2HFGH

Crystal structure of hbr3 bound to cb3s-fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISSSSIHWVRQAPGKGLEWVAWVLPSVGFTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRVCYNRLGVCAGGMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CB3s Fab light chain (kappa)
publication title Synthetic anti-BR3 antibodies that mimic BAFF binding and target both human and murine B cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfgH01
3EOTH 2IH1A 2P44B 2C3HA 3SHSA 3FN0H 1LO0H 3B6SB 1WICA 2VXTL 1A7OL 1GIGH 3KPSB 4ETQA 3LEVL 3TBVB 4U0RB 1BBDL 2AEPL 5KSAA 4PRHB 5D71L 3MYZA 1FLRL 5ADPH 4XHQA 1TTUA 2H26A 2AI0L 5FUOL 1RIHH 5GRWA 3UDWA 5DXWA 5LCVH 1YMMA 4F8TA 2NXZC 4S1RH 1I1AD 5DJZB 1MFAH 2JTDA 3HC0B 4NHCH 2EZ0C 4M7LH 4P48A 4HKBB 5L9DL 3JVGC 1I85C 1P7QB 3WE6A 1UACL 4JHAL 4D8PB 1OWWA 3JV5A 5GS3A 5D1ZA 1OVZA 5F9JA 5E8DH 1P69B 2NXZB 3BE1L 3MRFA 1FE8H 3G6JE 4NKOA 4JHWL 2A1WH 3UO1L 4UAOC 3ECBB 4NSKA 4EN3A 1QTYT 2A6JA 3QP3A 1A5FL 1G0XA 3V95A 1TIUA 2VO5A 5EC2A 1YNLH 4ZS6C 1NCDL 2EDDA 4KJYB 1L0QA 4JAMB 3DV4A 1JUFB 4UAOB 5HHOB 4MNGA 4KZEH 5CZVL 2FO4A 1IMHC 4JVPA 5FCSH 5F72S 1FORL 4JO2L 5C92A 4HJ0D 1NFKA 3SY0B 2EEBA 1MWAA 2UUDK 2VUYA 3TM6A 3QA3A 5DVKA 3QWQB 1IM9D 4OLEA 4XC3H 1FN4B 1F58L 3FFCB 1IAKB 4TUOA 1IFHH 2RHEA 4JFZH 4XVTH 5ERWB 1RUPH 3QDME 4Z7NE 4POYA 1GOGA 2P1YA 3FRPG 3MFFB 4AG4H 2ITDB 4M62H 1CDBA 4P2QE 3KPRD 1A6AA 5DQJB 5EPMA 1BFVL 4JKWA 2WLZA 5C0FA 3ZT7A 3P4MB 2P5WD 1EDQA 2WIMA 3MRQA 1MAMH 2P7TA 2FHFA 1E27B 5J57B 5A3IC 3EJZC 3OTTA 4HLZG 2OZ4A 5A2FA 1CTOA 4D9QE 1A8JH 1IGIH 4APQC 3RTQD 4G80B 2WANA 4F15C 5DK2A 5F88B 5FHBL 1LO3H 1T2QH 3BISA 4UB0L 1RIUH 3FHAA 5D8JL 5JOEA 1KN2L 2YK1L 2QR0B 3NMEA 1GHFL 1MHHB 4APQB 1INQB 2BX5A 3QG6B 5D1XC 1BVLA 1K3ZA 4F15B 1VPOL 3UJIL 4TQEL 1Y0LA 1S7XA 3FQTB 4KWUA 2D0FA 3WN5C 4PJDE 3ROOB 2A0LD 1K5NA 5JHDE 1EVTC 4YHIB 5I1IL 3CCHA 3DX6A 5D1XB 3GEWB 4MJID 3VXME 4XC1H 2VXVL 5FA3B 3MJ8B 2A6DA 3BGMB 3WN5B 2JB5H 4V2BA 2CIKA 1KT2A 5L2KD 1RK1A 5D7LA 2F5BH 5FB8B 5DJDB 4OI7A 5F7NC 1I1FA 3HAEH 3RZWA 3EYQD 3D87B 4CDHA 5H2BB 2Y07H 5D5MA 1I3VA 1O5DT 4WHYH 2XZAH 1GZQA 2YPLB 3BD3A 4S0SD 3UPRA 3NIDE 2AQ3A 1MFCH 1P84J 3GBML 1GXEA 1U8JB 1Z5LA 3FB6A 3QUKA 1CFQB 2E7MA 2FX7H 1U8NB 3ULUC 4UT6H 2B5IC 4PJ5E 1DANU 2IMNA 3GMMA 1TNNA 4PLKC 5DJYB 2AQ2A 3FO0L 1LD9B 1ZHLB 4CW1A 1JGDA 3LN4A 3SCMD 4YHZH 5E5RB 1MCPH 1C5BH 2B5IB 4U31A 3QH3B 2XFXB 1HEZB 1QR1A 5EORH 1WZ1L 1PKQB 3D2UB 1G6RL 2EC9U 3QPXH 2W9LA 4Z7WB 3TYFB 4L8BB 1JWUB 3VFOA 3OKEB 1MRCH 3EDJA 4LARL 4CVZA 1NBZB 2EDYA 4HGKC 4O5LH 1F90L 5D96C 1OPGL 1C5DA 5GJTH 2G60L 2BFVH 3O81A 4YHML 1B4RA 4NIKB 2R1XA 2EIEA 3TIDB 4LASL 5A16B 1TVHB 4XHJD 2NY0C 4H1LG 1N2RA 3G6JB 1NMCC 1T5XA 5D96B 1PQZA 1YPZF 4F58H 3LRSA 4OZGA 4Y4KC 1JBJA 4QRPD 1ZHKB 2EEAA 3WL9B 4PRBA 3FO9A 1NBYA 3KNBA 2NY0B 4ETYA 4Z0XA 1NMCB 1RAMA 3BJLA 4WW2C 4Y4KB 1C8PA 4L1DA 3QUYC 5DD5L 4HKZB 4OLYH 2WLYA 2VLJE 3ULUH 4F2MB 1UB5A 2O61A 1RZIB 4RBPH 5I8EB 3DVNB 4Q97A 1DL7L 3DBXB 4BSVA 3ULSB 2FR4B 4WY7H 1LGVA 3OKMA 3SDCD 4GKNB 4WW2B 5A2IH 2DJ4A 5AUMB 1A7PL 2NTSP 3QUYB 4FG6C 4K7PY 4PJXA 1BEYL 2A74A 3BAEH 5C2BH 4ODVL 5GGSB 4P3WA 4L3AA 1I75A 4PJHE 3U83A 5EFIA 3QDMB 5I1KH 3G08A 1G7PA 4L3CB 4DQOL 5ACZA 5MEQB 4MX7A 1PD6A 1BOGB 1YEDB 2BMKA 1J05A 5JNYB 3CSGA 2XPGA 1UXSA 2GFBA 4NGHH 4QXGL 3CFBB 1P4LA 4Q6IA 5EZOL 5IVXB 4PJIF 1I1AC 1DCLA 2DMCA 4NT6A 4LF3A 4O4YH 3HUJA 2GK0A 4G6JL 3FFDB 2VZUA 3MRDA 4P0DA 4HW6A 1I1AB 4L8SC 3NIFE 4PV9A 4LSDA 1TTFA 3H9HA 1ADQA 3K2MC 3HTLX 1NGPL 4AZ8A 2HFGH 1D5XA 1QFUL 1P4BH 2P8MA 1ITBB 3DWTA 3BHBB 3OR7A 5HDBF 4L8SB 3WSQH 2AXFB 5EZIL 4KHTH 2AK1L 1NLDL 4RIRB 3MBED 4XPGH 4U1JA 4KROD 5F1NA 2IGFL 1IARB 1S7SA 4J1UB 1F3DJ 1R0AH 4HJ0C 3BKJH 4TVSa 1YY9D 4K3EH 5DO2D 1R6VA 5C6TH 1R24B 4JDTL 4PJGA 4Y5VA 1TPXC 4URTB 4QF1A 4JDVB 1N3NB 2H45A 4K3DH 5CEZD 3ARED 3IU4L 1IM9B 3BD4A 2EYTA 4HWBA 4ONFL 5MP6L 1TPXB 5I18H 1I7TB 3PNWA 5FHAL 3NABH 5F3BB 4M03A 4S1QL 3EO0A 5C0CD 1HXYA 2CRMA 5EZJA 3T4YA 4OKVB 4OLVL 5AYUL 3LQMA 1T4KA 3MRPB 1RURL 3KPRB 4IOIA 3FB7A 3U7AA 5EO0A 3RTQC 3PJSB 1FL6B 1WWAX 4MNHB 4TULH 3OG4B 2P5WB 4F9LA 1J5OH 4NQED 2OTUB 2Z0BA 2HLFD 4J3TA 2V7HA 1HCVA 1TJGH 2VLRE 3RTQB 2CRIA 1N64L 2J2ZA 5F9OH 3QJHB 3CDGB 1RUAL 2ADJA 3JTSB 5E4IA 3H9YA 2EDLA 2R69L 1ZWIA 1W8OA 5CBAB 3BKYH 1MPAL 3GNMH 4L4VD 4DN3H 3D3VA 1V7MH 3PP3K 4GJTB 1XF1A 2A0LC 3RL2A 3QXAB 4ZUSA 5C9KA 4E0RB 5HSFA 3GM0A 3ME0A 1NFDF 1FL5B 2Q76B 1ETZA 4PJ7B 2HKHH 4MHHI 3ARDA 3VRIA 3UX9B 5JORB 1FNHA 1A1OA 3K2UH 3I6GB 4MJ4A 2ZOLB 4MJIB 1Q0XL 1DN2A 4KXZH 3EYQC 3MRGA 4OSUH 1NUGA 3MLYL 4NWUL 2VL5B 2VWEE 3RWFA 5F9DC 5GRXG 1QOKA 3WFHB 1OTSD 2K1MA 3I6KA 5IFHH 2ZCLL 3TCLA 2DMKA 2ZUVA 5KVFH 2DICA 1CDYA 5MERA 4P57B 2VLJB 1N7ML 4NZJA 2CKBA 2OP4L 5HYFA 2YD9A 5I0DA 1OQXA 2JJTA 4X6DA 3PWVA 2E7LC 3BUYA 4LPUA 4G7YH 4LP4A 4YDIL 2V5RA 5ESQA 3I3BA 4WVRA 2PW2B 4JM4H 5IFAL 3DETD 4LLWB 4PJHB 3SCMC 4XAKD 1KJ2L 2VDLH 5FKAA 1ERNA 1P5UA 1E28B 5EU4A 2NXYD 4RNRA 5GS1C 3EZ8A 3GMRA 4ZUWB 4EQ3A 5HDQH 1MCFA 4NUGH 3VXUD 2X1PA 2ZP0T 1OGTA 2P5EE 4XPHL 1LE5A 1FVCB 3O11B 2VRAA 5DWUL 3FT3B 1Z0MA 5GS1B 4R97C 2CPCA 3WIIL 3X14A 3IXAB 3QHTC 4LVHC 1UZ6F 1A7OH 1ZXQA 4ODXB 4O2CA 1HHIA 3LEVH 3CX5K 3BX7C 3O3UN 4L4VE 1BBDH 1H8OA 2AEPH 5K9JL 5E94B 1UEMA 4H88L 5D71H 5I8KL 4XHJC 1FLRH 2GK2A 5TDPB 4R97B 4LVHB 2AI0H 5FUOH 4UBDD 3D5OF 3DMMD 5TE4L 1HDMB 2QQKL 1VFBB 1S7VA 3CNKA 2R4SL 2Z8WC 4QRUA 5JZ7D 3CZJA 3PHSA 1LEIA 1P2CA 3MRMA 2ICWA 5D2LA 4WUUD 2VC2L 5L9DH 3UTTD 2X7LA 3QHZL 4JHAH 5DD6A 1YZZA 3MV01 1JNNL 4F3FB 4QRPB 3BE1H 4JHWH 4Q74A 3UO1H 3IAGC 3UYRL 4LCIL 3D0VA 5SWSE 1A5FH 3HLAB 4POUB 4OLZL 3C5SA 5C0EA 5E2UL 2JCCA 2KPNA 1NCDH 2R2HA 4F33B 3M1BA 4DUWA 5T1MA 1GCFA 4L4TA 5CZVH 4U1HB 2BVPA 2HG5B 3RIAF 3HG1D 1JHLL 3RWEA 4JE4B 3MJ9A 3IETB 1FORH 4JO2H 3C8HA 1HSAA 1EJOL 1I8LA 5HJ3B 3QI9D 3ZDYF 4P4KA 4JFXA 1XGRA 1KJMB 1F58H 5D7JA 3QQ9D 1UH4A 1DEEA 2QKIA 4EI5D 1HILA 3WHE0 1YC7A 3VI3E 4DKFL 4ELMB 4GBXD 3PABB 4GRWF 4TOYL 2YXMA 3MNZA 3QUXD 2XA3A 2IPTL 5MEPB 4WJ5A 1BFVH 3DVGB 5CJXC 2NX5D 3DVIA 1QLFA 1UH2A 1SHMA 2XZZA 4R9HA 3P73B 1C7TA 3LS5L 1XZ0A 2ZZUT 4R4BA 3MRLA 1S3KL 4YHPA 4S1SL 3CVIL 1WWCA 3RGVD 3TO2A 1HI6A 5D7IB 5FHBH 5EUOA 5DJXA 3S5LA 4UB0H 1T0NA 5GZND 4QTHB 3KAAA 4KROC 5I1LB 1L0YA 4HJJL 1KN2H 4IRJA 1TJIL 1GHFH 4M7JL 5F1SA 3H3KA 1X6LA 1DQQA 2BVQB 4WUUE 5DO2C 1YY9C 1VPOH 2NY6D 3UJIH 4MAUL 3QUZD 5ANMA 3F7PC 3RY6C 4KROB 2VDKH 5MEOB 3ARGD 1X5IA 5I1IH 4G9FE 5FV2A 5KAQF 3IDGA 1OAYL 2VXVH 4X0KB 4NRYA 2H32B 2K3TA 3AREC 1G6RB 3CLEL 4BH8A 1WISA 5D9SB 1XGYL 1B88A 3PHOA 3WLWD 4R7DA 1Q1JH 3PWUB 4MMZC 3ORJA 3S35X 4S0TD 1DE4A 3EYSL 3AREB 4JVUA 2VIRB 4OZHA 1FG2A 2VXUL 3U9UA 2HN7A 1MLBA 5ETUA 4XP6L 5SWZE 3TH3T 3KLAA 2FEDD 2ZWLT 2YC1A 5JW5B 3AXLB 4OZ4A 3GBMH 4LSQL 1UKSA 4MA1C 3PQYD 4JN1L 4NDMB 2EYRA 2Q8BL 2HLFC 2BSSA 4GG8B 5T1KA 1TZIB 3SE4A 4DZ8A 3HI6L 2BNRE 5I8OL 1KLFA 1H3GA 3L7FA 4NQEB 1UXWB 2E9IA 3FO0H 4MA1B 3V8CA 1T83A 5E24E 2Y23A 1N5YL 3GDBA 5AYQA 2AABL 2ICWI 2V5MA 2VDNL 4KK5D 3H7BA 4KTDL 3KPTA 4L4VB 2H32H 2AJVL 1G6RH 4HC1L 4GMTL 1R3KB 3V0VB 5J6HB 2OXHA 4LARH 1MCOL 2JK5B 4Y1AE 5JXED 5CEZH 3V0AC 3GJEA 1M71A 4PJFE 1F90H 1ZT4B 3I50H 2F8XC 2KUTA 1OPGH 3DECA 1OTSC 3P77B 2G60H 4K23H 4YHMH 5HXMA 3F6IA 4P3CL 5IMMA 3GSVB 3EUUA 4MB3A 4LASH 4HUNB 3VDAA 2XWTB 3L3IB 2DQUL 3MV9E 3B83A 3FQNA 3QSKB 3HN3A 5BZDA 1W2KT 3Q5TA 2CLRB 2EE9A 4P2OD 4S10A 1F4XL 3CK0H 4JZOB 3QDJD 3PWNA 1OARL 3TCXA 5AZEL 1KB5L 4FQIL 3BO8A 3S3SA 1E4JA 2I9LB 4J12A 1FGNL 3IDUA 5E8OA 3DETC 1MQKL 3JWDL 4HIHB 3VXRD 1T1WA 2NXYC 1DL7H 4JFQB 4KTYA 3N9GL 3B9KA 3FRPA 3DHJA 3VGEA 1A7PH 4U3CA 1JL8A 1BEYH 4FFYL 3DSNA 4ODVH 3PQYE 2V2WA 2NXYB 5CMAA 5SWQA 3KG5A 1DDHB 5KANG 1R3HA 3QEQD 1RUQL 4LGRB 1CFNA 1U92B 5IR1A 1KBGL 3I9GL 4YK4C 1L4IA 3VXUB 2IPKB 5DSCB 3DVFA 3WMSA 3BQUD 1KJVB 2QSVA 5DFWH 1WBYB 2LTQC 4YBHA 4D94A 4OGXL 2BY3A 3L9RB 4G43B 5C6PB 4YK4B 4UBDC 4NQXB 1BQUA 4QXGH 5EZOH 1R3IL 2R2BB 1XF4B 5ISZA 5JZ7C 2LTQB 4NN5C 1LWRA 3BP4B 1N4XL 4UILL 1KNOB 4MYWB 3VWJA 4XNMB 5F8RC 4G6JH 5L2JA 1X9QA 2CRZA 4X6FB 3BZ4A 1YUHB 3B5TA 3P4LA 2P8LA 4NN5B 4LP5A 4S2SB 4WUUB 5F71A 2RR3A 3IT8D 3UTTB 1QBLH 2FEEI 1NGPH 3D0LB 3P9WB 4XZUB 3VI4E 3VWKD 4HH8A 4WRLA 5SV3A 2KL6A 5K9QG 5DK0A 1QFUH 2WQRA 1FGVL 5JW4R 2AK1H 1NLDH 3TZVD 5IHUL 5CBEA 3DGCR 1GOHA 1HHJB 1QFHA 2IGFH 1BREA 4OZIB 1XGTA 3FQUA 1I8KB 3NCJH 3UTOA 3EDEA 3BDYL 4MJ6A 3CUPB 1FNEB 3QI9C 4Z8FL 3PWLB 3HG1B 4OZFB 2IALA 1FHGA 5E2TL 2HTLD 3QQ9C 4Z7QE 4LOUD 3QI9B 4PJ9A 5SWZB 3IU4H 4GBXC 2CUIA 4ONFH 2J8UF 5MP6H 3G5XA 3QUXC 5FHAH 1UKTA 3KPQB 1MEXH 2C4FU 3QEQE 3F7RA 1RK0B 4S1QH 2EDXA 1SYVA 1XCQA 2PYEE 4OLVH 2EH8L 5AYUH 4GBXB 3EFDL 3QIWA 4OBRA 2UV3A 3QUXB 1RURH 4FFWC 3QB7C 3GUTB 3RGVC 4JRYA 3ZL4L 2NX5B 5KSUB 2NYYD 4X9FA 5EBWB 5KZCD 5INDB 3ULVE 2KZWA 1J0ZA 2BOBA 4Y88A 3MMEA 1S78D 4E41A 4PJCE 2A6KA 3RGVB 1N64H 3H7LA 1PJ9A 5E8PB 3FMGL 5TH2A 4DCQB 1WF5A 2NY6C 1UENA 1RUAH 3UTZA 3QUZC 2R69H 1NQBA 3TN0D 1MPAH 4BFIB 4H1LA 2GAZB 5IVZB 1WC7B 2JF1A 3ARGC 5DMYA 4J2XA 3HI1B 4WHCA 5C08D 1I8MB 1KJ2B 5TDNA 2VOTA 4JG1L 4PJFB 5ITFA 2NY6B 3QUZB 3M17B 4UUJB 3CDYA 2PTUA 2DI9A 3OKNB 1D6EA 3ARGB 5JW3L 1LNUA 3WLWC 1V3JA 2FL5B 5HGAB 3MOQA 4CBPA 3RI5K 1Q0XH 2ZUWA 5HVHC 3MRBA 2GIYA 2CDGB 5CWSA 3MLYH 4NWUH 3TBVA 5LAXB 1CVSC 4PRHA 1IGYB 4HCRA 5KW9L 4LVOC 3CIQA 4RWYL 2CRYA 2X4OB 1HNFA 2ZCLH 5HVHB 1Q9KA 1BIIA 2FEDC 5FK9B 2FX8L 2HJLA 4QOKE 1N7MH 1S9XB 4GG6E 1U93B 2OP4H 3QIUD 3K4DA 4LVOB 1AIFA 1GL4B 2MQ3A 4GRLD 3IFLL 4F37F 2Z92B 3EYUL 3O4LE 5FGBA 4N8CH 4YDIH 1S7QB 2OSLA 1NPUA 2FYYB 3ECBA 3PQYB 4JY4B 5IFAH 1GZPB 5ELIA 1KJ2H 3VD7A 5H8DA 2X4RB 3OX8A 3DYPA 3CX2A 3HE6D 1NGZB 3OQ3B 4KK5C 4RA3A 4KJYA 3W9EB 3S3JA 1HIML 3U82B 1D5IL 4OCXL 5TPWL 1Y6NR 2R23A 4XPHH 3T0ED 2PXYA 3ILPB 3MYJB 4OF7A 5IB5B 5JXEC 5DWUH 2E9BA 4X7TB 1IEAB 4UDUA 3ZE0F 1S7WB 1DVFD 4FZ8L 1HHKB 2CQVA 5K9JH 5IW1B 4H88H 1FN4A 1JK8B 5I8KH 1IAKA 3WBDA 3VU2A 5ERWA 1OLZA 4CRPA 4K71C 4AQOA 1T1XB 5TE4H 4P2OC 4QRRD 2R4SH 3D85A 2YWZA 3DV6B 3RUGB 3VG9C 3EIFA 3DROB 4POZD 3T3MF 2VC2H 4X4XB 3EYVA 1KCLA 4K71B 3QHZH 2XKUA 5E7FA 4RGNE 3O6FD 3CXHK 1JNNH 4P2OB 3IGAA 4DW2L 4PRNB 3ESVF 2D4FA 1I9RL 3L95B 3UYRH 2FIRT 3SN6N 4G80A 1IQDB 3VG9B 4LCIH 4J3UA 3MCLL 4OLZH 1E4WH 5E1HB 4IJ3C 3K0WA 4L9LB 3VXRB 1ZLWH 4KMLB 2QR0A 1IGFL 1JF6A 4KAQL 4XCNB 3P9MA 2EDFA 1Z9LA 1CD1B 1JNLH 1JHLH 4XBGA 4IJ3B 1SBBA 3THML 4D3CL 1QYGL 1NDGA 5E9DE 4NJAH 4YHIA 1BWWA 4CDGC 4Y5YA 3SBWC 3QEQB 4DN4L 3EO1B 5BS0A 5FA3A 3S88L 2VZOA 3GMPB 5KN5B 3BGMA 2DQCL 3WN5A 1UC6A 1Q9OB 2PYEB 3CDCA 2DQFB 4H25A 2HKFH 5FB8A 3WYRA 1TJHL 1TTGA 2I26N 4LU5L 3OMZA 4Z7UB 1UWEL 5DVOA 4HUUB 2MKLC 3LS4L 4PS4L 4WFGD 4DKFH 5C8JA 4JVWA 4CAGA 4MQXD 3KYMA 2IPTH 2VR5A 5H2BA 5JW4N 5IQ7L 4PJEF 3OXRB 2YPLA 5GISL 2LAGB 2UYLA 5I1EH 4XXDA 4B41A 4HLJA 3TIEB 1QSFD 3VWKC 3BPLC 4KRNA 1S3KH 1FCGA 4IIQC 4S1SH 3EYFB 3CVIH 3LKSA 4OZFG 5IW3A 3MLSL 1U95B 5D70L 1U8NA 2EYSB 4PJBF 5EO1B 3TZVC 3CXDL 4JFFA 4MA3B 3PGDA 1RZFL 3BPLB 3VWKB 4HJJH 1LE9B 2DQGH 5MENA 3P0VH 1A3LL 4IIQB 5DJYA 4M7JH 5IMLB 3D18B 1ZHLA 1A14L 4JQXA 3RWIA 4MAUH 2PR4L 3TZVB 4RMWA 3EJJX 1IGCL 3KS0J 2Q86B 5FO7B 2IFGA 3HNTL 4QY8B 5DYOB 1SJEA 1OAYH 4AEIL 2DWDA 2MPAL 4Z7WA 4LOUC 3TYFA 4L8BA 5KJRL 3CLEH 4LRNL 3OKEA 1XGYH 5CJOL 5F7EL 1QP1A 4D9RE 1T0PB 3N1FC 1T3FB 1HSBA 1K85A 3EYSH 3G04B 5IM7B 1X7QB 3BP7B 4S11A 1T5WB 3RX5A 3GJFH 1U91A 3GSOB 1EZVX 5EOTB 3TIDA 1D7FA 2VXUH 3O4LB 3F5WA 4G8FA 2QADD 3G6JA 1G6VK 4XP6H 4XPTL 2NYYC 3OKYA 3WL9A 4JN1H 1S78C 3SGKC 1N0XL 3RNKB 4WFED 3JWDC 3TV3L 3WFBH 4OB5L 4NP4L 1RJCA 3V5HA 2Y1VA 4BK5A 3HI6H 4RSVA 1KB5B 5KZCB 4JDZA 4HKZA 5I8OH 3TN0C 2BVTA 2X4SB 3GO1L 3LVEA 4F2MA 2WINB 43CAA 5IKCA 1MHCB 3ARBA 2EKSB 5I8EA 1JZ5A 3ULSA 2FR4A 4YIQA 3MV8D 2AABH 4K94L 2VDNH 4F7PB 3QUYA 4KTDH 3TN0B 4KDWA 5GGSA 5IJVB 4HC1H 5C08B 3IYLW 4GMTH 3AY4A 4MZ2A 2DM2A 5C07E 3QDMA 2Y5TB 4PUBL 5J6GB 1MCOH 4JJHA 1A64A 4GXUM 4Z7VB 5DC4B 3O3DB 3KLDA 3B9AA 3RA7L 4L3CA 1OAXH 4P2QA 3TJHD 4Q9RL 2D9QB 5DTFB 3R06A 3QEHB 5JNYA 4P3CH 1JF5A 4YPJA 2DQUH 5HY9B 5HYJE 3W9DB 1QEWA 3QIUC 5C0BD 3DTXA 4FS0A 2IG2L 3REWA 1VB9A 4JO1L 1D5MB 4GRLC 2XWJA 1F4XH 4HK3J 1OARH 1Q9LA 1BBJA 1YY8B 2DI8A 1KB5H 4FQIH 1G7LA 1C08B 1ZTXL 3QIUB 3V6ZA 3QQ4A 5IOPB 1FGNH 5FM5O 4GRLB 3Q6GH 3Q3GB 1MQKH 4GT7A 1JZ2A 3K81A 4JFYA 3VCLA 3NA4A 4DUVA 1J18A 4PJDA 3N9GH 5I1DA 3K7UA 1F13A 2VABB 3BIAX 4L8SA 5JHDA 2AXFA 1A6PA 4BUHA 3RJDA 4G5ZL 5DRWB 3VXMA 2GJ6E 5J11B 4FFYH 1Q94B 2GSIA 3MJ7B 5GIRB 5FYLL 2DAVA 3VFNB 3WFEL 2XN9D 4MS8D 2YD5A 2DJUA 1RUQH 1U8PB 1KBGH 3I9GH 2FO1A 5LGJB 2Z9TA 1DVFC 1R24A 1UVQB 4JB9L 2ZUQB 1KENL 2LU3A 3VG0L 3VFRA 3HR5A 2B8OT 1BZ9B 1L0XA 3SKNB 4OGXH 4NO0A 4NQCE 5J1SC 2E9JA 1DVFB 2WM0A 3HZKB 1V3KA 4CNIA 1R3IH 1EIBA 4LIQL 4PRIE 1I7TA 5F3BA 1N4XH 4POZC 4UILH 3KGRA 1EEZB 2FH8A 3D6GA 1KLGB 1PEZA 3O6FC 3QWRA 3VFPB 4PJ5A 5D7SL 4U7KA 5LGKA 4QRRB 4MVBC 5IUSA 3OGCB 2P8PA 3KPRA 4M61B 5F7KC 3GGWA 1QRND 4MNHA 5M7QA 4H0GA 5HGHB 3NCEB 3O6FB 1UADC 4OF5A 1FGVH 4P5TA 3OKLB 1FNAA 3RTQA 4OI9A 5IHUH 3QJHA 1WTLA 1NCTA 1JHTB 4LPYA 4GW5A 1MLCB 2XA8L 3BDYH 5JPNA 4PY8J 3QXAA 4U2YA 2Z35B 2BC4B 4E0RA 1J8KA 2OX5A 4PGEA 1FL5A 5JPMA 3H9ZA 1NUNB 2AVGA 1CGUA 5E2TH 1T2XA 4LNRB 5CP3H 3VGGA 2BNUB 2YA0A 2ZOLA 4MJIA 1JYXA 1H3XA 3OKDB 4NQTA 2ICCA 4MQXC 3RVVD 2PTTB 2FLRT 2W65B 5CILL 3WFHA 5C0JA 5I71C 1IJ9A 3RL1B 3CPLA 4MCZB 4DGIL 1WWBX 1MQ8A 3HMXL 2EH8H 4RGOH 4OUUB 4ZFOL 2VLJA 3DUUB 3ZL4H 1BQSA 4OIIL 4V2CB 5I71B 2C1PB 4LLDA 3G5ZB 1G9NL 4W6WB 4FXKA 3CVHL 3WKMH 4KRMB 1B6UA 1U3JA 1CGVA 3SKOA 3KYNB 3FMGH 2PW2A 3N50A 1DUYB 3FOLA 4EDWL 4PJHA 3FB8B 4JZJA 1I4FA 3MTRA 1DQJB 3WNLA 2CLVB 3RP1A 4FN0A 4RAHA 1DBJL 1LK2A 4JG1H 5FYLD 1TNMA 1QFPA 4K7PL 4GQPH 5BRZD 5J3HD 1FVCA 3O11A 3MV7D 4U1MB 5ID0B 3E6HA 1P9MA 4A2MA 4LLMA 4BSWB 3GB7B 5CCKL 3RWHA 2AS5M 4TSBL 1X5FA 4YPGB 2DL2A 2EO1A 1KGCD 4JFHE 1XF2B 5JO5B 1EEYB 1JTOA 5KW9H 4JFOA 1URLA 4RWYH 2QADC 1T1YB 4LCCC 1CDCA 2Y6SD 4OQTL 1JWMA 4P3DB 4PJIE 3V79C 1HDMA 3ZKXC 2FX8H 4WENB 1VFBA 1FZKA 3U0WL 2QADB 1BF2A 2IADA 1YN7A 2YPKA 2VITB 4LCCB 3IFLH 5K9OB 1PBYA 1FIEA 1J11A 1TQCC 4CMHC 1U2HA 3EYUH 3DRQA 3ZKXB 4XXCC 3OV6A 4YHOL 1JRHI 1YA5A 1T21A 2JJSA 5GGSY 2DQDL 1T0MA 5BQ7A 5HDBE 3HB3D 4CMHB 4KXZI 1AH1A 2QLVB 4AY0A 1HWHB 1W8NA 3ALXA 4F33A 3CGTA 1FFPB 5DJ0B 4HV8B 1HIMH 1D5IH 4OCXH 5GS2D 5TPWH 4HUVB 1KELL 2IANE 4LEOB 3S98A 1MWAL 2HG5A 1JPTL 1XH3A 3QUMA 3IETA 1P7KB 4GS7C 4E9LA 2Y5EA 4B0MM 4DEPC 3TJHC 1QA9B 1J1PL 4FZ8H 5MHSD 3L5XL 4GS7B 3U0TB 4I5BB 4U4BA 1ZOXA 5F7FA 4DEPB 5J1AB 5DZNA 1KXQE 3SE8L 3L5WB 3VXSE 3SPVA 4KI5D 2FWOB 3SDXF 5MEPA 2MSPA 4J3SA 4JHBA 3DVGA 5EUKB 2FB4H 3IJHB 5D6DC 3G6DL 1IT9L 2VLRA 3LKRB 1MCCA 4LK4A 4JJ5B 2F53D 2DD8L 3LD8C 2I07B 4JZNB 1A9BB 4DW2H 5GHWL 3EDKA 1I9RH 5GGTA 1MCQA 3CD4A 3SE9L 1TDQA 2AKRB 2J1KA 3LD8B 3BRGC 1KG0B 4QTHA 3KVQA 4KDTA 1AD0B 1IEBA 1B2WL 1IGFH 2Z91A 1MJ7L 3V7AE 4MS8C 1ND0A 4XP4L 1G1YA 4ZUTA 2EIZB 4IRSA 3UTQA 3CXHJ 4D3CH 1QYGH 4UV7L 3WJJC 4LL9A 3MRKB 1QNZL 1NFDE 3RY5A 3QDGE 2SEBA 1YQVL 3QULA 3TYGH 3KPPA 2XN9B 4L4JA 4M6NL 1UM6L 4DN4H 5KSAD 3S88H 4X0KA 5JMRA 1KIRB 4P5KA 3WNMA 3RY6A 1YPZB 3NIGF 4U1IB 1TJHH 3PWUA 4ENED 5GRUL 3RVUD 3QISA 4LU5H 1I9EA 3KPNB 1UWEH 3H9SD 4PGCB 4R0LC 3LS4H 4PS4H 1ZLWK 3V6OC 4TSAL 3F7QA 3Q48A 3P0GB 3VXPA 3RIFF 4AEHL 1HHHB 3SJVE 5IQ7H 2CDFB 3GMNB 2C3VB 35C8L 3V4VL 5GISH 3FJTA 3S4SB 4R0LB 4HUMB 2WMPA 3PGCB 3S9DB 4V1DE 4EN3D 3MLSH 5HHPB 5DMGD 3HPLB 1ES0B 4OIBA 1B0GB 3V5DB 2Y7QB 1TZIA 1A1NB 5E5UB 5TF1L 1RZFH 3CFJB 3BEWB 5DURD 1NGYA 2I25N 4NQEA 5HYIA 2UWEB 4K94C 4FQXA 1A14H 4G6AD 5DUPL 2ZG1A 3B9VA 3SGDH 4XCFL 1MFDL 4ELKA 5KANI 1EMTL 2DLEA 2PR4H 4O51B 4O2FB 1YC8A 1IGCH 3HMWL 2V9QA 1REIA 3HNTH 4L4VA 2DIAA 1CGXA 5DS8B 3GHEL 4GW1B 5JLZB 4AEIH 1JCKA 3V0VA 2MPAH 5LGHH 5KJRH 4LRNH 2YPVL 1UZ6E 5CJOH 4YDVB 5F7EH 1I1YB 4OFIA 3V0WL 5FYJD 4U49A 2NQCA 1M4KA 3RVVC 1ZT4A 2C3XA 4YR6B 4UOW0 4TRPH 5DJAB 4QNPF 1Q9WA 5BV7L 4M1GL 2XWTA 2HJKB 1X5HA 4DZBB 2ITCA 4JLRA 2CLRA 3BPOC 4FP8L 4XPTH 4WU5A 1EO5A 4LMQE 3OB0K 4MSWB 4JZOA 4G6FD 5K9QI 3LN5B 2BOCB 1JGUL 1N0XH 3VXQA 5FOBB 3MRJA 3TV3H 5EC1A 1MJ8L 2N7BA 3FT2A 4NRXB 3BPOB 3NCMA 1XGPB 4KRPD 4R90L 1K8DA 5DRZB 1UQSA 3GO1H 3PV6B 4WTWA 4WI6A 3DX9B 2V2XA 1P6FA 4JFQA 2APXA 2VH5L 2DQEL 3TJEL 3DIFB 2J8OA 3L3GA 4K94H 1IGJB 4RA0C 3C8KB 3HFML 2CJUL 4ZOBA 5J3HC 1AKJA 3UJJL 4QXUL 2WK2A 4NJ9L 1CT8B 2E7CA 4LSTH 1XIWD 3QIBD 3H0TA 4QYOB 1U92A 5FO8A 3BKCL 3VXUA 2HTKD 1NGQH 1EZVY 2IPKA 2H41A 1CICA 3ZDYE 5BRZB 4J8RA 2BP3A 3RA7H 4P99A 1WBYA 3MV7B 1U8OB 3GRWL 5GGUB 4Q9RH 2X4PA 4PG2A 2GEEA 3L9RA 2Y6SC 3LHPL 3K3QA 4ONHA 3LPWA 2R2BA 4GRWE 1JYWA 3O2DL 2WW8A 4XMKL 3V6BR 2IG2H 4ZO9A 4JO1H 1FBIL 3BP4A 4M5ZL 4TVPL 5FUZL 4L1HA 1KNOA 4PLJD 1ADQL 5EU3B 3BH8B 3PWPE 4X6FA 2DQJL 1I3GL 3OBAA 2PUQT 4GAGL 4WUUA 4IRZL 1J87A 3RWGB 2E3VA 3HB3C 2R0KL 5HPMB 3GSUB 2KBGA 2ZUXA 3QQNA 1IC4H 3RZCD 2AW2A 4N9GB 1T22A 1MI5E 1ONQA 4G9FA 4G5ZH 3G5VB 4GRMB 5DUML 1JV5B 2GCYB 5FYLH 5BXFA 3LPFA 3W5NA 3WFEH 4F7CA 3IKCB 4UU9B 4OM1L 3CUPA 5B21A 3RPKA 2D7TL 3PWLA 4JB9H 1H0DB 4PTTB 1KENH 4OZFA 2H6PA 3LDBC 1MHEA 1D5BB 3A6OA 4MDIB 1Z2KA 3BXNA 3LKPB 3MCKB 1AE6L 3MNVB 3MNWA 1CS6A 3DXAE 3H2WA 1O7VA 4M1DL 5SWZA 4J4PA 4KI5C 1II4E 4I48A 2FZ3A 3QJFB 3LDBB 4YE4L 4LIQH 4N0FA 2E9WA 1RK0A 1TZGL 4GBXA 5D7SH 3D1MC 4LPTA 2BNRA 2R1WB 3QUXA 1G9NC 3BRDA 3IDYC 4Q6YA 3UC0H 3NN8B 4GO6B 4W6XB 5KSUA 4X80L 5J13C 4GH7B 4ZFOB 2F53B 2MFNA 4DVBA 4CU7A 3F7YB 4HAFA 1R3LA 4PV8B 4WU7A 3AAZA 3IDYB 5I1HH 2GUOA 3CVHB 4M02A 3CFCL 3ZHDA 1OT2A 5J13B 3FO1B 4N90E 4X9BA 4XNXH 3T1FA 3TBWA 5GS2H 2XA8H 4BFIA 4P23D 2GAZA 1WC7A 4YHLL 3HI1A 4Y1AA 1I8MA 2DL9A 5C6WH 2UZIL 2AEIT 4PJFA 1DFBL 5J0BA 4TUJB 4XNUL 3IJSA 4M6ML 5KSAC 1L7IL 4UUJA 3S4SG 1AGBA 2IH1B 3ARGA 2FJFB 5T3ZE 2OR9L 1TITA 3MV9A 1W0WA 3UDWC 4ENEC 1IKNA 1ZLVH 5E03A 3GSQA 4X9IA 2VZTA 1PZ5B 5KSAB 4HFUL 4X7CC 2UZYB 2Q20A 1JGVL 4Y8DC 2CKBL 2X4OA 4AJ0A 4F57H 1ZAGA 4DGIH 3H9SB 4JN2B 3BIBX 3HMXH 1DN0B 1GGIL 3FONA 4PREB 1KPRB 2WUCH 1S9XA 1UZ8B 4BQCA 3RKDD 3ZTNL 4OIIH 4GLRI 3WE6B 3LKQA 5DMGC 1G9NH 2YMXL 1NLBL 5F9JB 2WWMD 5EU5A 3CVHH 1EHAA 2Q3AA 4HQQL 3VGDA 5DGRA 4LLVA 4MLSA 1K8IA 4NKOB 5IBUG 1S7QA 3LRGA 3N06B 2A6JB 4N1CA 3PQYA 4JY4A 4LFHD 1JPFA 1KEGL 4G6AC 2EDOA 1NAML 2HAZA 3O2WL 1G9ML 3SDYL 5F7DB 1FDLL 2VQ1A 2VSDA 4MNGB 1DBJH 5JW4M 2FO4B 2WWKO 2E27L 4K7PH 2R56L 1MFNA 3ILPA 3MYJA 1C1EL 4G6ML 5IB5A 1ZA6A 5FYKL 4JFEE 4ODHL 2VDRL 3L3DA 4GRWB 5CCKH 4TSBH 4TNVF 1S7WA 4JCMA 1AFVL 4TUOB 5IW1A 4QHUA 1JK8A 5SX4I 3MA9L 1AD9B 4RMSA 1N8ZA 3VMPA 5IB1B 3U46B 1A6AB 2XNAA 5EU6E 4XPAL 5EPMB 1VADA 3X12B 2H3NB 5C0FB 5E4EC 2RB8A 3U0WH 3RUGA 3MRQB 2H2PD 3KLSA 1VA9A 3RVWD 4N0CD 1BAFL 4P2OA 2DDQL 4PRNA 2JLLA 4G6FB 5DK2B 5E4EB 4YUEH 3HCVA 1IQDA 4PLNC 2DQDH 4KTEL 5F7WC 3D3VD 2ATPA 5CFHA 4MB5A 3MJ9L 2E5EA 4L9LA 4TVPE 1BVLB 2ID5A 1JZ6A 4AEFA 1Y0LB 1S7XB 1MWAH 3ARDD 1XIWC 1CD1A 2X1OA 3QIBC 1JPTH 4HT1L 3SOBL 2BXZA 3EDFA 3FOMA 1FVDA 2IBGA 3CCHB 4RFNC 3DX6B 2YKLL 4K7FB 3AMLA 2A6DB 5DD1L 2HT4D 3K74B 4HKJA 3QEQA 1XIWB 3QIBB 4HIXL 5FYJH 2CIKB 1KT2B 3V7AG 3L5XH 4Z0BL 1X4ZA 1RK1B 1MNUL 3TBSB 4RFNB 1N0LA 1CFSA 1Q9OA 2PYEA 5M95B 2DQFA 3GI9L 2AEWA 2J8UE 1I1FB 3Q0HA 4LCWE 3SE8H 3SBWA 4Z7UA 3FN3A 4C56E 4PLJC 4UT9L 3CH1A 1RIVL 1A47A 1MRFL 4BJLA 1FC2D 5D5MB 2GJZA 1JZ3A 1GZQB 1UM4L 3WJLC 3UPRB 4KY1L 3OXRA 1NMAL 1IT9H 3G6DH 4PJCA 4LAQL 4BKLA 2DD8H 5HVFB 1TCMA 4NCDA 1WFNA 3MRCA 5GHWH 1Z5LB 4GXVL 3VJ6B 3QUKB 1YEGL 5I76A 3IDMA 3SE9H 1U95A 2WP3O 2FNBA 3RZCC 5EO1A 4KQ4L 4JKPL 2VUOA 4MA3A 3JSSA 1B2WH 1JGDB 4IIQA 4I0CC 1MJ7H 1XF3B 4P2CG 3RZCB 3C5ZC 3N0PB 4UV7H 3NAAL 1QNZH 5IIEB 4YEFA 1YQVH 1GGBH 2Q86A 4NC1E 5GSVA 1EFXB 1ZEAL 3K8LA 5DYOA 4M6NH 2XY1A 1UM6H 4JEGB 1F3DH 2ZNXA 2FEEL 1A4JB 2FRGP 5FYKD 3C5ZB 3WXVL 2KQNA 5C1MB 2FJGB 1AQDB 4X6DF 4IS6A 1AI1L 5HYQA 4UDTA 5ILTL 1T3FA 1C5DB 4NZTL 4QOKA 4N5UA 5GRUH 5BV7C 2GSGA 2HVJA 4OGYL 2R1XB 4TSAH 2VAAB 3KYOB 1G7QA 3GSOA 5IG7B 4PJAB 4AEHH 1N2RB 4XGZA 3O4LA 2F5AL 1H9VA 1PQZB 5C70A 1OD7A 2X41A 3DYMA 3KPMA 5BV7B 5M94B 3TWCL 2WNGA 3V4VH 4RISL 5JOPE 5I73C 2Z31D 1PZUB 1NBYB 3KNBB 5B39G 3WS3B 2QHRL 3U6RB 5JDSA 2DIJA 3RNKA 5I73B 5E6YA 1UB5B 1KB5A 4L4TD 2AJ3A 3ZHLA 1AO7E 4BSVB 2WINA 4P23C 4PRDA 4KHXL 1T20A 5DUPH 3SGKA 3HRPA 4XCFH 1MFDH 3W5MA 1EMTH 4PJXB 2A74B 5ACLA 4F7PA 1HE7A 1ZLSH 1PFCA 1K4DA 4KV5F 5IJVA 2CDEA 4P23B 3MJ6A 5F7MC 2KZ1B 1SY6A 3W0WE 5D7JD 1DQDL 2YPVH 4Q6IC 1KXTB 5AD0B 1G7PB 3ZE0E 2O5XL 2YZ1A 3V0WH 3O3DA 5ACZB 4MX7B 1J05B 1RJZB 2ZSWA 1YYML 4Y89A 5DTFA 5JHLL 1NANI 1U8HB 2GFBB 5BV7H 4Q6IB 3CDFA 2NTFA 4W6YB 5DVLA 4QGTA 3A6BL 1D5ZA 2JCCF 4M1GH 3HPJB 5HY9A 1NSNL 4NT6B 4BH7A 4UMGA 1A6UL 3RKDC 4LF3B 3HUJB 3IFOA 1WCBB 2J3SA 2WWMC 3T3ME 3MRDB 3LIZL 5IHLB 2NW3B 1YY8A 4RGMC 4NC2B 1JGUH 3H9HB 5HHME 1X6NA 1C08A 2R1YA 4S1DD 1MJ8H 5IOPA 4GRLA 4R90H 3VD3A 1ZK9A 1D5XB 2C4XA 4ONGL 5E9DA 4RGMB 5DFTA 2VH5H 1T03L 2DQEH 2VABA 3TJEH 4U1JB 3MZGB 1KTDB 4X4ME 2C7UB 4OGZA 5FIEA 4FABL 4Y5VC 5DRWA 3HFMH 2CJUH 1M05A 5GIRA 1Q94A 4BM7A 4R96B 3UJJH 4QXUH 4U3HA 5CGMA 3L5JA 4YXKL 4NJ9H 3LPGA 4H8WL 1DJSA 2DLFL 4Z78A 4FNLL 1VDGA 5F6HI 2J8UB 4C4KT 4Y5VB 1UVQA 3LSOA 4WTZG 4M8VA 2A9NL 2V9RA 1YEKL 4QF1B 5DJ2B 3VD5A 1VCAA 3GRWH 3LOWA 5K33A 3LHPH 1NCWL 2Y06L 5F6HJ 4DWHA 3HZKA 4HIIA 4C83B 4WWID 3PNWB 5GGVL 4DUXA 3EO9L 4PY7A 1JMXA 4XMKH 3EO0B 5KAQG 1HXYB 5EZJB 1FBIH 4F9LC 4M5ZH 5FUZH 2H2PC 1EEZA 1ADQH 4PJEE 5H37G 1U3YA 3FB5A 4IOIB 3FB7B 4UQ2A 3FQWA 5I1CH 4JRXD 1CG9B 5T1KD 3I75A 5C71A 2QHLA 2DQJH 1I3GH 2OJZL 4GAGH 3N1PC 5HGHA 3TBYA 1GSMA 2R0KH 3O6FA 1X3DA 4PJBE 5DLML 1NEUA 2A73A 5DJCA 1S9VA 1KIQA 5MI0C 3TBTA 3D3VB 5DUMH 3DRTA 1MLCA 3BI9X 4OM1H 1NFIB 2BC4A 1KPVA 5JTWA 3KXFD 1HHGB 3JWNC 4R4ND 2HT4C 2WV3A 2D7TH 3VRIB 5MI0B 4FMFA 1A1OB 4HWBH 3OPZH 5FUCC 5E56A 4LNRA 3EYOB 4MQSB 1QO3A 1GGCL 1RJLB 1AE6H 1YEJH 2BNUA 4N1EA 2C3GA 4ZUVA 1INEL 3MRGB 1KTRL 1S5HB 4M1DH 3RWFB 3L6FA 3TPUB 2K7PA 3OJDA 4YE4H 5KSVB 2PTTA 5AAMA 2JJTC 3TCLB 1TZGH 3RL1A 4U6XB 2FHCA 4HGMA 4ZAKA 4ZS7L 2W07A 4LGSB 1JE6A 2CKBB 1MH5A 4DFHA 2P43B 5IQ9A 1KYOJ 4UNTA 4HDIA 4UI2A 3PWVB 4X80H 2HRLA 3BUYB 1FPTL 2UUDH 4N68A 4NWTL 5ESQB 2YD1A 3RX8A 4JFPB 3CFCH 3KYNA 1DUYA 3EDDA 4ZXBA 1WVZA 3FB8A 1EHXA 5C07A 4LPWA 4XPFL 1DQJA 1RHFA 4JRXE 3GMRB 1HOCB 2CLVA 4YHLH 1NAMB 2X1XR 2NW2A 3KHOA 3REVB 1OGTB 1DFBH 3V7MA 5DRNB 4L29B 4HWEL 1LE5B 4XNUH 4M6MH 1L7IH 4CADB 3BT2H 4U1MA 1TMCB 3S35L 3X14B 1CDGA 5ID0A 1A6ZA 1MCDA 1T7WA 2OR9H 2X4UA 4HCRL 4BSWA 3GB7A 3UZVB 5HYJA 1BQHB 2NNAB 3MC0A 4YPGA 5FGCB 4HFUH 5ISZD 1XGQA 1XF2A 1MCBA 3QO0B 1EEYA 1JGVH 1U3HA 3LV3A 3X3GL 2CKBH 2QSTA 4P3DA 2DQIL 1GGIH 1S7VB 4MQ7B 4QRUB 3QG7L 1LEIB 1X5XA 2Z31C 1P2CB 5HYSB 3MRMB 5D2LB 2VR9A 4LPVA 1YN6A 3ZTNH 2X7LB 1A6WL 4NFCA 5DD6B 4RFEA 4LCCA 2YMXH 1ED3B 1NLBH 4XP5L 4HQQH 4U7MA 15C8L 3WFDL 5I9QC 1WZLA 2Z31B 2GJ6A 2PO6C 5ABDE 3D0VB 1G84A 3CZFA 1KEGH 1HINL 4NQUA 5C0EB 3WO4C 1NAMH 2ZUSA 3O2WH 1G9MH 2OL3L 4HAGA 1I8LC 1HQ4A 3M1BB 3SDYH 5I9QB 1RZ7L 4L4TB 1FDLH 2PO6B 1CLZH 4N1HB 3J7HA 2BVPB 1WBXB 3D9AL 2JIXD 3WO4B 2E27H 4WW1B 2R56H 5D7JC 1MJJA 1C1EH 4NQCA 1P7KA 4G6MH 4HXAL 5FYKH 4ODHH 2PW1A 4PJ9D 2AJXL 5D93C 2VDRH 4PRIA 4ZO8A 4M4PA 1QA9A 4ZNEE 4GKZA 1P84K 5D7JB 1AFVH 1DEEB 3U0TA 4I5BA 2X6MA 1YEFL 1HILB 3MR9B 5D93B 1MAJA 4OV5A 3L5WA 2F58L 3QIWD 1UJTA 2XZQL 3RHWF 2DKSA 3MNZB 5E5MB 4LFHG 4PP1D 3AS1A 5IT2L 3RFZC 4JRYD 4XPAH 2AJYL 3BUTA 1BD2E 4PJBB 1QLFB 3MGAA 3O3AA 3DI2B 5EUKA 4MXWL 4LSSL 3ZYJA 3UMTA 1XZ0B 1U8MA 3IAPA 4XCEA 3MRLB 3MX0A 3BYYA 3VE0B 2XOTA 5LWYL 3SGJA 4E41D 2DDQH 3P40A 1A9BA 1EEQA 3TO2B 1NCCL 1HI6B 3QCUL 1QACA 5EUOB 3S5LB 4KTEH 1T0NB 3KR3L 4Y2OA 1AJ7L 2AKRA 2IPUG 3MJ9H 1KG0A 2CD0A 5EG6C 3OJ2C 2IEPA 1FVEA 2JB6B 1H3PL 4HT1H 3SOBH 2PCPB 2BRRL 2GHWB 4XX1E 3T2NL 3OAZH 3RIAK 5SX5K 2YKLH 3IDGB 4M7KH 4AIOA 1MIEL 1S8DA 5A40E 5DD1H 4BH8B 2E8ZA 4HIXH 4DGYL 4EIZC 4PRHD 4Z0BH 1MJUL 2VZSA 1W72A 2X4TA 4WFHE 3WJJA 4R7DB 1KIRA 1MNUH 3D39E 4XMPL 2ADGB 2AV7B 1YPZA 2HVKA 3GI9H 3ZDZE 4U1IA 5I0ZA 1AGCB 1IAIL 4CN1A 4YFEA 3PGFL 3D48R 3PDOA 1YNTA 3RPIB 4UT9H 1RIVH 2FATL 1MRFH 2HN7B 3MGTB 1MLBB 2F74B 2HFFA 2XI9A 3SE4C 1UM4H 2CDFA 3GMNA 3KLAB 3ZSSA 1NMAH 1H8NA 4LAQH 2YC1B 2AJZA 3S4SA 4OZ4B 4R0LA 5AWNL 3V6OA 3SDDA 1J0IA 3PGCA 1NCBL 1T83C 2EYRB 1NBQA 1FZJA 4JRXB 5T1KB 5LG1A 5HHPA 1DBBL 5DGQA 3UAJC 2BSED 3V5DA 4KQ4H 4JKPH 5JIKA 4ZO6A 3VA6A 4OI8A 3CSPA 4Y7MA 3BEWA 2MQCA 3JBG7 2PXYD 5DEFB 1QSEE 4OF8A 1AY1L 3NAAH 4O51A 4R4NC 5LQBL 3BN9D 4PFEA 4XH2B 2XKSA 3GIVB 1ZEAH 3BYTA 1RFDL 4RAUB 5DS8A 4FTVE 2P45B 3WXVH 3KXFB 3GJEB 4PJIA 4YDVA 1M71B 1K2DA 1I1YA 1AI1H 4NO5A 1U8LA 5ILTH 2WBJA 4NZTH 4PRPE 1ZLUH 3LKOA 1NCNA 4OGYH 2CIIA 4G8IB 4YR6A 2ESVE 2FLBT 3D85D 2X70A 4EXPX 5BZDB 2F5AH 3TC9A 4N0UE 4D0BA 1MY5A 3TWCH 3WNKA 3TA3A 5IVOA 4RISH 3U7YL 3NFSL 3PWNB 4TYUA 3BO8B 2QHRH 1RULL 3H3BC 1G7HB 4KK9D 4IOSD 3HHRB 1HZHL 1XGPA 1T1WB 2IANA 3L3HA 1BQHG 1MVFA 2R2EA 3PV6A 4X7FC 3DX9A 2EDWA 3DIFA 3I6LE 1A21A 3ZMRA 3NCCB 4H8WC 2F19L 5GGRA 5FEBA 1R3HB 2JE8A 1CFNB 4I0PA 5BS0D 3AS2A 5IR1B 1BECA 5HYSG 4JPIA 2G2RB 2LU7A 1DQDH 1YJDL 3QO1A 4NOBA 2O5XH 3VXSA 4DTGH 5DK3A 2VLMD 1DBML 1I7RB 4JQIL 3WFCL 1VGKA 3IU3B 5GGUA 1YYMH 3O6ML 5JHLH 4MAYA 1NUFA 4KJQD 5ISZB 3A6BH 1CXHA 2YRPA 1OW0C 5CEXB 3PP3H 2OTPA 3SDXE 5D2NE 5IGXL 4CMMB 1HQRA 4K9EL 4EVNA 5L2JB 3LIZH 4I13B 5EU3A 2O5YL 4O58L 4YHYC 5F97E 2P8LB 4YHKL 5EN2B 4XRCB 4JFFD 3DNKA 3W82A 5J8OA 5MEND 4Z6AT 3MLWL 3WHXA 5DK0B 3RWGA 2BCKA 4PPTA 1IAOB 4ONGH 4I0KA 4YHYB 2I5YL 1Z9SA 1NFDA 4P49A 5HPMA 3QDGA 2ZUYA 4X5LA 1T03H 2EH7L 1HH6A 5CBEB 4YQXL 5FO9B 3HR6A 4FABH 2A6IA 1XGTB 3FQUB 2D03L 4JKLA 4PLKD 4GRMA 1N5AB 4HLZH 2GCYA 2PETA 4KMQA 4MJ6B 4NHUA 4YXKH 3AFLA 4PYHA 3TFKC 2DLFH 4UU9A 2A9MH 4FNLH 1F3JA 4PJ9C 1AHWA 2NR6C 2JIXB 1OF2B 2IALB 5EWIL 4KKAD 4PTTA 5EULV 2A9NH 2NY2D 3SKJL 3QHFH 4RMRA 1YEKH 2CR3A 3BMWA 3LKPA 3MCKA 4AL8L 4UOJA 4PJ9B 3KYAA 3NIGE 3SJVA 4H0IA 1NCWH 2EDEA 4R4FL 3QIWC 2Y06H 4KK8D 3NACL 2LABA 3P4NA 4PP1C 5GGVH 1L9NA 4ORGA 3BZFB 4RQQB 3S36X 3GSNA 4HEPG 2A38A 4QTIL 5T1DL 4DOHE 1J0HA 4LLQA 3QIWB 2XQYK 3ILQD 1OSZA 3ULUF 1LHZA 4LHQB 3K8KA 3TO4A 4UV4L 4ALAL 2OJZH 3NN8A 4H5SA 2BOBB 3P30L 3QZWB 4Z7WF 3ARBD 5DLMH 4E41B 4RWHA 3F7YA 4X8JA 3VFMA 5TH2B 4PV8A 5KVDL 4YGVA 3CVHA 3UTZB 4M6OL 1U8IA 2IQ9L 2E6JA 1FYTD 3FO1A 1CXEA 1G7IB 4FTVB 2X10A 5CIPA 4OF3A 2IBZY 4FQLL 5ITFB 3QDMD 5DMJB 1O0VA 1YMME 2MOVA 4PRPB 3V4PH 1SM3L 1QD0A 2IFFH 4P2QD 5B39A 3OZ9L 1FRGL 1Q72H 5GPRA 5FDWA 2FJFA 1GGCH 3MRBB 1INEH 1T7YA 5CWSB 3CSYA 1PZ5A 3DURA 3OB8A 3MRNB 2AEQL 4D9QD 1OTTD 4WHDA 4QNPE 1RZKL 4XVSL 2APWA 2X9WA 3QNXB 1Q9KB 4NN7C 3VW3H 1BIIB 1JZ7A 2IBBA 2HJLB 5FGBC 3H9SA 3MRHA 4JN2A 4WW2F 1DN0A 4JGJA 1CE6B 2YHGA 4ZS7H 3GKZA 4PREA 1FZMA 1KPRA 2VERN 1AIFB 1UZ8A 4OQTA 2IPUK 1EAPA 2CK0L 3FTGB 4KRLB 4NN7B 5DRXA 3JTTA 4YX2L 1BOYA 3QXWA 4NWTH 2OSLB 1A6VH 2D7QA 5JHDD 4YNYA 2AXHA 4Q0XH 1DR9A 2NY7H 4H1LH 3RNQA 5C9JA 1BJ1H 4N8PA 3VXMD 1AGFA 4YAQA 2PXYC 3OX8B 5I16B 4M9PA 3BN9C 4XPFH 5F7DA 3ZSTA 1I8IB 5IVXF 2OL3B 2R23B 2ZG3A 2HH0L 4LKCA 4Q9QL 2PXYB 2FGZA 4YXLL 4ZUUB 1FL3A 4MCYA 3S35H 1YDPB 3OKKA 4NO0D 1VGEL 4UDUB 3GSXA 4HCRH 3KS0H 3M8OL 4HZLB 1H3UA 1FYTE 2IAMA 3DO7B 5EIVA 4LSRL 1Z9MA 1F3RB 1MRDL 4X8XA 1IZJA 1AD9A 3X3GH 4FQ1L 3PWPA 5IB1A 2JELL 2Z8SA 3QWRD 4W70A 3U46A 4PJ5D 1BFTA 2DQIH 5HTSA 3QG7H 3D85B 5H94B 3X12A 2H3NA 1QFWM 3EYVB 4KK9C 1A6WH 2LVCA 1E6JL 4WEBL 4WTZA 3IGAB 5KS9F 5FV1L 15C8H 3WFDH 1MI5A 4P5TD 5GZOD 2CMRL 4NBZB 5F8QC 4XNQA 5EU7E 4CGTA 5GGRY 4F37K 2B0SL 1WJ3A 4KK6D 5INCA 4MB4A 1HINH 2D0HA 3PHQA 4PBWD 1MCKA 4JY5L 4EIGB 5D7LE 3UPCA 1RZ7H 2DB8A 3QUML 4U1LA 1CFVL 3OJVC 4Y5YC 1TXKA 3UCRA 3P9MB 1LDPL 2GY5A 3D9AH 4XBGB 1NDGB 3T09A 2EXYD 3DXAA 2CGRL 3HC3L 4HXAH 3I84A 2G5BB 4Y5YB 3CJJA 2Z4QA 2QTEA 2AJXH 2OK0L 4K7FA 1SJVA 5BS0B 5L88L 4KGJA 1XIWA 3QIBA 5EA0L 4DOHB 2K7QA 2ZOKB 4KJQC 3TBSA 4H25B 4MZ3A 5FFLA 5EBGA 1A7NL 5HPOA 1YEFH 1HKLL 1NKOA 5CZXD 3U30C 3VDCA 5C8JB 4XX1G 4O9HL 1CD0A 2ICEB 2P47B 2F58H 4YDKL 2XZQH 3MRIA 1JGEA 3ARSA 2VXSL 2R0LL 2VLJD 3KYMB 1ZSDB 3SQOL 4BK4A 5DC9B 5A2LH 4OIAA 1HH9B 5GGTL 1CXIA 4MXWH 4LSSH 3U30B 1A1MB 2UYLB 1RJYA 4XXDB 4L8DB 1C12B 5C86A 2PNDA 5LWYH 4HIEB 3NZHL 3LKSB 3TH2T 3VJ6A 4PJ7F 1NCCH 1MCEA 4JQXC 3ARVA 3QCUH 5E00A 4JFFB 3WJLA 3KR3H 4EUPG 1AJ7H 2OTWA 3PGDB 4M9OA 2B39A 3WUWG 5MENB 5C0AE 5FKPB 1FIGL 1QVOB 2PKDA 4OLWL 1FNSL 1PG7X 3RWIB 5HYEA 1XF3A 3NH7L 4HUWB 1SQ2N 2J88L 5DFVC 3RZCA 1ODAA 3CFKB 1EO8L 4YH6A 2BRRH 2CO7B 4NQDD 5DVNA 5IIEA 4KKAC 3T2NH 2NY2C 1SJEB 1EFXA 1DQML 1AGEB 1CYGA 1UCBL 2DWDB 3OJMB 4TNWK 1MIEH 2XG4A 4FQQB 1A4JA 4DGYH 1WGOA 3C5ZA 1MJUH 1ORSA 2FJGA 1AQDA 3FQRA 4KK8C 2NY2B 4XMPH 3QZWG 4KUCD 1HSBB 2F8VA 5F44A 1IAIH 3A67L 1GGYA 1DSFL 2DTSA 3PGFH 1CR9L 2PTVA 5FF6B 1U91B 4P4RB 2VAAA 3KYOA 2FATH 3F5WB 3ILQC 4G8FB 4MXVF 5IG7A 1NAKL 4PJAA 3HNVL 3T77B 4QT5A 4XPBL 1EJ6A 2RCSL 3OAZK 4D0DA 5AWNH 1WV7T 1NCBH 2HT2D 4UTBH 3ARBC 3VGBA 3WS3A 1YQ2A 3FCTA 3U6RA 1DBBH 3V5HB 4NPYA 1FJ1B 4JDZB 3K80A 43CAB 2P24A 5IKCB 3ARBB 3IS1X 1XR8A 3AY4C 5IHBA 4YIQB 1OAZL 4JFEA 2CKNA 3IDJB 1AY1H 4BFGA 2IQAB 1FYTB 4CJ1A 1EAJA 4P23A 1RFDH 1YJDC 1A7RL 3IS0X 1CF8L 5AD0A 5L7XL 3VFWA 4P2QB 4KGLA 1OTTC 5EU7C 2Y72A 3AROA 5EU6A 5JR1H 2H8PA 5HGBA 4IOFD 4OCRL 1S5IL 2ADFL 4RX4A 3R06B 4F7TA 4ZSOE 3N1QC 1RJZA 2NY5L 1U3ZA 1U8HA 4NQDE 4H26A 1FLTX 2GI7A 1AXSB 4I3SL 3V5KB 5LKNA 3GRWA 1QEWB 2VLRD 3DTXB 3HPJA 3REWB 4YDJA 1T7ZA 5HI3D 4K9EC 3X13B 2XWJB 2Q6WB 3C6LA 3OAYK 1WCBA 3U7YH 1ZV5A 3NFSH 5DUBA 5EIQA 1Q9LB 5BOPA 1BBJB 2X2YA 3RJQB 3O2DA 1G7LB 1OY3B 4LLUA 1RULH 2NW3A 3V6ZB 3FL7A 2ADIB 3QQ4B 4R2GD 1P7HL 1HZHH 3EOAA 3OR6A 1NDMB 1Z3GH 3C08H 4JFYB 1A9EA 2B2XL 3VCLB 2W59A 3T8XA 3DHMA 4A6YL 4PJDB 1ZLUK 1X44A 1JP5A 5I1DB 4K2UH 5JHDB 2BNQE 4IRSD 3HZVB 5L8JB 4L8CB 2KDGA 3VXMB 1KTDA 2GSIB 2C7UA 2F19H 4NBXB 5E1AA 4ELMF 3LQZA 4R96A 2X44D 4QRTA 2LE9A 3Q6FA 2HYMA 4EBQL 1ROWA 4YJZL 5T5FL 1J8HE 2J8UA 4J3XA 4LCWA 1YJDH 3VFRB 3HR5B 3IF1B 4DKDC 4HG4J 4C56A 1DP0A 5DJ2A 1ZHNB 5FM8A 1DBMH 4O02L 4DGVL 4JQIH 4NO0B 3WFCH 2EE6A 3AC0A 4E5XA 1GOFA 3ZTJG 3O6MH 4CNIB 2XKNA 5D7IF 4C83A 1KEML 1F8TL 6FABL 1MCLA 2VISB 4ONOA 5CHNA 4NQSA 4KVNL 1WEJH 4GQ9L 5KOVC 3KJ6L 4PJ5B 2EDNA 4K9EH 2O5YH 4O58H 4P5TC 2P8PB 5C0AB 4YWGL 5GZOC 4YHKH 3GGWB 1AGDB 1CG9A 3IFPB 3QXVA 4KK6C 2P5ED 1CL7L 2BJML 5I75C 4FQXD 4P5TB 3R4DA 4Y16D 5F96L 1RV6X 1SVZA 5IBLD 2EH7H 4YQXH 4GW5B 2D03H 1N6VA 2EXYC 4BELD 1RUKH 2LQRA 5TQ2L 5I75B 5JPNB 3VFSB 4X6EB 5DT1L 2GTZB 4PGEB 4UIKL 1NJ9B 5AEAA 1NFIA 3QXUA 5JPMB 1HHGA 5EWIH 5I1GL 3SKJH 1JRHH 2X4QA 3SKUD 4L9DA 1IQWL 4P2RE 3EYOA 4AL8H 4X6DE 4WV1A 1RJLA 4Y4FD 5CZXC 2VDMH 3PF2A 4MLIA 4R4FH 1XCTB 1S5HA 1RZKC 4ZDHB 3NACH 4X9GA 3TPUA 1TQBC 3VFGH 5BVPL 5C0JB 2BVOA 1AXIB 5KSVA 5SWSD 3CPLB 4N0RA 2DS4A 4QTIH 5T1DH 4U6XA 4LHUD 5KVGL 5ALBL 3UBXB 1TQBB 3U2SA 4KUZL 3TT1L 4X99B 4LLDB 4UV4H 4ALAH 1WAAF 4FXKB 3CMOL 4JZJC 3P30H 2DQTL 3U4AA 1KB9J 4JM2F 1MCWM 4QHMA 3SKOB 4JFPA 3FOLB 5C2UB 5KVDH 4M6OH 1V5JA 2CK2A 3ABZA 2C5DC 2IQ9H 2EDQA 1LP9F 1AKJD 4JZJB 1I4FB 4WNQB 2Q3ZA 1KCSL 1OGAE 1P9MC 3W0WA 3C09C 1LK2B 1IGTB 1HOCA 4FQLH 1KCUL 1NAMA 3REVA 4KV5E 2OI9C 1CICD 5DRNA 4L29A 1SM3H 4R3SB 3OZ9H 4CADA 3E6HB 4NQDB 1FRGH 3AGVA 3C09B 3VMNA 4LLMB 3RWHB 2VXTH 4ZYKA 2OI9B 1BQHA 2NNAA 2EICA 1EPFA 2AEQH 4JFOB 5EOCL 1RZKH 1IILE 3QO0A 2ILLA 4XVSH 3K46A 4K3JL 1H15A 4I4WA 4BZ1L 3GK8L 1FFOB 1JWMB 1SJXA 4BQ8A 2JCCE 3RWDA 5JOFB 5C09E 4MQ7A 1I3RB 1FZKB 3U1SL 2JJSC 5E70A 2HT2C 2IADB 5HYSA 1YN7B 2YPKB 3EOBB 1UACH 3I3EA 4YX2H 1UM5L 3WFZA 3DRQB 1ED3A 2D7PA 2KQMA 4ODUA 4X4MA 3DYOA 1T21B 2Z31A 3LAFA 3WS6C 3BEVB 4KMTL 1T0MB 4G9FD 1A3RL 5BQ7B 4AENA 1F00I 4EEEA 5GRZA 3R1GL 1JZ8A 1PX3A 4O00A 2KKQA 4LDLB 2PO6A 1J0YA 3CFIC 4DK3A 1WBXA 2ARJB 4OQ1A 2J5LC 2HH0H 4Q9QH 1XH3B 4PRAA 3QUMB 4YXLH 4WW1A 5ENWA 3T0BA 4XBEL 4JCLA 3MGOB 2D3VA 3GI8L 1B4JL 1VGEH 1TCRA 3M8OH 4MMXC 2AK4E 3QR2A 4Y19D 5SWZD 4J4PD 2J5LB 4IOFC 3FQXB 1KCRL 1QFWI 3PL6A 2G5RA 4PJEA 1MRDH 1E4KC 3NBNA 3MR9A 4FQ1H 2WBWB 4NM4L 3T2QA 5HI3C 3SPVB 2RQ8A 3IFNL 2BNRD 2YRZA 5E5MA 1D9KA 1DLHA 1IGML 4M3KB 5DHXB 3NVQA 4OZIF 2ZCKL 4PJBA 3FN0L 2VLRB 4R2GC 5C0IB 5I2IB 1E6JH 3E8UL 4WEBH 2QJDA 4KDTC 3VE0A 2CMRH 5CJ8A 3BWAA 4FFWD 3NPSC 1VFAB 3ARZA 3OXSB 2G75A 5IEKB 1HKFA 3RWJA 4IRSC 2B0SH 3N85L 4R2GB 4IDLA 3V2AR 3DO3A 5I8CB 5D8JH 4LLAA 1IEBB 4Y1AD 1BQLL 3O45B 2R29L 2YK1H 4B7LA 3QUMH 4CL7A 2Z91B 2VWEC 3NPSB 4JRWA 1V05A 1CFVH 2WIIB 4QHLB 4S1RL 1ND0B 1W0VB 4NHCL 4ZUTB 1LDPH 3DOSA 4IRSB 3UTQB 3Q5OA 4TQEH 2JB6A 4Q58C 3EGSB 3L3KA 2SEBB 2CGRH 2PCPA 3HC3H 3QULB 2BHUA 3KPPB 4JGUA 3MV9D 4HS3A 3STBA 2CXKA 5L88H 3A0OA 3O3EA 4P5KB 5EA0H 5ALCL 1OB1A 3U36A 5CGTA 4HZAA 1A7NH 1BMGA 1KUMA 2ADGA 2AV7A 3ULVL 3K8MA 1HKLH 4KZEL 2BVEA 4O9HH 1AGCA 3BSZL 4YDLC 5FYJU 4YDKH 2W0LA 1VEPA 2VXSH 3VXPB 2R0LH 3RPIA 3ALPA 3SQOH 1J9CT 3MGTA 1FNFA 1BF8A 3DPBA 4LKXB 4RDQF 2F74A 3VFTA 3VXNA 5AZ2L 5GGTH 4Y19E 1KCVL 4YDLB 1BX2A 5TDOA 2VJXA 1LO2L 3NZHH 1DANT 2GT9A 2X4NA 5DDHA 4FQXC 1OGAB 2MQ0A 4Y16C 3QFJE 4Y2DD 4JRXA 4Q7DA 5IBLC 4OBSA 4NRZA 5F1KC 2P5EB 3S96A 1NGYB 1FIGH 4OLWH 4AM0B 4FQXB 1FNSH 4Y16B 2EC9T 3NH7H 4ELKB 3GMOB 2J88H 5DEFA 4NUJA 3TNMB 1EO8H 1WZ1H 4PGZA 4QXTB 4XH2A 4U6HA 5DHYA 4BQ6A 3GFUA 5DMIL 3GIVA 3GHBL 1DQMH 1VESA 1UCBH 4EJ1C 4RAUA 3UBXG 4R7NA 4Y4FC 1T2QL 2HLAA 3KXFA 5DHVA 5F6IC 1ZANL 4Z77B 4MXQD 2NY5C 3FRUB 3A67H 2ED9A 3VH8G 1DSFH 1Q9WB 4Y4FB 4OCSL 4G8IA 1UJ3C 1CR9H 1KN4L 1GPOL 3W39A 4F7EB 3MROB 5F6IB 5EO9B 1CBVL 5TGBA 1UWXH 1NAKH 1OCWL 2EDTA 2ITCB 4W4NA 2X89A 5ID1B 4JLRB 3I02A 4XPBH 4WU5B 5SWSB 2RCSH 2F54E 1UJ3B 1IC5L 5BW7A 4MD5A 2YD7A 4LHUB 2AAVA 4BQBA 3IVKB 2N1KA 2ZUTA 3VXQB 1G7HA 3MRJB 5EC1B 4LDEB 3FT2B 1A22B 1K8DB 5DD5H 2IJ0C 1MVUA 4LGPB 1UQSB 5E0QA 1MCHA 2W91A 2V2XB 4I9WD 4FHBD 5F1IA 3BOVA 1DQLL 4NZRL 1N6UA 3RQ3A 5TF0A 1OAZH 3L3GB 4A6YB 4GW4A 1CU4L 1CICC 2JJUA 5JA8B 1MFCL 1SY6L 3UTSE 1AKJB 3BFOA 4ZNEA 1IC1A 1BFOB 5GS0L 3W11C 5DVMA 3H0TB 4PG2C 2FX7L 5FO8B 1A7RH 5C7XL 2G2RA 3RUGF 4F9PA 4J3VA 1CF8H 1CICB 1T2JA 2PYED 4TTGA 4J8RB 1IL1A 5L7XH 1IAIM 4QHNB 4DQOH 3VRJA 2EDJA 5CD3A 4J6RL 2BDNL 1BD2A 2X4PB 1I7RA 1S5IH 2ADFH 3JXAA 4OCRH 1UWGL 5FM5M 1QSVA 3IU3A 1MCPL 1C5BL 2NY5H 3ULVD 4ONHB 4IEFB 1PLGL 5LBSL 3SKMA 3AS0A 4I3SH 4JPKL 5FCUL 2AGJL 5CEXA 5BZWB 4CMMA 1DBAL 1P5VA 1NC4D 2O93L 2H9GB 3L7EA 2DTML 3L3OB 5EN2A 1OW0A 4XRCA 4NZDA 3GMQB 4NFBA 3RBSA 1KV3A 4PJ8A 2B2XH 4M00A 2V2TA 1IAOA 1ORQA 1S9YA 3QT2A 1A3QA 1L7TL 5EZIH 4PD4J 3UTPE 1BM3L 1T22B 1ONQB 2APBA 4G9FB 5GJSL 4F58L 4YGAB 5FO9A 3NFNB 5BXFB 4Z7UF 1AP2A 1HN1A 3C6SB 1N5AA 4LLYA 2X9XA 5D7KE 5DF0A 4F7CB 1U42A 4LEXL 1ZA3A 2ZJSL 1R5IA 3DX8B 4HIJA 3PUCA 3RAJL 4AEEA 3D39A 4GLRH 4C59B 4R8WL 5T5FH 4J4PC 4JDTH 2JIXA 1OF2A 1F6AB 1UEYA 4CUCA 4OLYL 2H6PB 4X7EC 1MHEB 4MWFB 4I9WE 2YD3A 3BXNB 4QOKD 4HK0A 4ODTL 5IB3B 3F6LA 3MNWB 4O02H 4UQ3A 4EUPA 2J8HA 3HS0A 3WUWA 4ZTPL 1NL0L 4Y19B 3B8SA 4I48B 2FZ3B 3O4LD 1KEMH 4N0FB 1F8TH 6FABH 3BZFA 4JFDE 4RQQA 2V17L 2YN3A 4KVNH 2NLJA 4M93C 4O2EA 4GQ9H 1F2QA 1LO5B 3KJ6H 4AQ1B 2DKUA 4F80A 3G9VA 2BNRB 4YWGH 3T4AB 1X5LA 2D31B 4M93B 1CL7H 4DVBB 2BJMH 1QSEA 3QZWA 4NGHL 1R3LB 1EX0A 2AQ1A 3TH4T 1QKZL 4WU7B 3AAZB 5F96H 5SX4H 3S97C 2GUOB 1JFQL 3QDAA 3KPSE 3T1FB 3TBWB 2W60B 4FTVA 1G7IA 1G7MB 3ET9F 5TQ2H 3NOIA 4Y1AB 4MDJB 5DT1H 5KSBF 4OZFH 4LSPL 4I18A 4UIKH 3L3JA 1IKNC 5CD5D 2Z8VC 1ZVYA 3IJSB 4QKXB 5GS0D 1A0QL 4PRPA 1AGBB 4ZFGL 5I1GH 1E6OL 2ESVA 2HJFB 3MRRB 1FFRA 1IQWH 2OMBA 3MV9B 1W0WB 3WSQL 3GSQB 3OKOA 4GUPA 4OLUL 4N0UA 4RGND 2F54B 3MRNA 2P46B 5BVPH 3SDAA 3QNXA 2VLKE 3FONB 1CE6A 5KVGH 2X09A 5ALBH 5HHOE 3TT1H 3LKQB 4Y2DC 3S6CA 2ZNWA 5EU5B 3FTGA 3CMOH 2XTJE 4LLVB 1K8IB 2DQTH 1FNGA 5E9DD 5E6IA 4GKOA 3WKNA 4LNVA 4XP1L 1JPFB 1MREL 4Z7VF 3BP5A 4Y2DB 2NZIA 3MLVL 4YFLF 3TVMA 5B3JE 5I16A 1U41A 3AU1A 3FFCE 4NO2B 1KCSH 2VQ1B 3DSFL 4KJWD 1S7UA 1KCUH 3CU7A 4BZYA 3MUGA 1I8IA 1I7UB 3BZDA 1M6OB 2OL3A 5HHNA 7CGTA 4TULL 3A6CL 2XWBB 1K4CB 1ZT7A 1ZA6B 4ZUUA 1ZGLM 2WAHA 5CEYB 5ESVB 1XR9A 3WIIH 1YDPA 3L3DB 4LHUG 5FM4A 4MXQC 3IB4A 4HZLA 2J4WL 1T1ZB 3DO7A 3SDXA 5D2NA 4M7ZC 4QHUB 3VGAC 5EOCH 3IAQA 1FH5L 2OQJA 1N8ZB 4BZ1H 1SYSB 2DLHA 2QQKH 2Y9RT 1EXUA 2CSPA 2XNAB 1VADB 4M7ZB 3U1SH 3VGAB 4ODWB 5H94A 1PY4A 3K2UL 4AMKL 4U0QB 3R8BB 4G6KL 1MCSA 5T5NF 1UM5H 5FA4A 4L9LC 4OM0L 4HH9A 4MVBD 3HCVB 4KMTH 1A3RH 3X3FL 3R1GH 2ATPB 5E2UH 1X4YA 4D9RD 4UIMA 1I9IL 5JIHA 3FOMB 2Q8AL 4WI4A 1FVDB 3B5HA 1NUDA 1EJOH 4XBEH 2NMSA 2WQ8A 2BSRA 1B4JH 3GI8H 3MLRL 2VTFA 2G5BA 2IH3A 4HKJB 3V8OA 1WIOA 1OAQL 3G5YA 1KC5L 1KCRH 3ULVC 3DJ9A 1CFSB 4PG9A 2ZOKA 5GGVY 2IMMA 4TNVK 5FYKU 3L1OL 4QEGA 5HDQL 4NM4H 4YEEA 4NUGL 4ZAKD 2ICEA 1OM3L 2XIDA 4OD2B 2YD4A 4TOYH 3IFNH 3CH1B 1LK3L 1IGMH 2GKIA 1ZSDA 4QGYA 4AT6B 2GJZB 2ZCKH 1OP3K 3ULUE 1HH9A 4PJCB 4BKLB 4U6YB 3LS5H 1A1MA 2YBRA 3E8UH 4D0CA 3BDXA 4L8DA 1C12A 3MRCB 1OT1A 1PKQE 4HIEA 5I76B 1NC4B 3BP6B 3E0GA 4KFZC 3IDMB 4Z7WE 4ZXBD 3N85H 2Q87A 1NANH 5C07D 4P59L 1WFOA 4RFOL 3EBAA 1F6FB 1BQLH 2R29H 1TJIH 2VDOL 5FKPA 3QRFM 3ZT5A 5E7BA 1QVOA 4HUWA 5CUSL 3MO1A 3F65A 1YEIL 3CFKA 1GGTA 5GSVB 1W72L 4JY6A 3WDJA 3OB0H 5HYJD 1MCJA 4XVUD 1AGEA 5F7UA 1KXVC 1A7QL 3J8F7 5I1JL 4FQQA 5ALCH 2VLKB 1Z9OA 2XTJC 4IS6B 3ESUF 1U3HD 5HYQB 4UDTB 1PW3A 1VKXA 4QOKB 3AS3A 3ULVH 4GG6B 2GSGB 3T04D 2HVJB 3ZYIA 2EC8A 3BSZH 2APFA 3AUVA 3MLXL 5FF6A 1G7QB 2B4CL 4P4RA 4G9DB 2XTJB 4EKXA 4XGZB 4XVJL 3KPLB 1FFNA 3R0NA 3KPMB 4WI7A 5AZ2H 3T77A 4YXHH 1KCVH 3MLUL 1OSPL 4BQ9A 1ITCA 5DEGA 5DQDL 2HWZL 1PKOA 2GJ6D 4LSQH 1LO2H 3X17A 4ZG1A 2D0GA 3C60A 2Q8BH 5JDSB 3BD5A 1OHQA 4AH2A 1SEBA 4YO0A 2I60L 1DLFL 1FJ1A 1C16A 1QPPA 2AJ3B 3ARFD 3QCVL 4Y4HA 4PRDB 1T20B 4KKNA 3HAEB 1ZHBA 5IK3B 4GSDL 1N5YH 5CD5C 3JV0A 2LAAA 2F9BT 2UY6A 4NQCD 3IDJA 5AG8A 5GS0C 5IVXE 1K4DB 2IQAA 1F11A 3NA9L 2AJVH 2CDEB 1FYTA 4WEMB 1WIUA 3DGGA 4PRID 5DMIH 3GHBH 2IC2A 1M1SA 4XBPB 1SVCP 3VMOA 5LVEA 4RGNC 4XNYL 5J06A 1ZANH 2W0FA 4OTXL 1VFUA 4I3RL 5H35A 2ZSWB 4FRWA 2OCFD 3EKCA 4OCSH 2NTFB 1KN4H 1GPOH 4RGNB 1CGSL 2DBJA 1D5ZB 2VDKL 1CBVH 1AXSA 3EFFA 1OCWH 4U6TA 1EHLL 3FHQA 3V5KA 4BH7B 4JGMA 4X5WA 1AXTL 2MHAA 3IFOB 3X13A 5B8CC 2Q6WA 3ZE1F 1S7RA 3GKWL 1IC5H 3SQBA 1TETL 5F3HA 4X6BB 5AZEH 3WHE1 1I7ZA 3BH9B 5C3TA 1Q1JL 4W4OA 4ZPTA 3WIHA 5KS9E 2R1YB 3WXWL 2ADIA 4OGAD 3GZKA 5B8CB 5J11C 2FD6L 5IB4B 3JWDH 4HUKB 1NDMA 3BVNA 4W68A 5A43C 5E9DB 4WI2A 4YZFF 1F4YL 1DQLH 4KJWC 2M2DA 4NZRH 1IAII 3H6JA 3HZVA 5DJ8A 4L8CA 2X9YA 1UWXK 5I1AB 1CU4H 1M05B 1CXKA 2ZUQC 1SY6H 4X6CF 5GS0H 4Z78B 4YHNA 2COQA 2H1PL 5C7XH 3INUL 3S8WA 5JIPA 1R5VB 3LSOB 3ES6A 3K1KC 1K9TA 2HA1A 3KPRE 3IF1A 3GM8A 4ODSL 1ZHNA 2P5WE 2BDNH 4J6RH 1IAMA 1UWGH 2L7UA 4NFDA 4KKLD 4PP2A 4HIIB 4F7MA 1PLGH 4EZMA 5LBSH 4JPKH 3B9DA 4PY7B 1ZGLA 2YD8A 5FCUH 3U79A 2VISA 2AGJH 3SDDD 4D2NA 1ZVSA 1DBAH 3FB5B 4UQ2B 1M7IB 3FQWB 1S7TA 4NOFA 2G9HB 2V5SA 5CEZL 1XF5A 3I75B 4X98A 2DTMH 5C0AA 3I50L 3ZKNC 1AGDA 3C5JA 3IFPA 4PJ7E 4K23L 4Y5XA 4PY8I 3TBYB 1QQDB 1X5AA 2FIKA 2W9DL 4N9OB 2A73B 3MREA 2D4DA 1ZS8B 5DJCB 1S9VB 1KIQB 1L7TH 2ZUUA 4MJIE 3BN3B 4Z95L 1BM3H 5ADOL 1JPST 5GJSH 2DF3A 4M6AA 3TBTB 3DRTB 1DEDA 2RAMA 4PGDA 5DQ9B 4OKDA 5A2KH 3CK0L 4XCYA 5L2KE 4JFHD 3U0PA 1J88A 2OBGA 4LEXH 4X6EA 2ZJSH 3RAJH 3VFSA 2GTZA 1KPVB 5K9KB 1NJ9A 2V7NB 4Z8FH 4R8WH 2AXJA 2BVYA 4QRSB 2WBJD 1QO3B 4ODTH 2CXGA 2J6EL 3KYKL 1ZT1A 1L6ZA 4ZUVB 2C4FT 4ZTPH 2X1QA 1NL0H 1SJHB 3GSNL 5I17B 4ZAKC 3L6FB 1XCTA 3ZDZF 3OJDB 4ZDHA 3ISWA 4OJFL 1PSKL 3TA3D 3PE9A 2V17H 5BMFL 1M7DA 4FXLA 4MXVE 4HFWB 2UWEF 3MXWL 3V9FA 4OAWA 4ZAKB 3QWOA 5E08L 1OQOA 3EFDH 1MH5B 1QHOA 1NC2A 2CH8A 5D6CA 3UBXA 2QV2A 5IQ9B 5ICXA 4X99A 1TZHA 4HDIB 2IAND 1A2YA 4ZXBC 2ATKB 2GITB 1ZVHA 1QKZH 2CLZA 4NNYA 3VH8A 5IWLA 1JFQH 3ZDXF 2ICES 4B5EA 1JNHB 4ZXBB 1G0DA 4KKBD 4Y0GA 4JQVC 5F1OB 5C07B 4WNQA 2HFTA 5F7HA 2D9CA 4I0PD 3BJ91 2NW2B 4LSPH 2X5PA 1IGTA 3O8XA 4XVUC 3O3BB 5FGRA 5EIIA 3VXSD 1A0QH 1QBLL 1QBBA 5EDXA 3T0XA 5CLWA 4ZSOA 4R3SA 4KQ3L 4ZFGH 1E6OH 2FSEA 1EGJA 5JW3H 3CAFA 1A6ZB 4NQDA 4WO4D 1U3HC 1SMOA 2X4UB 3MACL 5BVJA 1VHPA 1I3UA 5HYJB 1FSKC 4MAYD 1RQ5A 2DM7A 4OLUH 4U2ZA 4QRPE 2VLLB 1XGQB 3QEUB 3NCJL 3U4EB 3WDIA 1U3HB 3LV3B 1I1RA 2ED8A 3QPQD 1FSKB 5KS9B 1FFOA 3GIZL 3HAEG 3KPOA 5JOFA 4CN4A 4TN9A 1I3RA 3NFPA 4CVXA 1YN6B 4MD0A 3ZO0A 1S9WA 4WHYG 3EOBA 2VZ1A 2OR8A 4RFEB 2BNQA 4ZQKA 1QHPA 3EHBD 2GJ6B 3QDGD 4ISVA 2ZSVB 3ARFC 2MCG1 1OTUD 3CZFB 2CO6B 3NCFB 4XP1H 1MREH 1MEXL 3BEVA 1EBAA 3MLVH 1V3LA 2VNCA 4IHOB 5D1QA 4GAJL 1HQ4B 1J8HA 3LEXB 2W0PA 3ARFB 3DSFH 5DEZA 3WS6A 5IESL 1MOEA 4ELME 2ORBL 2ARJA 3A6CH 4OT1L 5JUEL 1RZGA 5IB2A 4GXUN 3N1MC 1MJJB 2RFXA 4NQCB 5ICZA 3SE3A 3RVTD 2PW1B 3MGOA 1KLUA 4ZD3L 4PGBB 4PRIB 5DJ6B 3SJVD 3C9NA 3TGXA 4GKZB 3KJ4C 2VZ3A 3FQXA 2J4WH 4V1DD 4ZOAA 1GRWA 1FH5H 4HGWA 5D7IE 3RBGA 4OV5B 2EXWD 4JM2D 1NMBL 3SGJC 2BY1A 3KJ4B 3IXTB 1LEKA 1CIUA 1FCCA 4LPCA 3TO4D 1SEQL 3O3AB 3DARA 4AMKH 1E4KA 4G6KH 1U8QB 1U8MB 3PXJA 4XCEB 1WWWX 4OGAC 2W1NA 5C0IA 5I2IA 4OM0H 1LVEA 4P46D 5JQHC 4HF5L 4HMDA 5L2KB 1VFAA 3OXSA 5IEKA 3MCLH 1KPUB 4P5MB 3X3FH 2EDKA 3BRFA 3JWOL 1R5WB 4Q2ZA 5I8CA <