2HFGH

Crystal structure of hbr3 bound to cb3s-fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
220
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTISSSSIHWVRQAPGKGLEWVAWVLPSVGFTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRVCYNRLGVCAGGMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CB3s Fab light chain (kappa)
molecule tags Immune system
source organism Homo sapiens
publication title Synthetic anti-BR3 antibodies that mimic BAFF binding and target both human and murine B cells.
pubmed doi rcsb
total genus 40
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfgH01
4X5LA 3WNPA 3V2AR 2E9IA 4D9QD 3FHQA 4PRHB 4KK9C 4NNPH 4S1SL 1EO8L 4P4KD 3TP4A 4KKNA 2ARJA 4TTDD 3IDXH 5KSBF 2AK1L 3PG2A 4IMKC 4JVPA 4AQOA 4M4PA 3X3FL 5F1NA 2HT2C 1A4JB 4OKVB 5E6IB 1I1YA 4MJIA 4HJJL 3PXHA 2DRUA 3QG7L 3EGSA 4NNXA 4HIEB 3MXVL 1ACYL 4UTAL 3U36A 3TNNB 3K0WA 1GRWA 3NCYS 5CP3A 3IKCA 2Q8BL 3EO0B 4MXWL 2YRZA 3V7AE 1SQ2N 3OAYK 5DQDH 5I1JH 1A6PA 5K9OA 4TOYL 2DBJA 2BDNH 4O2EB 1MLCB 2VZ3A 4HWNA 5LWYL 4ZAKA 3QEUA 5JDSB 1RZKL 3WE6A 2R2EA 4J12A 2XWTA 2F54A 1N8ZB 1LD9B 3C6LD 5DD6B 5ERWB 2GT9B 4R97B 3BQUD 2DQEL 1IKNC 1W72B 1T80A 4HIXL 4AENA 4X0KB 4FFYH 1JWMA 1MFNA 4MA1C 1A7OH 2P8MA 4JLRB 5IBUG 3DO7A 1KPRB 4HKBA 3V0VA 4RAHA 2WBWB 3SGEH 3U9UA 2CRZA 4ORGB 4WFEE 1BOGA 5HI4D 2IADA 5IBLC 1NCAL 4JPWL 5KVMC 1XZ0A 2W59A 4D9RD 3I02A 2LE9A 3CCHA 4YO0A 1V7NH 4ESKA 4LSTH 3PHOA 3NFNB 5GRJH 2DLEA 2B5IB 1S7RB 4NQEE 1I1FA 4OFPA 4JGMA 1MAML 3NA9H 2P49B 4NN5B 1LE5A 3J8F7 4QOKE 3WO4B 2B7DT 2HFFA 3EYUH 1IGJB 4NRYB 2H3NB 1FNLA 3HZVA 2WLZA 1AD0A 5IROA 1P9MC 1EFQA 5A3ID 2XICA 4DAGL 3KYMB 1U8MB 3U82B 4D0CA 3PL6B 4IDJL 2XWBA 4JFFD 4BJLA 4AEIH 4R96B 5CP3H 1PKOA 2GCYA 4K7PL 1EHXA 5F89A 2Y6SC 2I9TB 3S35L 4FQLH 4Y1AD 4QNPF 4WTZG 1FFNB 3QEHB 1V8HA 5CD3B 3U0TB 3QI9C 5M7QA 3U2SB 1ZT7A 1Z2KA 5LXGL 1EJOL 4ZD3H 5E08H 3ZT6A 1AXSA 2ZUYA 4OCXL 3SEPA 2J8UA 2MOVA 5KSBA 4CN1A 5CBEB 4MAUH 3V0AC 5GXBB 1U93B 4S2SA 3HUJA 4H25B 2XTJD 3INUH 3PDOB 3PDDA 3QAZC 4YXHL 2O61A 5ESQB 4U1JB 1GC1L 2CXKA 2D3VA 2NZ9C 3TBSB 4BSWB 1H0DA 4HUUB 1VESA 1UC6A 3E8UH 3VW3L 5JZ7C 5BMFL 2UYLA 2APTA 3CSYA 3GSRB 1V7NL 4Z7UB 3GMQA 1P1ZB 1JZ2A 5GJTH 4JB9H 5DRWB 3OKEA 3CX5J 3GMPA 3WE6B 5D7JD 2EKJA 3MRKB 1MCHA 3DX6A 5DJAA 1YNKH 3IU3A 1INEL 4OFDA 3H9YA 3G9VA 4IIQC 3WEXB 2MPAL 4WUKH 3LQAH 1A3LH 1UJ3B 4P4RB 4QY8B 1PVHA 5IB4B 1FYTD 2JLLA 4N0UA 3K46A 2W9EH 5CJQL 4WY7H 4I48B 4EUPH 1FFPB 1IQDA 5I1IL 3BN9C 12E8H 1IARB 1VFBB 3ARFB 3SCMD 3EYOB 3D48R 1PQZB 3T1WA 3AC0A 5GRVL 3QRFM 3CK0L 4BZYA 5C08E 1FZJB 3FOMB 5GS3A 5IVOA 3DX8B 4UILL 1V5JA 2AKRA 4NRXB 4G8GB 3OKYA 5JXEA 1CD8A 4Y0GA 1OTSC 4U6HA 5E6ZA 5IKCA 4LLUA 3PP3H 3TCLA 4YBQC 3ARQA 4PGBB 3GUTB 4P59L 3OWEA 3IYLW 3IAPA 4U1JA 2DWEA 5L8KB 1MVUA 1N5AB 5HDOA 5DRNB 5T1DH 5IEKA 2WQRA 4V2CB 1RJLA 1OF2B 3VE0A 1U92A 5GGRB 4QHKI 1M6OB 3RWHB 5FGRA 4CW1B 3IS0X 4GJTB 2VXTL 4XPGL 3I6KB 2ESVA 3LZFL 4KDWA 2KZ1B 3BKMH 2AQ1A 4QRSB 3X14B 5D93C 5F8RC 1SM3H 1NGQL 3IXTB 5FYKE 5C3TA 3C8DA 1VFUA 5ENWA 4F8QA 5F89B 3CZFB 4BH7A 2X9XA 1I7TA 1V05A 1NGYB 4PTUA 2JB6A 1BWMA 4M8QA 2YXMA 4ZFOL 3KYMA 2H8PB 1CR9L 1JNLH 5FB8A 1JN6B 3MNZB 5JW4N 1PQZA 4JVWA 1RVFL 3KR3H 5L88H 2HH0L 3UBXB 1EZVY 1MCBA 5J89A 3KR3L 4RDQG 5EPMA 1BF8A 2XKNA 1SVCP 2QEJA 1O7VA 4YBQD 1MLBA 3DETD 4PJGB 2NR6C 3OKDA 3HI6L 2BMKA 4ZO9A 4ZXBB 4R4NC 1H5BB 5MEOA 5IROC 4GAYA 1YEJL 3MLWL 1SY6A 5GGRA 4MJ5A 5DDHA 1DTUA 3B83A 1K5NB 4IIQB 5D7LB 5KSBE 4XPBH 3O6ML 2Z8SA 2ARJQ 2BC4B 4YUEL 4LEOA 2E9WA 3BXNB 1JF1A 2H26A 2VH5L 5TDNA 5FO7A 1HSAA 3L3HB 5TE7L 2MCG1 2EDYA 1HEZA 4H0IA 1G7LA 1WAAF 3MLRL 4MXVE 1A6TA 1J9CT 4JFDE 1NGWA 3KPNA 1IAIM 3MX0A 2BVUA 3KXFE 1X6LA 4MXWH 4OB5H 3BKYH 4ZUWA 3R8BB 5EULV 3EYUL 5TPWH 3U4EA 5SV3A 1GVIA 4POYA 2AVGA 5JPNB 4FZEL 1ZLWH 1RZIA 4Z7NE 4YHOH 2BVQA 1EEUA 4JPVH 3BP6B 43CAB 2WW8A 2Q76A 3TZVD 1B3JA 4YZFE 1ORSA 1TZIB 3OX8B 1X7QA 3K2UL 2W0LA 1NDGB 2IFGA 4X5XB 5E1HB 3CLEH 4KGJA 3WYRA 3HRZB 3FZUC 4GLRH 1I9EA 4R2GD 3V5HA 1JUFA 1ZHKB 1P6AB 1JHLH 5CZKA 4HMDA 1UKQA 2XZCL 4ELMA 1JGUL 4YHYB 3MCKA 2JJWA 4OZIF 3B5HA 5B39B 3LB6D 3MRBA 1MHCB 1I1AB 2FIKB 2OQJB 4PJ7B 3VXRD 1U95B 1INDL 1HQRB 5J6HA 2A1WH 2VL5B 4HZLA 3MLSH 3RGHA 1Q0YL 4HXAH 2MQCA 3X11A 4YHPB 4Y8AA 4NWUL 4H88L 2WBJD 4KKBD 3L7EA 1DUZA 1RZ7L 4IMLB 1C12B 4C59B 2OJZL 3D25A 1EBPA 2BSRB 3C8KA 1X44A 5KVFL 3LS4L 2AEQL 3LSOA 1MF2L 2J12B 1JGDA 4Y8DC 5EFIB 1JGLL 2PO6C 5T3ZE 1KB5B 4U31A 3RWCB 5I73C 3HLAB 1FCCA 4Y5YC 1OPGL 3ARWA 3BP7A 4XAWH 1F4YL 5EZIH 1RHHA 1N6QL 2ZSWA 4Z78B 2A38A 2GCYB 4UINL 2VXSH 1MPAL 3GJEB 3I2CH 1CGWA 5I66B 1BMGA 1X5IA 4PB0H 5EUOF 1NGZA 4I0PA 4L4TE 1NLBL 1IAKB 3PNWA 4WV1B 1K4CB 5EIVA 1EH9A 1TZGL 1NLBH 2DICA 3WNKA 5GRXG 3ZLQC 5JXAL 5FGSA 2B1AH 1LO2H 5FA4A 1YNTB 4U2YA 5I75C 1SJVA 1DEEB 4MD0B 2BMKB 2EIZB 2XKSA 4JFFA 3R8QA 1BREA 4YHZL 6FABH 1OD7A 3V4UH 3EYQD 1NGPL 2PXYD 4C58B 4OD2A 4NM4H 5DJDB 5I30H 1G7PB 5C71A 1U91A 5L0QC 2NX5A 4WFFE 1S7XA 4XCNB 2QKIB 3QUMA 4LKCB 3H9SE 3VH8B 1YN7B 1FVEB 1WCQA 1OAKL 4HEPG 4WW2A 3MYJA 1Y18A 3WCYA 3MCLH 4WHYG 3ARGD 3RUGA 4UDTA 1P69B 4TRPH 3L3IA 3IFNL 3N1QC 3KPRA 4P2OB 3RWDA 1B6UA 5I74B 5FF6A 4C55A 1VFOA 4BH7B 5GHWL 4JDZB 3C5ZC 4K7FB 2AJVL 2YD7A 2E7CA 4HG4J 3GIZL 1UG9A 3MC0A 1CFVL 2P5WB 1JTPA 4P5TC 3B6SB 4PJHA 4XBPB 3Q48A 4WFGE 1JN6A 2BOCA 4O9HL 3MV7E 5GS0D 3T4YB 1A3QA 1LO4L 3T77A 2PW1B 1QO3A 4HS6B 4UB0H 1IC7L 1WGOA 4ODVH 3CXDH 1G9EA 1KELL 1A7NL 1JI1A 1T03L 1NCBL 1U8JA 3MJ8A 2AEPL 3E3QE 4MNGA 1BIIB 1WZKA 4WU5B 1KEGH 4AIOA 1PX4A 2EXWD 1S5IL 3FB5B 1F2QA 4UDUA 1TXKA 3RPKA 5IV2B 5GIRB 1A6VL 4N5UA 2VLJA 1KT2B 1IEAB 3DX7B 4X98A 5GJSL 3TH4T 1CE6B 4F7MA 1D9KC 1JHKL 1RUML 3K1KC 4P46B 4YIQA 1M71B 3WDJA 4U7MA 1MEXH 4IMLA 3W39B 3W81A 4HFUL 1S7UA 2VH5H 4P4KB 4L8BB 2B0SL 4MGXA 4PJEE 5DI8A 2W0KA 4DZBA 3IJSA 1T6VN 5FO7B 3UC0L 3BQUB 1KFAL 1CE1H 3L6FB 3DLQR 4WW2B 3RWGB 2ITDA 3HMWH 2BRQA 3RIFK 2GFBB 1E28B 1R6VA 4I18B 1U8IB 1OLLA 3RDTB 1QPPA 4FQQA 2I9LA 4MD5A 4PJAF 4GKZB 1NJ9A 4HPOL 1ACZA 3VA2C 3T77B 4N0YL 4EZMA 1OP3K 1SYSB 1PG7W 5D2NC 4OGYH 5TE4L 1BQSA 3QRGH 1WZ1H 2GITB 3KS0J 4ELMF 4MJ6B 1NAKL 5HPOA 3NCFB 4EN3B 2HFGH 5C0BE 3VWJA 2E8YA 1G7HB 2EYRB 4PBVC 3ZT5A 4NSKA 1IGML 3D87B 3BD3A 1DP0A 1UGNA 2F53B 1KBGH 2Y6SD 5JQ6H 3T8XB 4U0QB 3FT4A 3QFDA 2PYFB 2NW3A 43C9A 1XGUB 4LP4A 5I8KH 5EOQH 2H2PC 1HYSD 3O4LB 1CI5A 1FDLL 2WBJB 4KJWC 2PO6D 4HFUH 2MWCA 1XR8A 3K8LA 4ZO8A 5CGTA 4R90L 1NANI 5TPWL 1T6WA 1YQVH 3BIKB 3QQ4B 5GGVH 4PJCA 3ROLA 1WAAA 3FJTA 4K3GA 5D71H 1AH1A 4Y4FC 2DQCL 5I8CB 4JZJC 1NFIA 3WFDL 5I19L 1AP2A 4OF8A 5T3XL 5F1IB 3VXMD 1FAIL 3HZVB 1KTRL 3GMRB 1QNZL 2XN9A 4ODWB 2WUBH 1FAKT 2B20A 2YPLB 3RHWK 4M61B 1QKZH 2G60L 3QUYB 3U0TA 3WDHA 2O26U 4PRPE 2GITA 1ZVSA 4HMCA 3M1BB 4L4VB 5EBWA 1CDHA 2PETA 3O3EA 4Z0XA 2WWKO 2FRGP 4ERSL 4KMLB 5C6TL 5L9DL 5CD5D 1TDQA 1U3HA 3JV5A 1MJJA 4XTRD 2EKSB 3DUUA 3MV9A 3FQRB 5DZOA 4U1HA 4NZUL 4F7PA 5H2BB 3OJDB 4E41D 3KYOA 5I76B 1QBLL 1I9RL 1DVFA 1KCRL 1RUAH 5I1LB 4L3EB 5C0BA 5JW3H 1MCWW 3LKSB 1BVLA 1BZQK 4M7JL 3OSKA 4G7VH 2FZ3B 2X1PA 2W60B 3KG5A 3R0MA 3MV01 4OGAC 1GXEA 3VGHA 1FFQA 1F97A 1KLGA 5FYJH 4Z7UF 4WEMB 2VLJD 4POZC 4LDOB 1CFBA 2Y9RT 3S7GA 1H3TA 2HWZH 3PWNA 3W5NA 1D5MA 5H94B 4CL7A 2H6PB 1UVQA 1VDGA 5I6XC 3BWAA 2NY5H 4U1LB 5KS9E 1A21A 5IFJB 4L4JA 1FORL 1WAAE 4LRNH 4UNVA 1FL3A 4XX1E 1F42A 5LJYH 4CU8A 3OB8A 2VITA 5BVJB 1W0WB 3NIDE 4ODWA 2R2BB 2LU3A 2VIRA 1V3LA 3QEUB 3RWJA 5C0JA 1U36A 1ZEAL 3L95B 5E2JA 4ZNEA 2NY0B 5ISZD 3VXUA 3T4YA 4OD1L 4X6EB 3FQNB 3T3MF 3TVMA 5D1ZD 1AR2A 1D5XB 4JY5H 2V2XA 4DAGH 4HFWB 4NZDA 1KXQE 2JKXA 2R4RL 4OAWA 4OI9A 5J06A 3LAFA 3EO1A 2ED9A 1XF4A 4LVEA 1OAZH 4WGVB 3MFFA 1ZHLB 3SE4A 3JBG7 1G9NH 3BT2L 3QXWA 4HWEH 4M02A 3KHQA 1FLRH 3ARDA 1KPVA 4OF7A 1FYTA 4LIQE 5F1NB 2Q20A 4MNQA 2DWDA 4RGND 3EGSB 4NNXB 1VGKB 3QEGL 3H9HB 3UO1L 5F8QC 1Q72H 2WV3A 3CFCL 2KL6A 5F9JA 5F9OH 3RNQB 1A4KA 1FNSH 2YPVL 2BHZA 2AI0H 3BZFB 2Z31C 2VXVH 1YA5A 5B39G 1S5HB 3G5YA 1NH6A 3QH3A 1MWAA 5BZWA 4PJFE 4Q9BA 5IBTL 4YNYA 4R9HA 5DJXB 2VR5A 2IQAA 3GB7B 5AZEH 1F3JA 4HK0B 1YEGL 2W9DH 4BUHA 4E41E 4PY7A 2IAMC 2N7BA 6FABL 5ACLA 2AEWA 4O51A 5F1SA 3ME0A 3K8KA 3DIFB 2W91A 3G6JB 1I8LC 4AENB 1KEML 3QG6A 3LD8B 4NPYA 4UT6H 3NPSB 1JUFB 5IHBA 1W0WA 1Z9LA 4K8RH 3VXOB 2IG2H 5I1DB 1UXSB 4K8RD 3ZHKA 3D3VB 5DFTA 1LEKA 5IFAL 2GJZB 2HAZA 1NSNH 4PRPD 4OB5L 1KENH 2WWKT 4F9PC 3VD4A 4LP5A 1R5VB 4HUNB 2K7PA 2FDBP 3ZHDA 3ABZA 1ONQB 1ZVYA 2X4QB 3DVIA 4YFLF 4OJFL 5FAAA 3BGFB 2UV3A 4MNHB 5JPNA 5DUBB 5CJOH 3TV3H 1FVDA 1J5OL 2YD4A 5GGRY 1K6QH 1JNNL 3GHBL 1FL3B 1VADB 4HPYH 3HB3C 3LS4H 2VL5A 3QQ9C 1IAIH 5A16A 4X4XA 1G0YR 5DS8B 4LCUB 4RGMB 3T0VA 4LSUH 5DRWA 2IG2L 1FNAA 1JPSL 2YXFA 3BAEH 3ARSA 1A4JA 5HYJE 2PYEB 5BV7L 4GXUM 2VZSA 4QTIL 5ITBH 1OTTC 4ONHA 1XR9B 2RFXA 3SO5A 5I2IA 3GM0A 1ZT1A 5GGTH 4MVBC 1NCDL 5EO9B 1CGYA 4MHHG 4EUPA 4R8WL 4J1UB 4K3DL 5T1LB 4XWOC 4XHQA 2MTPA 3SJVB 1CFNA 3M1BA 3OAUH 1AXSB 3OAYH 3P9WB 4KUZH 3QA3B 1A6AB 2P42B 4HFWA 1HSBA 4I0PD 4XXDA 5JORA 1A7RH 3QPXL 1X5XA 5B38A 2B2XH 3LH2L 3PQYE 4MWFA 2KBGA 4NQDB 4MD4A 5GZOC 1BJ1H 1X3DA 1WWCA 4IRZH 4NUJB 4IHOA 5D2NB 3UMTA 3KGRA 1NDMA 2ZSVB 2FH6A 4J6RH 1HKFA 2I07A 4IRJB 2KUTA 5LQBH 1LK3H 4YDKL 4LLYA 4NHUB 3BT2H 2DQCH 4X7SL 4Z78A 1KOAA 2E8ZA 4P3DA 1SY6H 1IQWH 2HN7B 4PY7B 3OL2A 3TWCL 2ZCKL 3MBXL 4NWTL 3QWOA 1WC7B 1YC8A 5ICXA 2OL3L 5DMKA 5DJXA 2IQAB 1QLRA 1MCPH 3G6JF 3QDJB 4M7ZC 3HZKB 5DHXB 5KSAB 2YRLA 4MJ4A 5HTSA 5FCSH 4B53A 1J0YA 2GJ6D 5J11B 1I7RA 1FL6A 3QO1B 5C2UB 5ETUB 3V8OA 3C08L 1J0IA 5FOBA 1IAOA 3I3BA 1B90A 4M48H 3OAUL 2FJHB 1J1OL 2XN9D 3UBXA 5T1KD 4P2RA 3BQUC 5E56A 3ZL4L 3ZTJH 1WLHA 4GG6B 1QVOA 5D1QD 4PGCB 3BKJL 4KJYB 3QULA 1CXHA 4TVPH 2M26A 1WVZA 3CVIL 4OLUL 1AQKH 4B7LA 2Z9TA 1A7BA 4YFEA 4ZFFB 4PJ8D 4JRYA 1JMZA 3CPLB 4YHLH 4FXKB 1IBGL 4XC1L 4EBQL 5DTFA 3KYNA 1Q1JH 1AQKL 1NMAL 3SGDI 1KGCD 1VSCA 1JK8B 4NO0B 3LS5L 1C16B 1WQVT 3QUZB 3UC0H 5D4QA 2N1KA 1K9TA 3HI1A 1NDMB 4HK3J 4XVTL 4KK6C 1U0QA 4P46A 4LMQI 4WJ5A 5DO2D 1DVFD 4J23A 1MEXL 5BS0A 4GXVL 5CLTA 1U3ZA 3VFTA 1W72H 5ANMB 4C56A 1EJOH 3KXFA 2RFXB 4ZSOB 4PJ9B 1FC1A 4IRJC 1Z3GH 2GJ6A 3SE8H 1DBKL 4MNGB 1BFSA 3S88H 4NP4L 1U3HC 3HMXA 3P77B 3MLTA 1SMOA 3PE9A 5CBEA 1RUPH 3U83A 4JHWL 4P2YA 3VFWB 3GZKA 4R3SA 5I16B 1XGTB 4CADB 1A14L 1R0AH 3D39A 4PUBH 4WWKB 3CC5A 4N8VG 5GGQH 3MJ9A 3ZYIA 2ZP0T 1XCTA 3LB6C 4HSQA 3PWJA 2L4OA 4X9GA 1BVKB 3NFSH 3O81A 4NNYA 1I8MA 3LIZL 3Q5YA 3U4AA 1ZGLP 2BJMH 2CLVA 3KNBA 3RU8H 3T1FA 2ZUUA 4P23D 4JJ5A 3GK8H 3PGDB 1KG0B 2AV1A 3RKDD 1I8KA 4OM1L 1H3WM 3BO8A 2EO1A 5KOVC 5ISZA 1XEDA 5L2KB 1FN4A 2IQ9H 5JW5B 4B50A 5DRZA 2IPKA 3MUGB 4J3UA 2O5ZL 1IC4L 3QDHA 5KS9F 1UM6L 5DFVD 3ES6A 2OJEA 4TNWK 4YR6B 1KUMA 1RUQH 2VAJA 4ERSH 4K71C 1XF2A 1CBVL 4LK4A 2FH8A 1AIFA 2DM3A 4DW2L 4D94A 3D0LA 3WIHA 3KLDA 2C1OA 4JM2A 4X4YA 2BNQB 3FQTB 3QSKB 4PJDE 1KLFA 2BFVH 1TTGA 3QPQC 3QFJE 4MA1B 3TO2B 1U8HA 2VISA 4P3CH 5I1KL 2FBJL 4A2LA 1MCJA 3O0RH 4Y2OA 2VABA 5DC0A 5ANMA 5FK9A 1NC4A 5F7MC 2Y36L 5T1LD 2HFTA 1ZVHA 1NFKA 1KF9B 3JV4A 3MCG1 4XNQA 3RBSA 1LEIA 2OR8A 4A6YA 4G6FD 4Z76A 1OP9A 1DUYB 4GRLB 1KFAH 1ZAGA 1ZANL 3D2UB 3GFUA 2NTSP 3VGGA 2CRYA 3PF2A 3K2MC 1R5IA 4PJ8B 3FT3B 4WUUB 4NQTA 4Z18A 4J4PC 3VXSD 3EJZC 2VMFA 2CKBB 4MDJB 5CLWA 3CD4A 1DBBL 3SDXE 5I1GL 1B88A 3LKSA 2HTKC 3MGTA 5HGHB 3CCHB 1AGFB 5IBTH 5SX5K 3AUVA 2ICCA 3PV6A 5IB3A 3P4NA 2A6DB 5H2BA 1QRNB 2DIAA 2VC2H 4P5TA 3OJDA 2FEEI 1MF2H 5BOPA 2FNBA 4QKXB 3WLBA 4LLDB 3GSUB 3F7RA 5DD0H 5HDQL 4EN3D 4HKXA 1MREH 3N9GH 3FRPA 3HMXL 2ZSWB 1FFOA 3IFPA 2DM4A 5HDBE 4HLZH 3FFDA 5ALBL 4DN4L 3VFRB 1J8HA 3QQNA 5HVHC 5C2BH 5SWQA 5IB2A 1HHJB 2CGRL 3DMMD 1A0QH 1BM3L 4RWHA 5IJVA 4XX1G 1I85A 3MRLB 1JHTB 4KK5C 2BERA 3WS6C 2H9GB 3HZKA 1A0QL 1YEGH 4F57H 5HYSG 4PJ9D 1JF5A 3VFWA 4YDVA 1E4XI 1RMFH 5DD3H 3VFVA 4BQ9A 2Z92B 1YYLH 5TF1H 5JHDB 2R1YB 4OGZA 4TN9A 1WTLA 2M8XA 3D2UA 4P2RD 3EYVB 5BVJA 3HNVL 4HUKB 3PP4L 3IB4A 1ORSB 2SEBA 3G6DL 4IOSD 1EO7A 1KPRA 4HKBB 3V0VB 4HAFA 3VFNB 1JNNH 1K6QL 4HDIB 2PNDA 3KPRE 2DB8A 5DLMH 3OXRA 1QBML 3KLHC 4X7TB 1NBYB 1H0DB 3O6FA 3UTTE 1GGUA 2APWA 3CVHB 1UWEH 4KPHH 5KANI 4M3JA 3SDDB 4NC1C 5DMIL 1KTKE 4TSBL 4XTRC 3G6AA 5DVOA 4PJAE 1F6AA 2C26A 3MA7B 2A73A 1OSPH 2X1OA 1NAMA 5CZXC 4Q9CA 5I18L 3VFGL 4GKOA 5FXCH 3BP4A 3OBAA 4FZ8L 3R1GH 4HT1H 3TLRA 5ADOH 3MRHA 3HAEH 4K94L 1RZFL 3TBTB 1P7QD 3DROA 1K8DA 3KPLA 4S0SD 3C8HA 4QRUB 1Y6KR 1BGXH 2V5SA 2QSTA 3SQOL 1I9RH 5T3ZL 2BP3A 1WFNA 1F45A 4ZS7L 2UUDK 3OTTA 4L8CB 3WBDA 1HDMA 4QRPD 1FORH 4BZ2L 2H2SD 4TSBH 2XQBL 5EBLB 2CH8A 1LEIB 1IVLA 2ICWA 3G5ZA 3AREA 4NT6B 5C0AD 2CK0L 4HIIA 4CMHC 4OZIE 1PKQB 2I5YL 5F1KC 5DEGA 3SDCC 4HX1B 4F9LC 3QZWA 3AY4C 5GS0C 2FATH 4BKLA 5BCAA 4K2UL 1YEFL 4U6TA 1RFDL 2HP4A 1LEGA 3TH3T 2LVEA 1RZ8B 4PRPB 3REWB 1T5XA 3ULUH 4LHQB 5JNYB 3D18A 1ONQA 2NYYD 3DUHA 3W0WD 4QGYA 4ZODA 3HZYA 1J88A 3U48A 1YECH 4KVNH 3QCVH 4P99A 4Z8FL 4KZEH 5IMMA 1NGPH 1BX2B 3DBXA 4NQDD 3PWPA 1F3RB 3GMMB 4NKOA 2VUOA 3RGVC 2NY5C 4CW1A 1QRND 5J7CC 1MJ7H 3QUKB 4X7SH 3AM8A 1D7FA 3ARBC 2JJUA 2UWEE 1IGFL 3MRFA 1AXTH 1FV1B 4Q0XL 4BSVB 3QXAB 3EYSH 2AJSL 1JFQL 4FQQB 1T0PB 2F54B 1UWEL 2XG4A 3VI4F 1RHHB 1CGTA 1KIUA 2EDLA 5IF0B 5C09E 4PGEB 3S88L 1GOGA 4MA7H 1U3JA 1T1XA 3TYFA 4GAFB 2YC1A 4CBPA 4QYOA 1FL5B 1FH5L 1WBYA 3SOBL 2PXYC 1WT5C 2C3VB 4ZUSB 4OT1H 1JRHL 2RQ8A 2Y06L 1QSEE 2WUBL 5T1LA 2DAVA 4Z0BL 3H2WA 4I0CC 1J8HD 3QHZH 1I3GL 1IAMA 3GNML 1A3RH 4JANB 2AJZA 4JN1L 4Y16C 3TPUB 5IR1A 4QWWD 1FSKB 4M62L 4RA3A 2NPLX 3TA3D 3SHSA 4ZAKC 5KBNC 3OGCB 1TJHL 1AI1L 2EECA 2W0FB 1PEZA 1J12A 3BKCH 3OZ9H 4KKCD 4M5YL 3O11B 3B43A 4FQIH 3T4AA 1A1OA 4TQEH 4F7EB 5B22A 5KSUA 4JFOA 1XAUA 3HG1A 5EOQL 4LSSL 1KCRH 2CKBH 4WNQB 4GSDL 4AIZB 3V0WH 2FJFB 5EUOE 1HWGB 3DYPA 3QUMH 3MRDB 2VNCA 4LBEB 4HIJB 3V6OE 3FFCE 3F7QA 2I5YH 3VD7A 4OLEA 3ZDXF 3RY6A 5I1CL 2CJUL 3NZ8B 1A5FL 2VXUH 4PJAA 4XZUA 5E99L 5C0NC 4N0FA 1QYGL 2D7NA 3IKKA 3B8SA 4G3YH 3ULVL 2FR4A 2VYRE 5C07A 4YHYC 3U4EB 3W5MA 4K7FA 3BWUC 4GRWH 2DD8H 2QADD 1WICA 3FRUB 5DWUH 4OLYL 1UB5A 1OSZB 1G6RA 5EO9A 5IFJA 1EHAA 2E7LC 3Q2CA 3FB6A 3BEVA 4TYUA 3T65B 2XTJC 4NT6A 2PW1A 4OZGE 1MHPL 3O6FC 3OR7A 4UMGA 4KHTL 4JRXA 3B9KC 1P4LB 2PCPB 1JV5A 4H0HB 1T21A 5BZDA 4WI8A 4WI9A 3MRQA 5CEYA 1CG9A 1CLZH 3K1DA 3L5HA 4J3XA 4I9WE 1K2DB 3CH1B 1MY7A 4PJBA 1J0JA 4JZNA 5E8OA 5F6IB 4GAGH 4E41B 5HGGS 4YQXL 2PO6B 2BNRA 1ZHLA 4XAWL 4L3EE 4OT1L 2LVCA 3LEVH 1A6VH 1AE6H 1WC7A 3QWOB 4H1LH 1SHMA 4WWKC 2DJUA 4PJ7A 3WS6A 4Z7QE 3PWLB 4TSAH 2IAMA 1PGRB 1OY3B 2WWMD 4L8SC 3THMH 4U6VH 4ZS6D 1J8KA 3U0WH 1Q72L 4OD3H 5IK3A 5FKAA 5FECA 5DFVC 2P48B 1XF5A 5D1ZA 3MLVH 3QUYD 1NCTA 4TQEL 4MB3A 1KGCE 2ID5A 3VXQA 5JOFA 2X5PA 4CVZB 1JPGB 2FX8L 4F57L 2FD6L 3UPRB 4PJIF 1KJ2L 4PJFA 2UZIL 2ED8A 1JNLL 1PG7X 3SKNB 5ADPH 4NO3A 5EBMB 2X7LB 4HG4K 2FLBT 3EYVA 3AVEA 1A7QL 2RBLA 2XN9B 4XNYL 2EE6A 5GS1A 4CADA 3DETC 1H3PL 4PRNB 5DJ8A 2MFNA 4TNWF 4JHAH 2HJLA 3W82A 4L8DB 4HS8H 1UM6H 3A6CL 3TYGL 4XXCA 3DO7B 2VC2L 5MI0C 1HOCB 3MCLL 3EOAA 4TNVF 4TSCH 4G8IB 2RR3A 1XR8B 4HZLB 1YDPB 4LMQE 3KYOB 3PWNB 4AZ8A 15C8H 2VXTH 3VXPA 4LSQL 4R4FL 7FABL 3HR5B 1NFDF 3MJ7B 3JWOH 3Q1SH 1FN4B 1SJXA 4M7ZB 3HZMA 4XNZB 3VFMB 4GG8A 4PGZA 1OAUH 5FGCE 5DF0A 1KIPB 3SKJH 1K8DB 2BNRE 3KPLB 4K3JL 4CJ1A 1LE5B 1DBJL 1SEQL 1YJDL 4W81A 1UACL 4LAQH 5IW6A 4LPTA 4ODVL 5FM4A 1IC7H 4RMRA 3E6HA 3UZVB 3IDGB 2WIIB 1KCVL 5I16A 1CDUA 1LDSA 2YMXL 5E8DL 2HT3D 2CR3A 2VXQH 1VFMA 2NZ9D 2HJFB 1S9YA 3ZKXC 1MRDH 4OCMC 3FO2A 5GS1C 1HH9A 4Z7UE 5D5MB 1AD9A 3GSVB 4UV7L 1L7TL 3PGDA 3S96A 4U0RB 2VL4A 1NBQA 3B9DA 5BV7C 3OGOE 4TVPD 3CFDA 1DQJB 3TPUA 4QRRD 4UT7L 1FNGB 3VMNA 3X12B 3BHBA 3L95A 4M7LH 5C0CA 4DWHA 1HE7A 3TN0A 1M71A 4XRCB 4MNGE 4Q6IC 4UIMA 2UZIH 3HG1D 3VDAA 5CJXA 3GK8L 5CSZA 2AJUH 1I1RA 5C0AA 1X5HA 3FCTB 5KSAC 3OKLB 1CF8L 1INDH 1EEYB 4EJ1C 4OCWL 2UWEF 1QSZA 3MRNB 1CLYL 4PJBE 4N9GA 1MAKA 5HI3D 5F3HB 3U7AA 3MBED 4JFEA 4Y4HD 2ADIB 5F9JB 1YUHA 2LFGA 4PRAB 3TBYA 4CU7A 3FFDB 4LSPL 5IKCB 2E27H 3H0TB 3AS1A 2BNUB 4XNZC 2LABA 1MIMH 1WF5A 3MMEB 3HAEA 1N26A 5FYKL 1AXIB 1S9YB 2VUYA 5D72L 3KPQA 3QDAA 3LV3A 2DLHA 3B6SA 4PJHB 1FNEB 3PL6D 4PB0L 1VFBA 1Q38A 1LQSR 2QL1A 4LIQL 1TCRB 3HI6H 4RFEB 1QR1B 3QNXB 4JREC 3BZEA 1T0NB 2G2RB 3BESR 3DMMA 1H5BC 1C5DA 3WJJA 3LEXB 3SKOA 4N8CH 4YX2H 1NFDA 1EUUA 4HK3N 1S7WB 5MENA 4HQQL 1HQRA 2FJHA 5J6HB 2NY4C 3U46B 3LRSB 2O5YL 4NFDA 2QHLA 4PR5B 5JOPE 3QJHA 4Z7UA 3VFPB 3V0WL 4KK8D 2DQHL 3MO1B 5GIRA 1I9JH 1G9ML 3TN0D 1RJLB 2JB6B 3DX9A 3H42L 1P7KB 3ALXA 3HR5A 2ZUQC 1P2CA 3RWIB 3QIWA 4DN4H 4LCWE 4DCQA 4NC1E 3OXSB 3RUGF 2UWEB 3DGGB 3VJ6A 5I1HL 2FBJH 4U1SA 2D7MA 2VQ1A 3MRNA 4NZUH 2JCCA 4PTTA 3ALPA 4WW2F 4KY1L 4TVPL 4GQPH 5BRZA 5H35B 2HFEB 5EU6B 4C83B 1XMWA 1A7OL 1EAJA 2Z4QB 4ELME 3CFKB 2FWOA 1TNNA 4LLMB 1V3KA 5KN5A 1IEBA 7CGTA 4YDLC 1YYML 1Q9WA 3CFEB 1K4CA 3IKCB 3AY4A 4JFEE 4QGTA 5C09D 3EO0A 1B4JL 5E94B 3INUL 3MRMB 4L4TB 4PY8J 1P53A 4UNTA 5JOFB 4DGYH 5CWSA 1JI2A 4QRQB 4WO4C 5TDPB 4P59H 4GRMB 4X7TA 4GG6A 1KELH 3L3DA 4PV8A 1WEJL 4ACPA 3ULUE 3WFBH 3MRIA 4UTBH 1OLZA 2CUMA 5DJ2A 4DVRH 4JN1H 1P5VA 2OR9H 3EDEA 4K71B 3GSOB 5E2VH 4HF5L 1A14H 4X9FA 4M1DL 5EN2A 3TIDB 3SJVA 5IGXH 5HGAB 4OF6A 5D96B 4HGWA 4XC1H 4EI5D 4HUVA 5DMKB 4U1SB 3MYZA 4YHLL 5D7LD 4G6AC 4KKLD 4JKPL 3KHOA 2VDKH 1P7KA 4LASL 2NNAB 3IFNH 2IH3B 5SV4A 3ZKQD 3RIAF 4RIRA 5IEHA 4UU9B 5C0CE 4PP1D 5CIPH 4E5XB 2Z8WC 5A16B 5TGBA 1VEPA 3F7VB 4LPWA 2ZPKL 4L8CA 1YEDB 3SGKA 3F7PC 4JN2B 1RULL 3WHXB 4NQEA 1L0XA 4OCWH 2Y25A 4XT1C 5ERWA 3BGMB 1QFOA 1F02I 1CLCA 4K3HA 3RFZC 4OZ4B 4PRNA 2R15A 4PJXA 1SBSL 2BVQB 5EA0H 4KRPD 1G9MC 4JRYB 4LQFH 1JZ3A 4YE4H 3VDBA 1CVRA 2UVFA 3CMOL 3S3SA 4XNMB 3CDGB 3UTSA 4P5KA 1IILE 4XB8A 1FC2D 3HI5L 4IOIB 1RUKL 3N85H 3QZWG 5D1XA 3DURB 1HSAB 3L3HA 4WO4B 1WCBB 1XIWC 3VRJB 3JV6B 1J1OH 2A83B 1WIUA 5C0BD 2EE2A 3GMMA 3REVA 4GG6E 4WV1C 5E2TL 4IIQA 5D7LA 1VGKA 5JW4M 2R0WL 1QRKA 3C6SA 4UIMB 3SGJC 4YXHH 3O6KH 4XVUC 5GSRA 5AZ2L 2X05A 3N1GC 4JO4H 4G80B 2W60A 2Q87A 3H9ZA 3V6FB 1AJ7H 1VENA 4O02H 3NCMA 3WJLC 1EAPB 1MWAL 5EUKA 4X80L 1Q1JL 4APQD 4ENED 3WV0A 5T3XH 3ARRA 4PREB 2F8XC 4CMMB 4ALAH 4ZXBC 2FX9L 3Q5TA 4Y16A 5E8EB 3WXVH 2R8SH 1S78C 1XIWA 2ZKHH 1Z9SA 4JM2F 5DSCA 5DJCA 1F8TL 5CKAA 5DWUL 1J8HB 1IC5L 1NCNA 2H32A 4W70A 1NQBA 5C0FA 2BFVL 1JPST 1MCRA 4FS0A 4JM4H 4QHNB 3S34H 1BFVL 1BZ7A 5JLZA 4Y5XB 1DE4A 1XGQA 4OCYL 2W9EL 4DOHE 3QI9D 4OBSA 2R0LL 3RTQC 1OPGH 3V8CA 1KPVB 1PLGL 3LPWA 1RZJH 3TH2T 1BQHB 1X4XA 3D3VA 4HULB 1ORQB 3EAKA 1N3NB 2XZQH 4G9FD 4UT7H 2VXVL 1W2KT 2YPVH 4LU5H 4QHLA 1XCTB 1H3VA 3QXVA 3KLHD 1NC2A 2XZQL 1RZ7H 4MDJA 2DTML 5CEZD 3IJYB 2IMMA 1Q0XH 5DHYA 5DVKA 5FGCB 3FCTA 4KUZL 4M1CD 5J9PB 2D2OA 1J10A 3SDCB 1I8IA 1LEKB 4HBQA 4PJ7F 1E6JL 5M95B 4QOKB 4EDXB 1EDQA 3O2WH 5ABDE 4F7TA 4IJ3C 4DVRL 2YWZA 5FOJA 2GAZB 3C5JA 5HHMB 3U79A 2CMRH 4OCXH 4PJBF 5ALBH 3MXVH 1B0RB 1EFXA 3DRQB 1QFWI 5E8EA 3QFJD 4Z7VB 1T5WB 1Z5LB 3GRWH 4Y88A 1RU9L 5EWIL 1MCSA 3O6LH 2D9QB 2PUQT 1CGSL 2A9NL 2FEDD 1EXUA 4EN3C 2CD0A 5F44A 2X44D 3DMMB 3LPFA 5SWZA 4JFFB 5EZJA 3WD5H 4S1DC 1CLOL 2FLRT 5TH2B 4NKMA 3ULUF 1CZ8L 2JIXA 3AB0C 5E8NB 1EEQA 4FNLH 2AJXL 4CVXB 1FP5A 1IM9B 3MV8D 2VSDA 4C57C 4GBXB 3GBMH 4PJIB 1DUYA 3VGAB 3BPCA 1BLNA 4XBEH 2QJDA 1P9MA 4HS3B 3O2DL 1A22B 2IAMB 1R3LA 4KMQA 4LQFL 3PIQA 3SJVD 4EUPG 3L9RA 2JCCB 3T0WA 4XCYB 4BQBA 4XCEA 1XGPB 4AJ0A 2P7TB 1W0VA 3PL6C 4OM1H 5CSGA 1LVEA 3MGTB 1KBGL 2HLAA 1HOCA 4OM0H 2DQIH 4TUOA 3U9PH 4JAMB 5BXFA 1CE1L 3HUJB 1TTFA 3WN5A 5C6WH 1HXYA 4LSDA 2Q86A 4DVBB 3NZHH 3BVNA 3P0YL 5A2JH 3P4OB 3FN3A 4GUPA 1CS6A 2CUHA 1T3FA 2ZJSH 1T7YA 1UQSA 2J88L 4RMSA 2NZIA 4PRIE 4G8EA 2CLRA 5J6GB 4LLVA 4ZUUB 3CFBA 3SQOH 4OZFH 1AKJA 3LOWA 4GKNA 2EH7H 1KXVC 2I60L 4JQIH 3RIFF 4S1RL 3QDME 1WWBX 1QLFB 3RL1B 3BMVA 3S37L 2BVPA 3VFRA 2QADC 1OTUD 1IM9A 4UT6L 1M7IA 3Q6GL 1KEMH 2ZOLB 2LTQB 1OAZL 3FOLB 4GMSH 5B38B 4IRSB 2B4CH 4O2CB 5T5FL 4WTZA 2RJMA 5D7IE 5DUPL 5JMOC 2XFXA 2JIXB 2GAZA 4ZFFA 1CXIA 4KROB 5BQ7B 3SDDD 2E9BA 3MRHB 5I8KL 1TZGH 3IJHB 1D3CA 2X4PB 4LHUD 1D5ZB 2OMNA 4IDLA 4V1DB 1E0OB 5C0AB 1JE6A 3CVHL 4RMTA 1S7TA 3FAWA 4YDIL 2HKHL 1C5BH 1ERNA 5EOTB 3TO4A 5K9QG 5DXWA 1B4JH 2AXGB 2R56L 1UT9A 2VE6A 3MA9L 4MMXC 1NFIB 1C8PA 1FLTX 1FGNH 1AQDA 4K3EL 5FEBA 3PWPE 1WZ1L 3QRGL 3KS0H 3O4OC 5JUEL 4YGVB 4MAYD 5HHPB 3GRWA 5KVDH 3BVNB 2NY7H 4WJ5B 4AMKL 1JZ4A 4BQCA 3WS3B 3NPZB 1PDKA 2DDQL 5FUZH 1G0DA 4KK6D 1BAFL 1V7MH 3MLTB 4OGXL 3VXNA 5L2JA 1ZHBA 4G9DA 1IBGH 4AYFA 2DI8A 2GW5A 2GY7B 1OGAB 3P11L 1U8LB 1AR1D 2F53A 4I5BA 3OKNA 2IANE 3DHMA 3JTTB 1WBXB 1JBJA 1HCFX 3PHOB 4FFVD 3UTZA 3OAZK 2D0FA 2YPKB 3VWJB 4XPAH 1AI1H 4X6CB 1TTUA 2CIKA 5DK3A 1FCGA 3MV9B 3MRCA 3N1FC 4MCYA 5IESH 4HIEA 1NC2D 4JG1H 4D3CL 5CAYB 1M7IB 1JTOA 4W6YB 3FQUB 3VW3H 2VB5A 3QFDB 5ISZB 3C08H 2MKWA 4NZTH 4FQ1L 3R06A 2PW2B 2GK0B 4P49A 3PQYD 3KNBB 3V4UL 2P24B 3SE9H 1JGDB 3C09B 4OCLC 1DBAL 2CLRB 2XTLA 4PP1C 4KZDH 4F7TB 1XZ0B 3H9SA 3L5IA 4I4WB 1E4WH 4NN7C 4X99B 1UCBL 1F3DH 5F96H 4LCYB 5HI3C 5ACMA 1FVCB 4NJAL 2NXYC 5C0GB 3H7BB 3DRQA 1QQDA 1I4FA 5ICXB 2Y7QA 5CJBA 3T04D 5F6HI 3MLRH 3KPOA 3TYFB 3DJ9A 3L5JA 4BSWA 3T65A 5C2BL 1JPGA 1LO5A 4XVSH 1E4KC 4LGPB 3MRFB 5D6DC 3IDNA 1INQB 3ULUL 3S37X 1Q94B 3BAEL 4MD0A 3EFDH 1U8HB 1BEYL 1G7MA 4L4TA 3UZQA 4F15C 3IU4H 2ERJC 3MBEA 4JFED 4Y4HA 5GS1B 3SKMB 1NKOA 4GT7A 3L3JA 3GMLB 3JTTA 1BQLL 3DVNB 4HWUA 2I27N 3MZGB 5DD3L 2FGWL 4ODTH 4I48A 3RDTC 1KYOK 1ZK9A 3QHTC 4NM4L 1IC1A 3LQMA 2CIIB 3X11B 5AWNH 1NSNL 2JJTC 3N0PB 3QPQD 4I3RL 2BCKB 1BBDH 1I1YB 1VEOA 5FECB 1I1AA 1HEZB 4KMTL 2Y5EA 5TGBB 1MELA 2XT1B 4LRIC 4Z7QF 4S10A 3A0OA 2NY3D 1J0ZA 3C6LA 4AL8H 4K3JH 3DI3B 2J8UF 3S36H 1EZVX 5F7NC 3L6FA 4HPYL 5JHDE 3MUJA 3KPTA 4PJ5B 4ZNCD 4B7IA 1PEWA 5HHVL 4P57B 3FHAA 1NANH 1QUNA 5LWYH 3OB0H 3MLZL 4PJBB 2J3SA 3S3PA 5DJDA 3C5SA 1X7QB 3RL2B 4L1HA 3HE7C 1CICA 1RD6A 5J13C 3P77A 3SDAC 1IGCL 3BKYL 3MTRA 3SDDC 5DD5L 2OK0H 1E6JH 4OGYL 2OTWB 4X0KA 3JWNC 2GTWB 5KJRL 2NY1C 4UBDD 3QEGH 3SBWA 2W9LA 3HE7D 4Y19B 1T2QH 3RKPA 1XF3B 3TVMD 3IT8D 5CEXB 1K4DB 3FONB 3DARA 3DUSA 4MS8C 5F9WB 1ROWA 3CK0H 2QV2A 4QCIB 3QUYC 4HMEA 3OG4B 3TZVC 1JWSA 4KRMB 1IJ9A 3LKNB 4WENB 4K9EL 3Q6FA 2PXYA 5FYJU 1RJZB 2Y7QB 3O2DA 1UA6H 4PGDA 3BP7B 1KTLA 2NNAA 3CU7A 3ZDYF 3KPOB 5T1KB 1CK0H 3MGAA 5CGYC 4P2RE 1ULVA 1JCKA 1CDGA 3LSOB 4GRWF 3IDMB 2EC8A 3F5WA 4NQCD 4QEGA 3DECA 1QG3A 2FO4B 3AM8C 1U58B 2D9CA 4PRDA 4LCWB 3FRPG 4ZOBA 1JHTA 3CLEL 5D2NE 4LSVL 1UM5H 1ADQL 2IH1B 2Q3ZA 1WIPA 2ZNWA 3I2CL 1NCUA 1P4LA 4UT9L 3PWUB 4IJ3B 2XRAL 4ZPVB 4QXTA 4LSRL 3W0WA 4Z7WA 4QTHB 2QR0B 3VRJA 2XPGA 1RZGA 1JTTA 4N0CD 5F7YC 4P4KC 4G7YL 1KC5H 3R0NA 5ID1A 5JDJA 1T0NA 4P5KB 3BD5A 3H3PL 3RAJH 5IMLB 3GJFB 3STLB 1LGVA 3UAJC 1N0XL 4PJGE 1OTSD 3LEXA 5E08L 3MJGX 3NCBB 3H8NA 4H20H 1G1YA 4RGNB 3PABB 1B9ZA 3HI5H 5DRZB 3BE1L 1R5VA 2ZUSA 3HZYB 4ODHH 3GBLA 5IW3A 3LCYA 3I6KA 2GJ6E 1EVUA 3NN8B 2FX7H 4A6YH 3BEWB 4PRPA 1IGTA 4G6KH 4XPHL 1W72L 1AP2B 3TBYB 4IRSC 5C8JB 3VG9B 5HYQB 5CEZE 4W68A 1QFUL 2IEPA 5INDB 5SWSD 5L0QB 5ESAB 3MNVB 4DW2H 2H26B 1NGYA 4PTUB 5JLZB 4Q6IA 5DJ0A 3BDXA 1KLGB 2HYMA 3TNMB 5MEND 4WW1B 3CFKA 3F6IA 1MNUH 1KNOA 3L5XH 5DI8B 4DZBB 3QFJB 4JHZA 3X3GL 1IC4H 3RGVB 1BM3H 4FQXD 4FQPA 4M5ZH 4NRZA 4LEXH 3RY4A 3RNKA 1WK0A 2QHRH 1N6UA 4M7KH 4NQCE 4YHPA 25C8H 2A9ML 1T66D 2MNUA 1NBZB 5LXGH 3UBXI 1KCKA 2J2ZA 4F33A 4TTDC 1TQBC 4FG6D 1MLBB 1ZLVK 2EDQA 5BRZE 5FYKU 3P4MA 2NCMA 3GHBH 3U30C 2ZUWA 2DQDH 3STBA 3W11D 1T83A 4Y2DC 3L3DB 3FO2B 3MACH 1LK3L 5LQBL 4YHIB 1J7VR 3SDYL 2ADFH 2P43B 1MAJA 2WINA 4KI5E 1OGTA 1T2JA 3KAAA 2JIXD 4QT5A 4PJ9C 1GGCH 4X7FC 4KPHL 1CL7L 3OPZL 4XWOD 3UYPA 3GI9L 4LLDA 4JFDD 1QBMH 4KUCF 4QXGH 4GG6F 2IF7A 1GPOH 1BPVA 2H1PH 1QRNE 1I8LA 4POUB 4M8VA 1MQKH 3ORJA 2NLJB 5A3IC 1IGMH 1MCPL 3SE3C 2V2TB 2F58L 1CFQB 3VD9A 4MX7A 3NFPA 2VLKB 4I77H 3NVQA 4P9HC 4KWUA 5FV1L 5AUMB 1T20A 1QP1A 3BPOC 2QR0A 5HHOA 5GRUH 12E8L 3FFCA 3S5LA 1YMME 3UPCA 2HJKB 1TITA 1WTGT 3O3DA 4BFBD 4K55A 4Y4FB 4NQSA 2DI9A 3VXMA 2LU4A 4QO1A 3VI3E 4LKCA 4RZCA 3EJZD 2LU7A 5DR5H 3K80A 4ZFZA 3RP1A 3QCUL 4ISVA 1EGJA 3CVIH 4OLUH 1UXWB 3QISA 1TLKA 4OIAA 1G7IB 2QQLL 1LD9A 4FQHB 4WVRA 1S7WA 2HKFH 3BEWA 4HBCH 3U7WL 1UM4L 1CD1A 1R3HA 1UEMA 4KU1A 4NKQB 4ZDHA 1IT9L 4Z5RB 1EGJL 3KYKH 2IBZX 4XI5D 2ARWA 5CHNA 3S36X 3PL6A 3QDGD 4IBLT 2GHWB 2IPKB 5FGBC 4E41A 4BSJA 3AS3A 4EOWL 3IS1X 2X42A 2ERJB 2AK4A 5IK3B 2DLFH 1PBYA 1FJ1A 3F12B 4KKAD 1BP3B 3IGAA 2RGSA 4L5FH 4PIRF 1CN4A 1JGEB 4JZOB 3AB0B 2VN4A 1MH5B 4YH6A 3MYJB 3VFUA 5DUMH 5HYFA 1IAIL 5HHQA 5EUOA 5FYLD 3T0EA 3QIBD 1KACB 1NUNB 1RK0B 4L4VA 1HHGA 2ZNXA 4BZ1L 5I1KH 2EXYD 1IEBB 4JQVC 3EDJA 4S1SH 4NO5A 3IDUA 2DQGH 3SDXB 2RCSL 1LO3L 2EZ0C 3C09C 4BFIB 4IRSA 3GGWB 3V4VH 4LKXB 4UBDC 1R3JA 3TIDA 5D7LE 15C8L 5CJQH 5D6CB 5DJ8B 5HHMD 3ROOB 1F4YH 1HQ4B 5CD3A 2ITCA 4HXBH 2EDKA 2ATKA 1JGVH 1N0LA 1PYWA 3GSWA 1N5AA 3AU1A 4PJFB 1JWMB 5DHVB 5B3JF 4ZXBD 1B0GA 1NAMH 3KPSE 2MQ3A 2BNQD 1A6UL 4G8IA 1GJIA 2DF3A 2ATPB 3G04B 4JGUA 4P48A 4U3CA 4HUUA 4Y4KC 2IBGA 4EDWL 4BUGA 1UWGL 1TPXC 2APXA 2D03L 1CWVA 3NTCH 4D0BA 4G5ZH 1RURL 3SN6N 2ENYA 4P4KA 1L7IL 3OKOA 5DQ9A 4JFOB 4NCC2 4RA0C 4CN6A 4X83A 3PQYB 4NO2A 5GZNC 4JFXA 2VDPH 5MI0B 4F7MB 1EK3A 3GSUA 5C0IB 1RULH 2ICWI 4LLMA 2IALB 1OQOA 5IIEA 1T1YA 4JY6A 4G6KL 5IVXE 2BSRA 1G6RH 1AGFA 2MPAH 4WUKL 4O00A 5CINH 3T0EB 4U3XA 5CGMA 3P9LA 2EE9A 1AGCA 2DI7A 4M03A 4MQ7A 1YPZF 3ZZ1A 1T4KB 3VXTA 2DMKA 1TETH 1F58H 1T1ZB 3S35H 1MUJA 1FO0H 2V5TA 1CXKA 4QTHA 3E6FA 2BOCB 3UEZA 4FQXA 1MPAH 1MCIA 1JPTH 5C92A 3TEUA 4FABL 4F7CB 2NW2B 4LCIL 35C8H 4ZFZB 4MDIB 5CP7A 5HHOE 2FJGA 1YDPA 1YQ2A 1Y0LB 1HZHL 5HJ3B 4ODUB 2BOBA 5D96C 1KENL 3OGCA 1U8PA 3TJHC 3BZDA 2E5EA 1JZ6A 3FO9B 4PLJD 4F33B 1N7ML 3S97C 3CDGA 2WUCL 3O8XC 3MROA 1OAXH 1T0MA 2A0LC 5GISH 4Z7VF 1LO2L 5I8OH 4R90H 3QIBB 5HVGB 3MRQB 4YBLC 5CEYB 2DQGL 3GSQB 4KQ4H 3RWEA 4M6NH 3C60D 5FYLE 5EIIB 5AG9A 1JL8A 2VDMH 4QRTB 3MV8E 2PTTB 1FQ9C 3CFDB 1S7SB 2PW2A 4OQ1A 4NO2B 4DZ8B 4P2CG 2YK1L 2IPUK 5FO8A 1PD6A 2QKIA 3VH8A 4EI5C 1XGPA 3P11H 1EHLL 1Q9LB 4JN2A 5SWZD 1HHKA 1J05B 3DYMA 4KUCD 2E6PA 4KQ3H 4M7LT 3SCMA 4E5XA 1D6VH 1OGAD 3OX8A 3TT1H 3HB3D 4LLQA 1A8JH 2AI0L 2HT2D 5E70A 4G6JL 1J11A 2A6KA 3G08A 4QRSA 5D1XD 1PYWB 3GSWB 2OM5A 3HR6A 3QUML 4QRPA 4JPKH 1BBJB 5DQJB 1T2QL 4F9LA 5KOMC 3FO1B 3Q5OA 1T5XB 2BY2A 4GXUN 4YZFF 3HMWL 4C56E 1G9MH 2EDDA 1JPSH 3ULSB 1ED3A 3IDNB 1YY9C 4TPRL 1QVOB 1M7XA 4GS7C 3VD5A 2ZUQB 5E7BA 3TN0C 3ZE2F 1QLEH 1EMTL 3ZT7A 1XR9A 4CU6A 3BIAX 3WFZA 4U6YB 1ACYH 1K5NA 4UQ3B 2AJ3B 3U7YH 4WEBH 5IT2H 4N5EC 4X7CC 3FOLA 5EZOL 2J5LB 4MXVF 3VWJC 2B4CC 3DURA 4XPGH 5F97E 4PJCF 3ARBA 4GMSL 1JRHI 5D7IA 4JREB 3KPSA 3OKDB 2Q8AH 4DKFH 4Z77B 1GGTA 3QWRD 3ZHLA 4M00A 1GOFA 3VWKA 5KVGH 4D2NA 2C3VA 5AYUH 1CDIA 5D70L 1DSFL 5T1KA 4ORZC 3G9AB 3SE4C 4Q0XH 5I15L 2FWOB 2Z31D 3BP6A 4LLQB 1DFBH 3H3BC 4PJHE 1VB9A 4MS8D 3LKNA 2Y5TA 2PR4L 4BSVA 4JPWH 1GL4B 1P7HL 1AHWC 3TVMC 3PNWB 2P5WD 4FTVE 5IHZB 4PRHE 3FTGB 5I9QB 1DQQB 3BD4A 2C4XA 3VCLB 4NKIL 5ITBL 4RDQF 4M9OA 1D5IH 5KSAD 3JWOC 1R24A 4RISL 1Y0LA 1DE4B 4PRIA 3CFEA 5BVPH 1CICC 3FQXA 1MHEA 1QA9B 4AEFA 4KY1H 1RFDH 43CAA 5E6IC 3LHPL 1IL1A 4O2FB 2HLFD 3KWWA 4P46D 4NBXB 1H3UA 2HTLD 2ICEA 1JPFA 3F58H 3SCMC 5A2LH 4Y5YA 1L9NA 1DN0A 3KJ6H 2HFGL 1ZT7B 5EN2B 1X5KA 1FBIL 4RRPA 1YN6B 1NL0L 4OJFH 3WIIH 4U1MB 4WHCA 4IRJD 5D8JL 5ACZA 2HVJA 5DEFB 2AGJL 1T7XA 1IQDB 3BGAA 2P45B 1HXMB 1PZUB 4XCYA 3WUWB 4KJWD 4N8CL 3IF1B 1N4XH 2A6KB 3G08B 2ORBL 1BECA 1DVFC 2GK0A 5J11C 3VXSE 2AKRB 4JY5L 4NHUA 1MFAH 3GIVA 1FZOB 3MA9H 5FDYA 5CWSB 4HUWB 1IGYB 3SOBH 3MBXH 4KDTA 3SO3C 5L7XL 2ZUXA 2ENSA 3DGCR 4UB0L 1YNLH 1PKQE 4Y1AE 2R0ZL 4OQTL 2EIZA 5LGJA 3DSFH 4XB7A 4FP8H 3NCCB 5TQ2H 3ZTNL 5IMOB 3SGDH 1FZKB 1D5XA 5J6GA 2X09A 2ZCLH 5GZOD 1U8LA 1Y6NR 3NZ8A 4I5BB 5IQ7H 4L3AA 1FNEA 5TQ2L 3ZTNH 1FO0B 5HVFB 4NCC1 3VMPA 5I1EH 5GHWH 4Z7WF 4F58L 4HZAA 3VFSB 4HK0A 4WTWA 4JKKA 5B38G 2HWZL 5K9KA 1A3LL 2A2QT 4NFBA 3IETB 4BK5A 3A6OA 2AS5M 4ZSOE 3P9MA 4Z7OF 3V5DA 3LH2H 1MAMH 1HHIA 1INQA 4G5ZL 4OFVA 1MFDL 2QHRL 4FMKA 4MJIE 4ELKA 4M43H 4QNPE 3H9SD 1W0VB 4LLUB 5TF1L 3I6LE 2SEBB 4NWUH 2FEDC 1N64L 2G5BB 3F7YB 3T4AB 3GUTA 5KW9H 5HYQA 1KJ2B 2YUWA 4PJCE 4GKSA 5IHUH 5GRZA 3M17B 3UJJH 4MSWB 1A2YA 3PHQB 1EEZB 4MYWB 5DK2B 3S6CA 4PJFF 1NC4D 4FXGA 1S7TB 3FQTA 3GM8A 4P23A 1DUZB 3VE0B 2AERT 2Y4SA 5FDWB 2QLVB 4LVNC 3ZDZF 4F58H 3X17A 5BV7B 4NO3B 5EBMA 4KGLA 3ZE2E 5K59E 1A1NA 1BFVH 3TPKA 4LPYA 4M1GL 1S7RA 3SDAB 3BP5B 1HHJA 2F5AH 4Y19E 1G7JB 4X6DB 3I85A 2CLZB 2VLRA 3T2PA 5HI5C 3GSNB 5FA3B 5F7EL 3WDIA 3KLSA 2FEEL 1FZJA 2QTEA 1SEQH 1BQUA 1YJDH 3EYFB 4K94H 3WFHA 3UTTA 2F74B 4KKBC 4PLOB 5AAMA 4XC3H 2XG5A 3SO3B 2BDNL 1AO7D 5GPRA 1OAQH 4P5TD 1NEZG 4NNYB 1I8MB 2OL3B 5F70A 4FQCL 4PRHA 4KXZI 4WI3A 1WBXA 3VFNA 4UIKL 4XNUH 3C6LC 1OWWA 3IJSB 5AYQA 3WNLA 3BH9A 3VXRB 2J8UB 4XMKH 1I1AD 2OCFD 4DGVL 5K9KB 5A1AA 4LSVH 1E4JA 1BD2D 4WUUA 3O6MH 1PX3A 3DX7A 2Z91A 2V7NA 4P5MB 1CVSC 3U2SA 3QEQE 3ROLB 1D5BB 4L9LC 4TVPE 2HT3C 3MJ9H 3V5KB 1FIGH 2F19L 3EHBC 1YYLL 1AY1H 1P4BL 4NN6C 1Z9MA 5ICYB 4XBGB 5EO0B 4KMTH 3S5LB 5JO5A 4CVZA 1CCZA 1UA6L 4U7SA 2HT4C 2KDGA 3QHFL 5AUMA 4OZIA 3NA9L 3RBGA 4PRBA 1FNSL 3N50A 3L3GB 2NY0D 1XF2B 1CFTA 5F7KC 1AD0B 1U8OB 4K3EH 5D2LF 3D0LB 4PG2C 3O9WA 3UTTD 1H3XA 4Q6YA 1I1AC 1RZKH 2ARJB 1W0YT 4XBEL 2FL5B 3MRGA 4RNRA 3UTZB 3BGMA 3M45A 2HRPL 2EH8L 4J1UA 5I0DA 3RVUD 4LNVA 1UJ3A 5ECJE 4YWGL 1R3HB 5DD5H 1AD9B 1BHGA 4L4VD 1X5JA 3IDJA 1OGAA 3BDYL 2VKWA 2XNAB 1NLDH 3RDTA 5E9DB 3LIZH 4MD5B 3PHQA 5DK2A 3BN9D 1BOGB 4QXTB 3VRIB 4XH2A 4MXQD 1IL1B 3ZDXE 4A6YB 2ZCLL 5GRVK 5DA0B 1HN1A 2VN7A 4PJDF 1RZJC 4NZJA 3W2DH 4KXZH 1HIMH 5DZLA 3OXRB 2ADGA 4DEPB 1O0VA 3SDAA 3JV6A 3TJEH 3TBSA 4H5SB 4NJAH 1MI5B 3V4PH 4M6NL 1HH6B 3O3UN 2CIIA 3OKKA 4JKWA 4L8BA 4LRNL 3T3PE 1KJ3L 2BY0A 3ARED 2EEDA 3NN8A 4JQIL 4P9HH 3TN0B 2EH7L 1AJ7L 2DYPB 4RAUB 4OI7A 3D85B 2GJJA 4J7RA 4OGXH 5IMKA 5BXFB 5AWNL 4KKAC 4NDMA 2IPTH 3B5TA 3FB8A 4YXKH 2G5RA 2C7UA 2IBBA 1WFUA 3U36B 3P30H 2A73B 5KVFH 1U3YA 4LCCA 2AAVA 2VXUL 4U1HB 1RIUH 3D9AH 1Q94A 2OJZH 2IPUG 3M8OH 3VWJD 4U1GC 2CJUH 5IB1B 3X3FH 1TCMA 1BQLH 1BD2E 3QUZC 3E1F1 1MIEL 2XA8H 1BLNB 2AK1H 2XPGB 1KJMA 4BH8B 5C07B 3GI8H 4DCQB 5C09A 3JSSA 4K2UH 2OTUB 1X5FA 4JFQB 3CPLA 3LVEA 1PLGH 4X9HA 5DTFB 1I1FB 4P3WA 3B9KD 4N68A 4NJ9H 2YKLH 1OP3H 2HG5B 4OCSH 1QSEA 3LRSA 4UOJA 4XXCC 3RWFB 4JFHD 1NMCC 4AT6B 2XZAH 4KI5F 2QSCL 4G6JH 4AIZA 4XNUL 4DTGL 3SKUD 4UIKH 3MRKA 1N7MH 1NEZA 5HHNB 2XQYK 5E6IA 1GGYA 1L6ZA 1KJ2A 5T1DL 2FSEB 5DJZB 4N8VB 5L7XH 3ARTA 3GNMH 4XP5L 4PUBL 1FRGL 3C5ZD 3HPJA 1QFUH 2PXYB 1I7ZB 4KTDL 5DGQA 4P9HL 1KV3A 1KXTB 2MHAB 3PUCA 1U2CA 1QNZH 5BS0B 3FONA 5SX4H 4WU5A 5DJYB 3RKDC 2R29L 5C0DB 2PTUA 3F5WB 4MA7L 1MCFA 3FB7A 1MFCH 1YEEL 1EA9C 3B8YA 5C7XH 4OAWB 1UB5B 1BX2A 3T0DA 3B5GA 5E94A 5EZOH 1T20B 4WI4A 4D0DA 4G6ML 1WSST 1IFHH 2Q76B 1DCLA 4HH9B 2H32H 3LN4A 1T7WA 1Y6MR 1D6EA 4KH2A 2R2HA 3O8XD 5F9WC 3DWTA 4XP9L 4KKCC 4LOUD 2OXHA 4Q9QH 4BKLB 3QCVL 3RVVC 1X4YA 4R96A 1CF8H 3QIUA 4Z9KB 2AEIT 4OCRH 5L8JB 4LCIH 5IVXB 4EQ2A 1JNJA 1K4DA 4LHJB 3C9NB 2EH8H 4DZ8A 4GFTB 2VAAB 2ZG3A 1AC0A 2YA2A 4YHNB 4M9PA 2FYYA 1OAYL 4OV6F 4TULH 4EI5A 3OF6A 4AMKH 1KB5A 4U1IB 4X4MA 4JR9L 1XGYL 3D85A 3TT1L 2R39A 4MJ5B 5DDHB 3BJLA 4APQC 4ENEC 4Y4KB 2MCPH 3WL9A 4D9LL 4U6YA 4LCUA 1ZMYA 4G6FB 4NOBA 4RGNE 4C4KT 3GJFA 3STLA 4JM2B 3IRZA 2DQJH 5C9JA 5HDLA 2X1QA 4OLXH 4HIJA 4ZYKA 5HGAA 3DO3A 4ZD3L 4NQUA 2X40A 1T5WA 1Z5LA 5FUOH 4YPJA 4JCMA 5D1QA 1A1MB 1NMBL 2F9BT 3LN9A 1SJEB 1IGIL 2F5BL 2GJZA 1MWAH 3MV8B 4KQ4L 5I1AA 4PGEA 4HHAA 1I9JL 4L5FL 1CT8A 1UJTA 2A83A 5F7HA 2VITB 4FXLA 3MRCB 5KANG 5I1GH 5JW4Q 2B39A 5IR1B 4YHOL 3VXOA 1N6QH 2GI7A 4YXKL 2OS7A 5K59F 3ULVF 3QIUB 4NPYB 1YMMA 4AG4L 3OJVC 2PKDA 4X6EA 2AK4E 4NHCH 2UZXB 5JIHA 3MLUH 4WU7A 4CGTA 1IZKA 5T33H 1ZGLB 2YRPA 1U8KA 4P5MA 3CSBA 3E2HC 4TSCL 4HD9A 4RQQB 2EZ0D 4GOSA 1U92B 3STZA 4PREA 1YZZA 1LO0L 3HZMB 1FE8L 4QRRA 3C5ZB 3S36L 4PRHD 1FNGA 3X12A 1JP5A 1X6NA 5C0DA 5LAXB 4KFZC 4X6BA 5E24E 2Q6WA 4EI6B 1S3KH 3O41B 4X6DE 3SDYH 4JDTH 4G80A 3QDJE 1XCQB 4HC1L 2X4SB 3MR9B 5HYSA 4K9EC 1F6LL 4TUJB 2XTJE 3BUYB 2AXGA 2VZOA 1ZGLM 3BUTA 1QLEL 1A1MA 1I3RA 3EDFA 3GKZA 2VWEC 5EO1B 4D9QE 5MERB 4WFFD 2JJVA 3IXAB 1AGEA 1ETZB 5I1HH 4QRUA 1ZA3A 2DKUA 3QJFA 1XGYH 4RFNC 3MLPA 3V5HB 1VGEL 3RVXD 3BOVA 3GGWA 4PY8I 1CIDA 3UTQB 1CFSB 1PY9A 5DD0L 5D93B 3RTQD 2QQNL 3S96B 3QUYA 5FO9A 3MODH 3IVKA 5B39A 2CPCA 5L2KE 4HXBL 5HI4C 1OVZA 3QWRA 2X4OB 4JE4B 1FGVH 4LLYB 3VWKD 4AH2A 3MBEB 1SM3L 4Y4HB 2YWYA 2OSLA 3BPNC 3O3EB 3TZVB 2FECL 2AK4B 2AW2A 1T21B 5BZDB 5IB5A 3EOBB 4YXLH 5FUCE 3L7FA 3ARFC 4BQ8A 4MCYB 1E27B 1CDCA 3MV7D 4HCRA 4XWGL 1LO0H 5ENWB 2FO1A 4O5LL 2NX5D 1A7PH 1MCOL 1OD9A 2VDLL 5JORB 3O4LE 2VE6B 4QOKA 4PJDB 4FQHA 2VO5A 2IALA 3RWJB 1UACH 4LAQL 5JOPD 1S7UB 4K7PX 3UROR 1BVZA 3CDCA 1C5CL 4TOYH 4X8JB 1EFXD 5FM5M 3BRFA 2GY5A 1FZMB 1SJHA 2WWMC 3OHXA 2PF6A 4XGZB 4YFLI 1DQML 4UUJA 5D9SB 3ULVH 2NY7L 4Q2ZB 4R2GB 3ESVF 4NFCA 4XPFL 2WSKA 4L8SB 4HH8A 4EVNA 3U7WH 3ARFD 2HTKD 2ESVD 3RVUC 1NJ9B 4WY7L 3WFEH 2CRMA 5IW1B 1H5BA 5TJWK 1XGUA 2EDFA 4Z0XB 2IGFH 4OZGB 3MLSL 2X4OA 3HHRB 3HUJE 4PJXF 5IG7A 2GFBA 1KB5H 1JJUA 5D2LA 3EO9L 3O6FD 4RFNB 4KK9D 4EN3A 4M4RA 1HSBB 1ZLWK 3SDXA 4LEXL 5CHNB 5GJTL 3VH8G 4GBXD 5E8PA 1BAFH 1V7ML 3DTXA 5IFHL 4IEFB 3W0WE 3RI5F 4Z7WE 3GSXA 3I02B 3K8MA 4NKIH 3MQIA 2M2DA 3DSFL 4ZDHB 4Z5RA 3WXVL 2R8SL 2C3WA 3RVXC 3M17A 4TULL 1N64H 4I77L 1SYVB 4PJ9A 4JY4B 4LFHD 4EDWH 3GBNL 4MAYC 3KPNB 1QSED 1F90H 3B2VL 4WDIA 2Y06H 4OD3L 5DEZA 1RUPL 4KZDL 2XQYG 4ONFH 2H6PA 2OL3H 4DUVA 3JVGA 1OAUL 1URLA 3O4LA 1FV1A 2Q8BH 2AABL 3VFTB 4BFEA 4OZHB 3GHEL 5L6YH 4OV5B 5EU5A 1Z9OA 2ZJSL 2GSGA 1N8ZA 5DD6A 1QO3B 1M05B 4HS6A 2NY5L 3GSNH 4L3CB 4NC2B 4R4FH 4JZJB 3N1PC 5JDSA 3MUZ1 1MWAB 5TDOB 2F8OA 2EYTB 1PFCA 4P2QE 2E7BA 2YSSB 3GDBA 4NO5B 3EJJX 1CGVA 3HNTL 4H26B 3MACL 5C08B 2BZDA 1PZ5B 4LNRA 4WW1A 4XPTL 1WIOA 5KVEH 3WNOA 4YK4C 4C56B 5ICZB 4RFEA 1KB5L 3QBTB 1F2XK 2WNGA 4J3SA 2XKUA 4QXUH 1CU4H 3L1OL 5EORL 4XCEB 1S9VB 1RY7B 2HRPH 1FRGH 1Q9LA 3FZUD 3MV7B 5DEGB 1FYTB 2QQKH 4K8RC 5L2KA 4JJ5B 2EDXA 3L5XL 2GTWA 5EB9A 4UAOB 1R3IL 1AIFB 3P4MB 1C5DB 4HAGA 1REIA 1FVEA 5EIIA 5E8PB 4MZ2A 2P5WA 3WHE0 4I0KA 2CQVA 1EPFA 1X5LA 3L5WB 2OJEB 4Q2ZA 1A02N 3HC3H 1HILA 3AXLA 5I15H 4OIIH 1YMHA 3ARZA 4C56D 2BNRB 2R56H 4JDZA 1AO7A 5FKPB 1IM3B 2IADB 1OP5H 1F4HA 2CK2A 3RTQB 4LASH 2FX7L 2AJYH 2DYPD 5IW1A 1FPTL 3EJYD 1RJYA 4XVJL 2DKSA 4GSDH 3BH8A 1A9BA 4Q9QL 4KI5C 3UTSE 5JIKA 1YEHH 1GSMA 1TFHA 4GRLA 5CILH 1OOAA 4PJIE 2J8OA 1WWAX 1C1EH 4M93B 2KKQA 1U6AL 5ESQA 5CJ5A 3RZCA 2V17H 5T5FH 3FB6B 2NTFA 3CLFH 4L29B 1SY6L 4X9BA 3TCLB 2I07B 4IRJA 2WK2A 5I18H 2JJSC 2GT9A 4OF5A 3W39A 4XNMA 5DT1L 4R3SB 5J12C 1UB6B 3QDGA 4L8DA 4GW4A 1YNTA 5EG6C 4LSRH 2V2WA 1HZHH 2P47B 3VFSA 1DEEA 1BBJA 2J1KA 5DQJA 1D5ZA 1I3GH 4UTAH 5I71C 1DDHA 3P73B 1JRHH 4IRZL 1P84K 2H2SC 3FN0L 5IV2A 2CUIA 3SGKC 3MRJA 3O6LL 3IDGA 1OP5K 3HE6D 5K9QI 3TBWB 1NGXB 2EDHA 1ADQA 5DMGC 1XF5B 5B8CA 3KPSB 2OZ4A 2Z35A 4XNYH 1QPXA 4WEBL 5IVZB 2UWEA 3MGOB 3DGGA 1ZTXL 5EIQA 1GC1C 1CK0L 5MEPB 5IFHH 2XV6B 1I7ZA 4CDHA 5KG9B 4OUUA 4PJEF 1F4XL 3VXSB 2IH3A 3JWDC 4P2RB 4RIRB 2DYPA 3PXJA 5DJCB 5IB4A 3JXAA 3UTQA 4AQ1B 5CS7A 3DV4A 5IUSA 1IRAY 4HKZA 4P46C 5BV7H 3MUHL 4YNYB 2BSSA 3NMEA 2MKLC 1ZLSL 4OZFB 1ED3B 4HWBL 4EUPB 3KPPA 4ZTOL 1XF1A 4WHTA 4IS6A 3MXWL 3O3BA 1PKQA 1F11A 4YHML 5K33A 2X4NA 1NCCH 4Z7VE 4NUGL 4G7YH 1D6VL 1II4E 1CIUA 4QHLB 1VACB 3LKOA 1H8OA 4RWYH 4I0PC 5IVNA 5E1AA 3VXME 5KTEH 1Q9KB 1UXSA 3ZSSA 2LAGB 1CXFA 4U2ZA 4OD1H 2B1AL 4NUJA 4JKLA 3ZTJG 4P5TB 2DQDL 3QG6B 1QACA 2WQ8A 2NY2C 1TVBB 3QYCA 3PWPB 5FYKD 4ZOEA 4Z95H 2ATPA 3G04A 2V7HB 3EYSL 4HS8L 4LSPH 3TIEB 5HYEA 2ESVB 4R97C 3ZKND 2P8PA 4PG9B 2G75A 4LLWB 2Y36H 2YUXA 1N0XH 1DANU 1IEHA 1MFBH 3MOAL 4HKJB 2B4CL 1CICB 4K23H 4X99A 1CXEA 3U4BH 1OWRM 5LCVL 2MCPL 4D9LH 5DJYA 2NYYC 3F7VA 4WFED 1TJIH 2XA3A 4MJ2A 4N1HB 4UT9H 5DRXA 3JWDL 1P4IL 2VZTA 4DOHB 1HWHB 1OHQA 4NN5C 2A74B 2F15A 4M7LL 5F7EH 4HWBH 3WFCH 5FCUL 1XT5A 1UADC 4ZTPH 1MY5A 5FOBB 3HG1E 1I85C 5JW5A 4Y16D 4YO0B 1XIWD 1NUDA 3VD3A 1B2WH 1QFWL 2QBWA 3HNVH 3I84A 4YE4L 3VG9C 4ZXBA 4LSSH 1YN6A 4M6MH 3ARDB 2A6JA 5DK0A 4WTXA 1CL7I 4Y4KA 4MQTB 4JM4L 5E5MA 3M8OL 4M1DH 1U3HD 1A1NB 4N1CA 1DQDH 1G9NL 4I3GA 5L2KD 4TUKH 4HIXH 4JLRA 5D7SL 4DUXA 1RZIB 2VLJE 3DX6B 5DJAB 3UYRH 5K93A 4PJEB 1QD0A 3LKRA 2BSED 3HE6B 2D7TH 4HUXB 3LEYL 2CLZA 1DFBL 3G6AB 2WAHA 3O9WD 5JO5B 4DKEL 1OB1A 5T1MA 5ADOL 3U0WL 1A6UH 4HT1L 4YGAB 4NGHL 3STZB 2RIKA 4NP4H 3OXSA 3MV8A 1UENA 3BPLC 3DRTA 1MLCA 3RVTD 1PG7L 3RDTD 3DIFA 2HJKA 3O3DB 3GI9H 4YPGA 1MRFL 4RAUA 3DX8A 4GBXC 1L4IA 1OAQL 1CLOH 1EVTC 5DZNA 4N0UE 5JXED 5J1AA 2EDBA 1DBBH 2CRIA 5E99H 2G9HB 1LMKA 3E0GA 4J8RA 5F3BA 1GH7A 4GRWB 3KXFD 5EC2A 3EIFA 1JGLH 4UTBL 3LY6A 3QZWB 4OFYD 5IWLC 3IFLL 4BFIA 2V5MA 1S7QB 2VTFA 5I76A 3CMOH 5DRNA 5IEKB 1KCSL 4XHJD 1D9KA 4OF0A 3L3KB 4HIIB 3QDJD 1UEYA 4PLKD 4UV4L 2HA1A 3U1SL 2R9HC 2DM2A 1WBYB 3O11A 1ZLSH 4Y4KD 2DJSA 5C8JA 2ATKB 4ZUVB 3UCRA 2N4IA 2JB5L 3HC0A 5BJTB 5A2IH 2NMSA 1OGAE 3MPCA 4P0DA 3WSQL 3WUWG 4E42A 1RSFA 1R3KB 2UY6A 4TNVK 4G3YL 3HC4L 1BVLB 1I7TB 4HQQH 5GZND 2D31A 2PR4H 3NFNA 5HVWA 2NY0C 2ZPKH 2GK2A 3BW9A 4P4RA 1ZTXH 1L6XA 5KSVA 8FABB 5D7JC 4YK4B 4D8PB 1V3JA 1KJ3H 5FDWA 1FZMA 1T1XB 2EC9T 3WNNA 5EC1B 4G9FA 1DBAH 5EOCH 3K2UH 3SE9L 2Q7NA 5HBBA 2NY1B 1UYWH 4KJPC 2PCPA 4Y2DD 3NCYP 5IGXL 4ZAKD 1KNOB 4G6AD 2E27L 3CVHA 1QSFD 4L8SA 1MRCH 3NAAH 4FHBD 3TWCH 2D7QA 4DGVH 1U9KA 1S9WB 1S7XB 5HHOD 1MCLA 4MCZB 3H3PH 3RAJL 1NBZA 2GQHA 2DIBA 4MAYB 2IFFH 3VXUB 5KSBB 3T3PF 5DJ6A 1RZKC 5TE7H 2ICEB 1U93A 1DEDA 5DVNA 1AHWB 35C8L 3OKKB 1ND0A 4PD4K 3H7LA 4CVXA 1ZS8A 1FHGA 1CE6A 3DOSA 4OFIA 1JNHB 3ECBA 2P7TA 4V1DE 3JTSB 3HN3A 4PB9H 2R69H 4QXGL 4Q97A 3TT3L 1OT1A 4HS3A 3QQ3B 1CL7H 4Q74A 3MO1A 4DTGH 1S7VA 2OR7A 4OUUB 4XP6H 2N7AA 5HSFA 4WNQA 3U7YL 4O2CA 1G7QA 1L7TH 5F9DC 1NAKH 2VLLA 5FKAB 4OZIB 3O3AB 1FFOB 1OGTB 3ZSTA 3CSPA 4MQ7B 3O8XA 2VLKA 4EEEA 2X4PA 5HYIA 3BQUA 3SPVA 3WSQH 4OGAD 5T3XE 1DLFH 4FQ2H 1I7RB 4J4PA 1FFPA 4H1LG 1BGXL 4JQXA 25C8L 3ILPB 1H15B 1D9KB 3GI8L 4M7KL 4IS6B 5HYJD 1MCKA 5B21A 5I17A 4OBRA 1U8OA 2WIMA 5TDOA 4M43L 3RGVA 1NMCB 4U49A 1P4IH 1TJHH 3RX8A 2ZOLA 1HYSC 5E2UL 4NRZB 2I9LB 1IEAA 4S0TD 4FFVC 4RBPH 5KVEL 4OV5A 3MV9E 4FNLL 4YX2L 4PJGF 3V6OC 5L8LB 2NY4D 1E6OL 3JUYA 1RIVL 5CMAA 4GMTH 3QUZD 4RZCB 4XPHH 3DXAB 3EJYC 5TFSL 4HW6A 1B6DA 1ADQH 4ONOA 4ZS7H 4FP8L 3SDCA 3ARVA 2DBLH 1U8JB 5FM8A 5F7WC 2K3TA 1ZGLA 2W07A 4R2GC 2BVYA 2JJTA 2Y07H 3LD8C 3IJHA 4MWFB 3D0VA 4RMQA 4GH7B 5HGDA 4L1DA 3MJ6A 2C4FU 4LPVA 1HILB 5JA9A 2AQ2A 1WT5A 4Y89A 3A6BH 4UDUB 3P0YH 2A6DA 5IMOA 1NBVH 2DLFL 2Z8VC 4MZ3A 3VFGH 3LKQB 3VWKB 1DBMH 5EUKB 2E6QA 3CDFA 3SPVB 3JVGC 5D5MA 4K9EH 1JYXA 3S9DB 4G43A 1WUNT 2M1KA 3AMKA 3MBEC 4Y4HC 3NCEB 1JPTL 5JUEH 5D1ZB 2VZVA 4EIZC 1YEDA 1DN2A 1I3RB 1YEKL 1P1ZA 4S1RH 5I2IB 1A1OB 2DMCA 1RUQL 3S4SB 2HVKB 1QFWH 2J8UE 4V2BA 2KQMA 3OR6B 1Q0YH 3QNYB 5F7FA 1YNKL 2ZUVA 1A9BB 2QQLH 1T7ZA 3CFJA 1UWXK 2X70B 4MJ6A 2J6EA 4JFPA 1CFSA 5E2WL 4JCLA 2P4AB 4UV7H 1IGCH 1S7QA 5ALCL 2I26N 1ZS8B 5GS0L 3SBWC 4DVBA 5GSVA 5ILTL 3KJ4C 4OCYH 5EZLA 3L5WA 4WO4D 4PV9A 4N0FB 3BHBB 4XMLH 5SWSB 4OLVL 5D7JA 2GYSA 2V5RA 3RA7L 5T3ZD 2FYYB 5I75B 5E7FA 5LGHH 4QCIA 4YHZH 4LPCA 3NTCL 4NIKB 5GRUL 1WCBA 3D0VB 1B0RA 4ZSOA 4WI6A 4P2QB 6CGTA 5E03A 1MHPH 5IVZA 4JRYD 1BOYA 1QHOA 1F6FB 1CDBA 3QUKA 1U2HA 4GS7B 4MA8H 1NBYA 3O6FB 3EYFA 4U1LA 1TIUA 5ITFB 5J1AB 1JK8A 4KHXH 2XWTB 3HFMH 4JFXB 3GEWB 1VFAB 4FOMA 4IDJH 1BFTA 4QWWC 3QI9A 4RX4D 4MLIA 4PBWD 1QQDB 2V6HA 1QFWM 4XCFL 3SJVE 4EXKA 5BOZG 4N5ED 3DV6B 4KJYA 4Y19A 5HHXH 1DR9A 4LDLB 4Z7NF 4MA3A 2EC9U 5D1ZC 3EFDL 4UDTB 2BNQE 3TJHD 2CKBL 4APQB 2EE3A 3QNYA 3S4SG 4L9LB 1YN7A 3QO0B 4LHUG 4EOWH 2DQJL 4WCYH 1RIHL 3WXWH 4QHKJ 5B4MD 2FD6H 3IFOB 2OX5A 2EYSA 2XNAA 2VDPL 2FX8H 4OLVH 1S78D 2O61B 3MREB 4H1LA 2BCKA 2VRAA 1NGXA 3UBXG 2ZKHL 2HH0H 5IHUL 4W4OC 1GGIH 2AJXH 3KPRB 4ODTL 3ZKXB 1A4KB 4R7NA 3I6LD 3SGEI 2DTMH 1HNGA 3C87A 2HKFL 5CEZL 1FL5A 2ICES 4N0UB 5C0IA 1CD0A 4OZGF 2EIDA 1ZE3C 3TGXA 1GZQB 3HE7B 1MQKL 4QHMB 5JNYA 3VGFA 3IU3B 2V7HA 3SCMB 2YD9A 5D72H 4JKPH 1NGQH 2NR6D 5I66A 2BVPB 4F37K 2BNUA 4RX4A 1L9MA 3DHJA 3FRUA 2X4UA 4M1CC 4NWTH 4NHCL 3TZVA 1XF4B 4FQIL 5DQDL 3C60C 4NKOB 4ONGH 5I1JL 4JFDB 5EU4A 4NDMB 1GCFA 3TCXA 3GSNL 2YPLD 1NC4B 1Q9KA 3QR2A 1MJ7L 1PY4A 1D5MB 2A6IA 4XVTH 1BZ9B 5J4MA 5KN5B 5D7JB 4XAKD 3O2WL 2FHCA 2YSSA 1SEBB 2VJXA 2P44B 5F88B 5L2JB 1KIQB 2UVEA 1FDLH 1KTDB 1MCNA 4J3WA 5E4EC 3WIHH 2XIDA 3H9SB 4I4WA 1IGIH 3MRDA 3QXTA 3LQZA 4ISVB 5F93C 1SBSH 4RBPK 4WWID 3AS2A 1MJ8H 2OZ4H 3BZFA 4H1LB 2BRRL 2DWEB 4I18C 3O4LD 1MIML 1DVFB 2YOCA 1GGCL 1E27A 3QIWB 4W6XB 3TFKC 1Y18B 5C0CD 4LAJH 2J4WL 4ODSL 4R7DB 1N59A 3MRPB 1IT9H 1HYRC 4IMKA 5A2FA 1HH9B 2BVEA 2Q6WB 4EI6A 4ZG1A 1AFVL 1T89A 4FFZH 2OLDA 4XPAL 1IGJA 2NXYD 3CFCH 2P5WE 4FTVD 4KZEL 3D69A 1AKJD 1YMHB 3PV6B 2COQA 3GKWH 4OIBA 4OM0L 2W65A 5EBWB 1LK2B 1MCDA 2Q7YA 1H3PH 3CVHH 5LG1A 1OT2A 4JFYA 3HA0A 1Q9WB 3ZKMC 2P5EB 4H20L 3DI2B 3O2DH 3H42H 5IF0A 2CO7B 1QBLH 3ULUC 1F4AA 3VA6A 2C4FT 1R5IB 4Q7DA 2R2BA 1U8IA 3NFSL 5C09B 3VFVB 1G84A 2OK0L 4Y5XC 1G7MB 3ZE1F