXA 2ZYDA 1DRJA 2X5NA 3RYFA 4O4JA 3I5XA 2YWCA 1K3FA 4QL3A 3EGWA 4OGFA 1NN5A 2XYVA 4MSUA 4PS0A 4IDBA 5KTYA 1EFKA 3F3SA 5JXJA 3IQFA 2C7VA 1PYOA 3HL0A 1N8KA 4X92A 1E0AA 1ZD3A 2NUTB 1YK0A 1ZVMA 1DIHA 1GDDA 4GP6A 3IBGA 2QI9C 2VPXA 5SICE 3QI7A 1T4CA 4MB2A 2IZ0A 1H2FA 4X6LA 4YMIA 4ARVA 1I80A 2C2HA 4IEEA 3M6WA 1P75A 3PTZA 3WGGA 1M33A 4EVIA 1MUUA 4Q1EA 2P2YA 4N9QA 3TLMA 2BDEA 4ERXA 3V4SA 4RMGA 1NVTA 1VSVA 4D44A 2OD7A 3RG2A 2YMLA 3C6KA 1SUBA 3WC4A 4RA9B 1WBDA 4LUCA 3BD9A 4AS2A 4YRAA 2H1WA 1OPRA 3D2AA 4CCSA 2JFVA 1KDPA 1PFQA 5JALA 1FMJA 1W5AA 1KPGA 1RVDA 1DT5A 3HBAA 4OJQA 1XAIA 1DXYA 4ZREA 3ZH2A 3E9ZA 5C1OA 2AN5A 3E7PA 4QNRA 1V1JA 3QX7A 1PR5A 3UMFA 1X94A 3ANSA 4J2HA 1TT7A 4HB4A 3LFTA 4OHWA 5CFOA 3VOAA 2Q07A 3T3DA 2GWHA 4F4IA 1B0UA 1RYNA 2WV7A 3KKNA 1L5VA 2D06A 3GJSA 5C4GB 3BB3A 2DHQA 4DUGA 2Z04A 3M8KA 4H3VA 3TI9A 3OQVA 1NLUA 1SQ5A 2C03A 4B6PA 3AIOA 4Q4CA 2X3UA 4RJKA 3L02A 3K92A 2BGNA 2I1VB 3V8QA 1JRLA 4FNOA 2Q6TA 4JEHA 2GPYA 3V00A 1PJQA 2D8AA 4I6JA 4TWIA 1N75A 2A9OA 4FKBA 3K3PA 1OBCA 5F2EA 4DAEA 2WT4A 4EVQA 1OGIA 1KH3A 2FR0A 3SEAA 3H97A 3UKOA 2ZLBA 2B36A 1N34B 4KTTE 3T9AA 2BGWA 3JRWA 3M5WA 4TMXA 3SYNA 1C3JA 2C4HA 3PX2A 5FAXA 5CDSA 2HPZA 4KYVA 3VHLB 1PFGA 1N92A 5GZ6A 4HLUA 1K68A 4ZEXA 5IFLA 5J4VA 2IX9A 1F38A 4J7AA 4D79A 4P80A 2EKQA 1CRQA 4YEDA 2ONKA 3PC8A 2QRVB 1PEYA 2YJ5A 1E3DA 3G1TA 4EUKA 5EHXA 3LK6A 1AV7A 3TUIC 3COZA 5TT1A 3QBEA 4M8KA 2VIIA 3TNJA 5I01A 3WGKA 4KQ6A 4BP9A 2I2FA 4LMRA 4M22A 4QFMA 3C39A 4O2BF 4OSPA 4W1RA 1HYQA 1EK5A 3E5MA 3UMYA 2RD2A 4N8SA 4OMUA 4GBED 2IVFA 1XTUA 3SE7A 3R74A 1GAXA 3NHBA 4EECA 2IU4A 4I50B 4MS4A 3T5AA 2XZOA 1NQTA 5TX7A 1KIFA 1E3WA 1DBSA 5EJ2A 4MR7B 3SBDA 1M5RA 3BYZA 2ZXEA 5GVRA 4UEJA 1EQAA 3LUDA 1MW9X 2XJ9A 3NT5A 3CVXA 1ZUNA 2FQ1A 1FA9A 2WVGA 4L85A 4XOIA 3JQ9C 5CB4A 1GCAA 3QEJA 1CHNA 1WUIS 4J90A 1WBJB 4JAVC 5H80A 3SXJA 4XLLA 3OQNA 4Q9LA 4PAWA 2IT1A 1U9CA 4PYJA 4EX7A 1R8QA 3MTAA 4JELA 1QIEA 2PYIA 1LBSA 3LKDA 3CQ9A 3BD8A 3OSUA 4RORA 4WN9A 4Z9AA 2H85A 5FYDA 3WLKX 3ZWQA 1QWOA 1ZN7A 5IXYA 2AJLI 3GG2A 4TSKA 3IALA 3RM3A 2OFWA 1UMCA 3OE5A 1TLLA 3FR8A 3HDVA 3PF9A 3VPSA 5JNUA 2GN4A 5EIHA 1VXOA 2CZCA 4ZT7A 3UHPA 1HLDA 3I76A 4X3CA 1M3SA 2IPAB 1ZHHA 3M4JA 1SOUA 1H5QA 1W73A 4MVJA 1HUQA 3HA2A 1PKXA 1UPBA 4P7GA 1U04A 1R16A 4PHHA 3X1WA 3GPLA 2IZ1A 1KKUA 2F48A 4JFAA 5TC4A 2FMIA 4BKOA 2Y2UA 4EHHA 1TKAA 5HVNA 3CZ9A 4GR5A 1MKYA 4UHCA 1TZKA 4QECA 1OI3A 5EAIA 1E92A 4DPMA 2WHQA 1V0JA 1WY7A 2ZBEA 3EXHC 5EZ5A 1G66A 3SQWA 4JYBA 1XEFA 4QVKA 3G9TA 3ROFA 3D6MA 2AS0A 2WWWA 3CX7A 3I5AA 4FD2A 4F4UA 4MVJM 1RBZA 3N07A 1FPQA 2IOYA 2ZJ5A 1V1RB 2ETVA 3AVPA 1P39A 2C94A 1TVCA 1CULC 3LT2A 6NULA 2WHXA 1Y7LA 4RC9A 4YMSA 4CU5A 1U9ZA 2IWHA 1K8RA 1KEEB 1OGYA 4PHGA 4PZYA 4QU5A 2HXYA 5EUBA 2JARA 5LP6A 3S8EA 1KMQA 4BUCA 4I4IA 2QK4A 4ALKA 2PIAA 2EBUA 3WYEA 2IIBA 3WYNA 4COKA 3EDYA 1IMOA 2ZYGA 1TF5A 1NUSA 4GE0A 3M3PA 4Y0NA 4CM1A 2BLLA 3ZQ4A 1CUWA 2GPNA 3AR3A 1OI7A 1WULS 1TZJA 4Z9XA 1JJAA 4C2AA 2FPUA 2BI4A 3DZJA 3GQBA 2BW0A 5B37A 5CCXA 1KBOA 2Q4RA 2QD3A 2QT1A 3ZHTA 4O1IA 1P2VA 4HWOA 2PUDA 1P2UA 2WJ3A 1W4CA 4FXOA 3U4HA 4PQFA 1Q0HA 2IZ6A 4H7DA 1SM4A 1XCOA 4BX9A 2ZITA 1XYGA 1RQPA 3H04A 2YH2A 1OCEA 3JW8A 1M2WA 1SUPA 3HY4A 3K9NA 3EG9A 4R2JA 4DCCA 4H1VA 5IAKA 3VFDA 2X4IA 2GZ2A 4RMHA 4QXAA 4UZEA 3SR0A 1KZ7B 2I3BA 2PY6A 4GYKA 2A9FA 3ONEA 4HOYA 2R6R1 2G5TA 3JQEA 5JDIA 2CHUA 1VBFA 4I5IA 3SJUA 3JAKB 1J9GA 3D7SA 1Q7TA 2Q2WA 4EJSA 3FVQA 3TNYA 2PDAA 3Q3IA 1QR2A 2IC5A 4M54A 2B3TA 3P26A 3R77A 3OCXA 5ALSA 4OB6A 2ZUCA 3UJPA 4AQDA 4QT0A 4DLBA 3WQSB 4CTOA 1GKYA 2JAPA 3TMAA 4AJ2A 3T8YA 1F8YA 4FE7A 4U7FA 2JGDB 4ZK6A 3FDXA 5JNTA 1T4CB 2G09A 2E89A 1R3DA 1JIKA 4GOMD 4JK3A 4XGIA 2YZ7A 3PDIA 3N53A 1LRJA 3PQ2A 4PX9A 1RQ7A 3RRNA 1DAIA 4Z4HA 2FUCA 2UYYA 2WYUA 4ZU1X 2VHQA 2AFIE 3FPFA 2DPHA 3AR9A 1YJCA 2FZ4A 4ZEMA 4HEHA 1VLHA 2QLFA 4RKYA 2J8ZA 2LCFA 2FAXA 3AM3A 3CUWA 2DETA 2IV2X 4NMXB 3QPBA 4E13A 1I4TD 4WK0B 4CI9A 4RH0A 4WKPA 3QELB 5B64A 1SQ0A 1ZI6A 3HGTA 4MS3A 4OJTA 4Z1MD 1VSQA 4F06A 2QB5A 3M6UA 4N5DA 3WLTA 1TRHA 5CHYA 4B75A 2RHDA 3G5MA 1VL8A 1RWMA 1G21A 1Y42X 2PZMA 3TUJC 1A88A 4B6SA 4DOMA 1Z5ZA 2E5LB 2HA2A 1VE6A 3QVWA 4HLUC 4F4FA 1E60A 1WVGA 3MHTA 2CSXA 3WGTA 1E1CA 3ACBA 3G2OA 1M67A 3TAXA 2VXYA 2KB0A 4NZMA 4EF6A 4P34A 3EQZA 1NWCA 1YA4A 4Q4AA 4MRRA 3D2BA 2F55A 3ZLBA 2AG5A 2H17A 3ZS8A 4LF8B 3SZGA 1UINA 1RYMA 1DXOA 2I7DA 1IB6A 3DC7A 1Y80A 3H87A 4PYQA 2V9PA 4JLKA 3OQHA 4GLLA 1Q92A 2JFUA 2F17A 4ND7A 5EY5B 5EMMA 2Q29A 1IBLB 3IR7A 3FNIA 2CJWB 3BGVA 3GA7A 5C0OE 1GT6A 4DNXA 1N3BA 1II9A 3T6KA 3UW1A 1UDWA 1B0PA 3GY0A 3O8NA 3OU6A 4M89A 2GM4A 2ZIEA 3B12A 5U1PA 1LH0A 2E6KA 1DIRA 1OZFA 2VL7A 2GEKA 1BEZA 2CJYA 3HVJA 4LIPD 5DI3B 4DR5B 2ZUBA 1O97C 5K3OA 4OMFG 2BSAA 2BZGA 1UK8A 4ZCIA 3ER9A 2IV3A 3H9GA 1KVQA 1ZD5A 2ZE7A 2NU8A 3W2HA 4R8VA 3IQDB 1JXOA 1W1WA 4NK4A 1OTYA 4UDXX 5DTMA 5FFNA 2K87A 5DTRA 4JSYA 1GGHA 1NFFA 4DL9A 4DAOA 2JJ2A 4H7FA 2HSGA 3ASUA 3I1IA 3P9CA 1FYFA 4GZ3A 1DTWA 1NSYA 4KTVE 3PUYA 3VKWA 3ZCVA 3OZUA 3AQIA 1XZPA 4DIBA 2JGAA 3C5EA 3QI2A 3DMYA 1GZHB 4XX0A 4B76A 5CFLA 5L53A 2EHDA 4A15A 5K4AA 4TS9A 4YMHA 4GG1A 1H5UA 2PSSA 3A2MA 3DZDA 4X20A 2GZMA 1Z3IX 4PGHA 1H6DA 1XZLA 2WFAA 3K8ZA 4HZUA 4XWAA 3MW8A 4KR0A 1DLJA 1PR3A 2ZPUA 3LQFA 2BPOA 1NVKA 2YV5A 3DUFB 4JI3B 5IBRA 1XKTA 1TU3A 3RBZA 4IIVA 4KQXA 4KDEA 3TDMA 3RAFC 4LJ9A 3U39A 1KTVA 1R5JA 4HX2A 1CTQA 5CB6A 1T1IA 4HWKA 4LFCB 3U80A 1Z0UA 1R0YA 4GL2A 3MD9A 3AB8A 3FLMA 3KDPA 2YVQA 3WHPA 1B0AA 1JSRA 1YB2A 2J4FA 3N8HA 4G1CA 2CXHA 3RSOA 4R69A 4EY3A 5CA0B 2OCYC 5COBA 3U56A 4UBLA 4MDFA 2HD4A 2VQ3A 1LC3A 2I65A 1O87A 4RFSA 2FWMX 4M7PA 4WEOA 5DTJA 5FOSA 3TTTA 4B80A 3OT5A 4WUVA 1VRVA 4BQQA 5JXGA 1EB8A 1IWPB 5LP6C 3U7EB 4ARSA 3C87A 1A9PA 5LR6A 1UP7A 2VJYA 2TSYB 3OO1A 1UCFA 3U62A 4DJJA 1APBA 5CHEA 4ETNA 3EBPA 1G8FA 1XEXB 2HA4A 4QDKA 1FFWA 4AIRA 1NNSA 5KDOA 1ZJZA 2V1XA 3AZOA 4JSRA 5BV2P 3IIEA 1IONA 2AW5A 3WKBA 3KOWA 5BWCA 5AVUA 5KVCA 3CZPA 3NV7A 1ECLA 1WNTA 1NY6A 3NJRA 2QZJA 3NDRA 4IDHA 3JYNA 1FQKA 3BFPA 3EWSA 3NJ8A 4CI0B 3NDBB 1C9MA 1EMDA 4F3YA 1CRPA 2O8NA 2EX4A 1A9XB 5JS2A 1Q1BA 1PW7A 3AUYA 1SU8A 1MO4A 4KYTA 3VDNB 3KZCA 3Q7SA 3H2IA 1E94E 1XDBA 3EVCA 3SHQA 4E46A 3EMKA 3HGMA 1RAHA 3KXLA 4LI0A 4ZGBA 1UH5A 4RVGA 3S8YA 3ORHA 2ZWAA 4TTIA 5ILOA 1VG8A 3PQEA 3BXGA 3M1LA 4OXRA 1U5AA 4L02A 1O94D 5E4FA 4TWRA 3W2TA 3EF1A 4JOQA 5KHAA 2PMKA 5BRAA 5JDIC 1UFRA 4YMWA 2I54A 3TTYA 2CV1A 3EDRA 5IX8A 1GDHA 2H06A 1UPTA 3Q11A 5JRJA 5HKKD 1S02A 2BM0A 4P92A 3T1HB 3ZW7A 3FFWA 2VJKA 1UWCA 4QU8A 1KGDA 5JBIA 4BKPA 1UBTS 4BX2A 1PNVA 4B9EA 2B98A 4WZAE 4KQWA 2CL0X 3U48A 3RR2A 4EYKA 3CRVA 1P45A 3BXPA 4XJSA 1Z9BA 1EFHA 1P0QA 3ZVKA 4RD1A 4CEIA 5HS4A 2W2NA 4L51A 1Q0ZA 4LMBA 4MIOA 4NNPA 4RKRA 4KW7A 3ZTWA 1QFJA 3A9RA 3AILA 3MT9A 3K0FB 1U7OA 5AW4A 4AY4A 4K0KB 4KQGA 2VT7A 4DJTA 4EMTA 5JAIA 5P21A 1Y33E 3Q7RA 1Y1QA 4C7MA 2ZAMA 3Q3JB 1KU0A 1Y8RB 2NVBA 3PF8A 4YIHA 2X0RA 3QKRA 1W88B 1AE1A 1VG0B 1ORHA 3H75A 3L9XA 4H7JA 5AQEA 4ZVPA 5KBYA 2I4OA 2QUZA 3CR3C 3GQVA 1ZH2A 5C8VA 1P4GA 4CT0A 4PANA 4Q12A 1VLLA 1O6FA 2O2SA 1L0BA 4X91A 3VJKA 4WIAA 4YGYA 1W1IA 1C3LA 1W6UA 1ZITA 2YJGA 4QBHA 5KNLA 1J1UA 4OK6A 4BIIA 2Y66A 3RYTC 1ICEA 2RAUA 1KS9A 1S7GA 1ORWA 3MVEA 1CQWA 1WTCA 4I6GA 4IXTA 4C0QC 5DNUA 3PQ3A 2G04A 4YALA 5KKAA 2AT1A 1L7BA 1NYLA 3N76A 4EGFA 3ZD8A 3IIIA 5BSFA 5AJXA 3HSYA 2VJQA 4RIFA 5CYOA 3IHKA 2SECE 3PE3A 4U39A 3RIGA 1KJIA 1Z0AA 4KNYA 4MS3B 3D7LA 4HTFA 5L95A 5LQUA 3H1PA 3V1NA 5A6SA 1SOAA 4EW3A 1IN7A 3C6BA 2VNKA 4KXLA 1H3EA 2CVZA 3K9WA 4MHSA 2FUNB 1CR4A 1B43A 1SD1A 3N7TA 3FWZA 3D6JA 4Z7NB 3QWFA 2C00A 1BA2A 4HDCA 3EZ9A 3SZMA 2PS3A 1P8JA 1JDVA 1GV0A 1WABA 1Y3CE 2IP4A 2R00C 2VFAA 5CP8A 3UJ7A 1GGNA 3TTWA 3WYDA 3LXXA 5B12A 2EP8A 4EELA 1DJMA 4B3FX 4RULA 3OJFA 4Q4AB 2VHEA 5HE9A 4JP8A 4EPTA 2PS9A 2CMDA 1NZDA 4NBUA 1RZRA 4YRFA 1ZO8A 4PO1A 1T29A 2AX4A 3FNHA 4NWIA 1REQA 5CA1B 1AQNA 3RC8A 2O06A 3AR4A 1XZ8A 5HK8A 2BISA 2QS9A 3T3PB 3V48A 5BQXA 3Q3HA 3R75A 1M76A 5D3MB 5JE8A 1JN0A 4J1TC 3VHQA 2VHVA 1LK7A 1RQGA 4ZMSA 2I2CA 1VHTA 2D62A 1JXQA 2AD5A 1KU6A 1IOZA 4I8XA 1FRQA 2DY1A 3FBTA 4PQRA 5I4KA 3REQA 4JLVA 5KWIA 5KX5A 1OAAA 2X41A 1IG0A 5BNWA 4CN8A 2JKZA 3H1AA 3ZQJA 4ETIA 5JZBA 5CVJA 3QXCA 1PYDA 4RKWA 1OD6A 4RF2A 2G77B 1DTWB 2YMQA 2GCNA 3GYGA 1BHJA 3AO0B 5A4MS 4FNGA 4HWSA 4EVSA 2HPHA 1GEGA 1L4MA 1PQ4A 1KYZA 1DDOA 2IW3A 4U2FA 4GI3A 3HBMA 1QFXA 5F76A 3A4MA 5FNZA 7REQB 3C3EA 5IKMA 5TJ9A 1SKYB 1FEZA 4AS3A 2BFCB 3JD0A 3OZRA 2ADOA 2VHZA 2Z3WA 4Y67A 5IVIA 4ENUA 1LSUA 3U1TA 4DHWA 4RIEA 4FCWA 3E9CA 2PGLA 1MH9A 2RJNA 4FQ8A 3UWKA 4BNIA 1G8GA 1UZUA 3ICEA 3S6JA 5T4BA 2I4TA 2PSHA 4S1VA 3UJ6A 1E7QA 2B92A 2CJPA 2QG4A 4GFDA 1P2DA 3JQCA 3WMRA 3MJRA 3O90A 4FP9A 5DYWA 4YN3A 4L3WA 5TNXA 3G85A 2XZTA 3P1JA 4FTWA 4ZV4A 3WYCA 2QX6A 3T12A 5JAOA 1DL5A 1FYDA 3IUSA 2DPYA 1HDOA 2GNOA 1NFQA 4AJJA 1DO2A 2BTQA 2JFYA 5K3CA 1X1BA 3JQGA 3R5SA 5JPIA 2JH9A 4D9GA 1RPTA 5DB4A 2HEGA 2O8DA 1WMDA 4Q3NA 1IYZA 4KZPA 3UUGA 4TYWA 3SZUA 1YR9A 3MA0A 1ZI9A 1BKYA 1TA0A 4UW9A 5EWMA 3D0RA 3EHEA 4M21A 1KQNA 5B4VA 1O95D 5DHRA 1LDBA 4N41A 2PXAA 3E0XA 4I8IA 4A6EA 1MAVA 4ZD6A 1W25A 4KFTA 3E3LA 4J94A 2ENWA 4RU1A 1WXDA 4MQEA 4B3CA 5LUAA 5I7EA 3H5IA 5H7XA 3G2IA 4Z4FA 2VWQA 5IJ9B 3AEYA 3ORSA 2VJNA 2VRCD 4WA8A 3Q8LA 1DBWA 2YC2C 1ULTA 4U2EA 5IBPA 4ZQCB 1GITA 1OFHA 4ZO7A 3R0QA 4CV1A 5DXFA 3RFCA 1NMQA 4FXPA 2BFDB 1XJWA 2XEXA 3D7RA 1Q44A 5ER6A 1KAMA 3A2LA 2CUZA 1NUTA 2R7MA 3Q8WA 1BS9A 2HQ1A 2PVSA 3BVPA 5IT4A 4L3OA 4RMIA 1Y6GA 1F60A 2Q2OA 2PL5A 2ZQ5A 4MMZB 3D81A 4S0XA 2P9GA 5U4XA 3H05A 3ZV5A 2O2CA 2ZAIA 3IDQA 2JLWA 1UPUA 2C5FA 4DJDC 1I7DA 4F2GA 2Y1FA 4QAQA 3CYFA 1OZAA 1DFIA 3WICA 3CB2A 1T34A 1E9BA 1C7RA 1Q15A 2NXNA 1FPMA 3N28A 2IGBA 4XDHA 3WL7A 4D74A 4YREA 3TVDA 3RCBA 3E2MA 5DM60 5HGXA 2PUBA 4D26A 3R3YA 1JFFB 4FW9A 1CU1A 4KOAA 4ASUA 2NU6B 1QGED 4X9XA 2D7DA 2X5KO 3UXYA 5HZHA 1T5HX 3T3OA 2X76A 1P0FA 3OPVA 5GIPE 3QKWA 4YCDA 5JS6A 5K1ZA 5CDFE 1JSCA 5A7GA 3BBPA 1RWPA 1P9WA 4FHFA 4HWTA 2OEPA 4KDRA 5TB5A 1G9TA 1RI3A 3BWDD 1C0EA 2ZAYA 2R4QA 5ITZA 2YFYA 3O9MA 3UJCA 3VI3B 3RSHA 4Z5XA 1MB4A 4LY6A 3JVDA 2GCGA 1XMPA 4LXXA 4RM2A 5CBPA 1L4YA 2L42A 2HRRA 4ONEA 2AEJA 2WINI 2BLNA 5NULA 4DBVO 3NEPX 4FHDA 4G84A 2VAVA 2JS7A 5CITA 1C9EA 4M99A 4N49A 4QDZA 4OHYA 4R0MA 4ZZ2A 1DX4A 3N59A 1IXSB 4WT7A 2PBFA 2CDRA 1QGYA 2YJZA 1HFKA 1QE3A 4IM7A 1T0UA 4REQA 4WE3A 2F1JA 1X87A 4MV7A 2XKKA 2P9HA 5TS3A 3T3IA 1V8DA 3O93A 4L0QA 3CVVA 2NUAB 3F3KA 4AKTA 4KITB 1F2VA 4MVJI 16PKA 2BTOA 3KEMA 4MAMA 3OA2A 3SQNA 1A95A 1E1LA 1XTQA 2VZLA 1TX4B 4MV6A 3ILYA 4MV4A 4FGSA 1CVLA 1E58A 1U8CB 2VO1A 3GVXA 4OHKA 4U0JA 5EQDA 4EO9A 4Q24A 1K7CA 1NOJA 2ZRLA 3EVNA 4RJJA 1GFIA 3ETDA 4CLEA 4RCVA 4BIMA 4RX1A 2HPVA 4OREX 1ZGJA 1RS0A 2GGSA 1LDMA 1RXYA 1A9RA 1E9VA 4HKTA 4IVRA 5AM1A 4LYYA 1JT2A 1MB0A 3MZ0A 5AOBA 3ND6A 3O8BA 3HO1A 1ZOLA 2OGSA 3EIEA 3ZEIA 1J2UA 4E5PA 5D5HA 3G9QA 3O31A 4ZVTA 5JSFA 4MYDA 1KZGB 4BKMA 2YHBA 4FU0A 1L5RA 2EV9A 3IA2A 5KYYA 4B4VA 4R98A 1S4QA 2AR7A 4BVKA 4EY7A 4GZLA 2QRUA 4TZ0A 3SYRA 1TUGA 3WGZA 5HJEA 3E1SA 1XZKA 1ODCA 5A4DA 1QF6A 3TQFA 2WR8A 3VC7A 1B8UA 3JZMA 3GFFA 4LS3A 3DHYA 2X0NA 2QLTA 1VKZA 1LFAA 2XQVA 4OUDB 4WXEA 3QVGA 1N0WA 3ACDA 3GW8A 1ANKA 3JCZA 2RI1A 4GBGA 4MKFA 4R68A 4RD3A 3SN6A 1REQB 1DAEA 4P0TA 5BQPA 1HRKA 1K5GA 4CF4A 3ABRB 3DYBA 2GTHA 1DIOB 2A5DA 1ZIDA 3ANXA 3FCOA 4XGNA 2M6RA 3L7YA 5GY7A 2VDKB 1V3UA 1V2HE 4Z0HO 4RHTA 4PCUA 4A8TA 1V25A 1J20A 1X1AA 3KL2A 4G0XA 1OAKA 2WP8J 2VSNA 3T1TA 1SHTX 1HMPA 1IZ8A 2QGFA 2Y9MB 4WVFA 4UUBA 3W2FA 3W79A 1XXHA 3ESCA 1PQUA 1FNBA 2IU0A 2JI7A 4A1OA 3MUFA 4HUTA 3Q7PA 1Q77A 5E1OA 4ER0A 2FEKA 2R65A 2HHAA 3JS5A 4OQ4A 4JU9A 3V7UA 3X1JA 4ZVKA 4CVNA 2BZ0A 3HYCA 2ZI4A 5CK5A 1IQ0A 4UFNA 2VNSA 3U1VA 4YLGA 1G3IA 1GPNA 1NUQA 1Z5UA 1LI5A 1Z25A 1H2EA 1OU4A 1GUFA 1NBIA <