2HFGH

Crystal structure of hbr3 bound to cb3s-fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISSSSIHWVRQAPGKGLEWVAWVLPSVGFTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRVCYNRLGVCAGGMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CB3s Fab light chain (kappa)
publication title Synthetic anti-BR3 antibodies that mimic BAFF binding and target both human and murine B cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfgH01
1DN2A 5JQ6L 4TVPL 3IB4A 3HI6H 4H5SA 4XNUL 2O61A 4Z95H 3SBWA 4WV1A 2EDEA 1N0XH 5LGJB 1IT9L 6CGTA 2M1KA 3PWUA 5C7XL 1Q0YH 4Q9QL 2WW8A 1WBXA 4K3DL 4TSBH 3DBXA 4RGMC 4QCIA 3JVGC 3ARUA 5D72H 3C2AH 3VRIA 3VRLE 5DHXB 2XA3A 3MRFA 1U91B 5JPNA 4OV6F 4TUKL 2AV7B 5C08D 2XNAB 3QNZB 1OT1A 3V6OC 2HFTA 3IXTB 4DVBB 5KVGL 4PG9B 1SMOA 5C2BL 2P8PA 1UT9A 5BZWA 5GGUA 2BFVL 3MGOA 2ZOKA 4JFZH 2DQJL 3MNWA 4NN6C 2ZUVA 4YHOH 3EKCA 2NXZD 3BKJH 4KHXH 4F7PB 4I77H 4OZHA 3MV7A 4G6AD 1S7SA 3WUWB 3MLXH 4NQSA 4LF3B 4MDIB 5FYJH 4WUUA 3KR3H 3G6AA 3SE9H 1ZKAA 1FAIH 5JHLH 4NN5C 1RIVL 1TETL 4TQEL 4JFDD 1A7QL 5IHZA 3FKUS 4OCSH 3VFWA 1TTFA 3VFVA 4DVRL 5GZND 1U3HA 4I4WB 1NDMB 4FXLA 1MCWM 1T1YA 5LWYL 3JWOL 4GRMB 5J6HB 2XQBL 5BZDB 3CZFA 2HLAB 4EZMA 3BPOC 3QEUA 3KJ4B 4HWUA 5E00A 5FDWA 4D0CA 1LP9B 4Y1AD 3WJLA 4MAYB 4HUNB 2OR7A 1D9KD 3DYPA 1A7RL 5JHDA 1ROWA 2P5EB 3IDXL 1MCSA 2VLJB 2RB8A 4AIZB 1MCBA 2IH1B 2WBKA 3RKDC 5ALCL 1M7XA 4YC2B 1HI6B 3L1OH 2GAZB 2AEPL 5CBEB 2DTML 1F8TH 1T66D 2HA1A 3O3EB 4ZAKC 1FGNH 1A6WH 4S1DD 2GQHA 1VEPA 4WEBL 4WCYH 3HTLX 4G6MH 5CEZD 3W9DA 4Z7OF 4DZBA 5H8DA 1N4XL 2ENYA 4FFZL 2WUBH 3E6FB 3HCVA 3S88L 1FLRH 1DQMH 1L7TL 3BDXA 5DEGA 1S3KH 3TPKA 4PRIE 3BVNB 4DW2L 2QQNL 4TSCL 3L7EB 2PTTB 5K33A 5DURB 2AEQH 4YGAB 5D7JB 1OGTA 4PJ8A 3CJJA 1RZ7H 4QHUA 1EXUB 4KV5F 5ECJE 1A7OH 4IOIB 4P5TB 1MHEA 4HMCA 3UTSB 2A83B 3B9VA 4X4YA 2F9BT 5L2JB 4RFNC 3VRJA 2VWEE 4NT6A 4CRPA 2YPVL 1MHPH 1YYLH 3OZ9H 43CAB 3U7WH 2RR3A 3E6HA 2O5XL 3V6FA 1RJCA 2OTWA 4U1KA 4XP5L 2CXKA 3MRNA 2VZUA 5SWZA 2PXYD 4JO1L 3CH8A 1H8NA 2GTZA 4KVNL 4P3WA 2HMIC 1Z9OA 4KZEL 4PP2B 2YPKA 1AI1H 4FQXA 5KVEL 1BM3L 3G6JA 5DJAB 3V6ZA 4ODSL 4I5BA 4PREA 4OI9A 5E03A 3MV7E 1R5IA 2AXFB 4Q0XH 1BP3B 3VWJD 1P2CA 2A9MH 4N1EA 1E27B 4OCRL 4WUUE 2BNUB 4OD1L 3OSKA 2CK0L 4NRXB 3RWDB 4YWGL 1AP2A 1NSNH 3OBAA 4OQTA 1HXYB 4GH7B 2DLFL 2VC2H 2Y6SC 3O41A 5JMOC 2NZIA 1ZGLP 5DEZA 1FV1B 1ZA3A 3QI9B 5IKCB 4LGSB 5CGYC 1HHJB 4P49A 3M07A 1MCJA 1OAZH 1FHGA 3U1SH 2FJFB 1P4IL 5GXBB 2ZNXA 2R0KH 4G42B 4X9FA 2D31A 3UTZB 1ZVSA 4BQBA 1I9RH 4ETQB 1UKSA 5JHDE 3PG2A 2ARJA 3QHFL 3CFKA 4PJXE 4MX7A 4JREB 1KCSL 3PWPD 3SKNA 2GSGA 3EYVB 1WFUA 4G9FD 4XHJD 8FABB 3RUGE 3BQUB 3KYKL 5J89A 5C0AA 1N59A 3QDGA 3IT8D 3KJ4C 1NFDF 5HYFA 4MAYC 3EZJB 1XGPA 2B1HH 3QCTL 4HEPG 1IC5L 2B2XH 1J05B 1FYTD 1Q9WB 1AFVL 2WIMA 4K9EL 2HT2C 4YC2C 3OWEA 3BSZL 4Z7UF 5F1SA 1QSZA 1CGVA 5HI5D 4NN7B 5KS9B 4XMKH 4LAQH 1OGAB 4OJFH 4BQ6A 3T4AB 1YEDB 4AL8H 4JY6A 3FB8A 1H0DB 5JW3H 1EDQA 5I30L 1YEHL 3LSOA 5I8OH 4PJEA 3I9GH 2FEDD 2NX5B 3PHOA 3FONA 4WU7B 1FDLH 2XN9D 1HHGA 2A6IB 2A74B 1WZ1L 2EYRB 3ZZ1A 1JI2A 5D8JL 4JGUA 1RIHH 3DV6B 4JHAH 1DBJL 2GT9B 5IEHB 4MVBC 5F93C 5SWSB 5D7JC 5DJ2B 5AWNH 1V8HA 1FNEB 3H9SB 3HE6D 3DVFA 5EU3A 5IMLB 3QIUD 3CUPB 4P5TC 4P59L 4Y5YB 5B8CB 3T0ED 1WEJL 3R0NA 2VDOH 4WJ5B 4O5LH 5CSBA 2AEWA 1NEZG 1R3HB 4HUMB 1K4CB 5JA8B 4PPTA 4QHNB 3BGMA 1LEGB 3B6SA 3Q3GA 5J13B 1KT2B 3BH8A 3HMWH 4JFFA 1J1PH 2FD6L 5SWQA 4M6NL 3IS1X 2J88L 4XWOC 1J0KA 1OAQL 4LSQL 4O02L 4NJ9H 1UM5L 4WU5A 3BZFB 4WI4A 3ZSSA 1NBVL 3PGFL 3DARA 3KYMA 3MLPA 1WLHA 2I26N 4NOFA 4L1DA 4XXCC 4OLVH 1NCWL 1DBBL 1AGCB 3I3DA 3WCYA 5DUBB 1E6JL 3WE6A 1KG0A 5KJRL 1QSFE 1HYRC 5GGVY 1F6AA 3MRMB 4NRYA 1E4WL 2UZIL 2NMSA 5IVXA 2R15A 2FZ3A 5DLML 4OF7A 3DECA 4M1DH 5CAYB 3TZVD 3CDCA 2FJGB 4HUUB 4PY8J 1CDHA 3TYGL 4JO2L 3RWCB 1I3GL 2V6HA 4JQVA 3UTOA 1MHCB 4FFYH 3QCVL 4LSVH 4XC1L 4I0PB 1KTKE 4OQTL 4X7EC 1MIEH 1FFOB 1A6AA 2Y06L 4JPKL 4QRPD 4RWYL 5C0AE 3QDGE 3WNLA 1JV5A 1FO0A 3SO5A 3FAWA 4OQ1A 3ARED 2YC1A 3VXOA 1ZLWK 3GBNL 4ZSOB 3K4AA 1QBBA 4LEOB 4JREC 2GJ6D 1OAUL 2VR5A 1MCOH 4NQCA 5F7YC 3OR6A 4EI5A 3A67L 3BQUC 3RVTC 3TPUA 3FHQA 1MH5A 3ZDYF 4Y2DB 3MBXH 2OS7A 4IRSD 3N9GL 2ESVB 4UNTA 3TF7C 3VG0H 3FN0L 1IGIH 4PJEE 1PYWB 3DVGB 5B38A 4OKDA 3GMMA 2IQ9H 1GGCL 2EKJA 2VDPL 4MA8H 1XGQA 3REWB 2OMNA 4PRDB 5CJBA 3FO0H 4J3OC 4NN7C 1ZT4A 4ZXBD 5A16B 1IFHH 2BY2A 1I1AD 3BRGC 3QXDB 4O51A 1YEGH 5IG7B 1UEYA 1B0GB 4KI5D 1PSKH 2BNQE 3O6LL 1CE6B 2IC2A 5SV3A 2D7TL 3DRQB 3H7LA 1IQDA 4ONGH 3RVXC 3IAQA 4YO0B 4PD4J 5FYLE 3Q48A 2VE6B 3S97C 4TUJB 3NACH 2AJVL 3BT2L 1RV6X 2GW5A 3O11B 1I75A 5ANMB 1KTRL 1S9YB 5EBWA 1OTTD 4EN3A 4NC1E 5E6ID 4FP8L 3SDDA 1GZQA 1OLLA 5E70A 2AV1B 3P9LB 4ODTL 5J13C 1SJVA 1QBAA 3HNTH 4OZHF 3DSNA 4LSUH 3SGJA 2DLEA 1N5AB 5IFJA 3GBMH 3NAAL 4BA8A 1JGVL 3I2CH 3LQAH 4GSDL 1UENA 4DAGH 4NCC1 1XZ0A 4BSVB 1MCEA 2VL5B 3SDAB 2F5AL 5IVXE 5T3XE 4V1DD 5F7EH 4YBLB 3OKMB 1L7IH 5E2UL 4U2YA 3ULUL 1CGSH 2LE9A 4NKDB 1MFBL 2VDQH 1YY9C 3DMMC 4LHUG 4HSQA 2BVPB 2WNGA 3OKDB 3LB6C 4UT7L 3TO2B 1ETZB 5DD1L 5HGHB 3U36B 4AENA 1XH3A 2C3HA 4JLRB 3DLQR 2EECA 5K9KA 2E7BA 2P42B 2P4AB 3W39B 4W6XB 4NIKB 3CK0L 4ZUTA 3S35L 1J8HE 3J7HA 4R97B 5HYQA 4IMLA 1F02I 4P2RE 3DTXB 2WINA 4HH9A 1CVSC 3VGGA 2NNAB 1X5HA 4I0PC 1EUUA 3DUHA 3G5VA 5C0GA 4HWBL 4NQCE 3KPPB 1S7VB 2ADIA 4G8GE 4C56A 2EICA 3WO3B 2R9HC 3NZHH 4JM4L 1TFHA 2VXSL 3PP3K 4P3CL 1HCVA 2ZZUT 5DR5L 4JO4L 3ARYA 1JPTL 1S9WB 2CRZA 3QJFB 5DJZA 4EOWH 5GGVH 4OZGB 1FO0L 2ATPB 3ARQA 1AXSB 4WFGE 5I19L 3VXNA 4PJ5B 5JPMA 3IETA 1F4YH 2VDRH 2R2HA 1OPGL 3TH4T 2UZXB 4YX2L 1KPUB 2J6EA 2JCCB 4ZS6D 4Y2DC 5I74B 4KJWC 3BUTA 4HHAA 4UU9B 2YD3A 3VWKB 4LCUA 5F1KC 3OG6B 3UZVB 3TYFA 5T3ZE 5IMOA 5F88A 4YHMH 2YK1H 5EC1B 4U6TA 3IJSA 1CBVH 2V2WB 2DIBA 2GFBA 4XBPB 2YEZB 1WZLA 5TH2A 3OX8A 5H94A 4BYHA 5GRZA 1CR9L 4N0UE 4K94L 3ARTA 3NFPA 4K8RD 3QDJB 5FGCE 3MV9D 1EHLH 3G6DL 3G6JF 1PX4A 3MRQB 4TRPL 1HK6A 1DLFL 5CEZH 1QD0A 1QZ1A 5E2VH 4JHBA 2MQ3A 2CKBB 4PBVC 5E2WH 1NAMB 4D9LH 3QEGL 3QEHB 1S5IH 3FB6A 4GT7A 1FC2D 4X98B 4PV9B 3ZSTA 4QY8B 4YEFA 4LPTA 5GS0C 4M62L 4NWTL 4RGOL 4XNQB 2EXYC 5IW1B 4JVPA 1EV2E 1DUYA 1RPQA 4XPBL 3WDHA 2P5WD 2OX5A 4OGYL 4PRHD 1D5XA 2VDMH 3QQNA 3SDAC 1TZGL 4FN0A 4K71B 5D5MA 4YBLC 5LBSH 2BMKB 3PGCB 3RIFF 3U7YL 3H0TA 1S7WB 1PVHA 1SYVB 1U36A 1N6QL 5DVKA 3FT3B 4M3KB 1YN6A 1OD9A 5C07A 5DD0L 5I8KL 3MLRH 3OXRA 1NLBH 2ATKB 1TVDA 3NA9L 3BH9B 1CLOL 2UWEB 1A5FL 2FR4B 1TQBB 3KJ6H 4C56E 4KAQH 4CNIA 1BIIA 5DJCB 4I18B 1T3FB 2JJSA 3D25B 3WIFA 3U0TB 4R97C 3VFPB 4JHZA 4W6YB 3RU8H 3AAZA 15C8H 4MMXC 4WI7A 4WW2B 3O2VH 1FVEA 4PLKD 1X9QA 3HLAB 5I76A 5E8NB 2GIYA 3V4UL 4PR5A 2R0WH 1FPTL 3S34L 1ZK9A 4TVPD 43C9B 3KWWB 4YR6B 4LLQA 4PJEF 1QBML 5BW7A 3CDGB 5C0BB 2F54E 3DX8A 4J23A 2FX7L 3TT1L 5JZ7C 2EZ0D 4CVUA 2CMRL 4L4TA 5KSAA 5CEYB 5I74C 4MZ2A 4XMPH 3CLEL 4PJBA 5IK3B 3VWKC 1BQUA 2G60L 2J6EL 3I6KA 4HQQL 3DYOA 5GGQH 3NIGF 5T5FH 1T2QL 2N1KA 1G0DA 2V7HB 3LKPA 4FTVB 2ILLA 4O2FB 2DQHH 2FGWL 4XPHL 3QG7L 4RBPH 3SE3A 3ARDA 3TBSA 3L5WB 2D03L 1OP5H 1A3LH 3IDIA 3ULUF 1CDUA 2E6JA 4R90H 4EVNA 1UH4A 1RUQL 3KPRD 2JIXA 4KKBD 3FQTB 1U6AL 1I8MA 1F00I 5E2TH 5I16B 1MFEL 1FORL 1Q94A 3JWDH 3RX8A 5LJYH 4WY7L 3DETC 1ZHKB 4Z7VA 4XH2A 1P4LA 3RZWA 5AZEH 4NQDB 3UO1H 3TA3A 3B43A 5C0FA 4FQJH 1SEQH 2D7MA 3MPCA 1N6UA 4LFHG 3IVKB 1DDHA 3WNPA 3IU3B 5IVXF 1HQ4B 3EHBC 5CBAB 2R39A 2F53B 1D5BA 4OBSA 5E94A 4JZNB 5FGSA 2H2PC 3TT3L 1UM6L 1JVKA 3MRBB 5F71A 5C07E 1PKQE 4TPRH 5IHLB 2M26A 5LVEA 4YHLL 4GQPH 4LCCB 3OKOA 2HWZH 4Y16A 4AZ8A 3VG9B 3WJJA 5JW4R 1WC7A 2X4QA 5AZ2L 3VXQB 2G75B 1E4XH 1KIRB 3BZ4B 3TNNA 3WS3A 4NHUB 3RWEA 1LE5B 5EU7C 4DKEH 2FX9L 1G1YA 1G7JA 3L5XL 5E5RB 5DJYB 3X12B 1FRGL 3QWOA 1NGYA 4M7LL 3SGKC 2KH2B 4NWUL 4KKAC 1HZHH 1TQBC 3MOBH 5EUOE 3RGVA 2I07B 3FO1A 5DGQA 3HKFA 4I3RL 4XHQA 3BP4B 2CKBL 4I18C 1IKNC 2DJUA 4CU7A 1ED3B 5EPMB 1BEYH 4HXAH 1U8QA 3HFMH 4Q6IA 1S9VA 4UZGA 5FB8B 1Y6MR 5EN2A 4WW2C 1T89C 5CD3B 4NQXA 1QR1A 2Z4QA 4L8CA 1C12B 2Q8AL 1MFDH 3QDHA 2O5ZL 5IROA 5DMIH 3RKDD 4PJBE 2D9QB 1HQRB 3S96B 1XGYH 4OLWL 2DF3A 1P4BL 2G5RA 4YGVB 1ZWIB 4PJHA 2NY6B 2UZYB 3LN4B 1QRNA 4TOYH 5EU6A 4F9PA 2BNRA 2BOBB 2H1PH 1BECA 2YRPA 4I9WE 3P4NB 3RWIA 1MVFA 2EE6A 1RHHB 5DK2B 4ZFFB 4UINL 4NO3B 4JFEB 2YKLL 3N85L 2AABH 1M4KA 4YNYA 5EFIA 3LKOA 1KCUH 5MERA 4RRPG 5HGAA 4FZEL 5TGBB 2P44B 4OFIA 4YPGB 4L3EB 4LK4A 3LQZA 3TJEH 3UTTD 1P1ZB 2CR6A 1JE6A 4U1JA 4NNPH 2YMXL 3KVQA 1CGTA 4HIXL 2X2YA 3QR2A 1UG9A 2A2QT 4HPYL 1T5WA 1WGOA 2V5YA 4J8RB 1R5VB 4LSSL 3EYSL 4MA3B 4OB5H 4U05A 3IFOB 2C3XA 5D6DC 2Y07L 3V4PH 5JORA 2VDLL 3EIFA 3K2UH 5TE7L 5IB2B 4PRAA 4YIQB 2J4WL 1H9VA 4ZD3L 1XF2B 3V4VL 3SHSA 4N9GB 1YEJL 1OF2A 5DRXA 4OFYA 4XAKD 3KPOB 1MCWW 1YNKL 4N0YL 3MA7A 1D5IH 4L1HA 2HMID 4G43A 3S5LG 5F9WC 2VDNH 2NY1B 3KPLA 1FFQA 4OZFH 5D1QA 3HMXL 5I8CA 3T8XB 2B0SH 4JO3L 5HY9B 1FFPA 1NCBL 1XGUB 4NO2B 4PLOB 3MV11 4X80L 3QDME 2IFFL 4KC3B 1IZKA 1X5LA 2AERT 3BP6A 1IC7H 5D7LB 1I9JL 2EEAA 2Z31A 5I1JH 4LCCC 5JTWA 1G7IB 3VG9C 3MFFB 2R56H 5EC2B 4KRLB 2A9NL 3C9NB 1ZVYA 4P2QB 2DDQL 3GKZA 3OPZH 1PDKA 3K4ZA 4AH2A 1ITBB 3KYOB 3VXUA 4R4BB 2V2TA 5I2IA 2Y6SD 3MACH 3GMPA 3INUH 4UT9L 3QSKB 5CGYD 2P48B 5B22A 4KK9D 1AHWB 3PWVA 2VLRE 9CGTA 2DBLH 2YOCA 1YUHB 2Q6WB 1FZOA 4WTZG 4JAMB 2QQKH 2H2SC 3PGDA 4RQQB 3PV7A 4WRLA 4APQB 3HZKB 4BSJA 4PP1C 2EDBA 3CFIC 3NCJL 4RZCA 5CSZB 5BQ7B 3LKQA 4QHLB 3N1PC 2XA8H 4ZPVA 4Y4HB 4R3SA 3GSUA 1QRNE 1EJ6A 3WKML 1G7LA 3P4OA 2EO1A 5E1HB 2DJSA 5EU6E 4CDGC 2BNRE 2HRPL 3QB7C 3L3KB 4MAYD 3CD4A 3FQXB 3TN0B 5D2LE 2P5ED 4S1QH 4AK1A 2VLJD 2HN7B 2VXUL 2XTLA 2HT2D 3CLFL 4M1CC 2QKIB 3T0WA 2NY6C 1MCPH 3JTTB 5DI8A 5FV2A 4RIRA 1CI5A 3O6FA 4PJ9A 1ORQB 5E7BA 4OCYL 5FXCH 2JCCF 4HUXB 4L3CA 3VD4A 5DYOA 4L9LB 4TSAL 2NW2B 3GKWH 1CFTA 2FH8A 5CMAB 3MUZ1 3CIQA 4ETYA 4D0BA 4ZO9A 4XNZB 1HH6B 3SOBH 5BJTB 5IFAL 4GG6A 1S9KC 3MCKA 3EOBA 4I2XB 4X9GA 3FZUC 1AY1H 4MVBD 5DMGC 5DURD 5D7JD 2VLMD 3UCRA 1PLGL 1OB1A 3LKRA 2MJWA 3CX5J 1Z5LB 2D0GA 3GIZH 1T83C 2ZJSH 4XXDB 4P5TD 2ZCHH 2NY0B 4H1LA 2FLRT 2CUMA 3AS2A 3MMEB 1UM4H 4NNYB 1I3RA 3UTSD 3WSQH 1CD1A 4MNQA 5L88L 4TTGA 4L29A 2Q20A 4ZUSA 3NGBB 4OZIE 5D5MF 3CDYA 4HKXB 1FCCA 2Z8SA 3DO7B 3BZDA 3QH3A 1YMHB 5ICYB 4DGVL 5EUKA 1ZHBB 5K9QG 1NC4A 2GJJA 4TTDC 3BESR 4UIMA 4XWOD 1KTLB 1MSPA 5CUSL 2V17H 4LLAA 3T1FA 2OL3H 3WD5L 4P3DA 1R0AL 5HDBF 4HGKC 3MUGB 4CW1B 4RBPK 1IAIL 4UTAL 3MA9L 4K8RH 1TDQA 3CFJB 3MRIA 2XZAL 1BF2A 5E08H 4OZ4B 3C09B 2ZOKB 4XZUB 1J5OL 1HNGA 2Q7NA 5F1NA 3W0WA 3CH1A 1IGYB 3T0AA 3OKNA 2XPGA 4P5MB 1KFAL 1S7SB 1S78C 1KJVA 3UC0H 4DQOH 4J1UB 5EORH 3QG6B 4ODUA 5E8OB 1FN4B 1LO2H 1K2DB 3F65A 4F7MB 4CVXA 1B4JL 1MVUB 1X5ZA 3FQNB 4GFTB 1IMHC 7FABH 4HBQA 2ZG1A 3OGCA 4H8WL 3X17A 2BCKA 3QI9D 2WBJB 1J87A 5LCVL 2VQ1A 1MPAH 4QRSA 3U9UA 2QQLH 1AHWC 5F9OH 2AK1L 1T6VN 3MJGX 1I7UB 3QA3A 3MR9A 3SJVA 3JV6B 2BC4B 3VFGH 5FDWB 3L3DB 4APQC 5IW6A 4PJBF 5D1ZA 4FS0A 2VOTA 3PNWA 3O3AB 1A6TA 1WFNA 2R29H 3HZMB 4M7KL 3B3IB 4PJXB 3HI5H 5KAQF 1TCRB 1V3KA 3BQUD 4Y4HC 5FGBC 3RVTD 3C5SB 1JPST 3RUGB 3PJSB 4CVWA 4URTB 3EAKA 3KXFA 5C1MB 4PG2C 5HYJA 2IBZY 4JDVB 1INEL 3WV0A 1VPOL 2XZCL 3C6LA 3KAAA 3TN0C 5MEOA 1JF6A 3LIZL 1PY9A 3CVIH 3KGRA 3VI4F 3GM8A 3B2UC 3C6SA 5GGTA 3S4SB 1MAJA 1H3GA 4GG6E 3BKML 2JJTC 1I7ZA 4Z7QF 1JHTA 1OGAD 1BZ9A 4DFIA 4OM1L 1OARL 4U49A 5TQ2L 3DURB 1U93A 1EGJA 3GHBH 4Z8FH 3GK8H 1ZLVK 4Z7VF 5I1KH 2YD6A 4TVPH 4L9LC 5JXEA 2XWTA 3QFJE 2NX5D 2F74A 2WK2A 4JM2A 4QHUB 5D2NA 2RQ8A 1T22B 2WP3O 1JNLL 2DIJA 3D87B 5I1GH 4WI3A 3RWFB 5H35B 1RK0A 4XNZC 4N0FB 1JHKH 4GRLA 3RJQB 2DQDL 5CIPB 1D5MA 3RVXD 1UCTA 4MYWB 3VRJB 5SWSD 3TJHC 1M6OB 3B2VL 4WV1C 3H9SD 3D48R 4EIGB 2NY0C 4FQLL 2AJZA 3JSSA 2IJ0C 4MB3A 3NGBC 5FHBL 1I1YA 3KHQA 2VZTA 2CUIA 2C3VA 1F3RB 4Y5VA 2VWEC 3VXSA 3V6ZB 4JR9L 4DKFH 5AG8A 5IQ9A 1MI5B 3W0WE 5AUMA 3ISWA 2IGFH 1VACA 5EA0L 3Q0HA 1EAPA 2Y7QB 4R96B 4P46B 3S36X 1QKZH 1XR9B 2R2EA 5KVDH 4ZUUB 1YY9D 3C09C 3LB6D 3X13B 3FJTA 3HB3C 3ROLB 1MUJA 1S7QB 3GMRA 1FVDA 1DL7H 1BAFH 2Y36H 1Q1JL 1QSFB 4LLVB 3PL6A 4TQEH 4XNMA 1SMAA 5CZXC 3TIEA 1C1EL 1RZIB 3MNVB 3RWHA 4DVRH 1M7DB 2IPTL 5DVOA 1BVKB 1BD2A 2B8OT 2BVOB 4Z5RB 2ZPKH 3PABB 4I0PD 4QXUL 4QTHA 1LEKA 4B41A 3E1F1 4QHKJ 3TH2T 1H15B 4YDKH 2HH0L 1KELL 4PJHF 4JJHA 5D7IA 2WBJC 2R9HD 3IDXH 2D4DA 4OZFG 3STZB 3QDGB 2VKWA 1DSFL 5HYJE 1RJYA 2DTMH 3MV8B 5KANI 2ZUXA 3OKKA 5DHVA 5ICXA 1AGFA 2Y5EA 4ZO7A 4A6YB 1M05B 5IW3A 3O45B 5L7XH 4DWHA 3H2WA 1U2HA 3QUMB 3C08L 5D4QA 1V7NL 1NCCL 1G6VK 4Y2DD 4LLUB 1T0MB 4KJWD 3LD8B 4GW4A 1ZT7B 2ESVD 2FHCA 1CLZH 2MPAL 2QQNH 3LSOB 1IGJA 4HX1A 3DUUA 3H3KA 4HLJA 3MLWH 1CE1L 3BO8A 1TITA 1VKXB 4HKJB 1GH7A 3N1MC 1NCAL 1ZS8B 1IGCL 4KQ3L 2OXHA 1KNOB 2HFGL 1T21A 2YA0A 1V7ML 5GGTL 2ZUUA 1NMAL 3ZE1E 4N90E 2AXJA 1U8JB 4ZFOB 1U8KA 1PD6A 3GM0A 2EKSB 5FKAB 5EZIL 2H45A 2V7NB 1SVZA 1U92B 3FN3A 1P6FA 2A73B 2W0FA 2BNQB 3F7RA 4HIEA 2APTA 2H8PA 2KPNA 4LSRL 3X3GL 2EH8H 1G1CA 4HULB 3KLAA 2VAJA 2BDNH 3WXWH 1R5WA 5I1LA 4X6BB 4Z7NE 2YD7A 3PXHA 1KEML 4JY5L 3CFDA 1N0LA 2AK4A 4X99B 5BS0E 4LRNL 1XF4A 4FQHA 1OL0A 3VXTA 4PB9H 3FOMA 4YFDB 2FL5B 3GSOB 1NEZA 4KH2A 4EJ1C 5GS0D 3MJ7A 4JANB 2HJKA 2K3TA 3IFNL 2EXYD 4XPAH 2CK0H 1YC7A 4J3VA 1UXWA 4NJAL 5K93A 3VJ6A 2VITA 3VE0A 5D9SA 2CGRL 3TCLA 2H6PA 1A2YB 3SDAD 4NRYB 2R4RL 2VLLA 4P46C 1QRKA 3K80A 5I8EA 3MJ9A 2H26A 1A1NB 5EO1A 3FO9B 5JQHC 2Q8BH 1PQZB 1OAXH 2OZ4A 4KROB 1J12A 5ADPH 25C8H 1A3RH 3BRDA 1XFPA 3H3PL 4DTGH 5BRZB 4KTDH 1P4IH 2HVKB 4G5ZH 5FIEA 1TLKA 4L4VA 1RUPH 4HLZH 4NRZA 5D7IE 5EG6C 1QLFA 2WIIA 1MWAL 1K5NA 2MFNA 4HKZB 1R24B 3BP7A 2XTJE 3P0GB 3NZ8B 1ADQA 5ID0A 1IEBB 2WM0A 2EDXA 2PF6A 1J8HB 2X1WL 3WN5A 5IEKB 2JELH 3KYKH 3VXRA 3DVNA 1SM3H 4P2RB 4OAWA 2ARJQ 2K7PA 4ZDHB 4CAGA 5HYSG 4UTBL 1UACH 4LKCB 2VERN 3QUXB 4NP4H 4G8GB 2Q3ZA 3V6BR 5BV7B 4WTWA 1AGBB 5CJQH 1A6VH 1RIUL 3E2HB 3L7FA 4PRPE 1MCRA 3AMKA 5IBUG 3TBWA 1FFRA 4IMKC 5ELIA 3ARZA 3UBXA 1F58L 5ACZA 4PJ5D 5JZ7D 5BXFA 3F62A 3TEUA 1S9XA 1KJ2B 4PJFA 4YXKH 3LD8C 3U0WH 1H8SA 1AIFB 1AC6A 4L8DB 5D8JH 3VWKD 2H3NA 1YEFL 5E8DH 1DBJH 3I3BA 3BDYL 3BKYH 2IANB 4G8IB 4JPIA 5DUMH 4JN1L 1T20A 3HR5A 4P23A 3JV4B 3ES6A 5K59E 2HKHL 3MODH 3TLRA 5DFVC 1UZ6F 1QA9A 2R2CA 1TZIB 5CJXA 1LE9B 2ICWJ 2OM5A 1F6LL 2DWEA 5GHWL 2Z91A 4RAHA 5DJ0B 1JNNH 2RCSL 2WZPD 3ULVE 3MBEA 5AAMA 2ADJA 4JZOB 1KIPA 3BISA 5GGSB 5C6WH 3LS4L 2AK4E 1C08B 2FD6H 3QDJD 1VGKB 4N0UB 2A1WH 3AM8A 4G6JH 3QXUA 1U3ZA 2MNUA 1J1OH 2W07A 3SDDB 4A6YL 3DETD 4BZ1H 2XI9A 1RZJC 3Q6GL 1GOHA 3QUML 35C8L 4JZJB 1MFAL 2X9YA 3GSWA 1YDPB 1NAKH 1NCWH 3EHBD 1K8DB 5BOZG 1AXIB 4PY7B 4L8SB 3ULSA 5C09B 3PWJB 2XZZA 3LCYA 2H2PD 3QIWA 4NC1C 3STLB 1L0YA 3G5XB 4D3CL 2R1YA 3IU4H 4NUJA 1PKOA 2ED8A 1S7RB 3ARGB 4PYHA 3SDYH 4JQIL 2NTSP 1IL1B 3TYGH 4JO2H 2VXQL 3CXDL 4XC1H 1WK0A 3GRWH 5HD8C 3WFDH 4ZFOL 3U0PA 1X5JA 4J4PA 5F44A 3WFCH 4KROC 1O7VA 2HJLB 3V5KA 3VXRE 4NQEE 2GK0B 1P9MA 5E1AB 1I7RB 3O8XA 1N3NB 2OZ4L 4KKAD 1X4ZA 1Z9LA 4QYOA 4YXHL 1JPSH 2DM2A 2Z93A 2NW3B 5JIIA 3MRRA 3C60B 2A6JB 4XCYA 1J9CT 4C56B 6FABL 1RZJL 5EZLB 5IHUH 3MJ6A 4QNPF 2VABB 1R3KA 4JKLA 5IMMA 1UGNA 1UWEL 3A67H 1BFTA 3CFBA 2C7UB 5K9JL 3MLZL 1SJHA 5CHNA 3FN0H 4ELMA 5LGHH 4Z95L 2QV2A 1RUAH 3QUXC 3VXNB 5D96B 1P7KB 1N0XL 1N2RA 4PJFE 5BV7C 1JWSB 5K9OA 4J3WA 1JYXA 3E2HC 5C8JB 1YEEH 4HV8B 4TSBL 5C0BD 3CSYA 2VZ1A 1NDGB 3QQ4B 5D72L 3EYFB 2F54B 3C2AL 5M7QA 3ET9F 4ODWB 3GSXA 5IR1A 3MROA 5KN5A 1UWXH 3ARFA 4JFOB 4WDIA 3MNZA 3O6LH 2GFBB 1FZKB 2YA1A 5D70L 5HGDA 2D7TH 5TH2B 1AO7B 3QXTA 1JZ3A 1M71A 5TE6L 5A40E 4FTVD 4JFZL 4JRYE 1C5BH 5A1AA 2AJVH 1C16B 2GI7A 4YHOL 5HHPB 2PR4H 3BKJL 4HUWB 4I77L 2QSQA 5EB9A 4CADA 2Q86A 3DIFA 5I1HL 2NY2B 1I1CA 3GJEA 5FYJL 2FBOJ 4E42B 1NFIB 1JGDB 2DLHA 3BPNB 5BV7L 4F9LA 4K55A 4GKNA 5H2BB 3IXAB 1FAIL 3I50H 4MD0B 5JHLL 2MHAA 1F2QA 1GGBH 3G5YB 3SDDC 1G7MB 2AQ3A 3L9RA 4M4RA 5EBLA 2HG5B 4NQDD 4YBQC 3MO1A 4MXVE 1TQCB 3GMOB 2C1PB 1ES0A 4JZJC 3VH8G 1OSPH 2UYLA 4JGMA 3P77A 3MXWH 5DD1H 5IF0A 2F53D 3RHWF 4L8SC 4JRXE 3BHBB 3CC5B 3HPLB 5DJXA 3ZYJA 2Z35B 1VCAA 3TNMB 2DJ4A 1ORSA 4HZLA 3L1OL 4MDJA 4O2EB 3ARGC 1PKQB 1FGNL 1A6WL 1KPVB 5D7IF 4M48H 4WCYL 2W9DH 4G6ML 5IGXH 1EEUA 1Z6JT 3CX2A 4RA0C 1VSCA 4IRJA 2WUBL 3HG1E 3D69A 1U8OB 1EVTC 1FLRL 4AMKH 1DQML 1IGTB 2GHWB 3SGDH 2P24A 2QADB 4KTYA 1S3KL 3MZTA 1IAIM 1QVOA 5E95B 5C0CA 4UV7H 1JPTH 4ELME 1I4FB 3C60C 4F15B 5EUOB 2AEQL 3RWGA 3W11C 2L4OA 2EIEA 4GAFB 2H2SD 4P0DA 1LO5B 3MGTB 1RZ7L 5IFHH 1HHIB 4KXZH 1A7OL 4PP1D 1B3JA 3VFTB 3D39E 1MCCA 3JV0A 4LSTH 2CSPA 4F3FA 4P2CG 3F7VB 1UKQA 3IKCA 4ZYKA 1MHPL 2DL9A 3OZ9L 2DI7A 1SYSA 1U2CA 2IPKA 5GJSH 3TVMB 3D3VB 5D96C 1TJHH 4JCLA 4MCYA 3REVB 3U7WL 2VISA 5JW5B 5KVFH 4YAQB 1JPGB 5E2JA 5KSAB 1MF2L 3WS6C 1VFBA 4M43H 4M6AA 4RX4D 4P48A 2QR0B 3I75A 5KSVA 4M1CD 3ZT7A 1BVLA 3GEWB 4N8VB 3B5HA 3HS0B 4PTTB 1AI1L 4Y5XB 2NY6D 5HJ3A 3L3IA 4FQQB 3MCLH 1FLTX 5D1XB 4X0KA 5HXMA 2VLKA 4ONFH 1JYWA 4KVCH 2JF1A 1NUNB 5EDXA 4Q0XL 5DRWB 2A9ML 5F9JB 4GW5A 3VDBA 2VZOA 2IBGA 5EU4B 3BXNB 4JFED 1KSRA 4X6EB 1R3JA 5AD0A 3IYLW 4GUPA 1NSNL 2ITCA 3EBAA 2WWKO 2FEEI 4XRCB 3I6GA 4L3ED 5DMGD 4D9RE 2VC2L 1AH1A 2NY2C 3OKLB 3MJ8B 4KK8C 4HT1L 3D2UA 3OAUL 4U7KA 3V7AE 3BPNC 4LCWE 3G04B 5T1KB 1HSAA 4RGOH 3WUWG 1T5XB 1DDHB 4K7FA 1I9RL 4RGNB 4U1MA 4QXGH 3WIHA 1IQWH 3BE1H 1BQLH 4HDIA 4TTDD 5CP3A 3MTRA 3FQRB 3VU2A 1U8MB 1U8IA 3CXHJ 1TQCC 1N6QH 4Y0GA 2F8XC 5EOTB 5L2KE 2BHYA 2DM4A 3PHQA 4LVNB 2NY1D 4X5XA 1CTNA 1UKTA 3OKOB 1B0WA 5FO9B 2FHFA 4RWHA 4HJGA 3NA9H 1CLOH 2B1HL 5BMFL 5L8KB 1R3LA 4I0CC 1FE8H 4U1HB 2B2XL 4OM0H 3TNNB 3AROA 3QDMB 3UYRH 4N5EC 4GRWE 5E4EB 1S78D 1BJ8A 5KSBE 4OJFL 4PTUB 5CILH 5ERWB 3D0LA 4TNWF 5T1LA 2KL6A 5JW3L 5I8OL 2FEEL 4PGEB 3GMQA 2CDGA 2R4SH 1QFUL 3I9GL 1XIWA 3VXMB 4QOKE 5GS0H 2X9XA 2I60L 3SO3B 3TC9A 3PDOA 1FDLL 1G7PB 3BPLB 5J9PA 4QRTA 1RQ5A 5DJDA 1UB5A 4PS4H 2QADC 1S9VB 1T1WA 4OI7A 1RIHL 4JHAL 5FF6A 2H9GB 3TO4A 3O2WL 4FXGA 4XVSH 4F15C 5GS2D 1UVQB 2VLRB 4PJFF 4HKBB 5AWNL 2FSEB 5A2KH 4LIQE 3LKSB 3D85B 4APQD 4X6FB 1BOGA 5IESL 2E9IA 4O5LL 4F58H 1EVUA 3UXFA 4Y4HD 3T3PF 1H3XA 2AXGB 2O5YH 4S1RH 4JQXC 3TVMC 3HMWL 4JJ5A 1J1PL 2VLKE 2FIKA 2YSSA 2NYYC 5EU6B 3K2MC 5KSAC 3V0VA 4Z6AT 1FIGL 3TN0D 5IWLC 2DQEH 3IF1A 4NJ9L 4PGBA 4PJAE 4GXUN 4WHDA 5D2LB 5F9DC 1IAKB 2CLZB 3B2UD 2R1WB 3THMH 4H0HB 2E7CA 2YUVA 3SKMA 2RFXA 3OMZA 3VD3A 4OLVL 5EFIB 3LKOB 5D1XC 3NIFF 1DLHB 4NGHH 5J56B 1ZMYA 3V9FA 1XCQA 1NGWA 4KDVA 3GIVB 3S8WA 5C3LD 1JIBA 1XF5A 1SEBB 2CLRA 3UDWC 4F33B 2XY2A 4HUKB 4M1DL 5C08A 2X4PB 5FHAL 3DX7A 4PJCE 4P5KA 4RRPA 3NMEA 3TJHD 2IALA 1ZT1A 4LSVL 4PRAB 1PW3A 2EIBA 4MXVF 1MIEL 2BERA 1ZA6B 3Q2CA 5IHBA 1BJMA 2NY0D 4LLMA 5HI3C 3TT3H 1QP1A 4GG8B 1ZHLB 1JZ5A 4HWEH 4MD5A 4OZIB 4RGNC 4OIIH 1N26A 1XT5A 1MHHB 4CMHB 4Q74A 1MCOL 1QEWB 4QGTA 4HUVA 4Z78A 4G7VH 5IB1B 4JFDA 5DQJB 4LVNC 3MBXL 3QRGH 2FX9H 3S5LA 3BZEB 3WYRA 4O00A 3WJJC 4U6HB 1BGXL 3VG0L 4NWUH 1IGIL 4UIKL 3UTPE 3HB3D 5GSRA 1HCFX 5FO7B 4MD4A 5CWSB 2EDNA 5EO9A 3RI5K 4Y1AA 4MA8L 1NAMH 2FCBA 4OIBA 5E4EC 4NUGH 4BFGA 4F7CB 5CZXD 2X4OA 1ZE3C 4FXKA 3LQAC 1GIGH 1WZMA 2DLGA 4BZYA 1IFHL 2DWDA 1GZPB 3FT2A 1AGEA 2EDYA 3U9PH 1YEGL 4M1GH 4W6WB 1BBJA 1VEMA 3SO3C 1GGTA 3BPLC 1G9EA 1L9MA 3QZWB 1ZLUH 2EDQA 1IGML 4RZCB 5CZVL 4GBXB 2WBJD 4W68A 1CN4A 3M1BA 3O3BA 4H25A 4ONGL 1JGEA 1F4HA 1UWGH 3GSUB 2YD5A 1IC4H 4UQ3A 4OLWH 4WTZA 3NACL 5MEPA 2JB6B 3IFPB 2GTWA 1KIQB 3OHXA 4P2YA 3NTCH 2ICEA 3SDXE 1FJ1A 5IROC 3N1FC 3NIDE 2V2XB 3AB0B 4TUOA 2ZSWB 4E0RB 3EDFA 2GCYB 2MCPH 3UJIH 3B5TA 1FL3A 3HNTL 5HPOA 4LSUL 5M94B 1YPZA 2CIKB 4TYUA 4KJYB 1QOKA 3GBML 2YKLH 4QT5B 4WFED 4MZ3A 4F9PC 3I2CL 3LQAL 4DAGL 2CQVA 1Y6KR 2E9JA 5F7EL 4WEUD 1L7IL 3JBG7 3B4NA 5C08E 1CGSL 5GSVA 5GS1B 1YEKH 3U4EA 1KACB 2VRAA 1A8JH 2VDQL 1BREA 4GG6B 1ODAA 3L3HA 3MCKB 1M7IA 3EOBB 3V8OA 2PXYA 1DQDH 3IFLH 1RJLA 2M2DA 1CXFA 4U1LA 5BOPA 5I1DA 2R2BB 4PJGB 2Y07H 5KOMC 5DS8B 5ITBH 5IV2A 3SKOB 2VDLH 1QFHA 3LKRB 4X6CA 1MAMH 2LAAA 3QFJB 4ZD3H 5DEFA 3HUJA 4H1LB 5C86A 5J7CC 3AXLB 1E4KA 4CBPA 1AQKH 3FB5B 5CSGA 3VWJA 1I7TA 2ZOLA 1AKJB 4WHCA 3MREA 3QJHA 1NFKA 3HMXH 2AKRA 1WIPA 5FDYA 1NCBH 2B20A 3DWTA 3U79A 2A38A 3IRZA 3F7PC 4JFDE 3NZHL 4QWWC 3PQYE 1EEZB 4MJ5A 1TVBA 3T2QA 3TBYA 2P7TB 3PV6B 4EOWL 4LNRA 2AJSH 1MFCH 5GGVL 1MI5D 4CMHC 1Z3GH 4GKZB 4OLEA 3P30H 2DDQH 3CH1B 1FCGA 3O2DA 3T65B 2VDRL 4XNXH 2XPGB 4KDTA 3MLYH 4HJJH 1CCZA 4P46D 2JK5A 1I1FB 5GRXG 3PWPA 4LMQI 1NC2B 4ODUB 4G9FA 1AQDB 1QQDA 1EIBA 3NFNB 2BVQA 5ITFA 2D7OA 1UJ3B 1QSFD 1CFQA 4QF1A 4U1SB 4YHML 2YK1L 1Y18A 4GAJL 2X40A 1CBVL 3FB7B 2X4NB 1KTDA 1FYTA 4JPVH 2FYYB 2X4RA 1DUZA 2DQCH 1J0ZA 5E9DE 5JIPA 4QRRA 5IBLC 5FOJA 3SY0B 4YPJA 1A64A 1AE6H 4GBXC 5AYQA 1EHLL 2VXVL 3P73A 1CXHA 5CCKL 5L9DH 5CEZL 2XFXB 3CLFH 5E2VL 2W0KA 3QDGD 5C0AD 4DCQA 5E2WL 3LZFH 2IBZX 4UOW0 3MV8D 2OQJB 4D0DB 1QSEE 3E3QE 2GUOB 1S5IL 1OTUC 1T4KB 4EDXB 1XCTA 3AB0C 4M8VA 4S1SH 3QO1A 3HE6A 3ZKQD 3D0VB 3QIUA 3RIAF 5A2JH 3P11H 1TIUA 4G80A 3EOYG 3QEQB 4XI5C 3ARPA 4PJ9C 4DKAA 5GGRB 3LEYH 2VDML 3MLSL 4U6XA 2J8UA 2GKIA 4UQ2A 5LBSL 3HUJE 1EA9C 5TDPB 4ALAH 5CKGA 2UVEA 3BJLA 5GS1C 2DL2A 4HJ0C 3QFDA 1A9BA 4IIQA 5DFVD 3MLRL 1NLBL 2D7QA 3R06B 4YLQT 1HDMB 3BW9A 1H3VA 3RZCB 1ND0B 1CFNB 1T04A 1DVFA 1CFVH 2DKSA 3KJ6L 4IRZH 4JDTH 3SQOH 3OR7A 4LRIA 1A6UH 4KGJA 1NBQA 4KAQL 1LEIA 3EO0A 1KYOJ 1DTUA 2BNQD 4DGVH 4LKXB 1YN7B 5C9KA 4NYLB 5D6CA 2LV4A 5DDHA 1R0AH 1L6XA 5JW4Q 5DO2C 1INDH 2XWBA 5IVZA 3WHE0 3RTQB 3RU8L 5E8PA 1Z0MA 3RFZC 3TZVA 1CS6A 1QO3B 1NGXA 1JZ4A 5ISZE 3RL2A 5DJ6B 4K07A 3CCHB 2EIZA 4F2MA 1VACB 1J5OH 3MRKA 5HPMB 5IIEA 1T0NB 1U0QA 5F8RC 5BS0B 2R0WL 3K8MA 5INDA 4QRQB 1UCBH 4WW1B 1WTLA 1HOCA 4QRPA 4Z76A 1U3YA 1ULVA 1LK2A 3AREA 4AT6A 1NGZB 1OWWA 3RX7A 3L95A 4ODVL 4JE4B 1G6RA 3UJJH 5I1AB 5T3XD 3CU7A 3HE7B 1P7QB 4XGZA 5HD8D 2GJ6A 4XMPL 4NO5A 1W0VA 3RWHB 4KROD 4R0LA 2VO5A 2X09A 3TBVB 4XVTH 1T1ZB 4ZPTB 1BLNB 2X1OA 4XBGA 5HHXH 3D18A 5GGQL 3BGFB 1XF3A 4WNQA 1F4XH 4QRRE 2X4TB 2PW1B 3G08B 5BRZD 5T5FL 5J1SC 1UJ3C 4IRSA 2AJYH 1E4XI 5TE4H 5FK9A 2CIIA 4W4OA 2DMBA 1W2KT 3ZO0A 3ILPA 1NLDL 2XTJB 1J8HD 1A3LL 2KQMA 3VFRA 2OTUA 4P2RD 4C83A 5E0QA 5JO5B 3LHPH 5ESQB 3RL1A 1RAMA 4ZMAT 4UT6H 4ZXBA 3MLTA 5E2TL 1N8ZB 1INEH 3BIKA 1I1AA 4QRUA 5FYJD 3QUXD 2XRAH 3GHEH 4G8GD 1VFMA 4PJ7A 5FYKL 4E9LA 3LIZH 3WO4B 2X5PA 1QFOA 3H42L 5CGTA 5AZEL 4OZFA 5DRZB 3HNSH 2EDTA 3F12A 4GW4B 2DQFB 4FQJL 1SEQL 3GJFA 1PZ5A 4PRPB 1T0PB 2AP2A 5TQ2H 2Y23A 1KF9B 4L8BB 5EBMA 5HGBA 1I85C 3TBTA 3V5HB 1NJ9A 4WFGD 1JL8A 4NDMA 2AI0H 2FGZA 5DUPH 2FJHB 3NVQA 3QULB 5HHNB 5GS2H 4TPRL 1FNHA 1YMMB 5E6IA 3DX9B 4OV5B 3BIBX 4HFWA 4P57A 1U58A 3NCEB 4C55A 5ETUB 3OV6A 2IAND 2G9HA 1E4XL 1S8DA 3B2VH 4FHBD 3GI9L 3HC0B 4BSWB 1AD9A 2OJEB 3ZE0E 3VFSA 4PBXA 4BZ2H 4LHJB 4V1DA 3GFUA 5FKPA 3C8DA 3KLAB 5BVJB 3NCYS 4JFHD 3RZCC 1HZHL 5I1LB 5LGKA 5F7NC 1VADA 2OSLA 2W60A 4FZ8H 1B6UA 2PYFB 3U82B 3QISA 1FIEA 1BEYL 2RIKA 4HXAL 4M61B 2NZ9C 3HFML 3SDDD 3RTQC 4YBQD 4QRPE 3T0XA 3BEVB 2DAVA 4PGDA 5F6HI 2AS5M 1PG7H 3K1KC 3B9KB 1REIA 2H6PB 4HK0A 5F89B 1L9NA 5C09D 1FFNA 3V79C 2GJ6E 5ESVB 3LV3B 4Z7WA 1Q9LA 5KOVC 4NZUH 1PZUB 2JE8A 3ARGD 1FG2A 2BJMH 1JN6B 3IRPX 4KHTH 3DUSA 3PWNB 3SE4A 4XP4H 4HBCH 2ZKHH 5LQBH 5TDOA 2FO4A 1CICB 1W8OA 5C0ND 3R1GH 4NRZB 3O81A 4RFEA 3HE7C 1E28B 1KELH 1Q9OB 1LHZA 4UDUB 3QXAB 2W9EL 4YHPA 3VDAA 3BGFC 1CF8H 4Z0BH 1OWRM 4NQEB 2AABL 3X14B 4OAWB 2PO6A 3DXAE 2ADGB 2APFA 3NFSH 1WT5C 1J11A 3C60D 2E7LA 4PJ7E 3GSVB 3W11D 3O6MH 3TJEL 4C56D 2WANA 4NQVB 2BY1A 4NNPL 1CGWA 3MRLA 2XTJC 1YPZF 3VGDA 3BWAA 1BZ7A 1T1XA 4PFEA 4XX1G 4XPTH 3EO1A 4WFFD 4J7RA 3L6FA 4MJ6A 4WTXA 5HYSA 2VDKH 2OL3A 3UBXB 5F1IA 4DKDC 3K3QA 1T7YA 3WIIH 2EDKA 5C0IB 3WO4C 1HHHA 1CE1H 3KHOA 4PJDB 5FUOH 1FZMB 1NCAH 1FP5A 2IPUK 3QUZB 3MV9A 1MOEA 4I3GA 4RAUA 3ZDZE 2HFGH 1D5IL 1OVZA 2VDNL 4UBDD 4X6CF 2OP4L 2B0SL 3HUJF 4HGWA 4OF0A 4M8QA 3HPJB 2F54D 5GIRA 1TXKA 2ICWA 3IDJB 5M95B 2IH3B 4RAVB 1S7TA 4R7NA 5SX5H 4MNGE 4JN2A 4MAUH 1IC7L 4HG4J 4Q9CA 3SPVA 3UROR 1JP5A 4U6VH 5A3IC 4LSRH 3X3GH 1AO7D 3OB8A 2R56L 3EDKA 3MUHL 5J6GA 3MYJA 3OPZL 4JRYB 1KEMH 2P5WA 4HIHB 3P3YA 4JFQA 1JF1A 3MACL 1LDSA 2NY2D 3INUL 5F1OB 3BEWB 3QUYB 4KMTH 3WFHA 4KK8D 1BVZA 4PJGF 4RMSA 2YR3A 4JG1H 4IS6A 2Q76B 3QP3A 4R7DB 4BFBD 2EDDA 3QWRD 4HEME 1JNJA 1WFOA 4MS8C 2QQKL 3ULVC 3OXSA 5FUZH 2DYPB 2I9TA 5F7LB 4HS3A 2LABA 1QBLH 3E8UH 1HHKA 3QXVA 2R4RH 5I17B 4HK3J 1RZGB 2XA8L 2BVUA 5GS3A 4NUJB 1A1MB 3TIDB 4NPYA 5EZJA 1AGDA 1U8PA 2WWMC 4LLWA 3B9KC 5DSCA 4JKMA 2X1QA 5CIPH 4S1QL 4JRXB 4G8EB 1I8KA 2EO9A 5ESAA 4ZUVB 4XCEA 4F37F 4N5ED 4Q2ZA 4Z7OE 3M8OH 1FNFA 1CD0A 1MCPL 3L3OB 1CICC 3I02B 2QTEA 4G9DA 3WL9B 1S5HA 3WFEH 4FQCH 3N50A 3GKWL 4OFVA 4UTBH 5LAXB 3VCLB 3HG1B 4UUJA 5IMMB 3SOBL 2QADD 4HWZA 1NH6A 2OCFD 3C5JA 5IB5A 2FX8H 4IBLT 4NHCL 3KNBB 1AY1L 3OF6D 4U1NA 5E99H 5INCA 2DMKA 3GUTA 2ZJSL 4NKMB 1TVHA 2F19H 3HAEB 2ZCHL 3MV9E 4BFEA 3WSQL 1UM4L 3MRHA 2J8UF 2BSSB 3D39B 2J3SA 3RWJB 1TENA 2CRIA 4KQ4L 5HVFB 3O3UN 1YEFH 3L3GA 3TVMD 3D3VD 2YD4A 5L6YH 2NYYD 3ZTJH 3KPRA 5KSAD 4JN1H 2V17L 2OL3L 4LCYB 2F5BL 1GGUA 3QUZC 3W9EB 4ISVB 3IDNA 4PB0H 2HTLC 2X70B 3DYMA 3VFMB 3LMJL 4K8RL 2W38A 1DN0B 5F7UA 4M5ZL 5E08L 4BFIB 1RVFH 4G8FA 5DQDH 4MMZC 2EDLA 5EZOH 3ZKNC 1Q0XL 5BVPH 5D1XD 4BK5A 2RCSH 1DQQA 5DRNA 1XGTB 4OLXH 3KPQA 4M6OH 5C0JB 3BRFA 4Y2OA 5ENWB 1KJMA 5DMKA 1G7HB 1VFOA 1A0QH 3QO0B 4I9WD 4CADB 1LNUA 2EYSB 3UC0L 2PETA 5JNYB 3GJEB 1EBAA 4DQOL 4RNRA 5EORL 2HT3C 1A22B 2R0ZH 5F3HB 4ZUWB 2YA2A 4P2OA 4A6YH 3HI1B 4Z77A 3NPZB 3V6OA 5IOPA 2V5RA 3Q6FA 4Y19E 2HTKC 4KPHH 3CPLA 5GGSY 4WHTA 1C5DB 1MFAH 3BPOB 4K3JL 3R8QA 7FABL 2YBRA 5MEQB 4Y4FB 1ACZA 3QUYC 2DLTA 2BY3A 2WQ8A 3MYZA 2X4SB 5HI3D 1MPAL 1F3JB 2QQLL 4MQSB 1FVCA 5F9OL 5T1KD 2DKMA 3P4MB 4LCWB 5IF0B 1PG7W 4RGND 3VFGL 1INQA 4ZAKB 4UV4H 4Z0XB 2ZCLH 2YXFA 2HP4A 2I5YH 2R29L 4M00A 4KZDH 3HI5L 4ZQKB 1SVCP 4HAFA 2OK0H 1ZGLB 1YQ2A 3FQWB 2IADA 3VH8A 5C3TA 1YZZA 1FSKB 5L2KB 4BH8A 3WHXA 3IAGC 1Z9MA 1AD0B 4LLDA 4IRJB 4XTRC 3CVIL 3MRDA 4MSWB 5F9AC 3NH7H 4CJ0A 3QDMD 1W0WA 4U1IB 1RZJH 5FA4A 5FYLH 5F7FA 3LPFA 4GRWB 1Y0LB 1UWEH 1CDYA 4KFZC 5KSBB 4PJ7F 3GGWB 1OSZA 1KB5B 1F42A 3LAFA 1JPFA 3GHBL 4CKVX 4KI5F 4NBZB 4BH7B 5K9JH 3GK8L 5J1TC 5C2UB 5I1KL 3HZVB 2D7PA 4RFNB 4HS6A 4NNXB 3PIQB 2FIRT 3D1MC 3LQMA 3VXMD 4EKXA 1JZ7A 1LD9B 4P4RB 1MCFA 5I1GL 4QOKB 3KLDA 4X7SL 3FFDA 1NBZB 1K8IB 1X4XA 4KY1H 1JHKL 1VERA 2UVFA 3ZE2F 3TESA 1JTPA 3VFNA 5IT2H 3A6BH 3EDDA 4O2CB 5T3XH 2EYTB 2VZVA 2VLRD 3VI3E 3HZYA 1C5CL 4IHOA 3KPRE 4IM8A 3SE8H 3D85D 4OKVA 3LDBB 3ZDZF 1KC5H 4ZO8A 2KUTA 1WAAA 3WDIA 1JK8B 2ED9A 3C5ZB 3UTTA 3V0AC 1CU4L 4PGCB 4JVWA 1JGLH 5D70H 1ZLWH 3AS1A 3QUKA 2HJFB 3FOLB 4NCDA 4DKFL 4PJIA 3G5ZA 3W2DH 5EU6D 3DGCR 4X0KB 5TE6H 5IM7A 2IGFL 1N5YH 4MJIE 4U7SA 3CZJA 5IVOA 2NY5C 4PJAB 1QKZL 4ZNEE 2Q7YB 5I1HH 1Z2KA 5KVDL 4OFPA 1MJUH 2R1XB 5BV7H 2XKSA 1QG3A 2ZUTA 3P9MB 1CD9B 1DL7L 1WBYA 1BAFL 4X4MA 2Y36L 3QCUH 3ZHLA 2NR6C 4XVJH 4ENEC 4NFBA 1U91A 4YFLI 3D2UB 4NQTA 2AV7A 2XNAA 3DO3A 3QNZA 1QLRB 4JKPH 4LDLB 1NKOA 5JLZB 3IXTA 1DQJA 5JOPE 4DVBA 1OTSC 1KJ2H 3Q5YA 2OBGA 3P2TA 2IQAB 4PG9A 4PJCB 4LU5H 2ZPKL 4Z7WF 4J2XA 3AVEA 4DK6A 2R8SH 2H41A 4N1CA 4Y4FC 3ARBA 3GO1H 4YDKL 5J1AA 1CYGA 3JUZA 3G9AB 3SKJH 5SX5K 1G7QB 2ED7A 3O9WB 4F7PA 4QWWD 4GMTH 1FG9C 3X11B 1UQSB 1NCNA 3WUWA 4U3CA 3PHQB 5T3ZH 4LF3A 4MDIA 2ZP0T 4Y8AA 1WFTA 5T5NG 3UTQB 3ZDYE 3SKUD 3GSNB 5HSFA 5L7XL 1H8OA 2DLIA 1CL7I 4QTIH 5FCSH 1LO3H 4CN4A 1EO5A 3KDMB 1CFBA 2VKXA 4I4WA 2CDEB 1PEZA 1NDMA 1FSKC 3DGGB 3EOTH 5C0EB 1EK3A 5T1LB 4GRMA 5J6HA 5KANG 1CLZL 5BZDA 3BDBA 3LH2H 4IRJC 2HLAA 5F7DB 3MLWL 3GMNB 5TDNB 1LP9A 4MAYA 5HI4C 4QRTB 4RCAA 1NBYA 3P0YH 2VLJA 5FF6B 4AIZA 2C1OB 2IH1A 3S4SG 1HI6A 1WWBX 2GAZA 4HK3N 5CBEA 4JEGB 1NPUA 2NY7H 5IBLD 3MRGB 4MA1B 1CD8A 3UTTE 4XC3H 1GHFH 4GBXD 5HVHB 1MF2H 1A9EB 1YNTB 3HNVH 2EH8L 3E6FA 4GAYB 5HYIA 2BDNL 1FGVH 3WXWL 3RRQA 1VEOA 4PJIE 3IS0X 2BHZA 2BSTA 3BVNA 2ITDB 3L7EA 3LDBC 4JFPA 2PTTA 3S37H 1OTUD 5DWUH 3IDGB 4OZHE 4YDVB 3BYTA 5D7JA 3C5ZC 4PB9L 3UPRB 3SDXB 3KYNB 1CL7L 5T33H 1EXUA 3PP3H 5MENB 2AJ3B 4D8PB 4P5TA 4IOIA 4XAKE 3UTSA 4XPAL 2A83A 3RKPA 3CVHB 4RDQF 1FL6B 5ID1B 3OJ2C 2XKNB 5L2JA 1KULA 4TNVF 1OLZA 4HZAA 4X4ME 1DANU 3WEXB 43CAA 2J8HA 4MNHB 4X5WB 2Q8BL 1X4YA 2EDJA 1OAXL 4HJ0D 5EU5B 4HT1H 3OAUH 3ESUF 2W92A 5ADPL 25C8L 1A3RL 2EDHA 1RZ8B 2JTDA 4DTGL 1O5DT 4KTDL 4G5ZL 4OUUB 4PP2A 3TM6A 1F4WH 2IALB 3OJDB 1X7QB 4F7EB 1RUPL 5DJ8B 2DQIH 3GSQA 4XXCA 4ODXB 2C5DC 4PV8B 4WGWB 3QFJD 3HA0A 5E7FA 5F97E 3GNML 3SN6N 3BAEH 3RIFK 2AXFA 4UB0H 5DO2D 1E27A 2BNUA 2JELL 1AKJD 1SM3L 1OCWH 1U41A 4XP9H 5GJTH 5I18H 1TZHB 4NRXA 3RWDA 5J12B 5ALBH 2PW2B 1UACL 3T0BA 2OJZH 1HXYA 3QNYB 3K1DA 4NP4L 5BMFH 1JF5A 4NKIL 5HHMB 3O9WC 3QIBB 3IGAB 1FV1A 5CJQL 3QI9A 1A6VL 3PQYB 5EO0B 1WJ3A 1HHJA 2P8LB 1CGUA 4M9OA 5FYKD 3RBGA 5C9JB 4DUVA 3RDTB 2FJFA 2HFFB 4XPGH 4G42A 1ONQB 2SEBB 4ETQA 1QFUH 3K8KA 3VGBA 4YXKL 4XP1H 2I60H 1NC2D 1F11B 3U0WL 3EYVA 8FABA 2YPLB 5E8DL 3BQUA 1T7ZA 1AGEB 3O2WH 3BKYL 4U1GB 5DUML 3KPSB 3RBSA 3RNQB 4K3EH 4WO4B 3AU1B 2VR4A 5SWZE 3MODL 5C92A 1J0JA 2ICCA 1J05A 3UMTA 4YUEH 1Q9WA 3VI3F 1WCQA 5IESH 2VQUA 3OB0K 3KYAA 2J5LB 5E9DB 1JNNL 2FLBT 3C87A 3G6JE 4OCLC 2D9CA 1OGAA 4YE4H 3BPCB 3T4AA 1YEDA 4NSKB 4U3HA 4MA1C 1EMTH 1H0DA 2A1WL 3VD5A 2VLME 4G6JL 5I1EL 5HVHC 2P1YA 1FIGH 4M93B 4BM7A 1GXEA 2MOVA 3TCXA 2NX5A 3ELAT 4F8TA 1J1OL 4WU7A 2VAAB 4AEIH 4QXTB 4BZ1L 2A6IA 4NO0B 1ZHNB 2A74A 2EYRA 5B3JF 3PUCA 3DV6A 3RPIB 3DMMB 4ZTOH 2GT9A 4WI8A 1IM9B 1NAKL 1QSEB 5SWSA 2BXYA 5DJ2A 3CFEB 1FNEA 1R3IH 2FBJH 3H9SA 5IMLA 3CUPA 1UYWH 2X89A 1D7FA 1GAFL 3QEQD 3IU4L 4Y5YA 5DVLA 5B8CA 1JBJA 4WJ5A 5FHAH 3SDYL 4OLUH 1HEZB 1R3HA 1CT8B 1JWMB 1W72B 3U48A 1YY8B 4QHNA 5KSUB 3T04D 4HWBA 4KK6C 1CLCA 1X5KA 1ERNA 3GRWL 5D71L 4FMFA 3WFDL 4KK5C 1MCIA 2XQYK 3GMLB 3WFCL 4N8CH 4LEXH 3OJVC 2W0PA 4L9DA 5E5MB 3BZFA 1D5ZB 3KPMA 1DE4B 5DFTA 2DKUA 3RZCD 1JPSL 4N90D 4E5XB 1WBZB 4TN9A 2VXTH 1AGCA 4EBQL 5DUBA 5IHUL 1V3JA 4OCXH 2X7LB 5DZNA 1CIUA 3DHJA 3MRMA 2NZ9D 4LLYB 2QJDA 4UOJA 1IBGH 5D93B 3RTQD 4YFLF 4E41B 4UDTB 4LDEB 4BKLB 2FJGA 2IF7A 4HUUA 5J12C 2CLVB 1BGXH 2DB8A 3RWCA 5LGHL 2D4FA 4UIKH 1RUAL 1T2JA 2BVTA 4LPYA 5ISZB 1MHCA 3QIBC 1EHAA 4I0PA 1G9NH 5BS0D 2A6DB 1VGEH 1RULH 4DGYH 4XT1C 1TPXB 3T08A 3VGAB 4NCC2 1YEEL 2LVEA 3O6KH 3RDTC 2FATH 2DI9A 4YHNB 1ZEAL 4ORGB 4ZSOA 4NKOB 2VTFA 4JFYB 3HE7D 2JJVA 4LEOA 1P7QD 3NIGE 3VFOB 1DEEB 1IGMH 4FQPA 2E7MA 5CZVH 3AY4C 2CDFB 3V5DB 3EFFB 1WAAF 4Y2DA 4U1GC 1CQYA 2HAZA 4JFFE 1SBBA 1C5BL 4QRRB 2ESVA 2DQTL 4WO4C 2PR4L 1PYWA 4FMKA 2G5BB 3DVGA 3ULUE 1IKFH 4PGZA 5F7WC 2NX5E 4WWKB 3U6RB 1WV7T 2XTJD 4PJIF 3SGDI 3REWA 4GKSB 4PRDA 2J5LC 1JHLH 3T0DA 1JNHB 3GB7B 1FNGB 4MWFB 4S2SB 2EXWC 3I50L 5SWSE 3DRTB 1O7SA 5A16A 5DD6B 3QXDA 1GGBL 4M93C 5IG7A 4KXZI 1GOGA 2FH6A 1B0GA 2V9TA 3KPNB 4MCZB 4MJ2A 1TNMA 1CE6A 1VFUA 3ECBB 3WLBB 5IMKB 4U6YB 3RNKB 3RQ3A 3DRQA 4MQ7B 1OSPL 4PRPD 4OT1H 3MXWL 4YO0A 3E3QC 2VE6A 2WLYA 4TUJA 1PG7X 1GC1C 3O11A 1I8IB 1HN1A 1CLYH 5ANMA 3H7BB 5JDJA 1Q38A 2FNBA 3LRSB 4LARH 1OHQA 1YMMD 3T2PA 1OW0A 5EH1A 5A3ID 4OSUL 2AV1A 3BW9B 3P9LA 3FFCB 4M48L 5EOCH 2W9DL 1QR4A 4DOHE 1DVFB 5IGXL 3WFBH 1X44A 4NZRH 3H9YA 5J3HC 4NM8H 1N5AA 1UZ8B 3ZKMC 2NTFB 2OR8A 4XP6H 3JTSB 3D9AH 3ARWA 2VL5A 5D6CB 3SDAA 4AMKL 4HPOL 1ACYH 3EGSB 3OKMA 2QSTA 3OKEB 5I0DA 2H32B 4UV7L 3DPBA 5CP7A 5E8PB 4NKDA 5I1IH 3KG5A 2BVPA 3TO2A 3OKDA 3LKNB 1ETZA 4X7TB 4ZNCD 5HGHA 4MS8D 1WZKA 5IFHL 1LO0L 5J0BA 3U36A 4LBEB 4OGZA 4EI6B 4JLRA 2BSED 1KB9K 2G2RB 1XMWA 1RJZA 4LSTL 3W39A 5D93C 5HHOA 1HOCB 1LP9F 4Z76B 3WLWC 1BX2B 2WWMD 5GJSL 3DTXA 3B9KD 1TJHL 5CD5C 5EBGA 5JA9A 1BF8A 5IJKC 5KVFL 4ZTPL 2NNAA 1W72L 4M43L 3PWLB 5I73B 3KPPA 1S7VA 5KG9B 4GAJH 2E3VA 2GITB 4YHYB 5JOFB 2YWZA 1TPXC 3VGAC 5TF1L 1CDJA 3DOSA 4WNQB 3MCLL 1S9WA 4HC1H 3QJFA 1CICD 4ONFL 3QHZL 1G0YR 4OZGA 2ATPA 2VUYA 1AXSA 4KVCL 2QBWA 4PJ5A 4LHQB 2VXVH 4BQ8A 5CCKH 1RMFL 1J0HA 3RX5A 2GEEA 4FQIH 1RD6A 1KPUA 1ZSDB 2JCCA 2VSDA 4NQED 4L3AA 1MJ8H 5C0RH 4UU9A 3VWKA 1KCLA 3DXAB 3K8LA 4X7CC 2BHUA 2EE2A 4WWKC 4EUPB 5IQ7H 2W65B 1IM3B 2VIRB 1YC8A 2PTUA 2IAMB 1K4DB 4BUGA 5EC1A 1U95A 4GXUM 4XCNA 2V2WA 2FB4H 2YZ1A 5JDSB 4XBPA 2YEZA 4L5FH 1HILB 3BUYA 2PCPB 3BFOA 4QXGL 3MLSH 1IQWL 3BE1L 3QWQB 4U33A 2XWJB 1BQLL 2B4CC 1K3IA 3QDJA 4MGXA 3QUZD 5I1CL 1LGVA 1T7XA 4QHMB 4U0QB 2MMXA 4ZOBA 2HTLD 3VXPB 4P4KB 3MRQA 5GGRY 4GW1B 5LKNA 4WFHD 3ZKND 2CKBA 1NAMA 2XZQL 1FE8L 1MFNA 4OBRA 4OM0L 4LNVA 4F7TB 1RZFH 3UYRL 3QEHA 3FTGA 4X98A 3U2SB 1EFXB 4PV9A 4MNGB 3KLHC 2BOCA 4QY8A 4S11A 1B88A 5CILL 5DTFB 1L0XA 1IEAB 4XNQA 2P46B 1DVFC 4M03A 5IW1A 2HTKD 4KUCD 1CFSB 2R4SL 1FC1A 4JRYD 3LN5B 4ODBD 5GS0L 3ZL4L 5DMJB 1A1OB 1MEXH 1I3VA 1UFUA 3QUYD 5HHOE 4PS4L 4AM0B 2BMKA 3IDMB 3PGCA 1KLUA 1S7WA 1SYVA 3FT3A 1BJ1H 4GS7B 4RMWA 3TZVC 4Q9RH 3SDCB 4XVSL 3UAJC 2ATKA 5ADOH 2DYPD 5J06A 1MLCB 3BH9A 2AJUH 1RK1B 2UWEA 4N8PA 2FR4A 2W91A 1MQ8A 2ORBH 3B9AA 4ODVH 3ETBF 5DJCA 4I18A 4F58L 1IKNA 3D25A 1HSBA 2O5YL 4S1RL 3U0TA 3EJJX 2E9BA 3VFPA 2CH8A 4H1LH 4JY4B 3CGTA 4LASH 1H3PH 3QNXA 2DQEL 1T89A 4JRXD 4PJ5E 3L3JB 4XTRD 5E4IA 5I73C 2EH7H 1K9TA 1JTOA 4YHYC 3THML 5KS9F 4WWID 3HLAA 3I6LD 1NLDH 2JCCE 4YHIB 3SEPA 4ZFZB 43C9A 3KWWA 4YR6A 2PO6B 1UH3A 4CU6A 4N8VG 2X1XR 4NGHL 3CDGA 4C4KO 5C0BA 3H8NA 1NANH 4KKCC 4N9OB 3ROOB 3HG1D 5GRWA 5FYKH 2HVJB 3IJHB 3BYYA 1KN4L 3C8KB 3H42H 5CEYA 3WXVH 2QSVA 3HMXA 3FO2A 3L5JA 4LVOB 1U8LB 5IK3A 1S7UA 1YYML 3PF2A 5F9WB 5D5ME 2V7HA 4FTVA 1JTTA 3QDJE 4O2FA 1ZTXH 4KRNA 2IAMC 3CMGA 2I9LB 4K23H 3D39D 3ME0A 3LEVL 5HHQB 1QYGH 3X3FH 3L5WA 4HWEL 1WTGT 5HDBE 4OIIL 3O3DB 2Y25A 4G3YL 4HIJB 1ZANL 3MRPB 3FQTA 1U8NB 5IJVA 4G7VL 3GI9H 2YD2A 5I16A 3SPVB 1BFOB 4I8DA 4P4KC 3QRGL 1B2WH 3HN3A 4OD2B 1ZHKA 5I66B 2LQRA 2NLJB 1IGFH 3IU3A 2DM7A 1HQ4A 1I8LA 5CBAA 2F53A 1NAML 3F5WB 4ELKB 2NR6D 4K2UH 4NUGL 4ENED 4JZNA 5F3BB 1FNLA 3SCMB 1GIGL 5EU7E 1DJSA 3MRBA 32C2B 4YHKH 4H26B 3U9PL 1A4KB 5FA3B 1ZLVH 4Y19B 4LCCA 4M1GL 3TWCH 1NCDL 1ZAGA 4U31A 4NZDA 5F72S 4D9RD 4L4TE 3VXQA 3OGOE 3MRJB 4Y4FD 2G75A 2FDBP 1KIRA 3VD9A 1I1RA 3BZ4A 5EWIH 1SJEA 2LVCA 4GS7C 1LE5A 1JWUB 3SDCC 4X6DB 1UWGL 4PRBB 2APWA 4LCWD 1IC4L 1UJTA 3DROA 4J3XA 5DJYA 4LPWA 4LLWB 5F96H 4ZAKD 1HINH 1IAOA 1S7XA 4ZODA 2NPLX 3NTCL 1P84K 2Z9TA 3P0VH 2I07A 3IJYB 1WCBB 3BP4A 1K6QH 4X4XB 1OOAA 3LEXB 2PN5A 1NFDB 3NA4A 1ED3A 4NFDA 2MCPL 3UJIL 3FQUB 3VI4E 1P7HL 5FB8A 1V05A 2L0DA 5L2KD 2AJXL 2W9EH 4GQ9H 2CK2A 4YK4B 1KLGB 4OCWH 4Z7QE 4Z7UB 4IRJD 5EIIB 5DK0B 5CD3A 5JOEA 1C12A 4R2GB 5FO8B 2AXHA 5HI4D 4UUJB 4Z7VE 1YEKL 3QQ9C 4PUBH 1TJGL 3DV4B 4RX4A 5DHYB 2PO6C 1HQRA 1DQDL 3IFLL 3S96A 1T03H 4LOUC 3T2OA 1VENA 2I25N 4YGVA 1ZWIA 3MRCB 2E9WA 3QT2A 5ITBL 3LN4A 5INCB 4OF6A 3GUTB 1MAML 5HDQL 4QOKD 5EOCJ 2BOBA 3VGEA 2RHEA 3DSFL 5DXWA 5FECB 1DR9A 3P4NA 1AQKL 4LVOC 1RHHA 1V3LA 4X4ZA 5DK2A 4ZFFA 4QLRA 5KZCB 2OP4H 4NO3A 4JFEA 2J2ZA 3M17B 5TGBA 4YPGA 4L3EA 3C5ZD 2HFEB 1P1ZA 3B83A 5IB3B 3IDNB 1YA5A 1T83A 4J6RH 4POYA 2QL1A 3FAXA 4FQ1H 4WI5A 4D9QD 2AJSL 1MFCL 4J8RA 2HKFL 4MA3A 1KUMA 1YJDH 1Z3GL 1HXMB 3WFZA 1WIUA 3P30L 3NBNA 5IB2A 4UILH 4XNXL 5DQ9B 1BQHB 2CR3A 5TQ0H 3MLYL 4HJJL 1XF2A 4MJIB 5E8EA 3ZHKA 4N9GA 1D6EB 1KPRB 4P2OB 2Z92B 3H9HB 3KPOA 1KN2H 1F45A 3AUVA 2Y5TB 5DD5H 3T8XA 2FO1A 2QHRH 3B9DA 5HY9A 1XGUA 4NO2A 4G7YH 5B39B 2WSKA 12E8H 3D2UD 3SCMC 5GRJH 4JPVL 3KPTA 1XGRB 2DQCL 3B8YA 3FRUB 5D7LA 4ONHB 4PJHE 3TV3H 1G7IA 3S6CA 3O4LA 3MFFA 4S10A 2IG2H 5EC2A 3CU1A 2WLZA 3C9NA 2DIAA 4P2QA 1N64L 5CEXB 1AE6L 4HMEA 3KYOA 3O9WD 2HT4C 5L9DL 4R4BA 3QZWG 3I84A 4WEMB 4OZGF 1MLBB 4WUKL 2XG5A 3LZFL 3QQ3B 2GSIB 4NBYB 3EOAB 1U8HB 4P9HC 3HRZB 2VNCA 4XCFH 1Q9KB 3U46B 3VMOA 3MCG1 3ARXA 2APBA 1YUHA 4Y4KB 3WKNA 4OF3A 4KI1A 4S1SL 1DBKH 3S37X 3FCTB 4RQQA 4ZFGH 3ZDXF 4APQA 3V8CA 4CVZB 3HZKA 3P11L 4ERSH 1CDBA 3ULVH 5CSZA 5BQ7A 1MJJB 4QHLA 3UX9B 4XB8A 4YK4C 1F90H 5T1LD 4Y4HA 5FGBA 4PRNB 3LEYL 1JMZA 4NHCH 4PRIB 3UTPD 5AG9A 4H5SB 2O61B 4R2GC 1EFQA 3L3KA 4WV1B 4ALAL 2CUHA 3FQXA 3TN0A 2HN7A 2C26A 4GAGH 3PWUB 4NBXB 1N7MH 2QKIA 4YHZH 1WBXB 1CFVL 2J1KA 3JTTA 4HF5H 4IRZL 4JDTL 3SQOL 2N7BA 3DBXB 1A6UL 4KQ4H 4QCIB 1J10A 1ORQA 3FMGH 3VRIB 5FM4A 4X8XA 3RY6C 5JIKA 3MRFB 4HUXA 5JPNB 1BMGA 4L9LA 4P9HL 2F5BH 2NW2A 5CMAA 3HHRB 1INDL 1JCKA 3CSPA 4FQ2H 2B1AH 4PLJC 4H1LG 3LMJH 1HH6A 5BJTA 2P8PB 1RUKH 5BZWB 4M5ZH 5GGUB 1ADQH 5FCUH 3MGOB 4I2XA 1Q0XH 1IVLA 5IM7B 1BJ1J 3MNWB 3OKYA 3VXUE 1Z5LA 3S3PA 4OZHB 3OJMB 3MV7B 4XXDA 5MEND 2YUXA 1UCBL 4NQSB 3MMEA 4NNYA 4WUUB 3RVVC 1FNAA 1JZ8A 2E8ZA 1MRCH 5D7KE 3G6AB 2ZWLT 4HKXA 4KK6D 2K9UA 4OD3H 3DO7A 3VMPA 1WBYB 3UJJL 1YMHA 5ICYA 4K3JH 4MB4A 1FQ9C 1ZHBA 3JWOC 5GISH 4KK5D 4C4KT 5IHZB 3V2AR 3VFWB 1KTLA 3VFVB 4P2OC 5D7LE 1U3HB 2VH5H 4XVTL 1WVZA 2UWEF 1T1YB 3MUGA 4CMMA 4CW1A 1SY6H 5HHXL 1DQJB 4BUHA 4DFHA 5JUEH 1F4XL 3O4LE 3R8BB 3CZFB 3CFJA 2AJYL 3QEUB 4MQTB 4P2QE 5TE4L 4OZ4A 5E00B 4D0CB 3ARBB 2CKNA 4XZUA 1LILA 5J1AB 5JHDB 4H88H 1II4E 4XBEH 1IGYA 4MXQC 2C3GA 4P5MA 4ODHH 4MLSA 4WW2F 4J1UA 3QG6A 3U4BH 5E8OA 3LHPL 1FN4A 4WI9A 1K2DA 1GJIA 4NC0B 4UT6L 4F7MA 4KUZH 1FL5A 2GY5A 4JCMA 5LXGH 2P45B 1MVUA 3FQNA 2XRAL 3GHEL 3KLSA 5HHMD 3W9DB 4DZBB 4XPFH 1RFDH 3QIBD 3BP5A 1DEDA 1MJ7H 4UMGA 5MHSE 5E56A 3HNSL 3HCVB 3PQYD 1LDPH 3FN9A 2WBJA 5DEGB 2X42A 3UYOD 4YXLL 1PX3A 3RDTD 4Y4KC 1I7UA 3T3ME 4M5YL 3JV6A 2BC4A 2AI0L 1OGTB 1RUMH 3L3DA 4PJ8B 5DUPL 1U9KA 2BP3A 4XNYH 4YBHA 1NBYB 1HH9A 4X7SH 3O3AA 4PJXA 3HZMA 3B3IA 4MNQE 1MHEB 1TCRA 4X4YB 2YPLD 3C5SA 3RUGA 5IVNA 3PJSA 3ARRA 3FL7A 3QYCA 1UZ6E 3KPSD 2GY7B 1YEIL 4NT6B 4JDVA 5I75B 3SBWC 5I15H 1C5CH 4WO4D 3E6HB 1QPXA 3V6FB 2OTWB 4OGXL 2WUCL 4U1KB 4AY0A 3MRNB 1MNUH 4BZ2L 5SWZB 1DBMH 3S4SA 1QUNA 3M45A 4KTEL 1CU4H 2EC9T 2GTZB 3PP4H 3MX0A 5E9DD 2YPKB 4FQXB 2BSTB 4I2XE 2EXWD 3G6JB 3DURA 4JFPB 4I5BB 2LU3A 4PREB 4FZ8L 1U42A 2GYSA 2ADFH 1EO7A 3AC0A 1R5IB 1T22A 4KRPB 1P2CB 4JDZA 4NO0D 3V0WH 3RWFA 5H35A 5KBNC 4N0FA 1DBAH 1PG7L 2NXYB 3DMMD 5GRVK 5CIPA 2VUOA 2XACC 1AP2B 1IM9D 1QSED 5BO1H 1M6OA 1MWAA 3ZYIA 5GPRA 2A6KA 5HVGB 3O41B 3EUUA 1ZA3B 4MQXC 4NZUL 1MCLA 4Y8DC 1EUTA 1MCQA 2BJML 4KHTL 2EE3A 3OAZK 4XP4L 1HNFA 3HAEH 4O58H 4HBCL 1D6VL 4POUB 3SJVE 2ZKHL 5LQBL 2D31B 1A21A 1ZVSB 3BX7C 5HHVH 3R1GL 3GSQB 3RHWK 2R0LL 2EDFA 5HYEA 5J3HD 2ARJB 1MI5A 5GRUH 3CFKB 3ZKMD 1KJ3H 4MX7B 5IB4A 3ZLQC 1HWGB 1CGXA 1U3HC 1PJ9A 1HWHB 3SKNB 2GSGB 1DP0A 2Y7QA 4R96A 1CF8L 4P46A 4Z0BL 4M7JH 3KXFE 1XR9A 1YNLH 5C0AB 1N59B 4QNPE 1A7NH 4ZUUA 3NFSL 1HIMH 2Y1VA 2N56A 3ARBC 4DZ8A 2NY5H 3WJLC 3X13A 3O6ML 4K9EC 3ROLA 1XGPB 5F7KC 1S7QA 1T7WA 1RY7B 1RZKC 4M3JA 5F6HJ 2DQUH 1QSFA 2D0HA 4LLVA 3Q1SH 4XPTL 2OMBA 3T2NL 4R6UA 3IDYB 4E41D 1RZIA 3MNVA 4YQXH 1M7DA 4AYFA 3NCBB 4KK9C 2VDKL 3WLWD 1BVKA 4JY6B 3FB8B 2RJMA 5I6XB 3WIIL 2BVOA 5CD5D 5ISZD 4Z5RA 1V5JA 3OTTA 4PJEB 5D2NE 3PABA 4X6DF 1LK3L 3PHOB 3FONB 2Y4SA 5FUOL 5F7HA 1H15A 1HHGB 2C9AA 4YZFF 3WUZA 4EXPX 1AXTH 1L4IA 1RHFA 3B5GA 3STZA 1JJUA 4XWGH 4YDIL 2X9WA 4DJMA 3MV8A 4J3UA 4WFEE 4U2ZA 4PJ8C 1H3UA 1CXIA 5EU3B 4IMKA 4A6YA 1M05A 4MAUL 1BFSA 3O45A 1B0RA 4U6VL 3QUMA 1KOAA 1RZKL 1JGUH 5TFSH 4LLUA 1T0MA 3VXSE 3BGMB 4QRRD 3B6SB 3Q3GB 1ZT7A 5I75C 3BH8B 1U3JA 4JFFB 5SWQB 3LRHA 1EHXA 4HXBH 4WWKD 2DS4A 5FUCE 1VKXA 4HKJA 4KMTL 4WU5B 1F5WA 2QEJA 1ZS8A 1CL7H 2JKXA 1KNOA 4JG1L 3BOVA 4FQXC 1WUNT 3KYMB 1ZVHA 2E27H 5FUZL 2XOTA 1EJOH 4GRWH 1QBLL 1U8JA 4Q97A 4ZFOA 3WE6B 1KG0B 2MQCA 3E8UL 1OM3H 2EKSA 1F6AB 1KB5H 5FKAA 4KRPC 3W81A 2V7NA 1U92A 5IVXB 2A73A 2BNQA 1QFWH 2FZ3B 1T80A 4JB9H 1E6OH 1Z0NA 2NXYC 1BD2E 3LS5H 4NZJA 3VRLF 1MI5E 4X6BA 1QNZH 1NUDA 2HLFC 1XR8A 3GNMH 4IDLA 4X99A 3KLHD 3M8OL 1MIMH 1A6AB 2FL5A 3GSOA 3KPMB 3KS0H 3ZYOA 1JV5B 1FO0B 4LIQH 4CN1A 4YDJA 3BIAX 1L6ZA 2YC1B 3FFCD 3VXOB 1DVFD 1FZJA 4JANA 4DOHB 3WFEL 4FQCL 1NGQH 1A2YA 1QACA 4NQCB 4NKIH 3OR6B 4EI5B 1MRDH 3TPUB 1A1NA 1MH5B 3FO9A 1JUFA 2FX8L 2V9QA 1PQZA 4TNWK 1J88A 3UAJD 1Q72H 1FYHB 5E99L 4QXWA 5BRZA 5B38B 2HVKA 4OLYH 2F19L 5CJ8A 1MREH 3GMMB 4DN3H 4MXWH 4EXKA 3QI9C 1XGQB 4HKZA 1R24A 3IDYC 3NZ8A 4I48A 2E6PA 5C6TL 1X6NA 1IEBA 3T3MF 4TVSa 1J8HA 1ZT4B 3AS3A 4XAWH 5IEKA 5I6XC 3MV8E 5JW4N 4ORZC 2WAHA 4P2RA 5L6YL 4MHHG 5DC4B 4O51B 1B9ZA 4ZDHA 3PDGA 2X05A 3UBXG 4LKCA 3S36H 4PB0L 3QUXA 4RDQG 4G8GA 4HD9A 3EJZC 3WIHH 5J8OA 1A14L 4PD4K 1AGBA 1IQDB 1R6VA 1RVFL 5CP3H 3QAZB 5DQDL 4X8JA 5EZOL 5BVPL 5DF0A 4J3TA 4LQFH 4OLXL 4M6OL 1IRAY 1A0QL 4YDLB 4KKCD 4AEHH 1OP3H 1NGPH 5EBWB 5I1EH 5FGCB 4EN3B 1KJ2A 2R0ZL 4OFKA 3BKCH 3GSNH 1GZQB 3EFDH 5SX4H 4KPHL 1AIFA 4L8DA 3DXAD 5IFJB 5DD3H 2VN4A 4MLIA 4PYGA 2IANA 3ULUC 4G8IA 1FH5L 1XZ0B 3JV4A 2IAMD 2PYEA 1UADC 2D0FA 1BBDH 1GAFH 1HE7A 1LMKA 4J3SA 5FM8A 1TZIA 1LE9A 1DANT 2D2OA 4UV4L 5DJ0A 2ZCLL 3MOAH 4L4VE 5H37H 4AENB 3RA7H 1XH3B 2I5YL 4JZOA 4KZDL 5GGSA 5K9KB 1C08A 4N0UA 1VGKA 5D71H 4Y5YC 5B8CC 4GJTB 2OK0L 4ZUTB 2J12B 4P4KD 4LHUA 1SHMA 5HYQB 3EYQC 4IMLB 3VFUA 1GGIL 2BZDA 3H9ZA 4UAOB 4JQVC 2WINB 3U83A 5JR1H 4HH9B 1EO8L 2A0LC 4JZJA 4RISH 4RMUA 2BRQA 3UYPA 3NH7L 3G5VB 5C0GB 1YDPA 2ADIB 1K8DA 1EFXD 4PY7A 5FYLL 4L8SA 4EBQH 2QLVB 5C09A 3PWJA 4D2NA <