2HFGH

Crystal structure of hbr3 bound to cb3s-fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
226
structure length
220
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISSSSIHWVRQAPGKGLEWVAWVLPSVGFTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRVCYNRLGVCAGGMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthetic anti-BR3 antibodies that mimic BAFF binding and target both human and murine B cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CB3s Fab light chain (kappa)
total genus 40
structure length 220
sequence length 226
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hfgH01
1E4KC 2E6PA 4NQTA 2QSTA 3VJ6A 4JPWH 4K7PY 4OI8A 3FTGA 1YNTA 3IRZA 3PWVA 1R3KB 3EHBC 2R15A 4HPOL 1L7TH 3HMXA 5I76B 1U9KA 3N85H 1BZQK 4JRYE 2MHAB 5KSUB 3QZWG 1KLUA 1UWXK 3SDAD 3SGJC 1INQB 2XXCB 4C54A 3G5XB 4DK6A 1TIUA 1EZVY 4ZFGH 4PPTA 5E00A 4IRJC 2NZIA 4M5YH 3SE4A 4JKMA 3QDJB 2R8SL 1FHGA 3AREC 4NQEB 4XNMA 1CDGA 5EU6D 2ADJA 4LCUA 1KTLA 3TJHC 4CU7A 5KSBA 1MRDH 2OMBA 1ED3B 1UENA 4PJ7A 4XCNB 3C08L 1U8OA 4XTRC 3WUWA 1J8HD 1WISA 3QCUL 1T3FA 4WW2B 1FG2B 2CRYA 3DUUA 2KDGA 1DN2A 1H3UA 5IHZA 5KZCB 5I8CB 3K81A 1HKLH 2VLLB 4NZUH 1G9NL 3C87A 5HHOB 3HG1A 5DRWB 1JZ3A 1RZ7H 2HLAA 1X5KA 4PRIB 3MRRB 3IJSB 3O9WB 1MWAA 1PG7W 4MNQA 5EZJA 1QFWL 3OF6D 1QLRA 3PJSA 3VXTA 4GKOA 3VDAA 3T2QA 4YXHH 3WUWG 4D3CL 1CLZH 3QEQB 4LGRB 3SKNB 2ESVB 5JHDD 1CTOA 5KSVA 4N8CH 4X6CE 3EYFB 1CDCA 1TJHL 1WWBX 1Q8MA 1YEEL 4NKDB 5HHNA 1HI6A 3CLFH 4CNIB 3RNKA 1AXTL 5HY9B 1CR9L 4PJBE 3IFNL 3PV6A 3ARFB 3TYGH 4HGWB 3VFTA 5DRNB 3TJEL 5DURD 5J4MA 3X13B 3VFMB 3BX7C 2A9ML 3D0LA 5MI0C 5F9WC 1JWMA 1QBBA 2C7UA 2YSSA 3IXAA 4KUZL 1I7TB 2CQVA 1H5BC 2YUWA 1FG2A 4JFFA 5ANME 1R6VA 2XWBA 5D7IF 6CGTA 3IXTB 3NFPA 5DEZA 3VRIA 3OAZK 3B9DA 1CBVH 3RUGA 1MRDL 5FV1L 4ONFL 4YJZL 3QHFH 1P53A 4XNXL 2XWTB 4PLOB 4N90E 4TUKH 4YHPB 1NGXA 4OF0A 1D6EA 2FL5B 3A0OA 5DQ9B 4Q0XL 2NY5H 4ONHB 4IRSD 4XNUH 1OTSD 5K9KA 2G5BA 5DFVC 1INQA 5KS9B 3ULVD 5B39A 2C3WA 1TLKA 1FN4A 1YZZA 4JJHA 3WKMH 4PJAF 3MUY1 3WS6A 4KWUA 1T5XA 1BQHA 3BHBB 4G9DB 3RTQD 3RY6A 4PJIB 1G0YR 4X9IA 5D2LF 1JVKA 4M1CD 3HAEA 3PWPA 1GC1L 1IAKB 1OSZB 2XIDA 4Y19D 5E8PB 3PXHA 4OGYH 1VGEL 2P5ED 1GYAA 4R26H 3S37L 5C0EA 4M3KB 4QLRA 5E56A 3WXWL 4LSVL 4BQ9A 1M7DB 4MAYA 1VA9A 4GW5A 4RBPK 3GSUB 1WSST 3I02A 5GGSA 2XTJB 5EIIA 2P7TA 2IMNA 4X9HA 1QHPA 5C0FA 2DQIH 5AYUH 1BQHG 3O3AB 2IAMA 4ELKA 3JWOH 4M7ZB 5F7YC 1TJIH 4OF5A 5LBSH 3L3OA 3O2DH 1NFDF 1YYLL 1ZV5A 1AJ7L 3MCLH 2IGFL 4R2GD 5C6TL 5C08D 2B20A 2WP3O 2DLGA 4I3SL 1E28B 4V1DB 4QXGH 4I0CC 4BH8B 2Y25A 4Q6IC 3U0PA 3LVEA 3BPLC 2D7PA 4CADB 2ZWLT 1RHHA 1D9KD 1H15B 1JPGB 1XCTA 1DE4A 3OZ9H 1NCWL 2FJFA 3CXDL 3DMMD 4LRNL 4OZFB 3HHRB 1AIFB 3EDEA 5I1KH 5IVNA 3OKDA 1FQ9C 4QHNB 2MQ3A 5CS7A 3OKLB 5IR1B 3GNMH 4O9HH 1AHWA 2XZZA 2VZUA 4FMFA 1G6RL 4JY4A 4B0MM 1SBSL 4QRTA 5SV3A 1A3RH 1WAAE 3HAEH 2WANA 4MB4A 1IT9L 4GG8A 4RFOL 3CFIC 4HS6B 1NBYB 3JUZA 2HT2D 4GS7C 3K1DA 1MCBA 2I9LA 1C7SA 4PFEA 3VWKA 4QHUB 4URTB 2DQGH 2UYLB 4J23A 1XGTA 4EXKA 2CUMA 3I9GH 4G5ZH 3BUYB 4Z7QF 5F7WC 3C6SB 5DUPL 3OJDB 4P9MH 4HUXA 4MLIA 3FZUD 3TGXA 1Q9WB 4UT7L 3PWJA 1JI1A 3ULSB 4NT6B 4LLQB 4XVTH 1IKFL 3UC0H 1MQKL 2VXUH 2EDWA 4X6DF 1MCCA 2YK1L 5DC9B 2EDTA 4IHOA 5GSRB 2EDXA 4NSKA 4QWWD 5F97E 5DWUH 2VIRA 4QT5A 2XKUA 3RI5K 3P30L 4LK4A 4IRSA 5DI8B 5L2KA 3P4MB 5DDHB 3EDFA 2UVEA 2F53D 5GJTL 3UTSD 1HYRC 4KUCD 1I9EA 1N6QL 2OP4H 1DANT 1UM6L 2VWEE 2ZOLA 3LS4H 4WHTB 3BYYA 5C0BD 3G6JF 1VEOA 1BLNA 3QWRA 3RZCD 5T33H 5ITFA 4FXGA 3WXWH 3D18B 4EQ3A 5DJYB 5E2UH 5E6IC 4TTDD 4LIQE 2KPNA 4ODUB 4OLYH 4GSDL 2M2DA 1A6TB 1T66C 5B38B 2QKIB 2W9EH 1NFIB 1OD9A 4P23D 1F3JB 1CZ8L 1YEDB 2KZWA 3A67H 2N7BA 3CAFA 4QY8A 5DO2D 4F2MB 4MS8D 2EDRA 1AQKH 1JHTA 3RAJL 1NCBH 3BMVA 4GQ9H 4L8SA 3QI9C 4ORGA 5EO1A 3MV01 5GGTL 3W11C 2HLFC 4Z5RB 1MEXH 2WP3T 4HMEA 4ACPA 2FNBA 3H9YA 4ZMAT 1S78D 1QNZL 1U8PA 2IWGA 3I2CL 1ZTXL 5MEQB 4ONFH 1RUAL 2MCG1 1ETZB 2GFBB 5EOQL 1P7HL 1PY9A 1J1OH 1K85A 5HDQH 4MJIE 1X7QA 2AK4B 1ORSB 1UM6H 5IVXE 4NFDA 4OQTA 4LCIL 2BDNL 1OF2A 3WFDH 3VGAB 4Y5VB 2UWEA 1EJOH 1FRGH 3I9GL 3MRHA 4LNVA 5D7SL 4GUPB 1ACYH 2HRPL 5D72L 3KWWA 3GJFH 4FABH 3VFSA 4FRWA 1J9CT 2YBRB 4M8VA 3WXVH 3ARVA 1JF5A 3I3BA 4Z76B 4HWEL 2XZQH 2I5YL 1T0MB 3UO1H 3W0WE 4WEBH 4FS0A 3RWFB 3DURA 5D5ME 4OZGB 2DQDL 3V5DA 3ZKXC 1XGTB 2X9YA 4HWBA 2H32H 1YEJH 1FFOB 4Y1AE 2C9AA 1KB5B 1UACL 3HZYA 3TFKD 3CDCA 3RIAK 5DSCB 4R0LB 5H94A 1CD0A 4P2RB 2A6JA 2BVQB 2YEZB 2BVPA 5HHMB 4I48A 3QI9A 5JIIA 3NPSB 1FFRA 3VXNB 1CDJA 4L3AA 1SBSH 1QO3A 1FJ1B 1TMCB 2FJGB 5HI4C 2IADA 2D9CA 2EYSB 4Q97A 1Q9LA 4XWOD 3CFBA 4HS8H 1UJ3A 1T83C 3QWOA 3LKNB 2W0LA 4KROC 2NY2B 3I85A 2NXYB 4X9GA 2FJFB 3OAUL 4POZD 1OARH 1DE4B 3D69B 5CGTA 1EV2E 3S34H 3QUZA 1OP9A 4JCMA 4ZPTA 1RJZB 3EYOA 5SWSD 2XTJD 3INUH 3NFSL 1S7XA 4RFNB 2B0SL 4GRLA 4RDQG 3GSNB 4I3SH 3V7AG 1JPSL 4J3UA 4OLUH 3UTTD 2WBJA 4LHJB 3ESVF 2FX9H 2VRAA 3BP7B 4PIRF 2ILLA 1JNJA 4ZUSA 4NZTH 1ZHBA 5E5RB 2E6JA 3SE3A 3IJHB 5J6HB 4GW1B 4MXWH 3G9VA 3NGBC 1FFPA 3C8DA 5GGSB 4RAVB 5C0BB 3MLZL 4ZNEE 5AG9A 2H8PB 2C3XA 2ORBH 5HTSA 2C1OA 3MOAL 4BFIB 3I84A 3ZE2E 1FIEA 1BMGA 4KKAD 3KYNA 4RWHA 5AUMA 1JF1A 1SMAA 2P8MB 1XF3A 3PWPB 4ZOEA 1IAIH 1I1RA 4KC3B 4LVHB 1BHGA 3MV7B 3Q6FA 4M1CC 4PY8I 5DT1L 1DBMH 4KK9D 3WUZA 5J12B 3O8XA 1QBLL 3F7PC 2AK1L 4W4NA 2VABB 1FN4B 1U36A 3BP5A 1BOGB 5BZDB 4P59L 3QIUD 1V3LA 3EJYD 5I1LA 1BZ9B 3SOBH 2BMKB 2I26N 4QYOB 3VXOA 5KTEH 1XGRA 2IANE 4EN3C 3UEZA 3SJVE 2HFFA 3MJ9H 4Y1AD 2XWTA 1BPVA 2MQ0A 4UU9A 4HUWB 2J4WL 1JNHB 3L1OL 3KYMA 4JHZA 4K2UH 3DVGA 2DD8L 4J3TA 4JFFB 3HTLX 5CMAA 2QADD 3UZQA 4QHLA 4YXLH 3L7FB 5IVXA 3X3GH 4K8RH 5F3BB 4P9ML 4YIQA 2BSRA 3DMMC 5I1IL 4OZFG 5KS9E 5F71A 4Y5XB 1FV1B 3PV6B 5JXAL 1T1ZB 1RHFA 4XH2A 2X4SB 4OF3A 5CGYD 3VXOB 5A2JH 4PP1C 4LU5H 3LRGA 3QIWB 4ZFOA 1E4WL 4MQXC 4CN1A 1HI6B 5HHNB 2RCSL 1HYSD 5EN2B 3T0EE 3SGKA 3IRPX 3MA9H 1OAYH 3RNQA 4ODTL 5D70L 1HSAA 1CL7I 3V5KA 5C71A 3GJFA 2YA1A 5LKNA 2FBOJ 3CZJA 4Z7OE 4Z7VE 5I8OL 3PL6D 1IQDA 1QHOA 1CQYA 1TZHA 4O2EB 4MNQB 3MV8A 3BP4A 3TN0C 4PLNC 1A8JH 4Q9RL 3PP4L 1VFUA 4GRWH 5IB3B 1ZANH 4JM2C 2VLLA 5HHOA 5D2NE 1S5HB 5ID1A 3LEYH 3NIGF 3WNMA 5D7LD 3PDGA 1CTNA 3BPCB 3AY4C 2EKJA 4J4PC 4GW1A 1T2XA 3UBXI 5L7XL 3EFFB 4UB0L 5HYQB 4HUUB 1MFDH 2YD9A 4G9FE 4JPIA 1FORL 1QLFB 5DVOA 2AJ3B 3TV3L 1UWEL 1LWRA 1RJYB 2FO1A 4FFZL 3HB3D 5GRVK 1BD2D 3QFJE 3O6KH 1XH3B 3STLB 3KYKH 4OAWA 1A7NL 5A3IC 3BYTA 2VZTA 2F54B 1XF4A 3JV6A 5I1HL 4WFHE 4KJPD 1KLUB 2EC9U 4HUNB 1U8MB 4DK3A 3QQNA 1AD9A 1MI5E 3MROB 5A40E 3QIBC 4ZD3H 5GS0H 4HG4K 4KHXH 4G6MH 4MJ6B 3FTGB 2YEZA 4NFBA 2MTPA 2CGRL 5DK2B 3WDIA 3QUKA 3MJ8A 3TN0A 3WEXB 2XXMB 4NRXB 1SJHB 1IRAY 3W11D 3IFLH 4X0KB 5JW4M 4YHLH 1LO0H 1RUPH 1P4BL 3DURB 4LCWA 2FBJH 4OLUL 2Y5EA 1WFOA 1A6AA 3QDHA 4NGHH 1XEDA 1EAPA 3GMPB 5F9DC 1ZS8B 4OZHA 4FQ1H 4TQEH 3RVWC 3BVNB 5DMGD 1WC7A 1AO7E 4WI6A 4AQ1B 4ETQB 4HXAL 1HXYA 4OFYD 1E0OB 4YHZL 2H2PC 1PX3A 1NGZA 3EDDA 1KJVA 4NBYB 3CLEL 2KQNA 4YDKH 1NBZA 2FIKB 4PR5A 3U0WL 2DJUA 3RKDC 5IESH 3FN0H 3KR3H 1NLBL 3VXUD 2D0HA 3IS0X 4XNZB 3T0DA 2PXYB 1ETZA 2GFBA 4C56B 4KH2A 5B8CA 1BFOA 3QDGD 4ALAH 2H26B 2V2WB 1U8PB 2B0SH 3MLXL 5DJ0A 1MSPA 5BS0A 5KZCD 2DQTL 3PV7A 5T1MA 1HWGB 4LCWD 4LASL 4NQDD 4E0RB 4PB0L 4JFYA 2EEBA 2VQ1A 5EA0L 4LSUH 1RJCA 2ZP0T 1HSBA 5TE6L 5IMLB 2ZUTA 1GGTA 3F7YA 4HIEB 3VFOB 2AABL 1HQ4A 4PYGA 1F4XH 3R1GH 2ZUQB 2V5MA 3QULA 3HC0A 4YUEH 3W5MA 4MNGB 3GMRA 5EU3B 5ICXB 2CMRL 4RGNB 1K6QH 3RJQB 3WSQL 4AH2A 2VAAA 3MGOA 1FGVL 1HHHB 1JK8B 4JDTL 3NZHL 2YXMA 3HC3H 5ENWA 2DAVA 1CFNB 4J3VA 4MMXC 3GGWB 4WU5B 4JHBA 4CVXB 1TQBB 4HWZA 2QSVA 5IMOA 3DX7A 4G80A 1J18A 3SO3C 1YEKL 3QDGA 1RUMH 4M61A 1UB6B 3IDGB 2B1AH 5E8EB 2BY0A 5HHPA 3GMOA 5I66B 4XNXH 4APQC 4FQIH 2B4CC 2DI9A 1KCLA 2CLVA 3RAJH 1XF5B 3FB5B 4L9LA 1EEZB 5BRZB 3SKOA 2CO6B 3MSPA 1KJMB 3A6OA 1TNMA 1UGNA 4P99A 4ZTPL 3MMEA 4NOFA 2PR4H 3R0NA 3W81A 1UZ6F 5HJ3A 2VDLL 3LMJH 1SEBB 4LOUC 4I4WB 1B3JA 5CJQH 5KAQG 1KSRA 4DKDC 1WEJL 2W38A 3C5ZD 3O3EB 2IQ9H 4HUXB 5CHNA 3HE6D 3VA6A 4MLSA 2AI0L 2HYMA 4BUHA 3IU4L 3P0VL 1QQDA 4MDIB 4D0CB 4JFDE 4U05A 5FM8A 5CBAA 1T83A 4WGVB 2DL9A 3E1F1 4MX7B 1EPFA 5J56B 1OAZL 4E0RA 3I3EA 1J88A 4XCEA 2K3TA 2HJKB 2XI9A 1OP3K 2NXYD 4I0KA 4GRMB 3QPXL 4LHQB 3RY5A 2UZXB 2V5TA 4OZFA 1IC5H 2X10A 5DLMH 5F9WB 4Z7WE 3IDYC 2OYPA 4PJBA 5IW6B 1AFVH 1KPVA 1PG7L 3DSFH 3WN5B 3EHBD 5FDYA 5I1GL 3RWGA 4P46C 2O5YH 4BH8A 3EYVB 4IDJH 3CFDA 3T2PA 3WHE0 1AO7A 3ARDA 25C8H 1JPTH 4JZNB 3O6FA 1LP9E 3BDYH 5H37H 3WBDA 2YUXA 5EDXA 1FLRL 2ENSA 2OMNA 1JMXA 3OSKA 2Q7YB 4GW4A 4HK0B 4XCEB 4DFIA 4CVUA 4G6AC 2NY5C 1EJ6A 1RIVL 5CZVH 3L3DA 1KUMA 3O3BA 1A5FL 4KGLA 2XQBL 5GRZA 1C1EH 1YMHA 3B9EA 1Q72L 3ZL4L 3B6SB 4JGJA 4RRPG 1URLA 1QQDB 4MDIA 5JXAH 3B5TA 4LCYB 2FB4H 3SOBL 1J8HA 4RMRA 1S3KL 2OQJA 4HKZB 4CBPA 3U36A 3NCYS 3MUJA 3AUVA 5I1EL 4H0IA 3SDYL 4K8RD 1N5AA 2IPTH 1KNOB 3MQIA 4U3HA 4OCNC 4OV6F 4XGZA 4YE4L 3ELAT 2X6MA 1ZHNA 4YAQB 5JDSB 5CFHA 1IC7L 4JM4H 4FNLH 4WVRA 5A16B 1U8MA 1OTTD 2X09A 3KPQA 4CJ1A 4UIMB 4RRPA 4MCZB 4M6ML 3S36H 5JTWA 2BSSA 2FYYA 4U1SB 5F3HB 3VRLE 1U3YA 4NRYA 2V17L 3N1QC 1HZHL 1XH3A 3QR2A 1AGCB 2HH0L 1LGVA 3LEXB 1LEIB 3HI5L 4OFDA 4U2YA 1Z9OA 2CLZA 3D3VA 4XX1G 4DQOH 3PWUB 1U2CA 4KI1A 1J12A 4L4VB 2IAND 5ESAB 2EH8L 3WE6A 1KJ3H 1KJ2H 1H8NA 4LKCA 3S7GA 4WEMB 3KPOA 3GSNL 1AXSB 3TYFA 3MRJA 2YRPA 3SDDB 3OAUH 3O6LH 5FGSA 4AZ8A 2FLRT 5D2NC 3V6ZB 3F7VB 5E8NB 4WUUD 5FGCE 3GMLB 3TESA 4HDIA 2F5AL 3JWDL 5E9DB 4MS8C 1LO4H 2EZ0D 3IAPA 4ZXBB 3RL1A 1I9RL 2OJEB 4LSQH 5M94B 4QRQA 4IRJD 1A02N 3IU4H 5IB5A 3GHEH 2YD1A 1KENL 2A83B 5IF0A 4O2CA 2VXTL 2D7MA 4JLRA 3RNQB 3P9WB 5JLZA 4C56A 2IQ9L 3QEHB 4ZSOA 1QSED 4P5TA 3G6JA 1BVLA 1DJSA 3MRRA 2D4FA 1A22B 4MZ2A 3CMGA 1KN2L 5FKAA 4HEPG 2OJZL 1UYWL 4UMGA 2G9HB 2A74B 3S5LB 5IMKB 1KOAA 2X4UB 1A3LL 1NGZB 5IHZB 1A3QA 4HJ0C 5EUKB 4EI5B 5HVWA 4NJAH 5CMAB 4XC3H 1T3FB 3N1PC 4WW2A 3BVNA 1FVEA 5CEZL 4BK4A 1ZS8A 3HPJB 5KVMC 4MXQD 5DA4A 3NH7H 2A73A 4EEEA 1OCWH 2E27L 3MOQA 3NIDF 2F54E 4LCWB 1BP3B 2J7LA 4OJFH 2XNAA 1FLRH 2HJLA 1ZK9A 2DQDH 2V2XB 4X5LA 1XGRB 2VOTA 3QO0B 4LVOB 3V4UL 3WKNA 5CIPA 4QYOA 1HHIB 3ULUH 1QSEA 4P5TD 2J8UA 5I1LB 5DMKB 3NH7L 1Z0MA 1JGDA 2HA1A 4H20L 1S8DB 2IAMC 4X5WA 3EOAB 5DC4B 5FXCH 4NN7B 1FNHA 1G7HA 3IFNH 2R4SL 2QHRH 3SE4C 3V5HB 2O26U 3MLTB 1R3KA 5EB9A 4XHQA 3DX9A 4K71C 3DGGA 1Z6JT 5I1KL 5CZXC 5D1XC 3WHXB 3MRCB 2X4PA 3PHOA 5EOTA 1JF1B 2P8MA 1PBYA 1UADC 4POZC 3QNZB 2EE6A 3T1WA 4YBHA 1CG9B 3T77A 3PHQB 4N5EC 2EO1A 2AJ3A 2H8PA 2NNAA 1OOAA 2N7AA 2R8SH 4UDTA 5DLML 4JKPL 4YHYC 1D5ZA 1MFBH 4LU5L 4HC1H 2D4DA 1VGKA 3T8XB 1C5DB 2IPKB 2CDFA 3QH3B 4JHAL 5IT2H 3ULUF 5K9JH 5HVHC 1RZJC 4KRPB 4NQDA 2J3SA 2ZOKB 1DVFB 1XCQB 4LRIC 3GJEB 3T0XA 1AXIB 3T77B 4XAKE 3S6CA 1JGVL 3BP4B 3QNZA 1CGXA 2QR0B 5I1HH 1IE5A 4KKAC 4ELME 3L1OH 1KFAL 2ITDB 4TPRH 3QWOB 2HTKD 4M7JH 3MACH 4PRAB 1DCLA 2HT4C 3ZDZE 3DOSA 3HE6C 2PF6A 4Y4FB 2R0ZH 4JN2A 1MELA 5DRXB 3QHFL 4JRWA 5HGGS 1LVEA 2R2BA 5FGRA 2OM5A 1CD8A 1NEZG 5DA0B 1U8HA 1CBVL 2WWKO 2BVQA 4E41D 4MVBC 5L7XH 4UV4L 4U49A 3RPIB 2KUTA 3P9MA 4MCYB 1YPZB 1T1ZA 1Y0LB 2VDPL 5EZIL 5IM7A 1EZVX 4EN3D 2R69H 3VXMD 4F7MA 2NW3B 3P2TA 4F9LA 1ZLWH 2BY1A 2EICA 2AS5M 1KCSL 4KROB 2NXYC 2DIAA 4OI9A 5BVPH 1YY8A 1LO5A 4PRHD 1OD7A 5TDPA 1A7NH 1IM3B 1UC6A 3ULVE 1EGJA 4RFNC 1RU9L 4P23A 4PS4L 4M1DH 5EA0H 3FQRA 2CDGA 5I1EH 5JOEA 1JNHA 3BKML 2ORBL 2X4TA 4P5KB 4LCCB 1DQDL 3UTQB 2X4UA 5ISZA 4MHHI 4Q6YA 3DIFB 2BNRD 4MAUH 5HHOD 1YN7A 2GUOA 3C8KB 4PY7B 3C6LC 4X7TB 3MCKB 3X14A 3R06B 3JTTA 4PJEA 4PJAB 3LSOB 4H0HB 3VXQA 4D0BB 5IB4A 2AEWA 4OT1H 2ZJSL 1PKQA 1SJXA 5H37G 4WI4A 3EO1B 4CU8A 4KVNH 1JNNH 1NGQH 3FZUC 4XZUB 2H9GB 4P4KA 3TT1H 3OKNB 4W68A 3SCMD 2WBJC 3KPRA 1PG7H 2C4FT 3FFCE 1KN4L 3EDKA 2VXQL 3CSPA 1K3IA 4G8GB 4EXPX 1LEGA 1QFUL 1KCSH 5MHSE 2HKFH 1P1ZB 4PRIE 5JR1H 4YHZH 5EUOE 2JB6A 3SDXA 4OV5B 3IFOA 1FCCA 4Q9CA 1CF8L 3NIFE 5BMFH 4LF3A 4NN5B 4BSJA 5T3XL 2JJSA 1DQDH 3ABZA 4U0RB 1D3CA 1ZMYA 5C08E 3S4SA 4YGVB 4F7PB 4HGKC 3MJ6A 1CD9B 4UIKL 5JPNA 3F58L 1LP9B 3RGVA 4M1DL 4U2ZA 3H9SD 4PJ8A 1MHEA 1PEWA 1V05A 4PLJC 4XP9H 1RZFH 3VWKC 1MOEA 1UH4A 2GJ6E 4GG6A 3RWCA 1MRFH 5F3HA 2VLKA 1AGFA 5IQ9B 1W72A 1GC1H 3PABA 4XNQB 4QOKA 4J6RH 4RMVA 1YECL 3F65A 3P4MA 4XXCC 2CUHA 2Z31D 1DN0B 4D2NA 1CXEA 2P5WE 3MODL 1P84K 1FC1A 1FL5B 3RVXC 3H7BA 4NQEE 3S88H 3WIIH 1EEYB 5E08H 1KN2H 3VXRE 2E9BA 1O7VA 1N5AB 5TGBA 3LHPH 1HXMB 4M1GH 4N8VG 3UTTA 5KSBF 5LWYH 4Q0XH 1DQML 3RBGA 1ZE3C 1FFOA 4LDLB 1AXTH 3BPNC 4OZHF 4TUKL 5SWZB 4JG0L 5A2IH 4GRWB 5DZNA 4DEPC 1OP5K 2B1AL 1KGCD 4HFUH 3WFEH 4AQOA 5FYJH 4S0SD 4Z76A 2EDKA 4EOWL 3FRUA 3ARZA 2VH5H 1FIGH 4XNYH 1A9EB 4PD4K 4QHKI 1Q1JH 5I18L 1D5MA 1AGBA 4N1EA 4JCLA 1XAUA 5FECA 3OKLA 2PTVA 3O6FB 3KJ4C 3UPRA 2A6DB 3QIUB 4NO2A 4PJIE 4GXUN 4WUKH 1H15A 3BD3A 4PV9B 3L5IA 2YMXH 2Y06L 3RKDD 2V9QA 4LPCA 4JM2A 2NY0B 5GS2H 3BRGC 3BH8B 2FX9L 3ULUC 3CLFL 4RZCA 4PJBB 3P73A 4HPYH 5C0RH 1U91B 5C8JA 3E2HC 3A6CL 1FH5L 3T65B 1DQLH 4OQ1A 3WS6C 4EBQL 1MFAL 5C09D 1KIPB 1X5HA 5I17B 5EO1B 1KB9J 3RDTA 4HPYL 4GBXD 3QXAB 4X4MA 3CVIL 2Z8RA 1UZ6E 5KVGL 1Q0YH 4K2UL 3VGBA 1YJDL 2BNQA 5E9DE 4PLKD 5KVDH 3W9DA 1HCVA 1G9NH 2EDBA 1FRGL 1YEIH 3MRDB 4KK6D 3OJMB 5GGRY 3BAEH 3MUZ1 5CHNB 2WINA 1FZKA 3WS3B 2BDNH 4NUJA 1MI5A 3BZEB 2L4OA 1MLCB 5A43C 5I18H 3PG2A 4HZLB 3D18A 4RMUA 5FYLD 5HJ3B 2VERN 4D9RD 4HIJB 2VDKH 1RVFH 3AREB 4ZAKC 4FXGB 5C70A 4FP8H 1IZJA 4PBXA 3RWJA 5B39B 3LQAC 4Z7UE 1QA9B 5FOBB 4GKSB 4DGYH 3ARTA 4ONHA 4WW2C 2EH7H 3FN9A 1SBBA 4XWGH 5TF0A 1YYML 3LKOA 2CLRA 1I8MB 4L1HA 5DJDB 5LWYL 4NPYB 3MRBA 3RUGE 2AJSL 4Z7QE 1RZJL 5CEZD 1J8HE 5JZ7D 4TSBL 5HHPB 2R23B 3PL6C 3AXLB 4A2MA 3L3IA 1SY6H 3ULVC 3U82B 4NKMB 3HUJE 2V5YA 5FUOL 4NSKB 5LGHL 1WTLA 3P4OB 4M7LH 4QXWA 3D39A 3KPTA 4TOYH 2PXYC 1R3JA 3MRLB 2ERJC 3IETB 4PV8B 4CN4A 4J1UA 2P45B 3D0LB 1UEMA 1WT5A 4XPGL 1LILA 1I8LA 3H8NA 2JELH 3NFNA 5SX4H 4KTDL 4XP9L 5JQHC 1BF8A 1QNZH 3QWQB 5BV7H 5LBSL 2EE2A 1WZMA 2GCYA 3X3FH 3MLVL 3RIAF 1AO7D 2QSQA 1A4JB 1FORH 3JWDH 3V0WL 1NBYA 2RQ8A 3U9UB 4P2OD 3MJ7B 1Q9KA 4X6CB 2HWZL 1YA5A 1VDGA 5CSBA 4QRTB 1BGXL 3UPAA 3MRIA 3VXSB 4AIOA 5T1KA 5KSVB 2DQJH 1CLYL 1AHWB 4XP5H 3JTSB 4JR9H 4NZTL 4U7MA 4XMPL 2HFEB 2VLRE 5I9QC 4OKVA 2PTTA 3FN3A 3MLYH 4KDWA 5MI0B 4B53A 5B8CB 2R2EA 3LPWA 3FT3A 3HKFA 1IEBB 2Q6WA 1YY9D 5DHXB 1J1PH 2PYFB 4X4XA 4PRIA 3A6BL 3PGFL 4CADA 3VFWB 2F58H 3BIBX 43C9B 5C09A 3IDJB 3BQUA 3SDAC 1EK3A 4ERSH 4QRPB 1KJVB 4PJDB 4ZTOH 2RFXB 5D2LA 2MCPL 3TVMA 5E2TL 1ZLUK 2MKLC 4HUMB 4APQB 4WW1B 2NY5L 3U4BL 5KW9L 4F7TA 1PAMA 4YDLC 3O3AA 1CGYA 5HYFA 3QUML 3WFBH 2PW2B 3DWTA 3TEUA 4DGIL 3O4OC 4NWUL 4OD3L 4PP1D 3W2DH 4MAYB 1VESA 3IVKB 5D1XA 3OKEB 4AK1A 1MAML 1JRHI 3GM0A 3IDUA 1CE1H 4RIRA 5CP3H 4X6CF 5EO0B 3SDCA 5D1ZD 2JLLA 4PUBL 3VFRA 2Y23A 3X3GL 3WJLA 1F4WL 3OZ9L 4OFYA 4DOHE 5FYJD 5FF6B 4I77H 4LP5A 3FQNA 1QRND 4J8RB 3ORJA 4LEXH 4D9LH 5I0ZA 4XI5C 1X6LA 1Z9SA 1WITA 1V3JA 2HTLC 3GMNB 3BQUC 1PZ5B 3BW9B 3PWVB 1WZKA 4OD3H 3UJIH 4TNWF 2OX5A 3QQ9D 1ZLUH 4A6YA 4JFXA 4G8FB 5IQ7L 4LSRH 4HIIA 1INDH 4PJXB 2P8LB 2YPLB 4J3SA 3LKSB 5HXMA 1BJ8A 5BO1L 3ZKNC 5C0RL 3LN5A 1QLFA 1ZVSA 2D31A 2HMID 2BVOA 4YFEA 2UZIL 3GM8A 1H0DA 3ZTNL 4CRPA 5HHME 5I1GH 2ATKA 5HI4D 3NCYP 3V6FB 5IJVA 4DCQB 2EKSA 5HVGB 1E4XL 3KLSA 4YH6A 2NY1B 2VQUA 3RFZC 4NNPH 1ZT7B 4NC2B 4R4FH 1L0XA 2BP3A 4HKBB 3H9SE 1S5HA 2QBWA 3PHSA 1YUHB 5CJ8A 1FL3A 3TIEB 2ZUSA 4QRSB 3P77B 2DQIL 3K0WA 4P3CL 2O93L 3BGFB 2BX5A 1AH1A 1NMBH 2ESVD 3RNKB 5JHDB 1KG0B 3D39E 1KCKA 3U2SA 4M6AA 5E4IA 2FGZA 3LQMA 2P4AB 5KVEL 4M8QA 1C5CH 1U95A 3DARA 3T4YB 3DO7A 2AJXH 4FXLA 3EW3B 1QPXA 4PRID 5MP6L 4O4YL 1GGIH 1N59B 3ARQA 5HI3C 3FFCD 3VWJD 3HE7C 4FZEH 3TBVB 5HD8C 3ARBB 3N9GH 1PLGH 3QIWA 4ZFOB 1ES0B 4E41E 3ZT6A 3RWEA 4ZUWB 2X4SA 4IBLT 4LSRL 3S34L 4OBSA 1WBXB 1F58H 2VDNH 5EBLA 4ZAKA 4JGMA 4YIQB 2HG5A 4F7CA 4JPKH 5DD0H 3V52H 1UA6H 2CK0H 4YC2C 3RWIB 1EHAA 3OMZA 2YR3A 2JJTA 4R3SA 5C08B 4G43B 1IAOA 2B5IC 4ETYA 2NXZC 2DTSA 1T1WA 5JW3H 3BDBA 4HSQA 1RIHH 5DMIL 3EJYC 4NQUA 3HNTH 2XA3A 3QDJA 3EYSL 1V7NH 1R24B 5C07D 2CRZA 2IMMA 3UROR 4NNXA 3ARWA 2AXGA 2IPUK 3SJVA 2I07A 1GXEA 1CN4A 3U1SH 5LQBL 3Q2CA 4XMLL 3QIWD 1I1AA 4TTGA 4PREA 3WD5H 4ZFZB 4XXDB 5IBTH 3UAJD 4YNYA 3BP5B 4U4BA 1PQZB 1S7RB 1SEQH 1ZGLA 1YDPB 4P46D 3OB8A 3BISA 4NRZB 4P2QA 2V2TB 1N26A 2PTUA 3LKPA 1MFEL 1HINH 3NACL 4IOFC 5JUEL 3TVMC 5F7FA 5I16A 2F58L 4JY6B 2YPLD 1ERNA 2XKSA 3AS2A 3SDAA 1E6JL 2GTZB 1X5LA 5ELIA 1B9ZA 3N9GL 5B22A 5C6TH 4W81A 2NY2D 4PJCA 1P4BH 2KL6A 1MHHA 1TCRA 5H2BB 3IB4A 3I6GA 3SE9H 3GMQA 4U6YA 4KQ3L 4PJ9A 1JRHL 2YN5A 5INDB 2BOBA 4KKCD 2HWZH 4B41A 5BZWB 1CQKA 4HKJA 2DTMH 1I1AD 5DJ2A 1OTSC 4XAKD 1J7VR 4NRZA 4P2QB 4Z95L 1U8LB 1BQSA 1ZVHA 3QUYD 1KB5L 1NLDH 2EDJA 2J8UF 4JB9L 5IKCA 4YO0A 4N0UE 5L9DH 5HGAA 4ZFZA 5E95B 3QG7H 4LSSH 1KJ2L 3ES6A 3U79A 5TFSL 3FOLB 4BFEA 1OAUH 2YWZA 4ELMA 1IGCL 1T5WA 3V8OA 3SJVB 3GIZH 2ICWA 5AD0B 1G84A 3B8YA 3HLAA 4N0FA 3IFLL 2AV1B 1R5VA 1NL0H 1QACA 2LE9A 1FNFA 3VXNA 4MA1C 2KBGA 1RZ8A 3TBWB 1MFDL 2HN7B 3CC5B 4NHUB 3BGMB 1WBZB 5JPMB 5I74C 3T0WA 5C7XL 4Y1AB 5HHXL 3S98A 4ODVH 4PJ8C 3SGDI 4FOMA 2QTEA 4FQLH 5GGVL 2E7BA 1GZPA 4HPOH 2VLRD 2MKWA 3C9NB 4NO5A 1NAMB 4QXUL 4HK3N 3O8XC 1Z9LA 2VAJA 3L3JA 2YBRA 3CK0L 2IPTL 1BAFH 1BBDH 1JNLH 1NGPH 1KF9B 4QTHA 4Y2DB 1IQWL 1WIPA 5B39G 4K94C 3U4EA 3DI2B 4P4KD 1GVIA 4IS6B 1IC4L 2DJ4A 2XKNB 2J8OA 4TSAH 2CIKA 5I2IA 2EIEA 4U31A 2Z91B 3WNKA 5J13C 1FO0B 3LY6A 3RKPA 5MEND 4JZJA 1CT8B 2PN5A 5F89A 1FNGB 5I30L 4ZO9A 2JK5B 2VDOH 4S1QH 1WK0A 5DJZA 2KQMA 2ZPKH 4RFEB 2G75A 3O9WC 5KG9A 5MEQA 2MJWA 3W0WA 1S9VA 2CRIA 4HWNA 5K59E 1NCUA 1NGYA 3GO1H 1AE6H 5DZLA 1A7RL 4X98A 4WGWB 4DKAA 2A6IA 4HHAA 2BERA 4YXLL 3QCVH 4X7SH 3EGSB 3T0EA 4F2MA 4C55A 4IDJL 2QQNH 4U1MA 1JYXA 3L6FB 5FUZH 4D94A 2GK0B 1MH5A 1G7MB 1TDQA 1RULH 2NY3B 5JA8B 4HX1B 5CUSL 4F15B 2F5BH 5A2KH 1KLGB 4FQJL 4I18A 3UTSB 1ZVSB 1YJDH 1A1OA 1SHMA 3IKKA 2Y36L 2XG4A 4KZEH 1Q94A 1UWGH 3BQUD 2P5EA 5DJ8A 1CFQB 3K74B 4EI6A 3BO8B 2FIRT 5DJYA 4M03A 2OL3A 3KXFE 2AGJH 2PW1A 5GS0C 1UM5H 3BW9A 3SY0A 4WO4D 4UUJA 4Q2ZA 1NGPL 4J3WA 1CL7L 4PJDE 1MLBA 3WXVL 2KKQA 1ZHKB 4H25B 5C0CB 4UILL 5GRUH 3C09B 3FAWA 1T7YA 5ITBH 1Y18B 3TBTA 4EUPG 3EBAA 4HXBL 4HS3A 3G5VB 1F4HA 2DJSA 4L3CA 4W4OC 3SDCB 5IFHH 4G6ML 3KG5A 5BCAA 4KJYA 1F58L 2VDNL 2I9TA 1RJLB 1MFCL 4LIQL 2Z31C 2ZSVA 2Y72A 3MODH 2W92A 4FQ2H 1ZVYA 2VISB 4MJ4A 3PIQB 4GH7B 4L8BB 1NGWB 3ZDXF 2XRAL 5ITBL 1P4LA 3HR5A 3BDXA 4O51A 3H42L 4NC0B 3F58H 3ARPA 5TPWL 5DT1H 5MENB 1DLHA 5EZOH 2K9UA 6FABL 5J6GA 2BVYA 4PGEA 3IDJA 1CGUA 1VSCA 4TULL 5KOMC 4G8IA 1UKQA 1UVQB 4X4XB 1B4JH 4KAQL 1P5VA 3KYAA 3V4PL 5C9JB 1I3UA 3BSZL 4D8PA 2JIXA 3DNKA 2R2EB 5CEXA 4PRPA 2YPLE 3L5WA 5KVFH 5J57B 1QFWM 3BJ91 1I9JH 2Y5TB 4KK9C 5EBMA 1JPGA 5T1KB 3MRIB 3Q5OA 4UILH 3V6OA 3AMLA 2ADGB 4POUB 4ZDHA 1QFHA 4LSUL 3ZE0F 1NLDL 2F53A 4Q6IB 5L9DL 1ORQB 4MXQC 3O6MH 5IB1A 2ADFL 1YNLL 3L9RA 3R0MA 4H1LB 1JGLL 4GMTL 4K3DL 3DI3B 3WLBB 1HHGA 3NFNB 1CDIA 3TPUB 3H9HB 3G6DH 1FNEB 4YXHL 5H35A 2DS4A 4XRCA 2XZQL 1PKQE 5CLWA 1NGWA 5I1AB 3D39B 4KKLC 4N9OB 2V6HA 4GAGL 4JPVL 5F1NA 1BF2A 1AY1L 1C16A 3LDBC 4KXZH 3WCYA 1FGNL 1SM3L 1CXFA 2R2HB 2QJDA 1YQVL 1XGYL 4I77L 4XPFH 1IGIL 4FFWD 1TQCC 1ZHLA 1I8LC 5FA3B 4WO4A 2OI9B 1U3HC 3LKOB 5IFAL 3BHBA 2D7NA 4CMHB 3JVGC 3GRWA 4ZOBA 1KV3A 3UTPE 4EDXA 5INCB 5CGYC 4BSVB 1U8NA 3IDXL 4XB7A 4YPGA 4NGHL 1Y6KR 5E4EC 1KXTB 1QUNA 1RUAH 2R29L 4M7KL 1G7QA 4YDVA 5FHBL 3GMMB 1DQQB 1ZSDA 2EDHA 1QSZA 5D7IE 2JJTC 3RGHA 4YHNA 5ADOH 4H5SA 7FABL 3RUGF 2EXWD 4M93B 3DV4B 2OZ4H 2XRAH 5J3HD 3FT4A 4S1DD 2GJ6A 4GG6E 4OCMC 2XY2A 3EJZD 2APBA 2W9LA 2AXFA 2VR5A 3O6FC 3WIFB 3QNXB 3GBML 2BFVH 3LD8B 1JPTL 1T7WA 2AEPL 4PB9H 1TZIA 4OLXH 3TZVD 2AV7B 3VXUE 3QQ3B 3MACL 5B4MC 1BEYH 4FTVA 2I25N 1KFAH 3M1BA 3IDMB 5EOQH 3RTQC 2DWDB 4YX2L 1L9MA 4LFHD 2IFFH 3QXDA 2VLMD 4NDMB 4GAYA 2A0LD 3QEGH 1MHCA 3TV3H 5KG9B 5F96H 1KC5H 2F53B 3WJLC 4NWTH 2CDEA 1CF8H 3G9AB 1J87A 3F8UB 5J9PB 3H9SA 4PJ8D 4JFOB 4Z0XA 4KDVA 3PQYB 3ARGD 4HC1L 3M07A 5D9SA 3LRSB 1LE5B 4PRPB 5F7DA 1F5WA 4K07A 1I7RA 2NTSP 1MWAB 1KIRA 5IV2B 2PKDA 5C2BH 4L29B 4ODXB 3Q5TA 3WYRA 5IEKB 5D1ZA 3TBSA 4NM4L 1NFDA 4X7SL 1KB5H 3O81A 3RY6C 1P6FA 2VKXA 1MVUA 1RUKL 1W72H 1PGRB 3UTPD 3C9NA 1ZEAL 4G9FA 1F4AA 3K4DA 5DJXA 4KK5D 1KTDB 2GHWB 2VN7A 4NO0B 3UDWC 1LO3H 5DGRA 4N0UB 3MV9D 1LP9F 2XN9B 4BKLB 3RPKA 4JDVB 4I3RL 4PGBA 5AZ2H 3QA3B 4ODHL 5JMRA 2BCKA 4FP8L 3P30H 2KH2B 1S7TB 4S1RH 5FFLA 3E0GA 3VG9B 2HT3C 4YBQC 5IOPA 3WFHA 1G9EA 5ADPL 1W8NA 4PRDB 4Z7UF 1L7IL 1XIWB 3O41A 5E8DL 2LVEA 1OGAB 4PJ5B 3OHXA 3HUJA 3G5XA 2VLKB 4PUBH 5IQ9A 1JYWA 2RR3A 1RU9H 3QFJA 2XFXA 1JN6B 3ZHDA 1JGEA 1OSPL 1XR8A 4XC3L 4I0PC 5F7MC 3QP3A 2AVGA 5AZ2L 2HTLD 4Y7MA 2GIYA 1HIML 5A2LH 4JFDB 2DQFB 4XXCA 3MNVA 2APVA 4PJ9B 1PYWA 4FZ8H 1AHWC 5EOCL 3GMQB 1IVLA 4XPHL 5AAMA 2Z31A 2G60L 1QRNB 1FNLA 3N50A 1MAMH 5C0IB 4PJCB 1YNLH 3KS0H 5GS3A 2R1YA 2X7LA 4M43L 1G6RB 1OAXL 1TCMA 4L8SC 4Y2DD 2VR4A 1MH5B 1RY7B 3GSRB 4DGIH 3OGOE 1F6FB 3T4AA 5M7QA 4XHJD 4X98B 5E2VL 3MA7B 3PDOA 4EVNB 4OZHE 5EC1A 1AGDA 3HZKB 4NO0D 1NAML 3GB7A 1MRCL 2DL2A 3HRZA 1C12A 2PYEB 4F3FB 1Q0XL 4G8EA 1OGTB 1WF5A 4D0BA 1G9MH 3PP3H 3WLWC 1T1YB 3MLZH 2DIJA 5BW7A 3IAGC 4PREB 3HI1B 5BS0E 3JTTB 1MCWW 3KPSE 1A4KB 3Q6GH 5DEFA 5T1DL 4MAYC 4FQXD 1T20A 4DUVA 3NCEB 4JO3H 4AG4L 1JIBA 5FK9B 4JZJB 1J5OH 1S9WB 2VXTH 3L3HA 5ESQB 3ROOA 1T04B 1FFNA 2X4OB 1RAMA 1TZGH 3U30C 5J12C 2MPAL 4RCAA 5JZ7C 1FE8L 4LCCA 4DVBA 1JPSH 3QZWA 3WFCH 1IARB 3QFDB 5AWNL 2L0DA 3Q6GL 4I3GA 1T1WB 1QSEE 3FQWB 4KQ4L 2IALB 2PETA 4MD0B 4JRXB 5FKPB 3PL6A 4Z7NE 3FT2A 1TVBA 3OJ2C 3SEPA 3C5ZC 5HYIA 3OKKB 4J6RL 4MNQD 2EXYC 1T0PB 1SEQL 2VDRH 2NY4B 2DQUL 3OGCB 4R8WH 1ZXQA 2AEQL 3RWEB 5EUOF 3FQWA 3P9MB 4MCYA 2Q8AL 3U4AA 4WY7L 1ES0A 2BNQD 1DSFL 4IOSD 5I15L 1EUTA 5E94A 3QNYB 1UWEH 3ULUD 4F58H 4YDJB 3TA3C 1N64H 4N68A 2EYTB 5E1HB 1VADA 3T1FA 3QEQE 1QSFB 2DMCA 4B50A 2CRMA 1WGOA 4HJGB 4GFTB 1LEKB 4Z78A 1DUZB 4PTUA 5ESQA 4O2FB 2BOCB 4H1LH 3T4YA 2BVTA 5F9AC 2DMKA 2ZG3A 2P44B 5FM5M 1T20B 4NWUH 5HYJA 8FABB 5E70A 3FCTA 5TF1L 2PO6C 3ES6B 1A5FH 4HJJL 4FNLL 1GRWA 3QIWC 5HGAB 3CSGA 1VKXB 4F37F 3VFGH 4XPBL 3VCLA 3ULVF 4Q7DA 4P57A 2ZOKA 1U92B 4O00A 4LLVB 4HKBA 2X4NB 1NEZB 2WK2A 4HKJB 5TDOB 5EU6B 4YBLC 2YOCA 3DX6A 5JQ6H 2I60L 3BH9A 1EAJA 2COQA 3K8KA 4YXKH 1KLFA 4R4NC 1VGKB 3TVMD 4EBQH 1FYHB 5CD5C 4QXGL 2VITA 4MD5B 1T03L 4JY5H 5MEPA 2NY1D 3LKSA 5KVGH 3F7QA 3OKMB 3P0GB 3TIDB 4KV5E 3WFBL 1QOKA 4IEFB 2LV4A 1BIIA 3U0WH 1QLEH 3BXNB 4LL9A 3GSWB 1I1YA 1CS6A 1IGTA 3DGGB 4I5BB 4ISVB 4S1DC 4ELMF 4YC2B 5B3JE 1CFTB 5DFVD 5GGUA 3GMNA 1J10A 4BZ2L 5DUMH 4C83A 4JFPA 5F1IB 1MJJA 5KAQF 4PS4H 1G7HB 4LPTA 2NXZB 4WU7B 3VRJA 3RX5A 5I8KH 2E7LA 3QUYC 4KTDH 4U1GC 2BJML 1JGDB 1N8ZB 5AEAA 1J05B 2DM7A 1I75A 3QDMB 1UZ8A 1JZ4A 4KMTL 4RNRB 4WV1A 2AXGB 1A1NB 1MCKA 4EQ2A 4M00A 1LO0L 4DVRL 4GKNA 4X6BA 4JJ5A 3C5JB 4JO4H 3VH8B 3EAKA 5C0CD 3U6RB 4DKEH 3KXFA 1J86A 5DD5H 1JWUB 4JREC 1F4YL 1GZQA 5GS0L 4BUGA 3BKJL 4JO4L 5C08A 2C26A 3QUXA 2WIIA 3T2OA 1S7SB 1LK3L 1HH6A 4FQHB 4DVRH 3QJFA 1QEWB 1X4ZA 5EUKA 3BRFA 3E3QC 4I0PA 2V5SA 4KFZC 1VFBB 4WTXA 3ESUF 4V1DE 5CIPH 4L3EA 2D7TH 1QR1A 4QRRD 5SWQA 3O8XD 2DLTA 1JHKH 3VFWA 3O2WL 4C4KO 1UH3A 1U58A 4JQVA 4YHKH 4OZIE 3BFOA 4JLRB 2CMRH 4GLRI 1FZMB 1NCCL 3PQYA 3FKUS 1KCVL 3IDNA 5LGJB 4PRNA 4QCIB 3VXSA 1D6VL 3DO7B 1GGCH 1NEUA 2DKMA 4XBGB 2EEAA 1B88A 3QAZB 3CDGA 5D6CB 2C3VA 4XVSH 1MPAH 2H32B 4RQQA 1A6ZA 3Q3GA 1RPQA 1EHLL 4OKDA 2V7NA 1EA9C 1XR9B 3HNVH 1F11A 3QUMH 3P77A 1QPPA 1NJ9B 1MREH 3QUMB 4W4OA 3SDDA 3VD5A 1G6RH 2GCYB 3FO9A 4AMKH 3AAZB 4G8GE 1EH9A 1JV5B 3IDXH 2IH1A 2OR9H 3KPPA 4PJ7E 2AGJL 1KCRL 4MB5A 5JW4R 1Q0XH 4PJEF 5E7BA 5JIKA 3CFEA 5DFTA 1N3NA 2H2SD 2YPVH 4XMKH 1XGPA 2CKBH 2F53E 4N0CC 2FDBP 3G6AA 5GRJH 1XT5A 5GS2D 15C8L 5HYSG 3B3IB 1JV5A 1OWWA 5HSFA 3VFGL 3MRMB 5C0ND 4QHMA 2D31B 4Z7VF 2DICA 2AKRA 2OLDA 5FHAH 1A9BA 3ARFC 4NKOB 4JRYA 4OCRH 2H32A 4PGCA 4RQQB 5D6CA 1B2WH 5JORB 1BM3L 4UT6H 2JB5H 5DJDA 2XZCL 2DQEH 3LS5H 2EEDA 4BQBA 5JHLH 4BSWA 1Q1JL 1M6OB 4LRIA 4U1HA 4WUUE 5ICYA 1UM4H 3GMMA 4EOWH 2GQHA 5F9JB 1SVCP 2NY6B 2W9DL 2I60H 3DX8A 5FYKD 3LKQA 4UI2A 4XBEL 1I3RA 2NZ9D 3TT3H 1J0HA 4PY8J 3SKUD 2FEDD 3VFVB 3VXRB 3W39B 1NBVL 1JFQH 5L6YL 4Y2DC 5C0AA 4QXUH 4MA8L 1S7VB 3VFRB 1NCCH 3IFPA 1H9VA 4FFVC 1LE9A 4JO1H 2VN4A 3X17A 2RHEA 5EO0A 1F2XK 3QDGE 1I1FB 4L8CB 1UEYA 4TN9A 3WKML 3C6LB 3FONB 4I2XB 5EZLB 1UXWB 1CCZA 2FCBA 2P24B 3EYSH 1FAIL 3LN9A 4UINL 2FX8L 2GY7B 3L3DB 3HN3A 4IIQC 1OVZA 4QRRA 5JW5A 3SDXF 4GKNB 3EO0A 1M05B 1HOCA 3KDMB 3L9RB 3UMTA 4RNRA 4WV1B 2F5AH 1JPST 4PJHA 4QTIL 1OP3H 3LH2L 2CGRH 4S2SB 4C58B 3TJHD 1JGVH 4XVJL 2W1NA 5EBMB 4M6OH 4U6VL 4JM2F 5ICZB 5HI5C 3L5WB 2PTTB 4NNPL 3QUZC 4U1LB 3UTZA 1AD0B 4O02H 4PRHB 2VDQH 1ACZA 4RISH 5AYQA 3TNMB 2EYRA 3KYKL 4M6NH 4ONOA 4G8IB 1MFBL 3OKMA 4G6FD 1Q9KB 1SMOA 2YKLL 3H9ZA 3KS0J 3U9UA 3O45B 4P46A 5TDNA 1OHQA 1A4JA 2D03L 2R56L 3VG0L 1IGYA 3HNSL 1DLHB 2NX5B 4X6DB 5CBAB 5MEOA 1A64A 1R5IB 3GSQB 5C0GB 3HS0B 2F8OA 5KN5A 5BW7C 5IGXL 4WWKA 2PYEE 5CBEA 3VXSE 5ESVA 3DX6B 1U8IA 2K1MA 5F9OH 1R3JB 3V79C 5JW4N 4L4TA 1X5ZA 4R2GC 3MNWB 2ED8A 2CJUH 5F7EL 1LQSR 3QBTB 4ONGL 5DWUL 3L7EA 5F21B 3L3IB 5FA4A 4PJFE 1LDPH 3AXLA 3KPNA 3P9LA 5BRZA 4YR6A 1MCWM 4GRLD 3H7LA 3QO1B 5CP3A 3D25A 1FAKT 2H1PL 4NN6B 3MYJB 4Y19A 4MA3B 1W72B 4XNQA 2NTFA 4X5XA 1BAFL 1BBDL 1JNLL 3Q0HA 4QRPE 5EO9B 1V8HA 5EWIH 3QXWA 1ZHKA 2VXSH 1CDHA 2EC9T 4DZBA 4P48A 3STZA 3PGCB 5IIEA 4Q2ZB 3KJ6H 3S4SB 3AS3A 2FJHB 1J1XL 1WIUA 1MCEA 5E94B 4JFFE 2HJFA 4YHML 2XA8H 1N2RB 2A77H 5ENWB 3P11H 4ZFFA 5GZND 4RGMC 4R97B 4HUVA 4NUJB 3QIBA 2VXSL 4L4TD 3SQOH 3EJZC 2Y07L 3AVEA 5HHQB 3QULB 1I1AC 3BKMH 4K8RC 4LHUB 4L5FL 3T0ED 3MFFA 1PKOA 2BNQB 2X70A 4HW6A 3C60C 4JFZL 4Y5YB 1FSKC 4NFCA 3T0EB 5GRVL 1FNAA 3ZKQD 4CKVX 1KULA 4ZQKB 2PXYD 3RRQA 5I17A 2VLRB 3V6OE 1FC2D 3MFGB 4PTTA 1WAAA 3V2AR 5EZIH 3JV5A 1U91A 2DTML 5C7XH 1OAKH 1KPUA 2OTWB 3HI1A 5CP7B 3OJVC 2NX5D 5I1DA 3HZMA 5D2NB 1YN7B 3C8KA 3CVHH 2AAVA 5HBBA 5I6XB 3W9EA 1CGWA 4ZUUA 1TTUA 4JREB 4I18C 1J1PL 4P2YA 5DHYA 3S96A 1KN4H 4P5KA 4EDWH 1HHJA 2OI9C 1G7IA 1D7FA 1D5MB 3HE6A 1ADQL 4L4JA 2BNUA 3IDIB 1WC7B 1RZKL 3MLWL 5KSAC 5M95B 5LVEA 5IROA 5L2KE 3L5HA 4HG4J 3CVHL 1OTUC 1WBYB 4KDTC 3O4LB 1UQSB 3LN4B 5BJTA 5FYLL 5E5UB 2GITA 5JHDE 3BKYH 2EH8H 1QRNA 2LVCA 2ZCKH 4HV8A 4HUVB 5CSZA 3MGTB 4LLAA 4Y8DC 5DS8A 4U7KA 3MJ8B 5EU4A 4X4YA 5L0QB 4Z7UB 5CLTA 4G6AD 5SX5K 3NA4A 3CC5A 3LD8C 3X12B 1U8HB 2DF3A 1I85C 2BK8A 1HNGA 2NPLX 1UACH 3PGCA 4DN3H 1CD1A 2SEBA 3O9WD 4MWFB 5GSVB 1H5BB 2FWOA 1GHFH 4N0FB 3CVHB 1G9MC 1RFDH 2ERJB 3AFLA 3HUJB 4Y16C 5IBLD 4MA3A 3H2WA 2CKNA 1DP0A 3QO1A 4KRPD 1XGYH 1PY4A 5DR5H 2QQQA 1FNSH 1CI5A 4OUOA 1LD9B 3BOVA 5IBUG 5IFJA 1CD1B 5L88L 4JANA 2X9XA 4LKXA 1WWWX 4K3JH 5DJCA 3VD3A 3QA3A 5DJ2B 3TWCL 1A3LH 4RFOH 4RSVA 1OTTC 3BEVB 3OWEA 2EO9A 4IMKC 2J8UE 1FYTB 2BOBB 4L1DA 2WIMA 2IPKA 4WWKB 4Y19E 2NQCA 3GSXB 1C5DA 1CFVL 3DXAA 3UPCA 1KCUL 1CE1L 4G9FB 3TFKC 5DD1H 1S9KC 3AM8C 4PRBB 4PJFF 2GITB 1ZOXA 3U9PH 4JFEB 3VG0H 1WVZA 4IMLA 3O4LA 2R0KL 3O3DB 4PBVC 4WFHD 3KPLB 4HIHB 3M8OL 5DXWA 3QISA 3OKNA 3ARXA 4ODXA 4XWOC 3C5SB 1I7RB 1HHJB 3QPQC 4PRHA 5F6HJ 3QJHB 3MRFB 2ZCKL 3E6FA 5D96C 3RZWA 2YPKA 1BD2E 3GJFB 3NIGE 5ICZA 3SHSA 1T66D 5EPMB 1K8IA 5J9PA 4K23H 4XXDA 3VXQB 3HZVA 3VXRD 1FCGA 1NANI 3S97C 1F6AB 4CVWA 1ZWIB 1HHKA 5EZOL 3O6ML 2GUOB 1UB5A 2FGWL 3LB6D 2P5WD 1QR4A 3DGCR 4Z7OF 2VLJB 1HEZB 3B2UD 4HFWB 3ZHKA 3FRPA 1PDKA 2VXVL 1MWAL 1U3JA 1TVHA 1A21A 4FTVB 4MSWB 5IHBA 3SGKC 3MRPB 3V0WH 4JQIH 1FVEB 3TZVC 3N85L 2AV7A 2VSCA 4P2QE 1IQWH 4DOHB 1OQXA 4RX4D 5DMGC 1TZIB 1OM3H 1MRCH 4X7DC 3BI9X 1YY8B 5F88A 4K7FB 4WUUB 2HG5B 3IFPB 4HJ0D 2R4SH 4WTZA 4F37K 1IFHL 3QUZD 3JXAA 5FKAB 4I1NB 4JHWL 4JFHD 2IEPA 2R0KH 1I9IH 2ZUWA 2A6KB 2OBGA 4OLWH 3LV3A 4QHKJ 2F19H 2R2BB 4DN4H 3B43A 3OG6B 1KT2B 1LNUA 1RZGB 1U8NB 2XPGA 3TA3D 4JVPA 4OIIL 4MQ7B 3IU3B 2DQEL 3LS5L 5JHLL 7FABH 5JIHA 4Y5XC 1AR2A 1TJGL 1NKRA 3ZE1E 1ZHLB 1EHNA 4YHMH 2P46B 2OR8A 1X6NA 2Y7QA 2O5ZL 1YQVH 3CCHB 4AL8H 1YEHL 2VQTA 3MRJB 3U4BH 5KW9H 1G7PA 1MJUH 1YMME 5TFSH 1D9KC 2ITCA 2QADC 4JQXA 4Q58C 4LKCB 5GISL 3MBEC 3U48A 4OGZA 2EDYA 3CVIH 4LRNH 5AZEH 4P2RD 4GRWF 4DW2H 1HH9A 1AR1D 5CBEB 1I7UB 2Z4QA 3T8XA 4N8CL 3U46A 3DBXB 1MY7A 5FGCB 4PJHE 4H1LA 1PZUB 2CLZB 3VGHA 1M7IA 2YD4A 2NNAB 2BSTB 2C5DC 1HYSC 3U0TB 1A6ZB 2Y06H 1JE6A 1AGCA 1LO3L 3RIFK 5FYKE 4NRYB 2GT9B 1KCVH 4PRNB 2R9HC 5D93C 1ZLSH 2Y5TA 4Z8FH 4NNYA 4LMQE 3BPOC 3WNOA 5DYOA 4KZDH 1SJEA 3LKNA 4X7EC 3DX9B 4YHOH 1PZ5A 4N9GB 1UJ3B 3MR9B 5JOPD 3G5ZB 3PWNB 2B1HL 4LPWA 3CXDH 1MFEH 4W6WB 5GJSH 3SCMC 5BV7C 2NX5E 1GH7A 1PVHA 4U0RC 3S37H 1BBJA 5DHVH 3TBYB 1KNOA 2BVPB 4I0PD 4P2RA 1VHPA 4OGYL 5CJ5A 5J6GB 1LHZA 5DSCA 3DYOA 3QO0A 3QRFM 1NMCB 2OQJB 4HKZA 5IMMA 4M48H 3QYCA 3QJFB 5IVZA 1I3VA 4J4PD 4O51B 1QFOA 1P2CA 5GGVH 4HGMA 1TJGH 1FZOB 1OL0A 1T7ZA 4NM8L 1RMFL 1NH6A 4BZ1H 1SY6L 2WWMD 2DRUA 1YMHB 2CXGA 1JWUA 2D0GA 3PIQA 3ZKND 1KACB 5CILH 3O3BB 5F96L 1DQTA 2CIIB 1I9IL 2FBJL 3LEVH 4ZNEA 2ICCA 1P2CB 2WLYA 5EU7E 4Y5VA 4Z7WB 2B2XH 1P9MC 4QRPA 2YHGA 5IMKA 1IGCH 3FQXA 1MCQA 3VI3F 5D7LE 2G2RA 3O6KL 2NR6C 4NQCE 3RWGB 3SDYH 5KSAD 4LDOB 3ZKXB 3ZE0E 1F97A 3WDJA 3RTQA 4CUCA 1W0YT 4OCWL 1BIIB 1PG7X 4OCSL 2MOVA 4ORGB 1EO7A 3MTRA 3KPSD 2A1WH 3BIKA 5GIRB 5JR1L 3VWJC 2R1WA 2R2CA 3TCLB 4PJDF 3RWDB 3ARSA 2VXQH 4X99A 1BQLH 1QBML 3MRMA 3Q1SL 4FQXB 4AYFA 1MVFA 4UZGA 5B38A 4NUGH 4EKXA 1ND0A 1X4YA 5E6ZA 3B83A 3O3EA 3I6KA 5T3ZL 4TVPE 1A6WL 4HIXL 3T2NL 3I6LD 3H3PH 2GTWB 1IBGL 3MBXL 2ICES 4TNWK 5IESL 4I4WA 1HILA 4E5XB 1R3IH 2BNRA 2IH1B 4P57B 2QHRL 4CVZA 1AFVL 3AAZA 3FO9B 3ZDXE 2Q8BH 4DKFL 3IKCB 4RFEA 2O5ZH 3MBXH 3SKOB 5BQ7B 3D3VE 1UG9A 1FNGA 3CU7A 4WHTA 5DEGA 3ARFD 3TPKA 1WCBA 2CLRB 1I8MA 4PB0H 5HYSB 3QCUH 1YEJL 3HCVB 2G60H 3J8F7 1FZMA 5SX4I 1F13A 3EDJA 3GO1L 3VXPA 1J11A 3DUSA 2D2OA 3KPQB 1QSFA 1JJUA 1E4XI 5DI8A 5L2KB 1OAYL 1DZBA 1JL8A 3QDMD 1JGUL 1OCWL 5C0JB 3AREA 4QNPF 5D7JC 4M9PA 4JG0H 4IHOB 5GSRA 2DD8H 4XVSL 1RURL 3GGWA 4OLVL 3CH8A 4PLJD 3VWKD 4CGTA 5F1KC 4OM0H 3U36B 5GPRA 4HBCL 2JKXA 1C08A 1YQ2A 4AIZB 3C6SA 3FB8A 2VDLH 3LMJL 2FZ3A 5CJOL 2DM2A 1S7SA 3FRPG 3V6OC 4Z0BH 1O0VA 4MD0A 1D5BB 3B6SA 3QAZC 1HQ4B 3VFOA 3FO1B 3WO4B 3JV4A 4HAFA 3QFDA 5IBUB 2VQ1B 3RDTB 4RBPH 4HFWA 4WDIB 5ISZD 2VLJA 4LSQL 2DDQL 4NJ9L 1HK6A 3OKDB 4QHNA 3MJ9L 2IQAB 5FK9A 3ARDB 3P73B 1IM9D 3CGTA 1NCDL 1NQBA 5HDBE 2CK0L 3QHTC 1A4KA 4UTAH 2WSKA 3QG7L 5JMOC 4FQQB 1M7XA 3U0PB 4WU7A 5H8DA 1IGJB 2X89D 4K94H 2UY6A 3AM8A 3BT2H 3GB7B 1XZ0B 2DQCH 4IJ3B 3VGDA 2DKUA 1HXYB 2M26A 2N1KA 3QJHA 1F90H 3GSWA 3K4AA 4B7IA 2RAMA 4ELKB 2WAHA 1CDYA 4JDZB 2EDEA 1XGUA 1JTPA 1CLYH 1JGUH 3NZ8B 2R1YB 4Z95H 1M7DA 1TJHH 5TE4H 1AP2B 3SDAB 3EYQC 1IC1A 5FO7A 2E7LC 5CJBA 4BZ1L 5IQ7H 1EEQA 1CLCA 1EGJH 1GPOH 1KJ2B 1P9MA 2RCSH 2DQFA 5IVZB 4ZNCD 1CICA 1K2DB 1SEBA 2EDQA 4MJ6A 4YX2H 1T5XB 5F7UA 1JZ8A 3O4OB 1T1XA 3GUTB 1RULL 1BEYL 1VKXA 1KIQB 4XCYA 5TF1H 3ZTNH 4HF5H 3FCTB 3RIFF 4FQCH 3ISWA 1NFDE 3PWNA 1NGQL 3MBED 1DLFH 3MRGA 2F54A 4X6EA 5K9QG 3D9AH 1F3DH 1K5NB 4YHOL 3RWCB 4IOFD 4RMSA 2R0WH 3GHBL 4PRDA 1XF2A 4HKXA 2EE3A 4OFVA 3IDGA 1Q72H 3ZL4H 2AJZB 3HNVL 3QNYA 2RJMA 1DSFH 3DX7B 4RMWA 3U0TA 2VTFA 3VRIB 1X4XA 3RHWF 4K3JL 1CFNA 4TUOA 4DZ8B 2BRRL 3MGTA 3V6BR 3V9FA 3OGCA 2EDOA 3VFNA 1RUQH 5CSZB 4OIIH 3DBXA 2VMFA 1DEEB 4MDJA 2W60B 3F6IA 2WLZA 3B9KB 3RX7A 1TPXB 5J11C 4BK5A 5DMIH 5E9DD 1WBYA 3REVB 1L0QA 3EZ8A 4HWEH 3MLRL 5D1ZB 3TBSB 4BQCA 2O5YL 4OF8A 1T0NB 4FABL 3F7YB 1CFBA 2BNUB 3IDIA 2AEQH 4EJ1C 1GC1C 1TZHB 4DVBB 1F02I 2IGFH 3F12B 1T21B 3VMOA 4O4YH 3PXJA 2E8ZA 1FFNB 2X4OA 1YEFL 1I9RH 5T1LB 1DBBH 1OM3L 4AEIL 5CWSA 5CEYB 3UYOD 1KEGL 2HT4D 4RA0C 5SWSA 1OAZH 4Y4KC 2P1YA 1KPUB 2OTWA 5AWNH 4GT7A 5DEFB 1NSNL 1KG0A 4Q74A 1YMMA 5AAWA 1NDMB 2D03H 2R56H 3RA7L 2UV3A 1C12B 2PYEA 5JOPE 5LGKA 1VEMA 3HZKA 2DWEA 3GBNL 1VGEH 5ISZB 1II4E 4X4ZA 2AJXL 1TQCB 4OBRA 3JWNC 4KHTL 1LK2A 4H0GA 3T4AB 1NCAL 1AKJD 1DBKH 5L8JB 1IC5L 4DCQA 2XYCA 4G3YL 3HE7B 3MLYL 1WTGT 4OZHB 4ZODA 4IDLA 2KZ1B 2W91A 2X1WL 2DQJL 5GJSL 4K94L 2H45A 2B4CL 1H8SA 2J8HA 3GJFK 4X7CC 4ZUVB 2YPLA 3KPSB 3MV9B 5JXED 3NA9L 5D70H 2HFFB 2V17H 1JRHH 1BVZA 4HMCA 4PYHA 5HI3D 2HJFB 2CR3A 4FHBD 5ACZB 1A7QH 5I1CH 3AU1B 4JKPH 1YMMD 5I73B 1BECA 3CMOL 5I8EB 1ZWIA 3L95A 3STZB 5IFAH 4K8RL 5FF6A 4WO4B 1QP1A 2K7PA 5T1LA 2GJZB 3OG4B 3D25B 1OGAA 4PJ5A 5SWZE 4OLZL 5GRXG 1CU4L 1C5BH 4JM4L 1RZJH 1YECH 3ZHLA 2WBJD 4YK4B 2AQ3A 3OKEA 3GJEA 2J12B 3IVKA 1I4FA 1WWAX 3WD5L 5F1SA 3MLRH 4KI5E 5FHBH 2G5RA 4H8WC 5I1AA 5JXEA 3U1SL 5LQBH 2W9DH 3K2MC 3L3GB 3WNPA 5DQJA 3HMXL 1JWSA 5E2TH 4KJQD 3TVMB 3GSQA 4NN7C 12E8L 4JVWA 1AC6A 4F9PC 3MO1A 3O45A 5C09B 2ARJQ 4ZDHB 4P2OA 4PRPE 2DYPB 3MLPA 4FN0A 3EYOB 4ZPTB 1MCDA 1I9JL 5T1KD 5IFJB 1KYOJ 3GKWH 3DYPA 4U1LA 3UTZB 4RAUB 3UYRL 5F7EH 5GRJL 2A2QT 3GNML 4O9HL 1LE5A 4XHJC 4LARL 2GJZA 2QL1A 3MRGB 2ZUXA 1FJ1A 1TFHA 2XTJC 5GGRB 3VGFA 3AB0B 4Q9QH 4RWYL 4HF5L 3ALXA 4XCYB 3MLWH 1S8DA 4MWFA 4X5WB 5DUBA 3GUTA 1QSEB 2FR4A 3MRQB 2A9NH 1EHLH 5MENA 4YHLL 4Y4HC 4PJEE 1RI8A 5GZNC 4QRRB 2ICWI 3UCRA 1D9KA 4U3CA 3RWFA 3MV7D 1JZ2A 3OQ3B 2IF7A 3D87B 5FO7B 2WW8A 3O6FD 5CINL 5IEHB 4L8BA 4ZUVA 3O2VL 1R3LA 3TA3A 1I85A 4K3GA 1I8KA 1UQSA 3LN4A 3DVGB 3P4OA 3LPFA 5I75B 5D1QB 5HGDB 1CZ8H 4NKMA 4L8CA 5F1OB 5B4MD 1XGUB 1IZKA 3L5JA 1FPTH 5I1JL 5E03A 4JFQB 5J0BA 3VDCA 5HYJD 4KKBC 1LE9B 2AJSH 3KPRE 1FBIH 1LK2B 4U1KA 4KHTH 4NC1C 2X1XR 4MNHB 1ORSA 4LLMB 1N6UA 2XWJB 2VXUL 4FFZH 2NXZD 5FUOH 5LGHH 4M43H 1DDHB 5JLZB 3Q48A 3IGAA 3GBLA 4G7YH 4O2CB 4UINH 3SKJH 5IJKA 3LHPL 4YFLF 5TJWK 3MUGB 2P47B 2OL3B 1MLCA 4IM8A 2A38A 5CEYA 3MV7A 3Q6FB 1RMFH 1NL0L 1JCKA 4S0TD 2EH7L 2XQBH 4PGCB 5DJ8B 3FL7A 3ZTJH 4NKOA 4OB5H 3F7VA 1IL1B 1IT9H 3KYNB 4NZRL 5ANMA 4FQJH 5DTFB 1IM9A 1S9YA 4PGJA 4ZOAA 3W9DB 4U1JA 3JV4B 1MRFL 3LZFH 3GSVA 1P7QB 4DWHA 5D7LA 2Z35B 1A6TA 2X70B 5C0BA 1D5BA 3BD4A 2FECL 3SGJA 2B1HH 4XRCB 2A6IB 4KPHL 2BNRE 1KEML 5TH2A 4D0DA 2YA2A 4FFYH 4KK5C 4G5ZL 5D8JH 3ETBF 4MJ5A 3BKCL 1NGYB 1QD0A 2WBJB 2FHBA 4MQXD 1L6XA 4PGDA 3P0YH 1QFPA 2JK5A 2ADGA 2FATL 2ZOLB 1I7ZA 1FO0A 1XF2B 3AY4A 1JZ7A 3KXFD 3QUXC 3BZ4B 5A16A 1AQDA 4IRSB 3CFBB 3MYJA 5C9JA 1KELL 4XAWL 1P6AB 4TULH 1RZKH 3QI9B 5GGTA 2H6PA 4L3EB 2EDFA 5GXBB 2XG5A 5GHWH 3UP1A 1K2DA 5KANI 2YZ1A 5C07E 2GTWA 4NCC1 2XICA 1GOGA 1NUNB 1GZPB 2F54D 2V7HB 1T2QL 5DJ6A 1IAIM 4MXVF 1AP2A 2PO6B 4GG8B 3EOBA 1S7QB 3O4LD 3QUYA 1RIHL 4LLUA 5GIRA 1TETH 2ZNXA 1DN0A 5D7KE 2MFNA 4N0YL 4M5YL 4P2CG 3VXME 4XB8A 3ZO0A 4NJAL 4QOKB 2VDQL 3SJVD 2XZAH 4K55A 2X05A 3KLAB 5BVPL 1ZA6A 2AK4A 4HCRH 4IRZL 5C1MB 5CCKH 1OB1A 4V2CB 5JPNB 1F00I 1IGJA 3NABH 3EJJX 2WBWB 2X2YA 4LVOC 2PW1B 3ARBD 4OM1H 2NY4D 2IAMB 5E2WL 2NW2A 3T0BA 1OWRM 3EO0B 1NC2A 3RWHB 2HP4A 5JW5B 2P5EB 2HVKB 3ZYJA 4H88L 5GHWL 4QY8B 4JAMA 4K71B 4LQFH 1KLGA 2IFGA 2VL4A 2VITB 2PO6A 4UNUA 4JKWA 1MCSA 2DM4A 3IF1B 1L4IA 3LPGA 2V7HA 3BZDA 5EZLA 3TT1L 4Y4KA 1R3HB 4Z7VA 2PYED 1FZOA 2OL3L 3ME0A 1F2QA 2DKSA 1AE6L 3QWRD 4KZDL 2CKBB 3LEYL 4S1SH 2ZUUA 1YEIL 5IB4B 1S7VA 5KOVC 4KI5C 3VCLB 2H6PB 1ZGLB 4ODTH 2K7QA 2IBZY 1R3IL 5ITFB 3DV6B 1VPOL 4O58L 5C0JA 3X14B 1ZLVH 3G5ZA 4KMLB 2FL5A 4ODWB 4X6DE 4NNXB 2Z91A 1LEKA 5ICYB 1R24A 4MXVE 4YXKL 3T0AA 3CX5K 3QDGB 4DGVH 1EVUA 5GS1C 2X4TB 2VDMH 2PO6D 4JRYB 4S1QL 5BQ7A 2Q8AH 4UAOB 2A1WL 4CVXA 3IXTA 2NZ9C 3D5OF 2IBBA 1NMAH 5E2WH 2VDRL 3O0RH 4MJ5B 5E8OB 1K9TA 3B3IA 1HILB 3ILQC 3OKKA 3OB0K 4G42A 4FFWC 3OBAA 1IAMA 1N3NB 3BUYA 3QXTA 2DLFL 3HC0B 3CFEB 1HH9B 3PL6B 4OZIB 2I9LB 3D2UA 3F62A 4ZUWA 4HIEA 3S4SG 3WLWD 3BGMA 1QFWI 1IGML 3QZWB 3TBWA 5ECJE 4NKDA 4JFYB 4OLWL 4AEFA 5J06A 2XV6B 4ENEC 4MJIA 4NZRH 5T1MB 4POYA 3GHEL 1MJ7L 3BIKB 2J88L 2C3VB 2QSCL 4X4ME 5FYKU 3REWA 1U95B 3MUGA 4MQ7A 5EZJB 3FOLA 3U2SB 1LNUB 1RZGA 4R90H 5GZOC 1G9ML 1YEGH 32C2A 2HLAB 5L8LB 3O6LL 1RUKH 4F3FA 4ZD3L 5IKCB 3TIEA 3HC4H 1WZ1L 1YNKL 2BNQE 4H1LG 4LLMA 1T22A 3VH8G 5KANG 1KTRL 5J89A 2VE6A 5SWSE 3RL2B 3WFCL 5BZWA 4U1KB 3QH3A 1UFUA 3UTSE 4U3XA 1HH6B 1G1YA 4WRLA 2FGWH 4UDTB 1A6AB 1A2YB 3B2VL 5DUML 5IG7B 1BGXH 1EERB 4MVBD 5I8OH 4R7DA 1B0RB 1EFQA 5LXGL 3Q5YA 3TH4T 3KXFB 5IEHA 2VL5A 5B8CC 3RU8H 1QTYT 2EDLA 2P43B 1SJHA 5I16B 2Y6SD 3GEWB 3C5JA 3VH8A 5BVJB 3QUKB 3FB7A 3MLUH 3TN0B 3WEXA 4AEIH 2W0PA 4M5ZL 3WN5C 5F8RC 3N1MC 1MCFA 2H3NB 2J2ZA 2LTQB 3MLTA 1RK1B 35C8L 4KMTH 3V5HA 1J05A 2LFGA 4YWGH 1CXHA 4D9QD 1S7RA 5MERA 4PJ7F 5DUBB 5D71H 4PLKC 5I1IH 1YNTB 5GGRA 1MNUH 2X5PA 3AS0A 5FGBC 4LDEB 4GJTB 5T3ZH 4JFPB 2AEPH 1Q38A 4NN5C 1P4IL 4I2XE 4GRLC 3QQ4A 1WWCA 1L7IH 2V2XA 5GISH 3E6FB 4LSPH 1KCUH 4LPUA 3LZFL 1PSKH 3WFHB 3I6LE 4R4ND 3BXNA 5TE7L 1N5YL 1QVOA 3C5SA 1RJYA 1HDMB 4HUKB 3HMWL 4OFKA 4YFLI 2JTDA 3O3DA 5K9QI 5HHMD 4LVHC 4RGOH 1BWWA 4L9LC 4N0UA 2P48B 3S35X 2JCCB 4BH7A 4R3SB 1UH2A 4NP4H 4PRBA 12E8H 2CSPA 3RWIA 2C7UB 1MIMH 4APQA 1E4KA 2W65A 4LSPL 3X13A 1WFNA 4OZ4B 5ID1B 4Y88A 3L5XL 1P4IH 1QYGH 4WEBL 4XP1L 2H1PH 2G9HA 3BQUB 1NEZA 4KVCL 5DJCB 5HY9A 3TWCH 4WY7H 3GI9H 5ADPH 1IFHH 4JANB 4LKXB 1JHLH 3FT3B 4NQSB 4Z9KB 1EJOL 1IEHA 2Y7QB 1KBGH 4ODSL 2ZCLL 5FCUL 4M5ZH 4DUXA 3VD4A 2IBGA 1H3TA 5IROC 5KVEH 3NTCL 2MCPH 2JF1A 3L95B 4WI2A 3V6ZA 3RQ3A 4DN3L 4UQ2A 5JIPA 4F9LC 1MAKA 3QEGL 3O4LE 3KPOB 5ACZA 4OCYL 4OSUL 1EVTC 4JZJC 3FJTA 1Z5LB 2ICEA 2BSRB 3D2UB 3UZEA 4TRPL 3GK8L 4NN6C 3ILPA 3HG1E 1DTUA 1MCOL 4NKIH 1VB9A 3KPSA 5A2FA 3MRLA 5T1DH 1KXVC 1YYLH 3HFMH 2FO4A 2O5XH 1FPTL 5F7LB 3V4PH 3ZE1F 2NR6D 2IALA 2BVOB 1AGEA 4KJWC 3GBMH 3DRQB 4MAYD 3BZFB 4R90L 4R4FL 4LPVA 1LEIA 4MA7L 2BHYA 3FT4B 1MCOH 3KLHC 2DLIA 3GIVB 3MJ9A 5E00B 5IVOA 4R97C 2BSSB 2FYYB 4U1SA 4YHNB 5B3JF 4ZUUB 1IGFL 2NY4C 4UIMA 4DQOL 4ODWA 1TPXC 5EIVA 5J11B 4A2LA 3DVIA 5C0AE 2GY5A 4I13B 5ERWA 4RGNC 5CP7A 1ZHNB 3ZE2F 4LSTL 1F6AA 1OAQL 3BKCH 4BSVA 3IAQA 4OQTH 2HT3D 1G7JA 4Y8AA 1MCRA 4EI5C 1TTFA 2VR9A 4YDIL 3BZEA 2B5IB 5IVXF 4PTTB 1OW0A 1FVCB 3MZGB 2CKBA 4HT1L 3DJ9A 4HBCH 4PG9A 4HXBH 1P5UA 2DQGL 2R2HA 4ZS7L 1AY1H 5T3ZE 3UJTL 1C16B 1BD2A 4IOIA 5E24E 4XI5D 2DBLL 2A77L 4KI5D 3HUJF 3IF1A 4DGYL 4PJFA 3V95A 4H8WL 1G6RA 3AGVA 1IKFH 3REVA 3UC0L 4XCCH 4JAMB 1MF2L 3TF7C 3U9PL 2Y07H 4QXTB 3QIBB 2Q7YA 1X5AA 4YQXH 1JYVA 1HQRB 4X9BA 3T65A 2RFXA 3VFNB 4GBXC 1N0LA 3NN8B 4FZ8L 3MNVB 1MF2H 1N2RA 4JFDA 1P69B 2ZG1A 3BH8A 3EYVA 1W0WB 3WDHA 4LFHG 3DXAE 2FEDC 1YJDC 1LD9A 3DLQR 1IEBA 1CR9H 4MA7H 1JGEB 3UPRB 4JPKL 5DD0L 3DSNA 2P5EE 1AR1C 4OLZH 3KLAA 5FECB 3ZDYF 2OL3H 4LCIH 1A47A 4JRXD 2CR6A 2PCPB 4BFGA 5E8DH 3SKMB 4N5ED 1X3DA 5FA4B 2VUYA 2YD8A 4I48B 4LGSB 2BRQA 1CLZL 4MX7A 1OAQH 4EUPA 5FB8B 3NBNA 3MJGX 4U1GB 5T3ZD 1QFWH 3EOBB 3HZYB 4IMKA 2VLME 3K3QA 3IDYB 4JDVA 2V5RA 4BKLA 2C4XA 3MX0A 2XN9E 2NY0D 1U41A 2AI0H 5DJ6B 3BWAA 1MHPL 5DRZB 3HR5B 4KKCC 1ULVA 2QQLL 5E1AA 4C4KT 1EFXD 5EU7C 1WEJH 1REIA 1R5IA 1Z9MA 3ALWA 5C0GA 3P4NB 5LXGH 3VFPB 4YHKL 1G7LA 5EG6C 1NDGB 1BFSA 3ZDYE 2ZSVB 3E8UL 1FL5A 3FHAA 2VLKE 2YKLH 3ZKMC 4L4TE 4NOBA 5DD6B 2NYYD 2UWEB 4PJIF 3HE6B 5ALCH 1KIRB 3LH2H 3LRHA 1A6UH 2OCFD 4XPGH 5IHUL 5IV2A 1AD0A 3FB5A 1NCAH 1XF5A 1GGBH 4MA1B 1CXLA 3F7RA 4X6FA 1X7QB 3GI9L 1XZ0A 2LQRA 2FLBT 4U6VH 3W9EB 4PJ8B 2WWMC 4JRYD 5EU5A 1I7ZB 1B90A 1A7OL 2J5LB 4G80B 3VXUB 1HCFX 5J7CC 5IMOB 4HIJA 1KYOK 4PGDB 1QRNE 2R4RL 4EI6B 1KB9K 3EYUH 4WDIA 4P5MB 4GLRH 2ZCLH 3WS3A 3BAEL 3VD7A 4UV7H 1W2KT 3MXWL 3VD9A 5TH2B 3SGEH 3HMWH 4OM0L 4R96A 4EN3B 1EMTH 5GGQL 4F80A 4KKLD 4ZQKA 1NCTA 2P24A 2IG2L 2V9RA 2P8PA 2P8PB 5D7LB 5TE6H 3DETD 1FL6A 4LHUA 4YLQT 1IM9B 1S9YB 4Y2OA 1HNFA 5L2JB 4U6XB 3EO1A 4BELD 1UJTA 2AXFB 5BS0B 2GJ6B 5D71L 4EIZC 5SWZD 2W59A 1FP5A 3K8MA 2GJ6D 1ZSDB 2I24N 2NY1C 5I30H 2N56A 1I3RB 3I75A 4BYHA 4QOKD 2BSED 1RIVH 5EU5B 3QHZL 4YPGB 1N5YH 1G9NC 4FTVE 2I27N 2A6DA 3QIUA 4NO2B 3MLXH 4JKLA 5DDHA 5EWIL 4CL7A 1SY6A 25C8L 3OXRB 3OL2A 3GI8H 4MQSB 3FQRB 4OCRL 1K8DA 1XIWD 2Z93B 3MXVH 4NCC2 4QO1A 4QTHB 1T2JA 3CK0H 3VE0A 4M7ZC 2FH6A 4J7RA 1IMHC 1AGEB 3IT8D 4CVZB 4YWGL 1JYNA 1NDGA 3QHZH 5F1NB 3BE1L 2FO4B 4WNQA 4NO5B 3MXWH 1XGPB 1R3LB 4WI7A 4X0KA 3I6KB 1OGAE 4PJ5E 5SWZA 1FNEA 5E1AB 5IGXH 1Y0LA 5AYUL 4ODVL 3M17B 2WV3A 3ARGA 4HLZG 5GS0D 1HHGB 1V7NL 3KPPB 1NSNH 2VH5L 4OFIA 4FFYL 3QT2A 1OP5H 3Q1SH 4KHXL 1VFOA 2E7CA 3DMMA 3UO1L 4TUJB 2AK1H 2R1WB 4H8WH 3CDGB 4X9FA 5ABDE 1CIUA 5I0DA 2XTLA 2X42A 4TTDC 1UA6L 2QR0A 5DVMA 5IB2B 2FECI 1L9NA 3LQAL 1NUDA 4D8PB 4DJMA 1YNKH 2AXJA 1FZJB 1PEZA 1U58B 2DN7A 4X80H 3ZSSA 2BZDA 5FGBA 2Q3AA 3FQXB 4P4KC 4PJHB 3MO1B 4F57H 5BMFL 3V4VL 4JHAH 1VFBA 1T89A 5T5NG 5ID0B 1IEAB 3BD5A 4KQ3H 3W82A 1MWAH 1A1MA 1S9XB 3O3UN 4MNQE 4XWGL 5J1AB 4NJ9H 2DOCA 1P1ZA 1MEXL 1VERA 1UJ3C 2A9NL 3BE1H 2N4IA 4BH7B 4PP2A 4G8GA 4LAJH 5IB3A 3T3PE 2BHUA 2AJUH 1N4XH 3HC3L 5JUEH 2XZCH 4XTRD 1DLFL 5CAYB 4KJYB 2UZYB 4ZS6D 4EI5D 1LMKA 1IGIH 4PG9B 5C2UB 2ZZUT 4F8QA 3TJEH 2Y36H 3VGEA 1UZ8B 4NKIL 5T5FH 1PQZA 4ZG1A 3WIHH 2CJUL 1CYGA 1JFQL 3LSOA 5MERB 1MJJB 5F1IA 2BVUA 5F9OL 4C83B 1RK1A 4X7FC 3V4UH 1UCBL 5HVHB 4ZFOL 4QF1A 3D2UD 1D6EB 1GCFA 2Z92B 4OT1L 3DIFA 2HJLB 1M6OA 1LDSA 1U3HB 1XMWA 3X11B 5ETUA 1UCBH 4M6MH 3S36L 4H88H 4DW2L 3TC9A 4QHLB 1A9BB 5KBNC 3NCFB 2VZVA 4M7LT 5D7JD 2GK2A 4G43A 3EFDH 3SPVB