2HFHA

The nmr structures of a winged helix protein: genesis, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
MVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes in the region directly adjacent to the DNA-binding helix highlight a possible mechanism to explain the observed changes in the sequence-specific binding of winged helix proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hnf-3 homologues
molecule keywords GENESIS
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1998-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hfhA00
4OMZA 1ZH5A 4IRIA 5TJJA 1V4RA 1USSA 4MGRA 3QOPA 1TQPA 3K69A 2CW0F 3DPLC 4U88A 3FHZA 2BV6A 4HV6A 2PFBA 1FLIA 1B9NA 4YIFA 5DUKA 3K9TA 2G9WA 1FYLA 3P7NA 4P55A 2LF7A 1KU9A 3RPUA 3R0AA 2Z9OA 2F5FA 3W6JB 1I1GA 3U1DA 1Z1DA 5ICEA 4UNOA 4KYWA 2QVOA 1F1ZA 4YG2F 1L0OC 2HQNA 1HBXG 2V1DA 5FGMA 4CGZA 1L3LA 4A0ZA 1XGNA 1YW7A 3DQVC 4M73A 4RB1A 2W57A 2FSWA 2EV0A 1YQAA 4NHJA 1ODDA 4CXFA 1XSXA 2FMYA 2JPBA 2LKPA 5L3CA 2A61A 2CYYA 4RB2C 1BM9A 4XSZF 4GYGA 3FF5A 1T98A 1WQ2A 1TQMA 1TLHB 3EETA 3EYIA 2CG4A 2EFNA 5FFXA 2OQGA 2STTA 5CYVA 3AAFA 3GFMA 1ON2A 3VFZA 4BYYA 1KQ8A 1KYZA 1R1TA 4LLLA 3VB2A 5BPDA 4UVCA 1T0FA 3MWMA 2EV5A 2NNNA 1BIAA 3FWEA 2NRAC 2H09A 5LGNA 4ETSA 1W4MA 4A0YA 2RGVA 4LK1F 4M9SA 2WWYA 3HRSA 3V7SA 1LJ9A 5LGUA 2H94A 1SMTA 1MJAA 2QM3A 2W25A 2XAGA 1K78A 2IRFG 3BY6A 3Q9VA 3I59A 1YG2A 5CVRA 4RGUA 3R60A 2YU3A 4WXHA 4GGGA 4MEYF 1S8NA 3C3WA 3KLOA 4H0EA 1O3RA 2HS5A 3LA7A 3CUQC 1DUXC 1Z6TA 4AIKA 1PP8F 2QYOA 3IL2A 4GXOA 3MCZA 3HOSA 4ZH4F 3J80Z 1KGSA 2L54A 1VTNC 5FO5A 1OKRA 1FPQA 1ZG1A 4WCGA 4I7HA 4EGYA 4EJTA 3GX4X 1B4AA 2IPQX 4WXDA 2HKOA 2XROA 1DPUA 1QO0D 1B1BA 5HLHA 1KQ9A 3IRQA 3HRMA 5LHIA 2K27A 3KEOA 1DPRA 1X3UA 1U3EM 4HA8A 4NB5A 2QQAA 5EEHA 3ZMSA 4CZZA 4L9TA 4U7BA 2R7FA 2A6EF 1ZRCA 1A04A 1R1VA 1MDMA 4R1HA 4P9UA 3K1NA 1FYMA 3TGNA 2NYXA 4A0XA 2Z33A 1C0WA 1HKTA 1P4AA 4I98B 1CF7B 4BHPA 3GFIA 2LDUA 2RDPA 4HQEA 2CWEA 3LAPA 2F2EA 2QUFA 5LRRA 3DXJF 4XSXF 3RDIA 5CVJA 1DP7P 2YPRA 2MH9A 1J0RA 2PI0A 5LEJA 2R3SA 2D1HA 1IN7A 4KA4A 3RIRA 1HW5A 1GVJA 2O8XA 3KZZA 4LJZF 4HW0A 2ELHA 2VBYA 2Y0MA 2HKXA 4HX4A 1YTYA 1S7OA 2Q0OA 4L5IA 1R7JA 4L18B 2IVMA 3RKXA 3BROA 1HKSA 1LDKB 3GFLA 2QZ8A 3I71A 4KN7X 2XKOA 1D5VA 4MNUA 3R4KA 3KEQA 2XUBA 3Q9SA 2ZBKA 2JTVA 3C18A 4G7ZF 4IHTA 1SAXA 3FXRA 2ZFWA 3ZMVA 1KU7A 2VXZA 5DV5A 4KIGA 2ETHA 4M6XA 4EVIA 4WXCA 3FZVA 3ABUA 3I4PA 2ZXJA 4UV9A 5E8GA 3QPHA 3TKYA 4RGRA 2VBZA 2O03A 3V7CA 3BPXA 2OZUA 5ILVA 5HOOA 4AVPA 5AONA 1E17A 1IAWA 2O3FA 2HTJA 2QQ9A 4Y15A 1LNWA 4OMYA 3HSFA 2WTEA 1KU3A 1QBJA 3ULQB 1T2KA 4LFUA 1QGPA 2O61A 1ZHFA 2V79A 2OBPA 2BBYA 3F8BA 3MFKA 4HZFA 3GWZA 2L02A 1K79A 5JR3A 3T8RA 1W7PD 1OMIA 4PZJA 1W5TA 1YLFA 1IW7F 1QZZA 4HDVA 4OU0A 5FD6A 5DEQA 3T1BA 3ZMZA 1BJAA 4M71A 4AIJA 3L00A 4Y13A 2GQQA 4AWXB 3HHHA 4O5VA 1FBUA 1YW8A 2DLLA 3GZ6A 4M6YA 1ONVA 5D6FA 3RPQA 2VE9A 5JFRA 2DK8A 2BGCA 3WTWC 3GF2A 3WTZA 4ESJA 4ENJA 3I54A 3BPVA 1P4XA 1G3WA 3HHGA 2K86A 5ICCA 5CJ9A 3HTUA 2P5LC 3R61A 1REPC 2DBBA 3COAC 1D3YA 2JT1A 2DI3A 1QPMA 1R36A 5F1RA 2PBIA 2E1NA 4B8XA 2HYFA 3EUHA 2A68F 2HYGD 1I5ZA 2FE3A 4RGSA 2KRFA 1TBXA 2A5YB 2EJRA 4UVBA 4ON0A 3WU1B 3CJNA 2JRTA 5LGTA 4FHTA 2KKOA 5L3EA 1IRFA 4KIFA 4N0BA 4Q4ZF 2RNJA 3KP7A 3ZP5A 2XVCA 4M9XA 5BOXA 1SFUA 5DCMA 3MQ0A 5BMZA 3GUDA 1XCBA 1U8RA 1R5HA 4RGXA 4LLNA 2HEOA 3F6OA 1PP7U 1EH7A 4ZYEA 2EV6A 3QRFF 5AIPA 3Q5FA 2F5DA 2EA4A 2L4AA 3U9GA 5IT9K 4Z2YA 2XIGA 2B0LA 3WE2A 4OIPF 1ZARA 2IJLA 3EYYA 5E18F 2PMHA 2FXAA 4EGZA 1P2FA 2RV8A 2KJBA 2DTRA 4G8XA 4M74A 2HQRA 1G3YA 4EM2A 1R5GA 4XLNF 1HKQA 2MLKA 5HLIA 2ACJA 1LQ1A 4KNYA 4WX9A 1Q1HA 4XRFA 1ZLKA 3I0TA 2W85A 3CO7C 1XDUA 3HIFA 3MAJA 2VODA 1ZN2A 2UZKA 4Q48A 1FZPB 1RUNA 2PMUA 1YYVA 3DP7A 5D5XB 5BPIA 5FD5A 3BJAA 1FWZA 2HFHA 4A12A 2DU9A 1IN4A 3WODF 5L3BA 3IWZA 3IWFA 2D45A 2Z3YA 2HR3A 5L3DA 3FXQA 1ULYA 4HLYA 4EJVA 4CO8A 2UXXA 5DD8A 3ZMDA 3RYRA 2M5WA 5L3FA 2M30A 4EJUA 4JQFA 2FQ3A 2CFXA 1F4KA 2D1VA 2KIUA 2DT5A 1IRGA 5D5VB 4KT5C 1FOKA 1ZG5A 1RZ4A 2VT2A 3WGHA 3V8KA 1IUYA 3JAMZ 3T0YA 2Y75A 4UHTA 4HLXA 1RI7A 4HQMA 1HXDA 5E17F 4D0PA 1BBYA 4JK1X 1Z9CA 2VBWA 1XCVA 1O7LA 2RQPA 3H3UA 3F8NA 4HF2A 4EV0A 3N97A 2PN6A 5HS8A 1DDNA 4NQWA 2A6HF 1UB9A 1MDMB 1IXRC 2WV0A 1D8KA 1OYIA 4A6EA 1I6XA 1EH6A 2IA2A 4UXNA 3KE2A 5ICGA 5A2QZ 1IN6A 3WTYC 5JI6A 3FXUA 4I01A 4G9YA 5LHGA 4RB3C 1WI9A 2IP2A 3TDUC 4U0VA 2KIMA 3R0JA 4KN4X 1NHAA 6PAXA 3RKYA 3KCCA 1WKMA 2VC0A 3I53A 2IT0A 3T5XA 2H27A 4L0ZB 5BS6A 2MH2A 3K1PA 1SFEA 3HRUA 4Q5SF 4KFCA 1EV7A 2LF8A 3QU3A 3G73A 1Y0UA 5D4RA 1HW2A 1XSDA 2ESHA 3ECHA 1RNLA 2DW4A 4EJWA 2G7HA 3S2WA 3D5LA 1TNTA 2P6TA 4IRHA 3HUGA 1XGSA 3P9IA 4O6JA 5HLGA 2FBHA 3E6CC 2FOKA 1FC3A 3E5UA 3JTHA 1W7PB 3RI4A 1HSJA 4KMFA 2GIVA 4PGGA 1H0MA 1Z05A 5ED4A 2MC3A 5HS7A 3SQNA 2PEXA 2BEOA 2YSRA 5DCFA 2ZNZA 3CUQB 2GWRA 3ZN0A 5K5RA 5FLXK 1R22A 3QAHA 4TV7A 4QLCU 2E7XA 2DO7A 2OU2A 3OV8A 5LEKA 1MD0A 3HRTA 4S04A 3J81Z 2PG4A 1JE8A 1OPCA 1P92A 4UV8A 1U2WA 4I09A 2O6GE 1FP2A 1J59A 4LGWA 4G7HF 2J5PA 1XN7A 4O3MA 4G6QA 4LB6B 1J9IA 1JHFA 5LBQA 4F7ZA 1O57A 3I58A 2NS0A 4AD9A 3KP4A 4ESFA 3M8EA 3WTXC 2EFWA 3SZPA 1QQIA 1B6AA 2FBIA 2VC1A 1ON1A 2MLGA 5DDGA 3P9KA 4YFNF 1UFMA 2AXLA 1BC7C 1CGPA 3M7GA 2MA3A 1MJBA 1JXSA 3HTSB 1D8JA 1HQCA 1LVAA 1LB2A 3FMSA 2RVCA 1S6LA 2DK5A 2FMLA 4L9JA 1LDDA 3F22A 4IRGA 3P9CA 2XHKA 1YFHA 4EM0B 4ENNA 3HYIA 1U5TA 1AOYA 5H6QA 4MEXF 3KP3A 2K4BA 4PGHA 2R7DA 4M72A 1MJ9A 2RN7A 3MZHA 2P5VA 2X0LA 3RKWA 3L2CA 3BWGA 2XAJA 2ISZA 4OIQF 2C6YA 3GEZA 4EMSA 2STWA 2Y48A 4GYIA 2EFQA 3IHUA 1SFXA 2GA2A 3WE3A 1SD6A 1WSUA 3GW2A 1HSTA 1KYWA 5D5WB 3DFGA 1ZREA 5J8FA 4RB0A 4A5MA 3TO9A 4IVNA 1GXQA 5D4SA 3GLXA 3CUQA 3KZYA 5E1ZB 2AS5F 2ISYA 3JSOA 5BQTA 4YIIA 1TQIA 1HW1A 4U0YA 3E6MA 1MZBA 4BHBA 1S7AA 2EFOA 3IKVA 5D8LB 3I64A 2K4JA 4L5JA 4HOBA 2QWWA 3F6VA 3GO5A 3LA2A 3PQKA 1PUEE 1U6GA 2VBXA 2CGPA 4LG0B 2OZ6A 1BN5A 5A2QK 1ZGAA 3RTRA 2JPCA 5LLQA 5FB2A 2EB7A 2K02A 1TW3A 3K2ZA 1U78A 3VEPA 3F72A 3E5QA 4ASNA 1H9TA 2COMA 3O6BB 4PCQA 1E2XA 2CQKA 4LLGF 2EA2A 3JSPA 2X4HA 3FM3A 4IPAA 3NQOA 1G3SA 5ILUA 4CYDA 3WTUC 1IXSB 2BE5F 3JW4A 2F5EA 1UCRA 1J5YA 2VN2A 5J8CA 4IXAA 1LDJA 4P9FA 2EWNA 1KA8A 3E6BA 4K2EA 4LB5A 3FX3A 2HZTA 2FNAA 4JBAA 5DD4A 1FNNA 4ZYDA 1GHCA 3FM5A 2KIFA 3H92A 4FX4A 1FSEA 3K1MA 3F8CA 1P6RA 3LQRA 3RJPA 4YFKF 2GZWA 2RC4A 3LWFA 3FMRA 1OR7A 2Z99A 1F9NA 2Q8KA 4EQQA 2H6CA 1XDSA 3J81K 4OOIA 2QENA 2P7VB 2MD5A 3E97A 4L0YB 2ZMEB 3BJ6A 3O3KA 2P8TA 2ADUA 3I5UA 4XLPF 4LMYA 1ZRDA 4ZZDA 4QWQA 2NNYA 3C7JA 2IW5A 2HGCA 1RIOH 1O3SA 2G7UA 3KFWX 3BOQA 3CDHA 5HDNA 1Z6RA 4ZZLA 3NRVA 3ZQ7A 1BC8C 4MQ9F 2ZMEA 1J7KA 2P5KA 3U2RA 2IA0A 5KK1A 1G3TA 2FNPA 4CHUA 2A07F 3JTGA 2GA1A 1FP1D 2CO5A 1IN5A 1S29A 4E70A 3ISPA 1F5TA 3F23A 1H9GA 3K0LA 4RAYA 1EH8A 4FT8A 4U7DA 3WTTC 2XRNA 3CUOA 1YS7A 5TRDA 4LK0F 2VONA 1BOAA 4IF4A 5HDKA 1CF7A 3F3XA 2XGXA 4ZYHA 2ZCWA 1IZ1A 1P4WA 4G6DA 1YW9A 1SD5A 2HTSA 3V8LA 3V8JA 3LSTA 2QBYA 5CVVA 2VT3A 4RAZA 3KP6A 1K7AA 4HF1A 4BNCA 4U0WA 1U5TC 3FMQA 3KLNA 2GAUA 2ESNA 3QU6A 3TO6A 2MBFA 3ERED 1QZYA 2V1UA 3EDPA 3O2PE 1U5TB 2M1BA 3J7AO 1S3JA 3SZTA 3KP2A 2L3DA 2QBYB 1MGTA 3E6DA 3ZMTA 4KICA 2XV4S 2P7CB 5F6FA 3ZMUA 3EQLF 4L9VA 3WGIA 3L9FA 2M8EA 2V6CA 3E5XA 4Y17A 4LG0A 5FLXZ 3T8TA 2JSCA 4BQAA 4ZYGA 2DAOA 3PFIA 3TOBA 3LAJA 2VOOA 1BI3A 2XASA 4AIHA 2DPUA 1I27A 3I59B 4KIBA 2XAHA 2OQRA 1WWXA 1R23A 1K78B 3ECOA 3PQJA 3JAMK 2K7LA 4ESBA 1B59A 4A2UA 3TO7A 5ERIA 3HSRA 2WC2A 2FEZA 2LNBA 1J2XA 1FT9A 3DKWA 1T6SA 3IRRA 1ZGJA 3WGGA 4WK8F 5HDGA 2DQRA 1XMKA 3M1EA 1UHWA 2KJCA 5KVRA 5E8IA 3ABTA 5D8KB 3F8MA 1W5SA 1OYYA 1YS6A 4ENKA 3F21A 2V9VA 2GXBA 2L4MA 4FX0A 3VODA 2OA4A 2ZJ2A 2J5OA 3M8FA 2VE8A 2F5CA 4A6DA 3LQQA 3CO6C 1G4DA 3DV8A 3VOEA 2CSOA 3HSEA 3WG9A 5E1WA 1LEAA 4N9HA 1AWCA 5CLSA 1PDNC 2PJPA 1FBSA 1B9MA 1GXPA 2YX7A 1KQ0A 1JGSA 2M45A 4P5OA 5J6XA 4EM1A 3IC7A 5E1XA 3GVAA 4I0BA 5HS9A 1W7PA 3ELKA 3LFKA 3MZYA 1UHMA 2Q2EA 5D5UB 4CICA 1IF1A 4HBLA 2E7WA 1G6NA 2UXNA 3G3ZA 1K6OA 2O0YA 3SXYA 3J80K 3WTSC 1USTA 3QPTA 1ZG3A 1BIBA 1XD7A 4EJOA 1JHHA 2PQ8A 3NEUA 4OIRF 3B02A 5HVQC 3ROUA 1IXCA 5JHUA 1FBQA 2VOPA 1O7FA 5D6EA 2HDCA 3CLOA 5DYMA 1YO5C 1BI1A 3MEXA 5IT3A 2W84A 5DUIA 2P6SA 1XB4A 1LEBA 2BYVE 1R1UA 2RKHA 1Z7UA 2Z5UA 4LD5A 2XKPA 4MTEA 5F64A 1FSHA 1ZRFA 5EEGA 3WU0A 1R58A 3BJOA 3R6SA 2OAZA 1XGMA 4S05A 1Z91A 1ZAOA 3SHFA 3D0SA 1IN8A 5E20A 3GXOA 5CVIA 4IJAA 5CVUA 3WTVC 2HWVA 4IHSA 5AIQA 3KETA 1R00A 4PDKA 4HDUA 2PLYA 1YIOA 3F8FA 2DPDA 3KP5A 3BZ6A 4MTDA 1XSVA 3W6KB 3TDZC 4GO1A 4R79A 4OIOF 1QNTA 3DPTA 2E1CA 2YX4A 4KUMA 5K5OA 4CDGA 1SD4A 4N9IA 5L3GA 2XAQA 2JZYA 4A5NA 2LSOA 1ZLJA 4HX8A 3LA3A 2EK5A 4MQVA 4ENMA 3TQNA 3GZ5A 3ZN1A 4HX7A 5ICFA 2ZNYA 3M9AA 1BI2A 4I0AA 2DFIA 3L7WA 4MHGA 5LRSA 4G94A 3OOPA 2EFPA 1J75A 4OINF 4R8HA 3ML6A 3E3VA 1T38A 1TTYA 4GCVA 4B09A 2OD5A 4P96A 4XBFA 2H6BA 5H6RA 4KMUX 3ZPLA 5JVTA 1I1SA 4HV5A 2UWMA 4L9NA 3IKTA 3DF8A 3H3ZA 3RYPA 4DNCA 1WRJA 3V4GA 2P4WA 4KDPA 5FFZA 2W24A 3C1DA 2DQLA 4BHCA 2FBKA 5LHHA 2M87A 5K5QA 4BH9A 1STZA 4RS8A 2NAZA 4HAMA 5K1YA 2FF4A 4BAYA 1O3QA 1TNSA 4BXUA 4WWCA 4I2OA 2FA5A 4UVAA 1O3TA 2YR2A 2TDXA 1FYKA 1OYWA 4Q47A 3HOTA 3REOA 4M9ZA 1XGOA 2GXGA 3V7RA 2QQBA 1FX7A 5H20A 2XAFA 4UUVA 1BI0A 2ZKZA 4HYEA 4YFXF 3CTAA 3GYHX 1SMYF 5IT9Z 4I02A 4HF0A 5DCMB 1T39A 1RUOA 1FY7A 2FRHA 3QP5A 3DEUA 1V3FA 3B73A 1ZYRF 2V1XA 3N4MA 3L09A 3TOAA 1XMAA 3BP8A 1SD7A 4G7OF 2FU4A 2ZO4A 3GFJA 4DQ2A 1TW2A 2D2WA 3BDDA 2L01A 2A69F 2HOEA 5ILSA 2IA1A 3SFZA 2A3SA 2QLZA 4WF2A 1MKMA 3QP6A 1KU2A
chains in the Genus database with same CATH superfamily
4OMZA 3DWLE 4NC7A 1ZH5A 4IRIA 5TJJA 4ZTFA 1V4RA 4ITVA 1OLTA 3UR3C 1USSA 2R7VA 4MGRA 4FCYA 3QODA 4MFDA 4XN3A 3QOPA 1TQPA 3WHBA 3OIOA 3K4NA 4CCKA 2K9LA 3K69A 2CW0F 1QVUA 3DPLC 4U88A 3FHZA 1PUFB 4UY8I 2BV6A 3GLLA 2VB6A 4HV6A 2PFBA 2OUMA 1FLIA 1DU6A 1B9NA 1Y8QB 5C4JJ 1OR7C 4YIFA 5DUKA 3FISA 4BY1J 3K9TA 2G9WA 1WJCA 2CUZA 3I55I 3P7NA 2M8GX 1FYLA 3CD6I 1SEUA 4P55A 2LF7A 1VQ8I 1GT0C 1KU9A 3RPUA 2DDBA 3ESWB 3R0AA 3VSLA 2Z9OA 4P1WA 2F5FA 3QOEA 3W6JB 1E0EA 2QSHX 2EIJH 4G6TB 1I1GA 3U1DA 1BR2A 4AC0A 1Z1DA 5B1BH 1V5FA 2CUJA 5ICEA 4UNOA 2R7TA 4KYWA 2QVOA 2L2OA 2YS9A 1SFOJ 1LVKA 1F1ZA 4YG2F 1L0OC 2HQNA 1KZHA 3CJTB 3KYLA 1MBHA 1HBXG 2IS6A 2V1DA 5FGMA 2HOAA 5EZHA 2E1MB 4CGZA 1L3LA 4A0ZA 4BS9A 3AG3H 3LSJA 1XGNA 4B43A 2HZDA 1YW7A 3DQVC 2QCOA 4M73A 2DFHA 4RB1A 2LP0A 4DBQA 2W57A 3TL4X 1CQTA 3UNGC 2FSWA 1FMWA 1T0FC 2EV0A 1YQAA 3LSPA 1ODDA 2VKEA 4CXFA 4DYQA 1EJ9A 4NHJA 1XSXA 2KMUA 3DBRB 2FMYA 2JPBA 2LKPA 2KP6A 5L3CA 2A61A 2CYYA 4Y7NJ 4RB2C 4NC6A 4A3IJ 1BM9A 4XSZF 4GYGA 5JLXA 3MKLA 3FF5A 1T98A 5TISC 1WQ2A 2DJIA 2Y0SN 3TBIA 1TQMA 1TLHB 3OYNA 3EETA 2ZJRF 3EYIA 2CG4A 3LMMA 3Q0UA 2EFNA 5FFXA 2OQGA 3OS0A 2STTA 5CYVA 3AAFA 2PJRB 3GFMA 2W00A 3FKIJ 4M3BA 2JWTA 5JVGF 2VPLA 4C2TA 1ON2A 4NQWB 4E6KG 3VFZA 4BYYA 5HNHA 4I6ZA 1Y6IA 3AL0B 4LG3A 4XN0A 4A3CJ 3LFUA 1KQ8A 4X0GA 1KYZA 3Q3SA 1R1TA 4LLLA 3VB2A 2VXDA 4F92B 5BPDA 2XPUA 4UVCA 1T0FA 3IUOA 3WU2C 2F5VA 5F0CA 3MWMA 2EV5A 2NNNA 1BIAA 4RM3A 3FWEA 2VL8A 2NRAC 2H09A 5B1AH 5LGNA 3OR1C 4ETSA 1W4MA 1I3AA 4A0YA 1SFKA 2XSDC 2RGVA 4HSTA 4LK1F 4M9SA 2WWYA 2DMTA 3HRSA 1LFPA 4OAYA 3V7SA 3NARA 1LJ9A 1JUMA 5LGUA 3OYDA 3CCEI 2LYCA 2H94A 1MMAA 1SMTA 1MJAA 3PIOF 3PM1A 1JKRC 3BTCA 1VQOI 2QM3A 2W25A 2XAGA 3MN2A 2LVSA 1K78A 2IRFG 3IV5A 1X4PA 4BDZA 3W2WA 2KRHA 3BY6A 4QIWN 3AG4H 4AVZA 3JREA 1ETOA 3Q9VA 3I59A 1YG2A 1VQ6I 5CVRA 4RGUA 5K7HA 5EG0A 2PX9A 2IBDA 2Y30A 3R60A 2YU3A 4WXHA 3HUGB 4GGGA 4MEYF 1S8NA 5EZGA 3C3WA 3KLOA 4H0EA 3GTOJ 1O3RA 2HU9A 3K4LA 2HS5A 1RRJA 3LA7A 2NVXJ 3CUQC 1DUXC 3HBLA 1EF4A 3S1MJ 1Z6TA 2V9KA 4AIKA 1K4TA 1PP8F 2QYOA 5FRMA 1N75A 3IL2A 2GLOA 4GXOA 4AM3A 3MCZA 3HOSA 4ZH4F 3J80Z 1RR8C 4BXXJ 4A69C 1KGSA 2L54A 1VTNC 2JVHA 2Y69H 1V55H 5FRNA 1K61A 2DA1A 5FO5A 2BVLA 1YX5A 3GTLJ 1ERDA 1OKRA 3IH2A 3PNTA 1FPQA 5M5YJ 3H5RA 1NG7A 1X1PA 1ZG1A 4WCGA 2VQGA 3LSMA 4I7HA 4EGYA 3PFYA 3OYHA 3GX4X 4EJTA 1B4AA 5M3MJ 1UJ8A 2IPQX 4WXDA 1MNMC 2AHQA 4LITA 4FISA 3JRIA 2JRMA 3CCLI 1XS9A 1B72A 2HKOA 2XROA 4ZC3A 1GLNA 2F6CA 1QO0D 1DPUA 1B1BA 5HLHA 1KQ9A 3H1CA 2X1CA 3IRQA 2BW3A 3HRMA 5LHIA 2K27A 3KEOA 1DPRA 1X3UA 2E1OA 1U3EM 4HA8A 4NB5A 2QQAA 2X1DA 4PSWA 5EEHA 3ZMSA 2HXOA 4CZZA 2VLAA 2VJ5A 3A1YA 3W6VA 4L9TA 4F55A 3VDXA 4NUBA 4U7BA 4B1RA 2R7FA 2A6EF 1ZRCA 4J19A 2X1EA 1A04A 4UB8C 4KISA 1R1VA 1MDMA 4R1HA 4E4HA 3K1NA 4P9UA 2XC7A 3LNQA 3S3OA 3S93A 3LSRA 1FYMA 3E7LA 4RAGA 2VJJA 3TGNA 2NYXA 4A0XA 2Z33A 1C0WA 5GPAA 1HKTA 1MBEA 2LKXA 1X2MA 1A31A 3MD2A 3ZQHA 2ZC2A 1P4AA 4I98B 1CF7B 1N77A 1FIAA 1JUPA 2CRGA 4BHPA 3GFIA 4Y52J 1HA8A 1NTCA 2LDUA 2F4OB 3I56I 4AYBA 3HGYA 2DMNA 2RDPA 3FXKA 4BL0B 4HQEA 2CWEA 2LREA 4BQNA 3A03A 1Z77A 3LAPA 2R7QA 2F2EA 2DA7A 4LOCA 2Q2EB 3RZOJ 2DOFA 2QUFA 2XF6A 5LRRA 1Y56A 3DXJF 4XSXF 3RDIA 1HOMA 4FTHA 3I9V2 5CVJA 4E7LA 1DP7P 2YPRA 2MH9A 2R7UA 1J0RA 1FOXA 2PI0A 4XORA 5LEJA 2R3SA 1B72B 3S14J 4FQGA 2D1HA 1IN7A 4KA4A 2AXTC 3RIRA 5DTDA 1OCTC 1HW5A 2OV7A 3GCMA 1GVJA 3KYCB 2O8XA 3VYTB 1D0ZA 3KZZA 1ETYA 3J7AY 4LJZF 2E19A 3FXLA 4BE1A 2M9HA 4HW0A 2ELHA 4C3HJ 1YJWI 5DM7F 2EINH 2VBYA 2Y0MA 5EGOB 2HKXA 4JYKA 3D5SC 4HX4A 1YTYA 1S7OA 2Q0OA 1UG2A 4L5IA 5EGOA 3H9JA 2HOTA 1R7JA 3A0HC 2IVMA 4L18B 4A3BJ 3RKXA 3BROA 1HKSA 4BKXA 1LDKB 3GFLA 2QZ8A 3I71A 1S9HA 1FTZA 2JN6A 4KN7X 2XKOA 1D5VA 2GXAA 4MNUA 4ZYAA 3R4KA 1H88C 2FUG2 3KEQA 2XUBA 3Q9SA 2ZBKA 4Y4RA 2R5YA 1MMNA 2JTVA 3NWTA 3PO3J 3C18A 4G7ZF 1BL0A 3WHCA 3OYAA 2R7OA 1GV2A 2BY1A 4IHTA 1SAXA 1NK3P 3FXRA 2ZFWA 3K4CA 1WJAA 3ZMVA 1KU7A 3L2VA 4N4OB 2VXZA 4ZDLA 5DV5A 1YIJI 4KIGA 2ETHA 2DFEA 4M6XA 4EVIA 4IHWA 4JOMA 4CCNA 2X51A 4WXCA 1Z67A 3FZVA 2KZGA 1PVEA 3ABUA 2E34A 2ZXJA 3I4PA 1JJ8C 4UV9A 2KDOA 5E8GA 3QPHA 3TKYA 4RLQA 5JHFA 4RGRA 2VBZA 3G4SI 2K9QA 5EDNA 2L9SA 2O03A 3V7CA 3BPXA 2OZUA 4BACA 5ILVA 3OYFA 1H8AC 5HOOA 4AVPA 5AONA 1E17A 1IAWA 2O3FA 2HTJA 1T8IA 2K9MA 1JGGA 2QQ9A 4Y15A 3VPRA 1LNWA 2ELJA 4OMYA 3HSFA 2WTEA 1KU3A 1QBJA 2R93J 2M3AA 3ULQB 5GTIC 1T2KA 4LFUA 1N78A 1JUSA 1QGPA 2O61A 3S17J 1WJ5A 4E7KA 1ZHFA 3RQ4A 2V79A 2OBPA 3EUKL 2H1KA 2BBYA 3F8BA 4YEJA 3MFKA 2LFBA 1D5YA 2VIXA 4HZFA 3GWZA 5F08A 1WCMJ 2L02A 5JR3A 4BQQA 1K79A 3T8RA 3G2BA 1W7PD 2NOJB 3QQAA 4RLFA 2X85A 1OMIA 1ZGWA 1MW7A 4PZJA 1WH5A 1W5TA 3GMEA 4M3FA 3GTKJ 2OPTA 1QZEA 1Z3YA 5B3SH 2BVMA 4HNUA 1YLFA 1IW7F 1QZZA 1VQ4I 1JKPC 4HDVA 1YJ9I 2HOSA 3D5RC 4XLCA 4OU0A 5FD6A 3DBLB 5DEQA 5J4VA 2V7FA 3T1BA 1VQ5I 3ZMZA 1BJAA 2JJ7A 4M71A 4AIJA 3L00A 1E3OC 4I76A 1S72I 3BTLA 3ZGKA 4Y13A 2GQQA 4AWXB 4BGDA 3GTMJ 3HHHA 4O5VA 1FBUA 4EEFG 1YW8A 2DLLA 3GZ6A 4M6YA 2VASA 1ONVA 1SVOA 5D6FA 3TP0A 3RPQA 2VE9A 1RESA 4BBRJ 5JFRA 2DK8A 2NXNB 3G1OA 2LR8A 2FOWA 1X3ZB 2BGCA 4NBQA 5EG0B 4BXFA 3WTWC 3GF2A 3M8JA 3BG3A 2BHZA 3WTZA 1Y1VJ 4ESJA 2E71A 4ENJA 2IGMA 1F43A 1ENHA 2QSFX 3I54A 3BPVA 2CQXA 1P4XA 4RAFA 1G3WA 3HHGA 2K85A 5F1JA 3EPZA 3TW7A 4DBRA 4D5FA 2K86A 5ICCA 2M4GA 3CMAI 2VPRA 5CJ9A 3HTUA 4B44A 3HZJA 2P5LC 1X4OA 3R61A 3CCRI 1REPC 5M5WJ 4A3GJ 2DBBA 3BR2A 3PNYA 3H35A 4XRSA 3COAC 1D3YA 3OWTA 3ZXSA 2JT1A 2CW7A 2DI3A 4Y3OA 4XOTA 1QPMA 2P81A 1R36A 3ERMA 5F1RA 2PBIA 2ID3A 1VQLI 2E1NA 3FXMA 4B8XA 5IPAA 2HYFA 4XLAA 3EUHA 2A68F 3BG5A 2HYGD 2PMZA 4BY7J 1I5ZA 1TWAJ 3RKQA 3OY9A 2DMUA 2FE3A 1VQNI 4RGSA 4A3EJ 2KRFA 3S2DJ 1R9TJ 1TBXA 2A5YB 2EJRA 4UVBA 2Z1DA 1XC5A 4PUSA 2LY1A 3LSHA 2ZXIA 4ON0A 4GFBA 3S15J 3WU1B 2DDAA 3CJNA 2LLKA 3NWSA 2JRTA 2EZIA 5LGTA 2IXSA 3OYMA 2BZTA 4FHTA 4XKVA 2KKOA 5L3EA 1OFCX 2O5RA 2JK3A 1IRFA 2MGQA 2KLOA 4KIFA 4N0BA 2HNHA 1X58A 4Q4ZF 2RNJA 1BR4A 3KP7A 4B47A 3ZP5A 1BW6A 2XVCA 4M9XA 5BOXA 1SFUA 2XGDA 4A3FJ 5DCMA 3MQ0A 4D7MA 5BMZA 1ZK8A 3GUDA 1XCBA 2ZXWH 1U8RA 1R5HA 1UZCA 3OYIA 3GTGJ 4RGXA 3CC7I 4LLNA 2HEOA 1DP3A 3CCMI 3F6OA 3I3LA 1QA6A 1PP7U 1EH7A 2F48A 4E7JA 3EUHC 1ZKGA 4ZYEA 3DKXA 2EV6A 3QRFF 5AIPA 1E3PA 3Q5FA 5GADJ 2F5DA 5F0FA 5DM6F 2EA4A 2L4AA 2KIQA 3U9GA 5IT9K 4W97A 3OYJA 4Z2YA 3S1QJ 2XIGA 2B0LA 3WE2A 4OIPF 1ZARA 2IJLA 3EYYA 4AYBN 1MIJA 1NG6A 2W7NA 2VQLA 5E18F 4IQJA 2PMHA 2FXAA 1VQ7I 3BTIA 4EGZA 1TT0A 1P2FA 2RV8A 2KJBA 2DTRA 4G8XA 5FROA 4M74A 2FQ4A 1XMXA 1ORKA 1G3YA 2HQRA 3NAUA 3BZKA 4C9YA 3C2BA 3I4NJ 4EM2A 1R5GA 2B9SA 3BR5A 4XLNF 3EUAA 3E0JB 3ZQFA 1HKQA 2MLKA 5HLIA 2FJ1A 2ACJA 1UAAA 1LQ1A 2GOMA 4KNYA 5F0HA 1VFCA 1AKHA 4WX9A 3M1CA 1Q1HA 5IOYA 3HC7A 1YX3A 1IO2A 4HG2A 3BR3A 4XRFA 4MFEA 1R49A 1ZLKA 3HDDA 1HLVA 3I0TA 3G71I 3CCQI 2X6OA 2ZSIB 2W85A 2XRLA 4B48A 1XDUA 3CO7C 2V26A 3HIFA 3MAJA 5IYBJ 2VODA 1ZN2A 5FKLA 2UZKA 2RNGA 5GPCA 5FLMJ 3RQIA 4PJJA 4Q48A 1FZPB 2DMQA 2LTPA 5M5XJ 2N8GA 1RUNA 1WVRA 2KHMA 5E3LA 2R5YB 1IRXA 1U8BA 2PMUA 1YYVA 4XOPA 1ZQ3P 3FXOA 3DP7A 5D5XB 5BPIA 5FD5A 1P7JA 1FWZA 3BJAA 1GDTA 5GAHJ 2I5UA 2BY2A 2HFHA 4YELA 3JRGA 1TL8A 4A12A 2DU9A 1IN4A 5IP6A 3WODF 1D1BA 5L3BA 3IWZA 3IWFA 2D45A 2VJIA 1JKOC 3U1KA 2Z3YA 2B63J 4MIMA 3KIOA 2HR3A 5L3DA 3FXQA 1FJLA 1ULYA 4S0HB 4HLYA 1TWHJ 4EJVA 2LG4A 2ZMEC 4CO8A 5J1YA 1R4MB 1RKTA 2UXXA 5DD8A 3C2HA 3ZMDA 3VWBA 4XR6A 4C3JJ 3RYRA 2M34A 2M5WA 2CV2A 3GZNB 5LFAA 1MBJA 1B8IA 5L3FA 2M30A 2EILH 4KT6A 4EJUA 2R4GA 3QPLA 5B5EC 4DW6A 4A3DJ 4JQFA 4OWRB 4D5CA 2FQ3A 2CFXA 2XB5A 5B66C 1F4KA 2D1VA 2KIUA 3KX2A 1X3WB 2XF7A 3TP3A 2DT5A 1IRGA 5D5VB 4XRMA 4KT5C 1KONA 4AIDA 4CCLA 1FOKA 3JRAA 1ZG5A 2JUCA 1RZ4A 2VT2A 3WGHA 3HPHA 1APLC 2OCEA 3V8KA 1SANA 1IUYA 3JAMZ 1R4NB 2R5ZA 2WA0A 2XSJC 1EKEA 3T0YA 2Y75A 5J1UA 5EF6A 3L2RA 4UHTA 3D1NI 2QGUA 4HLXA 1RI7A 3PIPF 4HEA2 4HQMA 1S7EA 1MSEC 4BEHB 1WJDA 2EZLA 3CCUI 5HNFA 3BR6A 1HXDA 5E17F 4D0PA 1BBYA 2Z2SB 3DEEA 3H0DA 1QHGA 4JK1X 1Z9CA 4M3DA 4BBSJ 3ABKH 3FXJA 1XCVA 2VBWA 2WB1N 1O7LA 2RQPA 2ZB9A 3H3UA 3F8NA 3LSGA 4HF2A 4EV0A 2TCTA 3N97A 2XGCA 3DTEA 3K4KA 2PN6A 5HS8A 1DDNA 4NQWA 2A6HF 1UB9A 1MDMB 1IXRC 2WV0A 1AA7A 1D8KA 1OYIA 4A6EA 5E3MA 3BLYA 3U21A 3ZQLA 1I6XA 1EH6A 2IA2A 1SVMA 4UXNA 3KE2A 2LOOA 5ICGA 5A2QZ 3DCFA 3WG7H 1PJRA 1IN6A 2LRDA 2CUFA 2K3FA 3MMYB 1UELB 3WTYC 2ID6A 5JI6A 3FXUA 5K7FA 4I01A 4ZDPA 1W5CC 1ZTRA 3BR1A 4G9YA 5LHGA 3QPSA 4XNFA 4RB3C 1WI9A 2IP2A 3TDUC 3GBGA 4U0VA 1HCRA 1UG0A 2KIMA 3OYLA 3R0JA 4KN4X 2BXZA 1NHAA 2UV1A 4LIUA 6PAXA 3JRBA 3RKYA 3KCCA 1WKMA 4ZTJA 2VC0A 3I53A 2IT0A 1BR1A 3T5XA 2H27A 2YU9J 4L0ZB 5BS6A 2MH2A 3K1PA 1SFEA 3HRUA 3PJRA 4IHXA 4Q5SF 5IY5H 4KFCA 1EV7A 2LF8A 3ZQIA 2ZJPF 4N4NB 3QU3A 4D1QA 5FKKA 1SAUA 3G73A 3H9QA 3FK6A 3ONQA 3VYUB 1OCOH 2M0CA 3IP4B 1Y0UA 5D4RA 3J7ZI 2COBA 1HW2A 1XSDA 2W4SA 4J00A 2K40A 2ESHA 2M0MA 3ECHA 1RNLA 2DW4A 4EJWA 3HG9A 1Z21A 2G7HA 1PYVA 3S2WA 5C3EJ 5FKNA 3D5LA 5E3NA 1TNTA 2P6TA 4IRHA 2DYSH 3HUGA 1XGSA 3DTKA 3P9IA 4O6JA 3CP8A 2CUEA 5HLGA 2FBHA 3E6CC 4BE0A 4IQ4A 2FOKA 4XLEA 3MZ8A 1E3HA 1FC3A 3E5UA 3CMEI 3JTHA 1BA5A 1W7PB 3FBIB 3RI4A 3OYBA 2R0QC 4IOCF 1HSJA 3CMMA 1XTAA 2FD5A 4RDUA 3H0GJ 4KMFA 3DPUA 2GIVA 2VI6A 4PGGA 5E3OA 1H0MA 1Z05A 3W2VA 5ED4A 3S3MA 2E1MC 2GIZA 2MC3A 2WADA 5HS7A 3BQZA 3OIPA 3SQNA 2PEXA 3ZRGA 4IOAF 2BEOA 2YSRA 5DCFA 2E5NA 2ZNZA 4PK4A 3CUQB 2GWRA 1WHUA 3ZN0A 2LY9A 2VUMJ 5K5RA 1WH7A 5FLXK 1R22A 1B8IB 4CYCA 3QAHA 2NVTJ 4TV7A 4QLCU 2E7XA 2DO7A 4XONA 2VKVA 2OU2A 4QTRA 3OV8A 3X2QH 2V4JC 1MD0A 5LEKA 3HRTA 3Q0VA 1N25A 4S04A 3W2AA 3BR0A 2CQ7A 3A0BC 3J81Z 3HGGA 1XX5A 4FE4A 2PG4A 4CCMA 4CCJA 1JE8A 1OPCA 1P92A 4UV8A 2A6TA 3ZQGA 2QQ8A 3KZIC 5IYDJ 1U2WA 2PMZN 4I09A 2O6GE 2IS2A 2AQFA 1X1DA 2NS8A 3OSGA 1VQKI 1MMGA 1FP2A 1J59A 4BJTA 4LGWA 4G7HF 2BXYA 2J5PA 1XN7A 2MD0A 2OF7A 1IV8A 3CF2A 3IH4A 4O3MA 4G6QA 2Y9ZA 1OCRH 2ELKA 3B6AA 2OJED 4LB6B 4XICA 1J9IA 1JHFA 1FOYA 2JA5J 5LBQA 4F7ZA 1O57A 2EBIA 1JKQC 1R71A 3I58A 2NS0A 1QU3A 4AD9A 5HLTA 3KP4A 3SDGA 4ESFA 3FBNB 3M8EA 1T33A 3WTXC 1TP4A 2EFWA 3SZPA 5M3FJ 3F9KA 1QQIA 1VZ0A 1B6AA 1R5ID 2L0KA 3ZQQA 2FBIA 2VC1A 1ON1A 2MLGA 3BCBA 5DDGA 3P9KA 4YFNF 3HM5A 1UFMA 2LH9A 4ZDOA 2AXLA 1BC7C 1CGPA 4XQFA 3M7GA 1LPQA 1YRNB 1LUJB 2MA3A 1MJBA 3HXLA 1JXSA 1IV6A 2Y2ZA 1WJBA 3HTSB 4X1EA 3V42A 1D8JA 1HQCA 2XB0X 3A4CA 2VKDA 4NNJA 1LVAA 3A2KA 1W0TA 1LB2A 4FETA 1U9OA 2AQEA 1TWGJ 2X48A 1WGXA 3FMSA 2RVCA 1S6LA 1VF9A 2DK5A 1ZELA 2KISA 2FMLA 3OS1A 4IO9F 1IGNA 4L9JA 3HOVJ 2ZJQF 1LDDA 4DGWB 3F22A 4IRGA 3P9CA 2WAQN 4QPOA 1WJEA 2XHKA 1YFHA 4F93B 4EM0B 2Z16A 3RCOA 1QVTA 4ENNA 3HYIA 2M4KA 3K4JA 1U5TA 3IH3A 1AOYA 5FKOA 4XKWA 5H6QA 2JSPA 5CQGA 4MEXF 1EA3A 2WY8Q 3HOXJ 3KP3A 4DOZA 2K4BA 3CC4I 5FLVA 4PGHA 5EYRA 2R7DA 4M72A 1G59A 1MJ9A 1MH3A 2RN7A 4FE7A 1ACIA 4BU2A 1X2NA 1P9QC 3MZHA 2P5VA 2BHYA 1MBGA 2X0LA 3RKWA 3L2CA 3BWGA 3BT9A 2XAJA 2ISZA 4OIQF 2C6YA 3GEZA 2DA2A 4EMSA 2DFFA 2STWA 2Y48A 3PO2J 2JUGA 3A02A 4GYIA 2X6WA 2HVQA 2EFQA 3IHUA 2QSGX 1SFXA 1BJZA 2DJNA 3MVPA 2Q1ZB 2GA2A 2DT7B 2H8WA 2M7BA 1SD6A 3WE3A 2JQ7A 2R7ZJ 1MMDA 1WSUA 3GW2A 2VQCA 4Y33A 1HSTA 2LC2A 1KYWA 4X6AJ 5D5WB 4BDYA 2L7KA 5GTHC 4YIRX 1LFUP 3DFGA 5KAIC 1ZREA 1JTYA 3J7YJ 1ETWA 5J8FA 4RB0A 4A5MA 4CYCB 4HRIA 2P0WA 3TO9A 4IVNA 1GXQA 3CJQB 5D4SA 1OQYA 3GLXA 3CUQA 1U9NA 3KZYA 5E1ZB 1I50J 4A3KJ 2AS5F 2ISYA 3H5AA 4H4KC 4XKCA 3JSOA 5BQTA 4YIIA 5F04A 1TQIA 1MBFA 2EQRA 4CCOA 5IP9J 1HW1A 3OYGA 5HODA 4RBOA 4U0YA 2LMDA 3E6MA 4W1UA 2HVSA 3LL7A 4NDLA 1FMVA 5CKTA 2NVQJ 1MZBA 1S7AA 2EFOA 2X9DA 3IKVA 5D8LB 4BHBA 2E36A 2K4JA 3I64A 4MO7A 4L5JA 1QPIA 4HOBA 1WJFA 2RREA 2QWWA 3F6VA 2XF5A 3GO5A 3S32A 3LA2A 3OSFA 3S1RJ 3HPGA 5J3LA 1IRZA 2MC4A 5DS9A 3PQKA 4BJ6C 4PJNA 1U6GA 2VBXA 3CP2A 1PUEE 2CGPA 2OZ6A 1YHQI 4LG0B 1BN5A 2IS1A 5A2QK 3PUBA 1ZGAA 3RTRA 2EIMH 1D0XA 2G0EA 2JPCA 4XL9A 5LLQA 5FB2A 2EB7A 2K02A 1TW3A 3K2ZA 3HOZJ 3RPUD 3BTJA 1T56A 1RC9A 1U78A 2DTZA 3DKYA 3F72A 3VEPA 1FOWA 3E5QA 4UB6C 5KAFC 4ASNA 1H9TA 2COMA 3O6BB 4PCQA 1E2XA 2CQKA 4LLGF 2EA2A 3N05A 3JSPA 4M3GA 2X4HA 1Y1WJ 3FM3A 4IPAA 3NQOA 1G3SA 2LBFA 3OYEA 3S16J 2CMPA 2KPMA 2EZKA 4PJ0C 5ILUA 4CYDA 3WTUC 3H36A 2OTLI 1IXSB 2BE5F 3JW4A 2F5EA 1XPXA 4PSXA 2OC6A 1UCRA 3SZGA 1J5YA 2VN2A 2MABA 5J8CA 3FDYA 4IXAA 4CH7A 1FTTA 1LDJA 4P9FA 4E7IA 2EWNA 4CSWA 1KA8A 5KHDA 3GTPJ 4MLOA 2HDDA 1K83J 2QF7A 1J09A 3E6BA 5J40A 2IGKA 2QEXI 4K2EA 1V5GA 2DN0A 4LB5A 3FX3A 5EJCA 2R7RA 2HZTA 2FNAA 2X6YA 4JBAA 5DD4A 1FNNA 4ZYDA 4LIVA 2WBMA 5C4XJ 1GHCA 4D7NA 1OCPA 3FM5A 4QSHA 3SYTA 1JT0A 1X19A 2XAUA 2HPIA 3O8GA 2LD5A 2KIFA 4JP0A 3BG7A 2ZFUA 2EPFA 3H92A 4FX4A 1FSEA 3K1MA 2ME6A 2HQAA 2ME0A 1P6RA 2XPVA 3F8CA 4F91B 1XG1A 2WY7Q 4KITB 1ZR2A 1G2HA 3K70C 4PJLA 3LQRA 3RJPA 2KL4A 4RMNA 4YFKF 2GZWA 1MSFC 2HXIA 2RC4A 3LWFA 3FMRA 2MG4A 2BY0A 2JA6J 1OR7A 2LBFB 3BC8A 2Z99A 1F9NA 4DYRA 2Q8KA 2ECCA 4EQQA 4PFPA 2H6CA 1XDSA 3OL3A 3J81K 1JI8A 4OOIA 2QENA 2P7VB 2MD5A 3E97A 4L0YB 2ZMEB 3BJ6A 3HOWJ 3O3KA 2ICWG 2P8TA 2ADUA 3I5UA 4XLPF 4LMYA 4ZJZA 1ZRDA 4ZZDA 4QWQA 4E7ZA 1R6RA 1WFXA 3RSNA 2MW8A 1TT5B 2NNYA 3C7JA 2E2IJ 3K4BA 2IW5A 2HGCA 3QYBA 2GBYA 1RIOH 1O3SA 2G7UA 3KFWX 2A5WA 3SEZA 4C2UA 2A05A 3BOQA 1ZR4A 1Z3XA 3LOCA 2CQQA 1FEXA 3CCYA 3CDHA 5HDNA 1Z6RA 4ZZLA 3NRVA 4IHYA 3OS2A 4C30A 3UKGA 1F36A 3ZQ7A 2ZXHA 4MQ9F 1BC8C 1T08B 1JTXA 3G1LA 3FHNA 2HYJA 4BUPA 2ZMEA 2CV1A 1J7KA 5IP7J 2P5KA 4J01A 4C3IJ 3U2RA 2IA0A 1IG7A 2L9RA 5KK1A 1G3TA 2FNPA 2IGOA 2L7MP 4CHUA 2M2EA 2A07F 3PSFA 1VQ9I 3JTGA 2GA1A 1FP1D 4B3AA 2QA4I 2CO5A 1IN5A 2GOXB 4BQOA 1S29A 4E70A 3ISPA 4XMYA 1F5TA 5CQEA 3F23A 1H9GA 3K0LA 5J47A 4RAYA 2KFDA 1EH8A 2ZSHB 4FT8A 4U7DA 3WTTC 1M1EB 1MBKA 2XRNA 2R7WA 2DXIA 2R7SA 1K4SA 3W3CA 2L9VA 3CUOA 1YS7A 2DA6A 3H5NA 4IX7A 1LE8B 3HOUJ 2CH0A 5TRDA 5TGTA 4LK0F 1QRYA 5EEAA 2IAIA 1AHDP 2VONA 1BOAA 4IF4A 5HDKA 3L2QA 2L9NA 3I4MJ 1CF7A 3F3XA 1X1AA 3VYSB 2XGXA 4ZYHA 2LKSA 1Y8RB 2ZCWA 1IZ1A 1P4WA 3CLQA 4G6DA 1YW9A 2MYSA 1SD5A 3OYCA 2HTSA 1SC7A 4GRIA 3V8LA 3HJEA 2DODA 3V8JA 2HQ5A 2HI3A 1JT6A 3LSTA 2QBYA 5CVVA 2NVUB 3HKZA 2VT3A 4RAZA 2DA5A 1HDDC 3KP6A 2E5ZA 3CCJI 1K7AA 4HF1A 3KEYA 4C2MJ 4ABZA 3L1PA 4BNCA 4U0WA 1U5TC 4CA0A 3FMQA 2E35A 3OMYA 3KLNA 2GAUA 3FKJA 2ESNA 3ABMH 4E7HA 3QU6A 3TO6A 2MBFA 3CESA 3CDIA 1IC8A 2BY3A 4DZPA 3G1MA 1IUFA 2WB1A 3ERED 1QZYA 2JA2A 2V1UA 3EDPA 3O2PE 4OAZA 1DU0A 1U5TB 3QYEA 3CCSI 3AL0C 3S1NJ 2M1BA 3J7AO 2K5CA 1S3JA 3SZTA 3KP2A 1MNEA 2L3DA 3ZQCA 1S5LC 1MGTA 2QBYB 4V19K 4ANJA 1RKWA 1X1CA 3E6DA 3ZMTA 2CJJA 4KICA 2XV4S 4NC8A 1D1AA 2P7CB 1MH4A 5F6FA 1YOVB 3ZMUA 3EQLF 4L9VA 3CMYA 3K70D 3WGIA 2H1LA 3L9FA 2M8EA 2DT6A 4I99C 2V6CA 3E5XA 4Y17A 4LG0A 5FLXZ 4BE2A 1TC3C 2LY2A 3SDBA 2I10A 3T8TA 2Y31A 2JSCA 4BQAA 1OCCH 5CPRB 3ZR8X 4ZYGA 2DAOA 3PFIA 3TOBA 5K7ZA 2RAEA 3LAJA 1LE8A 2VOOA 1BI3A 2XASA 4AIHA 4G12A 2DPUA 1I27A 3I59B 4KIBA 3H9GA 3OIQA 2XAHA 2OQRA 1VQMI 1Y0NA 3TEDA 1WWXA 1R23A 2FX0A 4DIQA 1K78B 2JA7J 3RZDJ 3ECOA 3PQJA 3JAMK 2K7LA 4ESBA 1B59A 4A2UA 3PNVA 3TO7A 5ERIA 2KT0A 3HSRA 4D9JA 2WC2A 1MNDA 2FEZA 3MKYB 2LNBA 1J2XA 3DEWA 1FT9A 3DKWA 5JLWA 1T6SA 3IRRA 3E1SA 1ZGJA 3WGGA 4WK8F 4M6VA 5HDGA 2DQRA 4RA2A 5FJ8J 1XMKA 1U0JA 3M1EA 1UHWA 2KJCA 5KVRA 5E8IA 2Y0SA 2W82A 2E2JJ 3GTQJ 2WAFA 2R7XA 2EH3A 3ABTA 5D8KB 3F8MA 1W5SA 5LD2C 1OYYA 1YS6A 3IAS2 1W1WE 3Q0WA 3F21A 4ENKA 2V9VA 2GXBA 2L4MA 4FX0A 2XPWA 1I39A 3VODA 2OA4A 1NK2P 2ZJ2A 2J5OA 2K9SA 3M8FA 2VE8A 2D5VA 2CS3A 3QYFA 2F5CA 3CF5F 3SJMA 4A6DA 3LQQA 3H3VK 1W36D 1ETQA 3CO6C 1RETA 1G4DA 3DV8A 9ANTA 3VOEA 2NVYJ 2CSOA 3HSEA 3WG9A 2L5QA 1DGWY 5E1WA 2PJRA 2NOGA 1LEAA 4N9HA 1IDYA 3IAM2 1AWCA 3S2HJ 4CZCA 4JX6A 4HNVA 5CLSA 1PDNC 2PJPA 1FBSA 2F4IA 1RR7A 3B6CA 5GAEJ 1B9MA 1GXPA 2YX7A 3BG9A 3AFHA 1JGSA 1KQ0A 2M45A 4P5OA 4HPQA 1G8XA 5J6XA 3L2UA 2EIKH 1QHHD 2NS7A 4EM1A 3IC7A 2DYRH 5E1XA 3GVAA 1FIPA 2E2HJ 4I0BA 3BG6A 5HS9A 1W7PA 3ELKA 4A3MJ 3LFKA 1JJ6C 1POGA 3BQYA 3MZYA 1UHMA 3CZ6A 3K4MA 2Q2EA 3TMOA 5D5UB 4CICA 1IF1A 4HBLA 2E7WA 5GP9A 1G6NA 3JRFA 2UXNA 3G3ZA 2KQRA 3AG2H 1K6OA 1AU7A 2O0YA 4IHVA 3SXYA 1DQUA 3J80K 3GTJJ 1IJWC 3SFIA 3WTSC 3VYRB 1USTA 3QPTA 1LKXA 1V54H 1ZG3A 1BIBA 1XD7A 4EJOA 1JHHA 4M3EA 2PQ8A 3NEUA 4OIRF 4EATA 2I8DA 3B02A 3C2GA 5HVQC 3CQZJ 3G6EI 1YJNI 3ROUA 4CUGA 5IYCJ 1IXCA 2TRTA 5JHUA 1FBQA 3MKZA 2VOPA 1O4XA 4V2GA 1O7FA 5D6EA 2IS4A 2HDCA 3CLOA 5DYMA 4QPQA 1YO5C 1GUUA 1BI1A 3MEXA 5IT3A 1YRNA 2W84A 2UUZA 5DUIA 2P6SA 1I6HJ 1XB4A 1LEBA 2BYVE 1R1UA 5F27A 1A6QA 1K6YA 2RKHA 1BW5A 1Z7UA 4JX4A 4UUTA 2Z5UA 4LD5A 4XKBA 4E7SA 2V9PA 3K2AA 2XKPA 3HOYJ 4MTEA 5F64A 1FSHA 1ZRFA 3OOUA 4V2FA 5EEGA 3WU0A 1R58A 3TW6A 4RM2A 3BJOA 3CCVI 3JR9A 4PJMA 3R6SA 2OAZA 5H2FC 1XGMA 2E60A 4S05A 1Z91A 1ZAOA 3SHFA 3D0SA 1IN8A 2CU7A 5E20A 4F52A 1OJLA 3GXOA 3JCUC 5CVIA 4IJAA 2V6EA 5CVUA 1Y39A 3WTVC 1W36C 2HWVA 1A35A 4IHSA 1A36A 5AIQA 3KETA 4IEJA 1R00A 4AUXA 4PDKA 4HDUA 2JA8J 2PLYA 5KCMA 1OCZH 2DOEA 2KRCA 2W48A 4HSRA 1YIOA 3DTIA 5GAGJ 3F8FA 2DPDA 4A3JJ 1BOBA 3KP5A 3BZ6A 5E79C 2XGEA 3S8PA 4MTDA 1XSVA 3W6KB 3TDZC 2CFOA 4GO1A 4R79A 1ITYA 4OIOF 3ASNH 3DU6A 3CC2I 3JRCA 2JMWA 3ASOH 1QNTA 3L2WA 3OL4A 3DPTA 2E1CA 3ABLH 1WZ2A 2YX4A 4KUMA 4DJAA 2ECBA 5K5OA 4BJ5C 4CDGA 3OR2C 1SD4A 2WV1A 4N9IA 5L3GA 3HB9A 1IDZA 2XAQA 3K6GA 2JZYA 1VI0A 4A5NA 2LSOA 4JX5A 1ZLJA 4HX8A 3KYDB 3BCAA 3LA3A 2CQNA 1Z0XA 2KZVA 1WI3A 2EK5A 4MQVA 4ENMA 3TQNA 2QKLB 1LFBA 3GZ5A 3ZN1A 1X1BA 1OISA 4HX7A 1TZLA 5ICFA 2ZNYA 2W1OA 3M9AA 3DLLF 3ZCOA 2Y9YA 1BI2A 4I0AA 2DFIA 1Z7LA 1YITI 4Z6YA 5J4YA 1HF0A 3L7WA 4MHGA 5LRSA 4G94A 1D1CA 2HPMA 1RPWA 2EFPA 3OOPA 1J75A 4OINF 4R8HA 3ML6A 3E3VA 1T38A 1TTYA 3PSIA 4GCVA 4B09A 2OD5A 1Q1VA 3S3NA 2IGNA 3JRHA 3HEFA 4P96A 4XBFA 2H6BA 2L7ZA 2HVRA 2VJ4A 3A01A 3DLAA 5H6RA 1GV5A 4KMUX 3ZPLA 5JVTA 1I1SA 4HV5A 4UUSA 2UWMA 4L9NA 4L5EA 3IKTA 2V1NA 2B7EA 2KDZA 1GVDA 3M07A 1A5JA 2X6XA 3DF8A 3H3ZA 3RYPA 1MMSA 3BZCA 3SEQA 4DNCA 2GM4A 1WRJA 2JVGA 3V4GA 4XIDA 2P4WA 4KDPA 2BW3B 5FFZA 2W24A 2H8RA 3C1DA 1UHSA 2DQLA 1WPKA 4BHCA 1DGRM 3F0CA 4XM3A 2FBKA 2L7FP 5LHHA 2M87A 1TWCJ 5KNLA 2QKMB 5BNGA 2DCEA 5K5QA 4BH9A 2O8KA 1STZA 1VNDA 2YUSA 4RS8A 2NAZA 2XDVA 4HAMA 1ETKA 5K1YA 2FF4A 1D0YA 4BAYA 4A93J 1H89C 1AKHB 3M4OJ 3FK7A 1O3QA 2RQQA 4PFOA 1UMQA 1TNSA 4UUSB 3MKWB 4DZJA 4BXUA 4WWCA 4GDFA 4I2OA 2FA5A 2WAEA 4UVAA 1O3TA 2YR2A 2TDXA 5J1RA 1FYKA 3A01B 4YRVA 4IL6C 4XLHA 5C44J 4II3A 1OYWA 4DYCA 3JRDA 2M7AA 1TWFJ 1ETXA 2LK2A 4Q47A 3ZOBA 3HOTA 1HDPA 2BOLA 2DMPA 4AU7A 2EZHA 2OTJI 1YI2I 1VQPI 3REOA 2DA3A 4M9ZA 1XGOA 2GXGA 2QQBA 4KJZA 1FX7A 3V7RA 4BEHA 5H20A 4B4CA 2O9LA 1P7IA 2WAQA 3DU5A 1W0UA 4IKFA 2AO9A 2MSYA 1HC8A 3K7AJ 2XAFA 4UUVA 2DA4A 2MFZA 4HNTA 3CJRB 1BI0A 2R5ZB 2ZKZA 2OCCH 2IEKA 1PUFA 1NH3A 2F4MB 4HYEA 4FASD 1YE9A 3O8HA 4YFXF 1SVLA 3OYKA 3M3YJ 4B3XA 3CTAA 3P5JA 3GYHX 5IOZA 2DOAA 1SMYF 1V5EA 5IT9Z 3PUFA 4I02A 3AG1H 4HF0A 5DCMB 4XK4A 1T39A 2K9NA 1RUOA 2CV0A 1FY7A 2CW8A 2VQHA 2FRHA 2K3PA 4XLFA 3HL2A 3QP5A 3DEUA 3LSKA 1V3FA 3KPHA 3B73A 4II2A 1ZYRF 2V1XA 3N4MA 3L09A 4F3QA 3VSKA 3TOAA 2R92J 1XMAA 2O7OA 2VKHA 3BP8A 1SD7A 1T95A 3FIWA 4G7OF 2FU4A 2ZO4A 1A6IA 3GFJA 4IZZA 3QWLA 4DQ2A 4XRSG 1TW2A 1ETVA 2D2WA 3BDDA 3AKZA 3LSIA 2L01A 2A69F 2HOEA 5ILSA 2IA1A 1I3QJ 3CDLA 3SFZA 2A3SA 2QLZA 4WF2A 5FKMA 4U87A 4A3LJ 2HDWA 3DBHB 3K10A 1MKMA 3PL8A 3QP6A 3HKZN 1KU2A
chains in the Genus database with same CATH topology
4OMZA 1ZH5A 4IRIA 5TJJA 1V4RA 1USSA 4MGRA 3QOPA 1TQPA 3K69A 2CW0F 3DPLC 4U88A 3FHZA 2BV6A 4HV6A 2PFBA 1FLIA 1B9NA 4YIFA 5DUKA 3K9TA 2G9WA 1FYLA 3P7NA 4P55A 2LF7A 1KU9A 3RPUA 3R0AA 2Z9OA 2F5FA 3W6JB 1I1GA 3U1DA 1Z1DA 5ICEA 4UNOA 4KYWA 2QVOA 1F1ZA 4YG2F 1L0OC 2HQNA 1HBXG 2V1DA 5FGMA 4CGZA 1L3LA 4A0ZA 1XGNA 1YW7A 3DQVC 4M73A 4RB1A 2W57A 2FSWA 2EV0A 1YQAA 4NHJA 1ODDA 4CXFA 1XSXA 2FMYA 2JPBA 2LKPA 5L3CA 2A61A 2CYYA 4RB2C 1BM9A 4XSZF 4GYGA 3FF5A 1T98A 1WQ2A 1TQMA 1TLHB 3EETA 3EYIA 2CG4A 2EFNA 5FFXA 2OQGA 2STTA 5CYVA 3AAFA 3GFMA 1ON2A 3VFZA 4BYYA 1KQ8A 1KYZA 1R1TA 4LLLA 3VB2A 5BPDA 4UVCA 1T0FA 3MWMA 2EV5A 2NNNA 1BIAA 3FWEA 2NRAC 2H09A 5LGNA 4ETSA 1W4MA 4A0YA 2RGVA 4LK1F 4M9SA 2WWYA 3HRSA 3V7SA 1LJ9A 5LGUA 2H94A 1SMTA 1MJAA 2QM3A 2W25A 2XAGA 1K78A 2IRFG 3BY6A 3Q9VA 3I59A 1YG2A 5CVRA 4RGUA 3R60A 2YU3A 4WXHA 4GGGA 4MEYF 1S8NA 3C3WA 3KLOA 4H0EA 1O3RA 2HS5A 3LA7A 3CUQC 1DUXC 1Z6TA 4AIKA 1PP8F 2QYOA 3IL2A 4GXOA 3MCZA 3HOSA 4ZH4F 3J80Z 1KGSA 2L54A 1VTNC 5FO5A 1OKRA 1FPQA 1ZG1A 4WCGA 4I7HA 4EGYA 4EJTA 3GX4X 1B4AA 2IPQX 4WXDA 2HKOA 2XROA 1DPUA 1QO0D 1B1BA 5HLHA 1KQ9A 3IRQA 3HRMA 5LHIA 2K27A 3KEOA 1DPRA 1X3UA 1U3EM 4HA8A 4NB5A 2QQAA 5EEHA 3ZMSA 4CZZA 4L9TA 4U7BA 2R7FA 2A6EF 1ZRCA 1A04A 1R1VA 1MDMA 4R1HA 4P9UA 3K1NA 1FYMA 3TGNA 2NYXA 4A0XA 2Z33A 1C0WA 1HKTA 1P4AA 4I98B 1CF7B 4BHPA 3GFIA 2LDUA 2RDPA 4HQEA 2CWEA 3LAPA 2F2EA 2QUFA 5LRRA 3DXJF 4XSXF 3RDIA 5CVJA 1DP7P 2YPRA 2MH9A 1J0RA 2PI0A 5LEJA 2R3SA 2D1HA 1IN7A 4KA4A 3RIRA 1HW5A 1GVJA 2O8XA 3KZZA 4LJZF 4HW0A 2ELHA 2VBYA 2Y0MA 2HKXA 4HX4A 1YTYA 1S7OA 2Q0OA 4L5IA 1R7JA 4L18B 2IVMA 3RKXA 3BROA 1HKSA 1LDKB 3GFLA 2QZ8A 3I71A 4KN7X 2XKOA 1D5VA 4MNUA 3R4KA 3KEQA 2XUBA 3Q9SA 2ZBKA 2JTVA 3C18A 4G7ZF 4IHTA 1SAXA 3FXRA 2ZFWA 3ZMVA 1KU7A 2VXZA 5DV5A 4KIGA 2ETHA 4M6XA 4EVIA 4WXCA 3FZVA 3ABUA 3I4PA 2ZXJA 4UV9A 5E8GA 3QPHA 3TKYA 4RGRA 2VBZA 2O03A 3V7CA 3BPXA 2OZUA 5ILVA 5HOOA 4AVPA 5AONA 1E17A 1IAWA 2O3FA 2HTJA 2QQ9A 4Y15A 1LNWA 4OMYA 3HSFA 2WTEA 1KU3A 1QBJA 3ULQB 1T2KA 4LFUA 1QGPA 2O61A 1ZHFA 2V79A 2OBPA 2BBYA 3F8BA 3MFKA 4HZFA 3GWZA 2L02A 1K79A 5JR3A 3T8RA 1W7PD 1OMIA 4PZJA 1W5TA 1YLFA 1IW7F 1QZZA 4HDVA 4OU0A 5FD6A 5DEQA 3T1BA 3ZMZA 1BJAA 4M71A 4AIJA 3L00A 4Y13A 2GQQA 4AWXB 3HHHA 4O5VA 1FBUA 1YW8A 2DLLA 3GZ6A 4M6YA 1ONVA 5D6FA 3RPQA 2VE9A 5JFRA 2DK8A 2BGCA 3WTWC 3GF2A 3WTZA 4ESJA 4ENJA 3I54A 3BPVA 1P4XA 1G3WA 3HHGA 2K86A 5ICCA 5CJ9A 3HTUA 2P5LC 3R61A 1REPC 2DBBA 3COAC 1D3YA 2JT1A 2DI3A 1QPMA 1R36A 5F1RA 2PBIA 2E1NA 4B8XA 2HYFA 3EUHA 2A68F 2HYGD 1I5ZA 2FE3A 4RGSA 2KRFA 1TBXA 2A5YB 2EJRA 4UVBA 4ON0A 3WU1B 3CJNA 2JRTA 5LGTA 4FHTA 2KKOA 5L3EA 1IRFA 4KIFA 4N0BA 4Q4ZF 2RNJA 3KP7A 3ZP5A 2XVCA 4M9XA 5BOXA 1SFUA 5DCMA 3MQ0A 5BMZA 3GUDA 1XCBA 1U8RA 1R5HA 4RGXA 4LLNA 2HEOA 3F6OA 1PP7U 1EH7A 4ZYEA 2EV6A 3QRFF 5AIPA 3Q5FA 2F5DA 2EA4A 2L4AA 3U9GA 5IT9K 4Z2YA 2XIGA 2B0LA 3WE2A 4OIPF 1ZARA 2IJLA 3EYYA 5E18F 2PMHA 2FXAA 4EGZA 1P2FA 2RV8A 2KJBA 2DTRA 4G8XA 4M74A 2HQRA 1G3YA 4EM2A 1R5GA 4XLNF 1HKQA 2MLKA 5HLIA 2ACJA 1LQ1A 4KNYA 4WX9A 1Q1HA 4XRFA 1ZLKA 3I0TA 2W85A 3CO7C 1XDUA 3HIFA 3MAJA 2VODA 1ZN2A 2UZKA 4Q48A 1FZPB 1RUNA 2PMUA 1YYVA 3DP7A 5D5XB 5BPIA 5FD5A 3BJAA 1FWZA 2HFHA 4A12A 2DU9A 1IN4A 3WODF 5L3BA 3IWZA 3IWFA 2D45A 2Z3YA 2HR3A 5L3DA 3FXQA 1ULYA 4HLYA 4EJVA 4CO8A 2UXXA 5DD8A 3ZMDA 3RYRA 2M5WA 5L3FA 2M30A 4EJUA 4JQFA 2FQ3A 2CFXA 1F4KA 2D1VA 2KIUA 2DT5A 1IRGA 5D5VB 4KT5C 1FOKA 1ZG5A 1RZ4A 2VT2A 3WGHA 3V8KA 1IUYA 3JAMZ 3T0YA 2Y75A 4UHTA 4HLXA 1RI7A 4HQMA 1HXDA 5E17F 4D0PA 1BBYA 4JK1X 1Z9CA 2VBWA 1XCVA 1O7LA 2RQPA 3H3UA 3F8NA 4HF2A 4EV0A 3N97A 2PN6A 5HS8A 1DDNA 4NQWA 2A6HF 1UB9A 1MDMB 1IXRC 2WV0A 1D8KA 1OYIA 4A6EA 1I6XA 1EH6A 2IA2A 4UXNA 3KE2A 5ICGA 5A2QZ 1IN6A 3WTYC 5JI6A 3FXUA 4I01A 4G9YA 5LHGA 4RB3C 1WI9A 2IP2A 3TDUC 4U0VA 2KIMA 3R0JA 4KN4X 1NHAA 6PAXA 3RKYA 3KCCA 1WKMA 2VC0A 3I53A 2IT0A 3T5XA 2H27A 4L0ZB 5BS6A 2MH2A 3K1PA 1SFEA 3HRUA 4Q5SF 4KFCA 1EV7A 2LF8A 3QU3A 3G73A 1Y0UA 5D4RA 1HW2A 1XSDA 2ESHA 3ECHA 1RNLA 2DW4A 4EJWA 2G7HA 3S2WA 3D5LA 1TNTA 2P6TA 4IRHA 3HUGA 1XGSA 3P9IA 4O6JA 5HLGA 2FBHA 3E6CC 2FOKA 1FC3A 3E5UA 3JTHA 1W7PB 3RI4A 1HSJA 4KMFA 2GIVA 4PGGA 1H0MA 1Z05A 5ED4A 2MC3A 5HS7A 3SQNA 2PEXA 2BEOA 2YSRA 5DCFA 2ZNZA 3CUQB 2GWRA 3ZN0A 5K5RA 5FLXK 1R22A 3QAHA 4TV7A 4QLCU 2E7XA 2DO7A 2OU2A 3OV8A 5LEKA 1MD0A 3HRTA 4S04A 3J81Z 2PG4A 1JE8A 1OPCA 1P92A 4UV8A 1U2WA 4I09A 2O6GE 1FP2A 1J59A 4LGWA 4G7HF 2J5PA 1XN7A 4O3MA 4G6QA 4LB6B 1J9IA 1JHFA 5LBQA 4F7ZA 1O57A 3I58A 2NS0A 4AD9A 3KP4A 4ESFA 3M8EA 3WTXC 2EFWA 3SZPA 1QQIA 1B6AA 2FBIA 2VC1A 1ON1A 2MLGA 5DDGA 3P9KA 4YFNF 1UFMA 2AXLA 1BC7C 1CGPA 3M7GA 2MA3A 1MJBA 1JXSA 3HTSB 1D8JA 1HQCA 1LVAA 1LB2A 3FMSA 2RVCA 1S6LA 2DK5A 2FMLA 4L9JA 1LDDA 3F22A 4IRGA 3P9CA 2XHKA 1YFHA 4EM0B 4ENNA 3HYIA 1U5TA 1AOYA 5H6QA 4MEXF 3KP3A 2K4BA 4PGHA 2R7DA 4M72A 1MJ9A 2RN7A 3MZHA 2P5VA 2X0LA 3RKWA 3L2CA 3BWGA 2XAJA 2ISZA 4OIQF 2C6YA 3GEZA 4EMSA 2STWA 2Y48A 4GYIA 2EFQA 3IHUA 1SFXA 2GA2A 3WE3A 1SD6A 1WSUA 3GW2A 1HSTA 1KYWA 5D5WB 3DFGA 1ZREA 5J8FA 4RB0A 4A5MA 3TO9A 4IVNA 1GXQA 5D4SA 3GLXA 3CUQA 3KZYA 5E1ZB 2AS5F 2ISYA 3JSOA 5BQTA 4YIIA 1TQIA 1HW1A 4U0YA 3E6MA 1MZBA 4BHBA 1S7AA 2EFOA 3IKVA 5D8LB 3I64A 2K4JA 4L5JA 4HOBA 2QWWA 3F6VA 3GO5A 3LA2A 3PQKA 1PUEE 1U6GA 2VBXA 2CGPA 4LG0B 2OZ6A 1BN5A 5A2QK 1ZGAA 3RTRA 2JPCA 5LLQA 5FB2A 2EB7A 2K02A 1TW3A 3K2ZA 1U78A 3VEPA 3F72A 3E5QA 4ASNA 1H9TA 2COMA 3O6BB 4PCQA 1E2XA 2CQKA 4LLGF 2EA2A 3JSPA 2X4HA 3FM3A 4IPAA 3NQOA 1G3SA 5ILUA 4CYDA 3WTUC 1IXSB 2BE5F 3JW4A 2F5EA 1UCRA 1J5YA 2VN2A 5J8CA 4IXAA 1LDJA 4P9FA 2EWNA 1KA8A 3E6BA 4K2EA 4LB5A 3FX3A 2HZTA 2FNAA 4JBAA 5DD4A 1FNNA 4ZYDA 1GHCA 3FM5A 2KIFA 3H92A 4FX4A 1FSEA 3K1MA 3F8CA 1P6RA 3LQRA 3RJPA 4YFKF 2GZWA 2RC4A 3LWFA 3FMRA 1OR7A 2Z99A 1F9NA 2Q8KA 4EQQA 2H6CA 1XDSA 3J81K 4OOIA 2QENA 2P7VB 2MD5A 3E97A 4L0YB 2ZMEB 3BJ6A 3O3KA 2P8TA 2ADUA 3I5UA 4XLPF 4LMYA 1ZRDA 4ZZDA 4QWQA 2NNYA 3C7JA 2IW5A 2HGCA 1RIOH 1O3SA 2G7UA 3KFWX 3BOQA 3CDHA 5HDNA 1Z6RA 4ZZLA 3NRVA 3ZQ7A 1BC8C 4MQ9F 2ZMEA 1J7KA 2P5KA 3U2RA 2IA0A 5KK1A 1G3TA 2FNPA 4CHUA 2A07F 3JTGA 2GA1A 1FP1D 2CO5A 1IN5A 1S29A 4E70A 3ISPA 1F5TA 3F23A 1H9GA 3K0LA 4RAYA 1EH8A 4FT8A 4U7DA 3WTTC 2XRNA 3CUOA 1YS7A 5TRDA 4LK0F 2VONA 1BOAA 4IF4A 5HDKA 1CF7A 3F3XA 2XGXA 4ZYHA 2ZCWA 1IZ1A 1P4WA 4G6DA 1YW9A 1SD5A 2HTSA 3V8LA 3V8JA 3LSTA 2QBYA 5CVVA 2VT3A 4RAZA 3KP6A 1K7AA 4HF1A 4BNCA 4U0WA 1U5TC 3FMQA 3KLNA 2GAUA 2ESNA 3QU6A 3TO6A 2MBFA 3ERED 1QZYA 2V1UA 3EDPA 3O2PE 1U5TB 2M1BA 3J7AO 1S3JA 3SZTA 3KP2A 2L3DA 2QBYB 1MGTA 3E6DA 3ZMTA 4KICA 2XV4S 2P7CB 5F6FA 3ZMUA 3EQLF 4L9VA 3WGIA 3L9FA 2M8EA 2V6CA 3E5XA 4Y17A 4LG0A 5FLXZ 3T8TA 2JSCA 4BQAA 4ZYGA 2DAOA 3PFIA 3TOBA 3LAJA 2VOOA 1BI3A 2XASA 4AIHA 2DPUA 1I27A 3I59B 4KIBA 2XAHA 2OQRA 1WWXA 1R23A 1K78B 3ECOA 3PQJA 3JAMK 2K7LA 4ESBA 1B59A 4A2UA 3TO7A 5ERIA 3HSRA 2WC2A 2FEZA 2LNBA 1J2XA 1FT9A 3DKWA 1T6SA 3IRRA 1ZGJA 3WGGA 4WK8F 5HDGA 2DQRA 1XMKA 3M1EA 1UHWA 2KJCA 5KVRA 5E8IA 3ABTA 5D8KB 3F8MA 1W5SA 1OYYA 1YS6A 4ENKA 3F21A 2V9VA 2GXBA 2L4MA 4FX0A 3VODA 2OA4A 2ZJ2A 2J5OA 3M8FA 2VE8A 2F5CA 4A6DA 3LQQA 3CO6C 1G4DA 3DV8A 3VOEA 2CSOA 3HSEA 3WG9A 5E1WA 1LEAA 4N9HA 1AWCA 5CLSA 1PDNC 2PJPA 1FBSA 1B9MA 1GXPA 2YX7A 1KQ0A 1JGSA 2M45A 4P5OA 5J6XA 4EM1A 3IC7A 5E1XA 3GVAA 4I0BA 5HS9A 1W7PA 3ELKA 3LFKA 3MZYA 1UHMA 2Q2EA 5D5UB 4CICA 1IF1A 4HBLA 2E7WA 1G6NA 2UXNA 3G3ZA 1K6OA 2O0YA 3SXYA 3J80K 3WTSC 1USTA 3QPTA 1ZG3A 1BIBA 1XD7A 4EJOA 1JHHA 2PQ8A 3NEUA 4OIRF 3B02A 5HVQC 3ROUA 1IXCA 5JHUA 1FBQA 2VOPA 1O7FA 5D6EA 2HDCA 3CLOA 5DYMA 1YO5C 1BI1A 3MEXA 5IT3A 2W84A 5DUIA 2P6SA 1XB4A 1LEBA 2BYVE 1R1UA 2RKHA 1Z7UA 2Z5UA 4LD5A 2XKPA 4MTEA 5F64A 1FSHA 1ZRFA 5EEGA 3WU0A 1R58A 3BJOA 3R6SA 2OAZA 1XGMA 4S05A 1Z91A 1ZAOA 3SHFA 3D0SA 1IN8A 5E20A 3GXOA 5CVIA 4IJAA 5CVUA 3WTVC 2HWVA 4IHSA 5AIQA 3KETA 1R00A 4PDKA 4HDUA 2PLYA 1YIOA 3F8FA 2DPDA 3KP5A 3BZ6A 4MTDA 1XSVA 3W6KB 3TDZC 4GO1A 4R79A 4OIOF 1QNTA 3DPTA 2E1CA 2YX4A 4KUMA 5K5OA 4CDGA 1SD4A 4N9IA 5L3GA 2XAQA 2JZYA 4A5NA 2LSOA 1ZLJA 4HX8A 3LA3A 2EK5A 4MQVA 4ENMA 3TQNA 3GZ5A 3ZN1A 4HX7A 5ICFA 2ZNYA 3M9AA 1BI2A 4I0AA 2DFIA 3L7WA 4MHGA 5LRSA 4G94A 3OOPA 2EFPA 1J75A 4OINF 4R8HA 3ML6A 3E3VA 1T38A 1TTYA 4GCVA 4B09A 2OD5A 4P96A 4XBFA 2H6BA 5H6RA 4KMUX 3ZPLA 5JVTA 1I1SA 4HV5A 2UWMA 4L9NA 3IKTA 3DF8A 3H3ZA 3RYPA 4DNCA 1WRJA 3V4GA 2P4WA 4KDPA 5FFZA 2W24A 3C1DA 2DQLA 4BHCA 2FBKA 5LHHA 2M87A 5K5QA 4BH9A 1STZA 4RS8A 2NAZA 4HAMA 5K1YA 2FF4A 4BAYA 1O3QA 1TNSA 4BXUA 4WWCA 4I2OA 2FA5A 4UVAA 1O3TA 2YR2A 2TDXA 1FYKA 1OYWA 4Q47A 3HOTA 3REOA 4M9ZA 1XGOA 2GXGA 3V7RA 2QQBA 1FX7A 5H20A 2XAFA 4UUVA 1BI0A 2ZKZA 4HYEA 4YFXF 3CTAA 3GYHX 1SMYF 5IT9Z 4I02A 4HF0A 5DCMB 1T39A 1RUOA 1FY7A 2FRHA 3QP5A 3DEUA 1V3FA 3B73A 1ZYRF 2V1XA 3N4MA 3L09A 3TOAA 1XMAA 3BP8A 1SD7A 4G7OF 2FU4A 2ZO4A 3GFJA 4DQ2A 1TW2A 2D2WA 3BDDA 2L01A 2A69F 2HOEA 5ILSA 2IA1A 3SFZA 2A3SA 2QLZA 4WF2A 1MKMA 3QP6A 1KU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMZ A;  1ZH5 A;  4IRI A;  5TJJ A;  1V4R A;  1USS A;  4MGR A;  3QOP A;  1TQP A;  3K69 A;  2CW0 F;  3DPL C;  4U88 A;  3FHZ A;  2BV6 A;  4HV6 A;  2PFB A;  1FLI A;  1B9N A;  4YIF A;  5DUK A;  3K9T A;  2G9W A;  1FYL A;  3P7N A;  4P55 A;  2LF7 A;  1KU9 A;  3RPU A;  3R0A A;  2Z9O A;  2F5F A;  3W6J B;  1I1G A;  3U1D A;  1Z1D A;  5ICE A;  4UNO A;  4KYW A;  2QVO A;  1F1Z A;  4YG2 F;  1L0O C;  2HQN A;  1HBX G;  2V1D A;  5FGM A;  4CGZ A;  1L3L A;  4A0Z A;  1XGN A;  1YW7 A;  3DQV C;  4M73 A;  4RB1 A;  2W57 A;  2FSW A;  2EV0 A;  1YQA A;  4NHJ A;  1ODD A;  4CXF A;  1XSX A;  2FMY A;  2JPB A;  2LKP A;  5L3C A;  2A61 A;  2CYY A;  4RB2 C;  1BM9 A;  4XSZ F;  4GYG A;  3FF5 A;  1T98 A;  1WQ2 A;  1TQM A;  1TLH B;  3EET A;  3EYI A;  2CG4 A;  2EFN A;  5FFX A;  2OQG A;  2STT A;  5CYV A;  3AAF A;  3GFM A;  1ON2 A;  3VFZ A;  4BYY A;  1KQ8 A;  1KYZ A;  1R1T A;  4LLL A;  3VB2 A;  5BPD A;  4UVC A;  1T0F A;  3MWM A;  2EV5 A;  2NNN A;  1BIA A;  3FWE A;  2NRA C;  2H09 A;  5LGN A;  4ETS A;  1W4M A;  4A0Y A;  2RGV A;  4LK1 F;  4M9S A;  2WWY A;  3HRS A;  3V7S A;  1LJ9 A;  5LGU A;  2H94 A;  1SMT A;  1MJA A;  2QM3 A;  2W25 A;  2XAG A;  1K78 A;  2IRF G;  3BY6 A;  3Q9V A;  3I59 A;  1YG2 A;  5CVR A;  4RGU A;  3R60 A;  2YU3 A;  4WXH A;  4GGG A;  4MEY F;  1S8N A;  3C3W A;  3KLO A;  4H0E A;  1O3R A;  2HS5 A;  3LA7 A;  3CUQ C;  1DUX C;  1Z6T A;  4AIK A;  1PP8 F;  2QYO A;  3IL2 A;  4GXO A;  3MCZ A;  3HOS A;  4ZH4 F;  3J80 Z;  1KGS A;  2L54 A;  1VTN C;  5FO5 A;  1OKR A;  1FPQ A;  1ZG1 A;  4WCG A;  4I7H A;  4EGY A;  4EJT A;  3GX4 X;  1B4A A;  2IPQ X;  4WXD A;  2HKO A;  2XRO A;  1DPU A;  1QO0 D;  1B1B A;  5HLH A;  1KQ9 A;  3IRQ A;  3HRM A;  5LHI A;  2K27 A;  3KEO A;  1DPR A;  1X3U A;  1U3E M;  4HA8 A;  4NB5 A;  2QQA A;  5EEH A;  3ZMS A;  4CZZ A;  4L9T A;  4U7B A;  2R7F A;  2A6E F;  1ZRC A;  1A04 A;  1R1V A;  1MDM A;  4R1H A;  4P9U A;  3K1N A;  1FYM A;  3TGN A;  2NYX A;  4A0X A;  2Z33 A;  1C0W A;  1HKT A;  1P4A A;  4I98 B;  1CF7 B;  4BHP A;  3GFI A;  2LDU A;  2RDP A;  4HQE A;  2CWE A;  3LAP A;  2F2E A;  2QUF A;  5LRR A;  3DXJ F;  4XSX F;  3RDI A;  5CVJ A;  1DP7 P;  2YPR A;  2MH9 A;  1J0R A;  2PI0 A;  5LEJ A;  2R3S A;  2D1H A;  1IN7 A;  4KA4 A;  3RIR A;  1HW5 A;  1GVJ A;  2O8X A;  3KZZ A;  4LJZ F;  4HW0 A;  2ELH A;  2VBY A;  2Y0M A;  2HKX A;  4HX4 A;  1YTY A;  1S7O A;  2Q0O A;  4L5I A;  1R7J A;  4L18 B;  2IVM A;  3RKX A;  3BRO A;  1HKS A;  1LDK B;  3GFL A;  2QZ8 A;  3I71 A;  4KN7 X;  2XKO A;  1D5V A;  4MNU A;  3R4K A;  3KEQ A;  2XUB A;  3Q9S A;  2ZBK A;  2JTV A;  3C18 A;  4G7Z F;  4IHT A;  1SAX A;  3FXR A;  2ZFW A;  3ZMV A;  1KU7 A;  2VXZ A;  5DV5 A;  4KIG A;  2ETH A;  4M6X A;  4EVI A;  4WXC A;  3FZV A;  3ABU A;  3I4P A;  2ZXJ A;  4UV9 A;  5E8G A;  3QPH A;  3TKY A;  4RGR A;  2VBZ A;  2O03 A;  3V7C A;  3BPX A;  2OZU A;  5ILV A;  5HOO A;  4AVP A;  5AON A;  1E17 A;  1IAW A;  2O3F A;  2HTJ A;  2QQ9 A;  4Y15 A;  1LNW A;  4OMY A;  3HSF A;  2WTE A;  1KU3 A;  1QBJ A;  3ULQ B;  1T2K A;  4LFU A;  1QGP A;  2O61 A;  1ZHF A;  2V79 A;  2OBP A;  2BBY A;  3F8B A;  3MFK A;  4HZF A;  3GWZ A;  2L02 A;  1K79 A;  5JR3 A;  3T8R A;  1W7P D;  1OMI A;  4PZJ A;  1W5T A;  1YLF A;  1IW7 F;  1QZZ A;  4HDV A;  4OU0 A;  5FD6 A;  5DEQ A;  3T1B A;  3ZMZ A;  1BJA A;  4M71 A;  4AIJ A;  3L00 A;  4Y13 A;  2GQQ A;  4AWX B;  3HHH A;  4O5V A;  1FBU A;  1YW8 A;  2DLL A;  3GZ6 A;  4M6Y A;  1ONV A;  5D6F A;  3RPQ A;  2VE9 A;  5JFR A;  2DK8 A;  2BGC A;  3WTW C;  3GF2 A;  3WTZ A;  4ESJ A;  4ENJ A;  3I54 A;  3BPV A;  1P4X A;  1G3W A;  3HHG A;  2K86 A;  5ICC A;  5CJ9 A;  3HTU A;  2P5L C;  3R61 A;  1REP C;  2DBB A;  3COA C;  1D3Y A;  2JT1 A;  2DI3 A;  1QPM A;  1R36 A;  5F1R A;  2PBI A;  2E1N A;  4B8X A;  2HYF A;  3EUH A;  2A68 F;  2HYG D;  1I5Z A;  2FE3 A;  4RGS A;  2KRF A;  1TBX A;  2A5Y B;  2EJR A;  4UVB A;  4ON0 A;  3WU1 B;  3CJN A;  2JRT A;  5LGT A;  4FHT A;  2KKO A;  5L3E A;  1IRF A;  4KIF A;  4N0B A;  4Q4Z F;  2RNJ A;  3KP7 A;  3ZP5 A;  2XVC A;  4M9X A;  5BOX A;  1SFU A;  5DCM A;  3MQ0 A;  5BMZ A;  3GUD A;  1XCB A;  1U8R A;  1R5H A;  4RGX A;  4LLN A;  2HEO A;  3F6O A;  1PP7 U;  1EH7 A;  4ZYE A;  2EV6 A;  3QRF F;  5AIP A;  3Q5F A;  2F5D A;  2EA4 A;  2L4A A;  3U9G A;  5IT9 K;  4Z2Y A;  2XIG A;  2B0L A;  3WE2 A;  4OIP F;  1ZAR A;  2IJL A;  3EYY A;  5E18 F;  2PMH A;  2FXA A;  4EGZ A;  1P2F A;  2RV8 A;  2KJB A;  2DTR A;  4G8X A;  4M74 A;  2HQR A;  1G3Y A;  4EM2 A;  1R5G A;  4XLN F;  1HKQ A;  2MLK A;  5HLI A;  2ACJ A;  1LQ1 A;  4KNY A;  4WX9 A;  1Q1H A;  4XRF A;  1ZLK A;  3I0T A;  2W85 A;  3CO7 C;  1XDU A;  3HIF A;  3MAJ A;  2VOD A;  1ZN2 A;  2UZK A;  4Q48 A;  1FZP B;  1RUN A;  2PMU A;  1YYV A;  3DP7 A;  5D5X B;  5BPI A;  5FD5 A;  3BJA A;  1FWZ A;  2HFH A;  4A12 A;  2DU9 A;  1IN4 A;  3WOD F;  5L3B A;  3IWZ A;  3IWF A;  2D45 A;  2Z3Y A;  2HR3 A;  5L3D A;  3FXQ A;  1ULY A;  4HLY A;  4EJV A;  4CO8 A;  2UXX A;  5DD8 A;  3ZMD A;  3RYR A;  2M5W A;  5L3F A;  2M30 A;  4EJU A;  4JQF A;  2FQ3 A;  2CFX A;  1F4K A;  2D1V A;  2KIU A;  2DT5 A;  1IRG A;  5D5V B;  4KT5 C;  1FOK A;  1ZG5 A;  1RZ4 A;  2VT2 A;  3WGH A;  3V8K A;  1IUY A;  3JAM Z;  3T0Y A;  2Y75 A;  4UHT A;  4HLX A;  1RI7 A;  4HQM A;  1HXD A;  5E17 F;  4D0P A;  1BBY A;  4JK1 X;  1Z9C A;  2VBW A;  1XCV A;  1O7L A;  2RQP A;  3H3U A;  3F8N A;  4HF2 A;  4EV0 A;  3N97 A;  2PN6 A;  5HS8 A;  1DDN A;  4NQW A;  2A6H F;  1UB9 A;  1MDM B;  1IXR C;  2WV0 A;  1D8K A;  1OYI A;  4A6E A;  1I6X A;  1EH6 A;  2IA2 A;  4UXN A;  3KE2 A;  5ICG A;  5A2Q Z;  1IN6 A;  3WTY C;  5JI6 A;  3FXU A;  4I01 A;  4G9Y A;  5LHG A;  4RB3 C;  1WI9 A;  2IP2 A;  3TDU C;  4U0V A;  2KIM A;  3R0J A;  4KN4 X;  1NHA A;  6PAX A;  3RKY A;  3KCC A;  1WKM A;  2VC0 A;  3I53 A;  2IT0 A;  3T5X A;  2H27 A;  4L0Z B;  5BS6 A;  2MH2 A;  3K1P A;  1SFE A;  3HRU A;  4Q5S F;  4KFC A;  1EV7 A;  2LF8 A;  3QU3 A;  3G73 A;  1Y0U A;  5D4R A;  1HW2 A;  1XSD A;  2ESH A;  3ECH A;  1RNL A;  2DW4 A;  4EJW A;  2G7H A;  3S2W A;  3D5L A;  1TNT A;  2P6T A;  4IRH A;  3HUG A;  1XGS A;  3P9I A;  4O6J A;  5HLG A;  2FBH A;  3E6C C;  2FOK A;  1FC3 A;  3E5U A;  3JTH A;  1W7P B;  3RI4 A;  1HSJ A;  4KMF A;  2GIV A;  4PGG A;  1H0M A;  1Z05 A;  5ED4 A;  2MC3 A;  5HS7 A;  3SQN A;  2PEX A;  2BEO A;  2YSR A;  5DCF A;  2ZNZ A;  3CUQ B;  2GWR A;  3ZN0 A;  5K5R A;  5FLX K;  1R22 A;  3QAH A;  4TV7 A;  4QLC U;  2E7X A;  2DO7 A;  2OU2 A;  3OV8 A;  5LEK A;  1MD0 A;  3HRT A;  4S04 A;  3J81 Z;  2PG4 A;  1JE8 A;  1OPC A;  1P92 A;  4UV8 A;  1U2W A;  4I09 A;  2O6G E;  1FP2 A;  1J59 A;  4LGW A;  4G7H F;  2J5P A;  1XN7 A;  4O3M A;  4G6Q A;  4LB6 B;  1J9I A;  1JHF A;  5LBQ A;  4F7Z A;  1O57 A;  3I58 A;  2NS0 A;  4AD9 A;  3KP4 A;  4ESF A;  3M8E A;  3WTX C;  2EFW A;  3SZP A;  1QQI A;  1B6A A;  2FBI A;  2VC1 A;  1ON1 A;  2MLG A;  5DDG A;  3P9K A;  4YFN F;  1UFM A;  2AXL A;  1BC7 C;  1CGP A;  3M7G A;  2MA3 A;  1MJB A;  1JXS A;  3HTS B;  1D8J A;  1HQC A;  1LVA A;  1LB2 A;  3FMS A;  2RVC A;  1S6L A;  2DK5 A;  2FML A;  4L9J A;  1LDD A;  3F22 A;  4IRG A;  3P9C A;  2XHK A;  1YFH A;  4EM0 B;  4ENN A;  3HYI A;  1U5T A;  1AOY A;  5H6Q A;  4MEX F;  3KP3 A;  2K4B A;  4PGH A;  2R7D A;  4M72 A;  1MJ9 A;  2RN7 A;  3MZH A;  2P5V A;  2X0L A;  3RKW A;  3L2C A;  3BWG A;  2XAJ A;  2ISZ A;  4OIQ F;  2C6Y A;  3GEZ A;  4EMS A;  2STW A;  2Y48 A;  4GYI A;  2EFQ A;  3IHU A;  1SFX A;  2GA2 A;  3WE3 A;  1SD6 A;  1WSU A;  3GW2 A;  1HST A;  1KYW A;  5D5W B;  3DFG A;  1ZRE A;  5J8F A;  4RB0 A;  4A5M A;  3TO9 A;  4IVN A;  1GXQ A;  5D4S A;  3GLX A;  3CUQ A;  3KZY A;  5E1Z B;  2AS5 F;  2ISY A;  3JSO A;  5BQT A;  4YII A;  1TQI A;  1HW1 A;  4U0Y A;  3E6M A;  1MZB A;  4BHB A;  1S7A A;  2EFO A;  3IKV A;  5D8L B;  3I64 A;  2K4J A;  4L5J A;  4HOB A;  2QWW A;  3F6V A;  3GO5 A;  3LA2 A;  3PQK A;  1PUE E;  1U6G A;  2VBX A;  2CGP A;  4LG0 B;  2OZ6 A;  1BN5 A;  5A2Q K;  1ZGA A;  3RTR A;  2JPC A;  5LLQ A;  5FB2 A;  2EB7 A;  2K02 A;  1TW3 A;  3K2Z A;  1U78 A;  3VEP A;  3F72 A;  3E5Q A;  4ASN A;  1H9T A;  2COM A;  3O6B B;  4PCQ A;  1E2X A;  2CQK A;  4LLG F;  2EA2 A;  3JSP A;  2X4H A;  3FM3 A;  4IPA A;  3NQO A;  1G3S A;  5ILU A;  4CYD A;  3WTU C;  1IXS B;  2BE5 F;  3JW4 A;  2F5E A;  1UCR A;  1J5Y A;  2VN2 A;  5J8C A;  4IXA A;  1LDJ A;  4P9F A;  2EWN A;  1KA8 A;  3E6B A;  4K2E A;  4LB5 A;  3FX3 A;  2HZT A;  2FNA A;  4JBA A;  5DD4 A;  1FNN A;  4ZYD A;  1GHC A;  3FM5 A;  2KIF A;  3H92 A;  4FX4 A;  1FSE A;  3K1M A;  3F8C A;  1P6R A;  3LQR A;  3RJP A;  4YFK F;  2GZW A;  2RC4 A;  3LWF A;  3FMR A;  1OR7 A;  2Z99 A;  1F9N A;  2Q8K A;  4EQQ A;  2H6C A;  1XDS A;  3J81 K;  4OOI A;  2QEN A;  2P7V B;  2MD5 A;  3E97 A;  4L0Y B;  2ZME B;  3BJ6 A;  3O3K A;  2P8T A;  2ADU A;  3I5U A;  4XLP F;  4LMY A;  1ZRD A;  4ZZD A;  4QWQ A;  2NNY A;  3C7J A;  2IW5 A;  2HGC A;  1RIO H;  1O3S A;  2G7U A;  3KFW X;  3BOQ A;  3CDH A;  5HDN A;  1Z6R A;  4ZZL A;  3NRV A;  3ZQ7 A;  1BC8 C;  4MQ9 F;  2ZME A;  1J7K A;  2P5K A;  3U2R A;  2IA0 A;  5KK1 A;  1G3T A;  2FNP A;  4CHU A;  2A07 F;  3JTG A;  2GA1 A;  1FP1 D;  2CO5 A;  1IN5 A;  1S29 A;  4E70 A;  3ISP A;  1F5T A;  3F23 A;  1H9G A;  3K0L A;  4RAY A;  1EH8 A;  4FT8 A;  4U7D A;  3WTT C;  2XRN A;  3CUO A;  1YS7 A;  5TRD A;  4LK0 F;  2VON A;  1BOA A;  4IF4 A;  5HDK A;  1CF7 A;  3F3X A;  2XGX A;  4ZYH A;  2ZCW A;  1IZ1 A;  1P4W A;  4G6D A;  1YW9 A;  1SD5 A;  2HTS A;  3V8L A;  3V8J A;  3LST A;  2QBY A;  5CVV A;  2VT3 A;  4RAZ A;  3KP6 A;  1K7A A;  4HF1 A;  4BNC A;  4U0W A;  1U5T C;  3FMQ A;  3KLN A;  2GAU A;  2ESN A;  3QU6 A;  3TO6 A;  2MBF A;  3ERE D;  1QZY A;  2V1U A;  3EDP A;  3O2P E;  1U5T B;  2M1B A;  3J7A O;  1S3J A;  3SZT A;  3KP2 A;  2L3D A;  2QBY B;  1MGT A;  3E6D A;  3ZMT A;  4KIC A;  2XV4 S;  2P7C B;  5F6F A;  3ZMU A;  3EQL F;  4L9V A;  3WGI A;  3L9F A;  2M8E A;  2V6C A;  3E5X A;  4Y17 A;  4LG0 A;  5FLX Z;  3T8T A;  2JSC A;  4BQA A;  4ZYG A;  2DAO A;  3PFI A;  3TOB A;  3LAJ A;  2VOO A;  1BI3 A;  2XAS A;  4AIH A;  2DPU A;  1I27 A;  3I59 B;  4KIB A;  2XAH A;  2OQR A;  1WWX A;  1R23 A;  1K78 B;  3ECO A;  3PQJ A;  3JAM K;  2K7L A;  4ESB A;  1B59 A;  4A2U A;  3TO7 A;  5ERI A;  3HSR A;  2WC2 A;  2FEZ A;  2LNB A;  1J2X A;  1FT9 A;  3DKW A;  1T6S A;  3IRR A;  1ZGJ A;  3WGG A;  4WK8 F;  5HDG A;  2DQR A;  1XMK A;  3M1E A;  1UHW A;  2KJC A;  5KVR A;  5E8I A;  3ABT A;  5D8K B;  3F8M A;  1W5S A;  1OYY A;  1YS6 A;  4ENK A;  3F21 A;  2V9V A;  2GXB A;  2L4M A;  4FX0 A;  3VOD A;  2OA4 A;  2ZJ2 A;  2J5O A;  3M8F A;  2VE8 A;  2F5C A;  4A6D A;  3LQQ A;  3CO6 C;  1G4D A;  3DV8 A;  3VOE A;  2CSO A;  3HSE A;  3WG9 A;  5E1W A;  1LEA A;  4N9H A;  1AWC A;  5CLS A;  1PDN C;  2PJP A;  1FBS A;  1B9M A;  1GXP A;  2YX7 A;  1KQ0 A;  1JGS A;  2M45 A;  4P5O A;  5J6X A;  4EM1 A;  3IC7 A;  5E1X A;  3GVA A;  4I0B A;  5HS9 A;  1W7P A;  3ELK A;  3LFK A;  3MZY A;  1UHM A;  2Q2E A;  5D5U B;  4CIC A;  1IF1 A;  4HBL A;  2E7W A;  1G6N A;  2UXN A;  3G3Z A;  1K6O A;  2O0Y A;  3SXY A;  3J80 K;  3WTS C;  1UST A;  3QPT A;  1ZG3 A;  1BIB A;  1XD7 A;  4EJO A;  1JHH A;  2PQ8 A;  3NEU A;  4OIR F;  3B02 A;  5HVQ C;  3ROU A;  1IXC A;  5JHU A;  1FBQ A;  2VOP A;  1O7F A;  5D6E A;  2HDC A;  3CLO A;  5DYM A;  1YO5 C;  1BI1 A;  3MEX A;  5IT3 A;  2W84 A;  5DUI A;  2P6S A;  1XB4 A;  1LEB A;  2BYV E;  1R1U A;  2RKH A;  1Z7U A;  2Z5U A;  4LD5 A;  2XKP A;  4MTE A;  5F64 A;  1FSH A;  1ZRF A;  5EEG A;  3WU0 A;  1R58 A;  3BJO A;  3R6S A;  2OAZ A;  1XGM A;  4S05 A;  1Z91 A;  1ZAO A;  3SHF A;  3D0S A;  1IN8 A;  5E20 A;  3GXO A;  5CVI A;  4IJA A;  5CVU A;  3WTV C;  2HWV A;  4IHS A;  5AIQ A;  3KET A;  1R00 A;  4PDK A;  4HDU A;  2PLY A;  1YIO A;  3F8F A;  2DPD A;  3KP5 A;  3BZ6 A;  4MTD A;  1XSV A;  3W6K B;  3TDZ C;  4GO1 A;  4R79 A;  4OIO F;  1QNT A;  3DPT A;  2E1C A;  2YX4 A;  4KUM A;  5K5O A;  4CDG A;  1SD4 A;  4N9I A;  5L3G A;  2XAQ A;  2JZY A;  4A5N A;  2LSO A;  1ZLJ A;  4HX8 A;  3LA3 A;  2EK5 A;  4MQV A;  4ENM A;  3TQN A;  3GZ5 A;  3ZN1 A;  4HX7 A;  5ICF A;  2ZNY A;  3M9A A;  1BI2 A;  4I0A A;  2DFI A;  3L7W A;  4MHG A;  5LRS A;  4G94 A;  3OOP A;  2EFP A;  1J75 A;  4OIN F;  4R8H A;  3ML6 A;  3E3V A;  1T38 A;  1TTY A;  4GCV A;  4B09 A;  2OD5 A;  4P96 A;  4XBF A;  2H6B A;  5H6R A;  4KMU X;  3ZPL A;  5JVT A;  1I1S A;  4HV5 A;  2UWM A;  4L9N A;  3IKT A;  3DF8 A;  3H3Z A;  3RYP A;  4DNC A;  1WRJ A;  3V4G A;  2P4W A;  4KDP A;  5FFZ A;  2W24 A;  3C1D A;  2DQL A;  4BHC A;  2FBK A;  5LHH A;  2M87 A;  5K5Q A;  4BH9 A;  1STZ A;  4RS8 A;  2NAZ A;  4HAM A;  5K1Y A;  2FF4 A;  4BAY A;  1O3Q A;  1TNS A;  4BXU A;  4WWC A;  4I2O A;  2FA5 A;  4UVA A;  1O3T A;  2YR2 A;  2TDX A;  1FYK A;  1OYW A;  4Q47 A;  3HOT A;  3REO A;  4M9Z A;  1XGO A;  2GXG A;  3V7R A;  2QQB A;  1FX7 A;  5H20 A;  2XAF A;  4UUV A;  1BI0 A;  2ZKZ A;  4HYE A;  4YFX F;  3CTA A;  3GYH X;  1SMY F;  5IT9 Z;  4I02 A;  4HF0 A;  5DCM B;  1T39 A;  1RUO A;  1FY7 A;  2FRH A;  3QP5 A;  3DEU A;  1V3F A;  3B73 A;  1ZYR F;  2V1X A;  3N4M A;  3L09 A;  3TOA A;  1XMA A;  3BP8 A;  1SD7 A;  4G7O F;  2FU4 A;  2ZO4 A;  3GFJ A;  4DQ2 A;  1TW2 A;  2D2W A;  3BDD A;  2L01 A;  2A69 F;  2HOE A;  5ILS A;  2IA1 A;  3SFZ A;  2A3S A;  2QLZ A;  4WF2 A;  1MKM A;  3QP6 A;  1KU2 A; 
#chains in the Genus database with same CATH topology
 4OMZ A;  3DWL E;  4NC7 A;  1ZH5 A;  4IRI A;  5TJJ A;  4ZTF A;  1V4R A;  4ITV A;  1OLT A;  3UR3 C;  1USS A;  2R7V A;  4MGR A;  4FCY A;  3QOD A;  4MFD A;  4XN3 A;  3QOP A;  1TQP A;  3WHB A;  3OIO A;  3K4N A;  4CCK A;  2K9L A;  3K69 A;  2CW0 F;  1QVU A;  3DPL C;  4U88 A;  3FHZ A;  1PUF B;  4UY8 I;  2BV6 A;  3GLL A;  2VB6 A;  4HV6 A;  2PFB A;  2OUM A;  1FLI A;  1DU6 A;  1B9N A;  1Y8Q B;  5C4J J;  1OR7 C;  4YIF A;  5DUK A;  3FIS A;  4BY1 J;  3K9T A;  2G9W A;  1WJC A;  2CUZ A;  3I55 I;  3P7N A;  2M8G X;  1FYL A;  3CD6 I;  1SEU A;  4P55 A;  2LF7 A;  1VQ8 I;  1GT0 C;  1KU9 A;  3RPU A;  2DDB A;  3ESW B;  3R0A A;  3VSL A;  2Z9O A;  4P1W A;  2F5F A;  3QOE A;  3W6J B;  1E0E A;  2QSH X;  2EIJ H;  4G6T B;  1I1G A;  3U1D A;  1BR2 A;  4AC0 A;  1Z1D A;  5B1B H;  1V5F A;  2CUJ A;  5ICE A;  4UNO A;  2R7T A;  4KYW A;  2QVO A;  2L2O A;  2YS9 A;  1SFO J;  1LVK A;  1F1Z A;  4YG2 F;  1L0O C;  2HQN A;  1KZH A;  3CJT B;  3KYL A;  1MBH A;  1HBX G;  2IS6 A;  2V1D A;  5FGM A;  2HOA A;  5EZH A;  2E1M B;  4CGZ A;  1L3L A;  4A0Z A;  4BS9 A;  3AG3 H;  3LSJ A;  1XGN A;  4B43 A;  2HZD A;  1YW7 A;  3DQV C;  2QCO A;  4M73 A;  2DFH A;  4RB1 A;  2LP0 A;  4DBQ A;  2W57 A;  3TL4 X;  1CQT A;  3UNG C;  2FSW A;  1FMW A;  1T0F C;  2EV0 A;  1YQA A;  3LSP A;  1ODD A;  2VKE A;  4CXF A;  4DYQ A;  1EJ9 A;  4NHJ A;  1XSX A;  2KMU A;  3DBR B;  2FMY A;  2JPB A;  2LKP A;  2KP6 A;  5L3C A;  2A61 A;  2CYY A;  4Y7N J;  4RB2 C;  4NC6 A;  4A3I J;  1BM9 A;  4XSZ F;  4GYG A;  5JLX A;  3MKL A;  3FF5 A;  1T98 A;  5TIS C;  1WQ2 A;  2DJI A;  2Y0S N;  3TBI A;  1TQM A;  1TLH B;  3OYN A;  3EET A;  2ZJR F;  3EYI A;  2CG4 A;  3LMM A;  3Q0U A;  2EFN A;  5FFX A;  2OQG A;  3OS0 A;  2STT A;  5CYV A;  3AAF A;  2PJR B;  3GFM A;  2W00 A;  3FKI J;  4M3B A;  2JWT A;  5JVG F;  2VPL A;  4C2T A;  1ON2 A;  4NQW B;  4E6K G;  3VFZ A;  4BYY A;  5HNH A;  4I6Z A;  1Y6I A;  3AL0 B;  4LG3 A;  4XN0 A;  4A3C J;  3LFU A;  1KQ8 A;  4X0G A;  1KYZ A;  3Q3S A;  1R1T A;  4LLL A;  3VB2 A;  2VXD A;  4F92 B;  5BPD A;  2XPU A;  4UVC A;  1T0F A;  3IUO A;  3WU2 C;  2F5V A;  5F0C A;  3MWM A;  2EV5 A;  2NNN A;  1BIA A;  4RM3 A;  3FWE A;  2VL8 A;  2NRA C;  2H09 A;  5B1A H;  5LGN A;  3OR1 C;  4ETS A;  1W4M A;  1I3A A;  4A0Y A;  1SFK A;  2XSD C;  2RGV A;  4HST A;  4LK1 F;  4M9S A;  2WWY A;  2DMT A;  3HRS A;  1LFP A;  4OAY A;  3V7S A;  3NAR A;  1LJ9 A;  1JUM A;  5LGU A;  3OYD A;  3CCE I;  2LYC A;  2H94 A;  1MMA A;  1SMT A;  1MJA A;  3PIO F;  3PM1 A;  1JKR C;  3BTC A;  1VQO I;  2QM3 A;  2W25 A;  2XAG A;  3MN2 A;  2LVS A;  1K78 A;  2IRF G;  3IV5 A;  1X4P A;  4BDZ A;  3W2W A;  2KRH A;  3BY6 A;  4QIW N;  3AG4 H;  4AVZ A;  3JRE A;  1ETO A;  3Q9V A;  3I59 A;  1YG2 A;  1VQ6 I;  5CVR A;  4RGU A;  5K7H A;  5EG0 A;  2PX9 A;  2IBD A;  2Y30 A;  3R60 A;  2YU3 A;  4WXH A;  3HUG B;  4GGG A;  4MEY F;  1S8N A;  5EZG A;  3C3W A;  3KLO A;  4H0E A;  3GTO J;  1O3R A;  2HU9 A;  3K4L A;  2HS5 A;  1RRJ A;  3LA7 A;  2NVX J;  3CUQ C;  1DUX C;  3HBL A;  1EF4 A;  3S1M J;  1Z6T A;  2V9K A;  4AIK A;  1K4T A;  1PP8 F;  2QYO A;  5FRM A;  1N75 A;  3IL2 A;  2GLO A;  4GXO A;  4AM3 A;  3MCZ A;  3HOS A;  4ZH4 F;  3J80 Z;  1RR8 C;  4BXX J;  4A69 C;  1KGS A;  2L54 A;  1VTN C;  2JVH A;  2Y69 H;  1V55 H;  5FRN A;  1K61 A;  2DA1 A;  5FO5 A;  2BVL A;  1YX5 A;  3GTL J;  1ERD A;  1OKR A;  3IH2 A;  3PNT A;  1FPQ A;  5M5Y J;  3H5R A;  1NG7 A;  1X1P A;  1ZG1 A;  4WCG A;  2VQG A;  3LSM A;  4I7H A;  4EGY A;  3PFY A;  3OYH A;  3GX4 X;  4EJT A;  1B4A A;  5M3M J;  1UJ8 A;  2IPQ X;  4WXD A;  1MNM C;  2AHQ A;  4LIT A;  4FIS A;  3JRI A;  2JRM A;  3CCL I;  1XS9 A;  1B72 A;  2HKO A;  2XRO A;  4ZC3 A;  1GLN A;  2F6C A;  1QO0 D;  1DPU A;  1B1B A;  5HLH A;  1KQ9 A;  3H1C A;  2X1C A;  3IRQ A;  2BW3 A;  3HRM A;  5LHI A;  2K27 A;  3KEO A;  1DPR A;  1X3U A;  2E1O A;  1U3E M;  4HA8 A;  4NB5 A;  2QQA A;  2X1D A;  4PSW A;  5EEH A;  3ZMS A;  2HXO A;  4CZZ A;  2VLA A;  2VJ5 A;  3A1Y A;  3W6V A;  4L9T A;  4F55 A;  3VDX A;  4NUB A;  4U7B A;  4B1R A;  2R7F A;  2A6E F;  1ZRC A;  4J19 A;  2X1E A;  1A04 A;  4UB8 C;  4KIS A;  1R1V A;  1MDM A;  4R1H A;  4E4H A;  3K1N A;  4P9U A;  2XC7 A;  3LNQ A;  3S3O A;  3S93 A;  3LSR A;  1FYM A;  3E7L A;  4RAG A;  2VJJ A;  3TGN A;  2NYX A;  4A0X A;  2Z33 A;  1C0W A;  5GPA A;  1HKT A;  1MBE A;  2LKX A;  1X2M A;  1A31 A;  3MD2 A;  3ZQH A;  2ZC2 A;  1P4A A;  4I98 B;  1CF7 B;  1N77 A;  1FIA A;  1JUP A;  2CRG A;  4BHP A;  3GFI A;  4Y52 J;  1HA8 A;  1NTC A;  2LDU A;  2F4O B;  3I56 I;  4AYB A;  3HGY A;  2DMN A;  2RDP A;  3FXK A;  4BL0 B;  4HQE A;  2CWE A;  2LRE A;  4BQN A;  3A03 A;  1Z77 A;  3LAP A;  2R7Q A;  2F2E A;  2DA7 A;  4LOC A;  2Q2E B;  3RZO J;  2DOF A;  2QUF A;  2XF6 A;  5LRR A;  1Y56 A;  3DXJ F;  4XSX F;  3RDI A;  1HOM A;  4FTH A;  3I9V 2;  5CVJ A;  4E7L A;  1DP7 P;  2YPR A;  2MH9 A;  2R7U A;  1J0R A;  1FOX A;  2PI0 A;  4XOR A;  5LEJ A;  2R3S A;  1B72 B;  3S14 J;  4FQG A;  2D1H A;  1IN7 A;  4KA4 A;  2AXT C;  3RIR A;  5DTD A;  1OCT C;  1HW5 A;  2OV7 A;  3GCM A;  1GVJ A;  3KYC B;  2O8X A;  3VYT B;  1D0Z A;  3KZZ A;  1ETY A;  3J7A Y;  4LJZ F;  2E19 A;  3FXL A;  4BE1 A;  2M9H A;  4HW0 A;  2ELH A;  4C3H J;  1YJW I;  5DM7 F;  2EIN H;  2VBY A;  2Y0M A;  5EGO B;  2HKX A;  4JYK A;  3D5S C;  4HX4 A;  1YTY A;  1S7O A;  2Q0O A;  1UG2 A;  4L5I A;  5EGO A;  3H9J A;  2HOT A;  1R7J A;  3A0H C;  2IVM A;  4L18 B;  4A3B J;  3RKX A;  3BRO A;  1HKS A;  4BKX A;  1LDK B;  3GFL A;  2QZ8 A;  3I71 A;  1S9H A;  1FTZ A;  2JN6 A;  4KN7 X;  2XKO A;  1D5V A;  2GXA A;  4MNU A;  4ZYA A;  3R4K A;  1H88 C;  2FUG 2;  3KEQ A;  2XUB A;  3Q9S A;  2ZBK A;  4Y4R A;  2R5Y A;  1MMN A;  2JTV A;  3NWT A;  3PO3 J;  3C18 A;  4G7Z F;  1BL0 A;  3WHC A;  3OYA A;  2R7O A;  1GV2 A;  2BY1 A;  4IHT A;  1SAX A;  1NK3 P;  3FXR A;  2ZFW A;  3K4C A;  1WJA A;  3ZMV A;  1KU7 A;  3L2V A;  4N4O B;  2VXZ A;  4ZDL A;  5DV5 A;  1YIJ I;  4KIG A;  2ETH A;  2DFE A;  4M6X A;  4EVI A;  4IHW A;  4JOM A;  4CCN A;  2X51 A;  4WXC A;  1Z67 A;  3FZV A;  2KZG A;  1PVE A;  3ABU A;  2E34 A;  2ZXJ A;  3I4P A;  1JJ8 C;  4UV9 A;  2KDO A;  5E8G A;  3QPH A;  3TKY A;  4RLQ A;  5JHF A;  4RGR A;  2VBZ A;  3G4S I;  2K9Q A;  5EDN A;  2L9S A;  2O03 A;  3V7C A;  3BPX A;  2OZU A;  4BAC A;  5ILV A;  3OYF A;  1H8A C;  5HOO A;  4AVP A;  5AON A;  1E17 A;  1IAW A;  2O3F A;  2HTJ A;  1T8I A;  2K9M A;  1JGG A;  2QQ9 A;  4Y15 A;  3VPR A;  1LNW A;  2ELJ A;  4OMY A;  3HSF A;  2WTE A;  1KU3 A;  1QBJ A;  2R93 J;  2M3A A;  3ULQ B;  5GTI C;  1T2K A;  4LFU A;  1N78 A;  1JUS A;  1QGP A;  2O61 A;  3S17 J;  1WJ5 A;  4E7K A;  1ZHF A;  3RQ4 A;  2V79 A;  2OBP A;  3EUK L;  2H1K A;  2BBY A;  3F8B A;  4YEJ A;  3MFK A;  2LFB A;  1D5Y A;  2VIX A;  4HZF A;  3GWZ A;  5F08 A;  1WCM J;  2L02 A;  5JR3 A;  4BQQ A;  1K79 A;  3T8R A;  3G2B A;  1W7P D;  2NOJ B;  3QQA A;  4RLF A;  2X85 A;  1OMI A;  1ZGW A;  1MW7 A;  4PZJ A;  1WH5 A;  1W5T A;  3GME A;  4M3F A;  3GTK J;  2OPT A;  1QZE A;  1Z3Y A;  5B3S H;  2BVM A;  4HNU A;  1YLF A;  1IW7 F;  1QZZ A;  1VQ4 I;  1JKP C;  4HDV A;  1YJ9 I;  2HOS A;  3D5R C;  4XLC A;  4OU0 A;  5FD6 A;  3DBL B;  5DEQ A;  5J4V A;  2V7F A;  3T1B A;  1VQ5 I;  3ZMZ A;  1BJA A;  2JJ7 A;  4M71 A;  4AIJ A;  3L00 A;  1E3O C;  4I76 A;  1S72 I;  3BTL A;  3ZGK A;  4Y13 A;  2GQQ A;  4AWX B;  4BGD A;  3GTM J;  3HHH A;  4O5V A;  1FBU A;  4EEF G;  1YW8 A;  2DLL A;  3GZ6 A;  4M6Y A;  2VAS A;  1ONV A;  1SVO A;  5D6F A;  3TP0 A;  3RPQ A;  2VE9 A;  1RES A;  4BBR J;  5JFR A;  2DK8 A;  2NXN B;  3G1O A;  2LR8 A;  2FOW A;  1X3Z B;  2BGC A;  4NBQ A;  5EG0 B;  4BXF A;  3WTW C;  3GF2 A;  3M8J A;  3BG3 A;  2BHZ A;  3WTZ A;  1Y1V J;  4ESJ A;  2E71 A;  4ENJ A;  2IGM A;  1F43 A;  1ENH A;  2QSF X;  3I54 A;  3BPV A;  2CQX A;  1P4X A;  4RAF A;  1G3W A;  3HHG A;  2K85 A;  5F1J A;  3EPZ A;  3TW7 A;  4DBR A;  4D5F A;  2K86 A;  5ICC A;  2M4G A;  3CMA I;  2VPR A;  5CJ9 A;  3HTU A;  4B44 A;  3HZJ A;  2P5L C;  1X4O A;  3R61 A;  3CCR I;  1REP C;  5M5W J;  4A3G J;  2DBB A;  3BR2 A;  3PNY A;  3H35 A;  4XRS A;  3COA C;  1D3Y A;  3OWT A;  3ZXS A;  2JT1 A;  2CW7 A;  2DI3 A;  4Y3O A;  4XOT A;  1QPM A;  2P81 A;  1R36 A;  3ERM A;  5F1R A;  2PBI A;  2ID3 A;  1VQL I;  2E1N A;  3FXM A;  4B8X A;  5IPA A;  2HYF A;  4XLA A;  3EUH A;  2A68 F;  3BG5 A;  2HYG D;  2PMZ A;  4BY7 J;  1I5Z A;  1TWA J;  3RKQ A;  3OY9 A;  2DMU A;  2FE3 A;  1VQN I;  4RGS A;  4A3E J;  2KRF A;  3S2D J;  1R9T J;  1TBX A;  2A5Y B;  2EJR A;  4UVB A;  2Z1D A;  1XC5 A;  4PUS A;  2LY1 A;  3LSH A;  2ZXI A;  4ON0 A;  4GFB A;  3S15 J;  3WU1 B;  2DDA A;  3CJN A;  2LLK A;  3NWS A;  2JRT A;  2EZI A;  5LGT A;  2IXS A;  3OYM A;  2BZT A;  4FHT A;  4XKV A;  2KKO A;  5L3E A;  1OFC X;  2O5R A;  2JK3 A;  1IRF A;  2MGQ A;  2KLO A;  4KIF A;  4N0B A;  2HNH A;  1X58 A;  4Q4Z F;  2RNJ A;  1BR4 A;  3KP7 A;  4B47 A;  3ZP5 A;  1BW6 A;  2XVC A;  4M9X A;  5BOX A;  1SFU A;  2XGD A;  4A3F J;  5DCM A;  3MQ0 A;  4D7M A;  5BMZ A;  1ZK8 A;  3GUD A;  1XCB A;  2ZXW H;  1U8R A;  1R5H A;  1UZC A;  3OYI A;  3GTG J;  4RGX A;  3CC7 I;  4LLN A;  2HEO A;  1DP3 A;  3CCM I;  3F6O A;  3I3L A;  1QA6 A;  1PP7 U;  1EH7 A;  2F48 A;  4E7J A;  3EUH C;  1ZKG A;  4ZYE A;  3DKX A;  2EV6 A;  3QRF F;  5AIP A;  1E3P A;  3Q5F A;  5GAD J;  2F5D A;  5F0F A;  5DM6 F;  2EA4 A;  2L4A A;  2KIQ A;  3U9G A;  5IT9 K;  4W97 A;  3OYJ A;  4Z2Y A;  3S1Q J;  2XIG A;  2B0L A;  3WE2 A;  4OIP F;  1ZAR A;  2IJL A;  3EYY A;  4AYB N;  1MIJ A;  1NG6 A;  2W7N A;  2VQL A;  5E18 F;  4IQJ A;  2PMH A;  2FXA A;  1VQ7 I;  3BTI A;  4EGZ A;  1TT0 A;  1P2F A;  2RV8 A;  2KJB A;  2DTR A;  4G8X A;  5FRO A;  4M74 A;  2FQ4 A;  1XMX A;  1ORK A;  1G3Y A;  2HQR A;  3NAU A;  3BZK A;  4C9Y A;  3C2B A;  3I4N J;  4EM2 A;  1R5G A;  2B9S A;  3BR5 A;  4XLN F;  3EUA A;  3E0J B;  3ZQF A;  1HKQ A;  2MLK A;  5HLI A;  2FJ1 A;  2ACJ A;  1UAA A;  1LQ1 A;  2GOM A;  4KNY A;  5F0H A;  1VFC A;  1AKH A;  4WX9 A;  3M1C A;  1Q1H A;  5IOY A;  3HC7 A;  1YX3 A;  1IO2 A;  4HG2 A;  3BR3 A;  4XRF A;  4MFE A;  1R49 A;  1ZLK A;  3HDD A;  1HLV A;  3I0T A;  3G71 I;  3CCQ I;  2X6O A;  2ZSI B;  2W85 A;  2XRL A;  4B48 A;  1XDU A;  3CO7 C;  2V26 A;  3HIF A;  3MAJ A;  5IYB J;  2VOD A;  1ZN2 A;  5FKL A;  2UZK A;  2RNG A;  5GPC A;  5FLM J;  3RQI A;  4PJJ A;  4Q48 A;  1FZP B;  2DMQ A;  2LTP A;  5M5X J;  2N8G A;  1RUN A;  1WVR A;  2KHM A;  5E3L A;  2R5Y B;  1IRX A;  1U8B A;  2PMU A;  1YYV A;  4XOP A;  1ZQ3 P;  3FXO A;  3DP7 A;  5D5X B;  5BPI A;  5FD5 A;  1P7J A;  1FWZ A;  3BJA A;  1GDT A;  5GAH J;  2I5U A;  2BY2 A;  2HFH A;  4YEL A;  3JRG A;  1TL8 A;  4A12 A;  2DU9 A;  1IN4 A;  5IP6 A;  3WOD F;  1D1B A;  5L3B A;  3IWZ A;  3IWF A;  2D45 A;  2VJI A;  1JKO C;  3U1K A;  2Z3Y A;  2B63 J;  4MIM A;  3KIO A;  2HR3 A;  5L3D A;  3FXQ A;  1FJL A;  1ULY A;  4S0H B;  4HLY A;  1TWH J;  4EJV A;  2LG4 A;  2ZME C;  4CO8 A;  5J1Y A;  1R4M B;  1RKT A;  2UXX A;  5DD8 A;  3C2H A;  3ZMD A;  3VWB A;  4XR6 A;  4C3J J;  3RYR A;  2M34 A;  2M5W A;  2CV2 A;  3GZN B;  5LFA A;  1MBJ A;  1B8I A;  5L3F A;  2M30 A;  2EIL H;  4KT6 A;  4EJU A;  2R4G A;  3QPL A;  5B5E C;  4DW6 A;  4A3D J;  4JQF A;  4OWR B;  4D5C A;  2FQ3 A;  2CFX A;  2XB5 A;  5B66 C;  1F4K A;  2D1V A;  2KIU A;  3KX2 A;  1X3W B;  2XF7 A;  3TP3 A;  2DT5 A;  1IRG A;  5D5V B;  4XRM A;  4KT5 C;  1KON A;  4AID A;  4CCL A;  1FOK A;  3JRA A;  1ZG5 A;  2JUC A;  1RZ4 A;  2VT2 A;  3WGH A;  3HPH A;  1APL C;  2OCE A;  3V8K A;  1SAN A;  1IUY A;  3JAM Z;  1R4N B;  2R5Z A;  2WA0 A;  2XSJ C;  1EKE A;  3T0Y A;  2Y75 A;  5J1U A;  5EF6 A;  3L2R A;  4UHT A;  3D1N I;  2QGU A;  4HLX A;  1RI7 A;  3PIP F;  4HEA 2;  4HQM A;  1S7E A;  1MSE C;  4BEH B;  1WJD A;  2EZL A;  3CCU I;  5HNF A;  3BR6 A;  1HXD A;  5E17 F;  4D0P A;  1BBY A;  2Z2S B;  3DEE A;  3H0D A;  1QHG A;  4JK1 X;  1Z9C A;  4M3D A;  4BBS J;  3ABK H;  3FXJ A;  1XCV A;  2VBW A;  2WB1 N;  1O7L A;  2RQP A;  2ZB9 A;  3H3U A;  3F8N A;  3LSG A;  4HF2 A;  4EV0 A;  2TCT A;  3N97 A;  2XGC A;  3DTE A;  3K4K A;  2PN6 A;  5HS8 A;  1DDN A;  4NQW A;  2A6H F;  1UB9 A;  1MDM B;  1IXR C;  2WV0 A;  1AA7 A;  1D8K A;  1OYI A;  4A6E A;  5E3M A;  3BLY A;  3U21 A;  3ZQL A;  1I6X A;  1EH6 A;  2IA2 A;  1SVM A;  4UXN A;  3KE2 A;  2LOO A;  5ICG A;  5A2Q Z;  3DCF A;  3WG7 H;  1PJR A;  1IN6 A;  2LRD A;  2CUF A;  2K3F A;  3MMY B;  1UEL B;  3WTY C;  2ID6 A;  5JI6 A;  3FXU A;  5K7F A;  4I01 A;  4ZDP A;  1W5C C;  1ZTR A;  3BR1 A;  4G9Y A;  5LHG A;  3QPS A;  4XNF A;  4RB3 C;  1WI9 A;  2IP2 A;  3TDU C;  3GBG A;  4U0V A;  1HCR A;  1UG0 A;  2KIM A;  3OYL A;  3R0J A;  4KN4 X;  2BXZ A;  1NHA A;  2UV1 A;  4LIU A;  6PAX A;  3JRB A;  3RKY A;  3KCC A;  1WKM A;  4ZTJ A;  2VC0 A;  3I53 A;  2IT0 A;  1BR1 A;  3T5X A;  2H27 A;  2YU9 J;  4L0Z B;  5BS6 A;  2MH2 A;  3K1P A;  1SFE A;  3HRU A;  3PJR A;  4IHX A;  4Q5S F;  5IY5 H;  4KFC A;  1EV7 A;  2LF8 A;  3ZQI A;  2ZJP F;  4N4N B;  3QU3 A;  4D1Q A;  5FKK A;  1SAU A;  3G73 A;  3H9Q A;  3FK6 A;  3ONQ A;  3VYU B;  1OCO H;  2M0C A;  3IP4 B;  1Y0U A;  5D4R A;  3J7Z I;  2COB A;  1HW2 A;  1XSD A;  2W4S A;  4J00 A;  2K40 A;  2ESH A;  2M0M A;  3ECH A;  1RNL A;  2DW4 A;  4EJW A;  3HG9 A;  1Z21 A;  2G7H A;  1PYV A;  3S2W A;  5C3E J;  5FKN A;  3D5L A;  5E3N A;  1TNT A;  2P6T A;  4IRH A;  2DYS H;  3HUG A;  1XGS A;  3DTK A;  3P9I A;  4O6J A;  3CP8 A;  2CUE A;  5HLG A;  2FBH A;  3E6C C;  4BE0 A;  4IQ4 A;  2FOK A;  4XLE A;  3MZ8 A;  1E3H A;  1FC3 A;  3E5U A;  3CME I;  3JTH A;  1BA5 A;  1W7P B;  3FBI B;  3RI4 A;  3OYB A;  2R0Q C;  4IOC F;  1HSJ A;  3CMM A;  1XTA A;  2FD5 A;  4RDU A;  3H0G J;  4KMF A;  3DPU A;  2GIV A;  2VI6 A;  4PGG A;  5E3O A;  1H0M A;  1Z05 A;  3W2V A;  5ED4 A;  3S3M A;  2E1M C;  2GIZ A;  2MC3 A;  2WAD A;  5HS7 A;  3BQZ A;  3OIP A;  3SQN A;  2PEX A;  3ZRG A;  4IOA F;  2BEO A;  2YSR A;  5DCF A;  2E5N A;  2ZNZ A;  4PK4 A;  3CUQ B;  2GWR A;  1WHU A;  3ZN0 A;  2LY9 A;  2VUM J;  5K5R A;  1WH7 A;  5FLX K;  1R22 A;  1B8I B;  4CYC A;  3QAH A;  2NVT J;  4TV7 A;  4QLC U;  2E7X A;  2DO7 A;  4XON A;  2VKV A;  2OU2 A;  4QTR A;  3OV8 A;  3X2Q H;  2V4J C;  1MD0 A;  5LEK A;  3HRT A;  3Q0V A;  1N25 A;  4S04 A;  3W2A A;  3BR0 A;  2CQ7 A;  3A0B C;  3J81 Z;  3HGG A;  1XX5 A;  4FE4 A;  2PG4 A;  4CCM A;  4CCJ A;  1JE8 A;  1OPC A;  1P92 A;  4UV8 A;  2A6T A;  3ZQG A;  2QQ8 A;  3KZI C;  5IYD J;  1U2W A;  2PMZ N;  4I09 A;  2O6G E;  2IS2 A;  2AQF A;  1X1D A;  2NS8 A;  3OSG A;  1VQK I;  1MMG A;  1FP2 A;  1J59 A;  4BJT A;  4LGW A;  4G7H F;  2BXY A;  2J5P A;  1XN7 A;  2MD0 A;  2OF7 A;  1IV8 A;  3CF2 A;  3IH4 A;  4O3M A;  4G6Q A;  2Y9Z A;  1OCR H;  2ELK A;  3B6A A;  2OJE D;  4LB6 B;  4XIC A;  1J9I A;  1JHF A;  1FOY A;  2JA5 J;  5LBQ A;  4F7Z A;  1O57 A;  2EBI A;  1JKQ C;  1R71 A;  3I58 A;  2NS0 A;  1QU3 A;  4AD9 A;  5HLT A;  3KP4 A;  3SDG A;  4ESF A;  3FBN B;  3M8E A;  1T33 A;  3WTX C;  1TP4 A;  2EFW A;  3SZP A;  5M3F J;  3F9K A;  1QQI A;  1VZ0 A;  1B6A A;  1R5I D;  2L0K A;  3ZQQ A;  2FBI A;  2VC1 A;  1ON1 A;  2MLG A;  3BCB A;  5DDG A;  3P9K A;  4YFN F;  3HM5 A;  1UFM A;  2LH9 A;  4ZDO A;  2AXL A;  1BC7 C;  1CGP A;  4XQF A;  3M7G A;  1LPQ A;  1YRN B;  1LUJ B;  2MA3 A;  1MJB A;  3HXL A;  1JXS A;  1IV6 A;  2Y2Z A;  1WJB A;  3HTS B;  4X1E A;  3V42 A;  1D8J A;  1HQC A;  2XB0 X;  3A4C A;  2VKD A;  4NNJ A;  1LVA A;  3A2K A;  1W0T A;  1LB2 A;  4FET A;  1U9O A;  2AQE A;  1TWG J;  2X48 A;  1WGX A;  3FMS A;  2RVC A;  1S6L A;  1VF9 A;  2DK5 A;  1ZEL A;  2KIS A;  2FML A;  3OS1 A;  4IO9 F;  1IGN A;  4L9J A;  3HOV J;  2ZJQ F;  1LDD A;  4DGW B;  3F22 A;  4IRG A;  3P9C A;  2WAQ N;  4QPO A;  1WJE A;  2XHK A;  1YFH A;  4F93 B;  4EM0 B;  2Z16 A;  3RCO A;  1QVT A;  4ENN A;  3HYI A;  2M4K A;  3K4J A;  1U5T A;  3IH3 A;  1AOY A;  5FKO A;  4XKW A;  5H6Q A;  2JSP A;  5CQG A;  4MEX F;  1EA3 A;  2WY8 Q;  3HOX J;  3KP3 A;  4DOZ A;  2K4B A;  3CC4 I;  5FLV A;  4PGH A;  5EYR A;  2R7D A;  4M72 A;  1G59 A;  1MJ9 A;  1MH3 A;  2RN7 A;  4FE7 A;  1ACI A;  4BU2 A;  1X2N A;  1P9Q C;  3MZH A;  2P5V A;  2BHY A;  1MBG A;  2X0L A;  3RKW A;  3L2C A;  3BWG A;  3BT9 A;  2XAJ A;  2ISZ A;  4OIQ F;  2C6Y A;  3GEZ A;  2DA2 A;  4EMS A;  2DFF A;  2STW A;  2Y48 A;  3PO2 J;  2JUG A;  3A02 A;  4GYI A;  2X6W A;  2HVQ A;  2EFQ A;  3IHU A;  2QSG X;  1SFX A;  1BJZ A;  2DJN A;  3MVP A;  2Q1Z B;  2GA2 A;  2DT7 B;  2H8W A;  2M7B A;  1SD6 A;  3WE3 A;  2JQ7 A;  2R7Z J;  1MMD A;  1WSU A;  3GW2 A;  2VQC A;  4Y33 A;  1HST A;  2LC2 A;  1KYW A;  4X6A J;  5D5W B;  4BDY A;  2L7K A;  5GTH C;  4YIR X;  1LFU P;  3DFG A;  5KAI C;  1ZRE A;  1JTY A;  3J7Y J;  1ETW A;  5J8F A;  4RB0 A;  4A5M A;  4CYC B;  4HRI A;  2P0W A;  3TO9 A;  4IVN A;  1GXQ A;  3CJQ B;  5D4S A;  1OQY A;  3GLX A;  3CUQ A;  1U9N A;  3KZY A;  5E1Z B;  1I50 J;  4A3K J;  2AS5 F;  2ISY A;  3H5A A;  4H4K C;  4XKC A;  3JSO A;  5BQT A;  4YII A;  5F04 A;  1TQI A;  1MBF A;  2EQR A;  4CCO A;  5IP9 J;  1HW1 A;  3OYG A;  5HOD A;  4RBO A;  4U0Y A;  2LMD A;  3E6M A;  4W1U A;  2HVS A;  3LL7 A;  4NDL A;  1FMV A;  5CKT A;  2NVQ J;  1MZB A;  1S7A A;  2EFO A;  2X9D A;  3IKV A;  5D8L B;  4BHB A;  2E36 A;  2K4J A;  3I64 A;  4MO7 A;  4L5J A;  1QPI A;  4HOB A;  1WJF A;  2RRE A;  2QWW A;  3F6V A;  2XF5 A;  3GO5 A;  3S32 A;  3LA2 A;  3OSF A;  3S1R J;  3HPG A;  5J3L A;  1IRZ A;  2MC4 A;  5DS9 A;  3PQK A;  4BJ6 C;  4PJN A;  1U6G A;  2VBX A;  3CP2 A;  1PUE E;  2CGP A;  2OZ6 A;  1YHQ I;  4LG0 B;  1BN5 A;  2IS1 A;  5A2Q K;  3PUB A;  1ZGA A;  3RTR A;  2EIM H;  1D0X A;  2G0E A;  2JPC A;  4XL9 A;  5LLQ A;  5FB2 A;  2EB7 A;  2K02 A;  1TW3 A;  3K2Z A;  3HOZ J;  3RPU D;  3BTJ A;  1T56 A;  1RC9 A;  1U78 A;  2DTZ A;  3DKY A;  3F72 A;  3VEP A;  1FOW A;  3E5Q A;  4UB6 C;  5KAF C;  4ASN A;  1H9T A;  2COM A;  3O6B B;  4PCQ A;  1E2X A;  2CQK A;  4LLG F;  2EA2 A;  3N05 A;  3JSP A;  4M3G A;  2X4H A;  1Y1W J;  3FM3 A;  4IPA A;  3NQO A;  1G3S A;  2LBF A;  3OYE A;  3S16 J;  2CMP A;  2KPM A;  2EZK A;  4PJ0 C;  5ILU A;  4CYD A;  3WTU C;  3H36 A;  2OTL I;  1IXS B;  2BE5 F;  3JW4 A;  2F5E A;  1XPX A;  4PSX A;  2OC6 A;  1UCR A;  3SZG A;  1J5Y A;  2VN2 A;  2MAB A;  5J8C A;  3FDY A;  4IXA A;  4CH7 A;  1FTT A;  1LDJ A;  4P9F A;  4E7I A;  2EWN A;  4CSW A;  1KA8 A;  5KHD A;  3GTP J;  4MLO A;  2HDD A;  1K83 J;  2QF7 A;  1J09 A;  3E6B A;  5J40 A;  2IGK A;  2QEX I;  4K2E A;  1V5G A;  2DN0 A;  4LB5 A;  3FX3 A;  5EJC A;  2R7R A;  2HZT A;  2FNA A;  2X6Y A;  4JBA A;  5DD4 A;  1FNN A;  4ZYD A;  4LIV A;  2WBM A;  5C4X J;  1GHC A;  4D7N A;  1OCP A;  3FM5 A;  4QSH A;  3SYT A;  1JT0 A;  1X19 A;  2XAU A;  2HPI A;  3O8G A;  2LD5 A;  2KIF A;  4JP0 A;  3BG7 A;  2ZFU A;  2EPF A;  3H92 A;  4FX4 A;  1FSE A;  3K1M A;  2ME6 A;  2HQA A;  2ME0 A;  1P6R A;  2XPV A;  3F8C A;  4F91 B;  1XG1 A;  2WY7 Q;  4KIT B;  1ZR2 A;  1G2H A;  3K70 C;  4PJL A;  3LQR A;  3RJP A;  2KL4 A;  4RMN A;  4YFK F;  2GZW A;  1MSF C;  2HXI A;  2RC4 A;  3LWF A;  3FMR A;  2MG4 A;  2BY0 A;  2JA6 J;  1OR7 A;  2LBF B;  3BC8 A;  2Z99 A;  1F9N A;  4DYR A;  2Q8K A;  2ECC A;  4EQQ A;  4PFP A;  2H6C A;  1XDS A;  3OL3 A;  3J81 K;  1JI8 A;  4OOI A;  2QEN A;  2P7V B;  2MD5 A;  3E97 A;  4L0Y B;  2ZME B;  3BJ6 A;  3HOW J;  3O3K A;  2ICW G;  2P8T A;  2ADU A;  3I5U A;  4XLP F;  4LMY A;  4ZJZ A;  1ZRD A;  4ZZD A;  4QWQ A;  4E7Z A;  1R6R A;  1WFX A;  3RSN A;  2MW8 A;  1TT5 B;  2NNY A;  3C7J A;  2E2I J;  3K4B A;  2IW5 A;  2HGC A;  3QYB A;  2GBY A;  1RIO H;  1O3S A;  2G7U A;  3KFW X;  2A5W A;  3SEZ A;  4C2U A;  2A05 A;  3BOQ A;  1ZR4 A;  1Z3X A;  3LOC A;  2CQQ A;  1FEX A;  3CCY A;  3CDH A;  5HDN A;  1Z6R A;  4ZZL A;  3NRV A;  4IHY A;  3OS2 A;  4C30 A;  3UKG A;  1F36 A;  3ZQ7 A;  2ZXH A;  4MQ9 F;  1BC8 C;  1T08 B;  1JTX A;  3G1L A;  3FHN A;  2HYJ A;  4BUP A;  2ZME A;  2CV1 A;  1J7K A;  5IP7 J;  2P5K A;  4J01 A;  4C3I J;  3U2R A;  2IA0 A;  1IG7 A;  2L9R A;  5KK1 A;  1G3T A;  2FNP A;  2IGO A;  2L7M P;  4CHU A;  2M2E A;  2A07 F;  3PSF A;  1VQ9 I;  3JTG A;  2GA1 A;  1FP1 D;  4B3A A;  2QA4 I;  2CO5 A;  1IN5 A;  2GOX B;  4BQO A;  1S29 A;  4E70 A;  3ISP A;  4XMY A;  1F5T A;  5CQE A;  3F23 A;  1H9G A;  3K0L A;  5J47 A;  4RAY A;  2KFD A;  1EH8 A;  2ZSH B;  4FT8 A;  4U7D A;  3WTT C;  1M1E B;  1MBK A;  2XRN A;  2R7W A;  2DXI A;  2R7S A;  1K4S A;  3W3C A;  2L9V A;  3CUO A;  1YS7 A;  2DA6 A;  3H5N A;  4IX7 A;  1LE8 B;  3HOU J;  2CH0 A;  5TRD A;  5TGT A;  4LK0 F;  1QRY A;  5EEA A;  2IAI A;  1AHD P;  2VON A;  1BOA A;  4IF4 A;  5HDK A;  3L2Q A;  2L9N A;  3I4M J;  1CF7 A;  3F3X A;  1X1A A;  3VYS B;  2XGX A;  4ZYH A;  2LKS A;  1Y8R B;  2ZCW A;  1IZ1 A;  1P4W A;  3CLQ A;  4G6D A;  1YW9 A;  2MYS A;  1SD5 A;  3OYC A;  2HTS A;  1SC7 A;  4GRI A;  3V8L A;  3HJE A;  2DOD A;  3V8J A;  2HQ5 A;  2HI3 A;  1JT6 A;  3LST A;  2QBY A;  5CVV A;  2NVU B;  3HKZ A;  2VT3 A;  4RAZ A;  2DA5 A;  1HDD C;  3KP6 A;  2E5Z A;  3CCJ I;  1K7A A;  4HF1 A;  3KEY A;  4C2M J;  4ABZ A;  3L1P A;  4BNC A;  4U0W A;  1U5T C;  4CA0 A;  3FMQ A;  2E35 A;  3OMY A;  3KLN A;  2GAU A;  3FKJ A;  2ESN A;  3ABM H;  4E7H A;  3QU6 A;  3TO6 A;  2MBF A;  3CES A;  3CDI A;  1IC8 A;  2BY3 A;  4DZP A;  3G1M A;  1IUF A;  2WB1 A;  3ERE D;  1QZY A;  2JA2 A;  2V1U A;  3EDP A;  3O2P E;  4OAZ A;  1DU0 A;  1U5T B;  3QYE A;  3CCS I;  3AL0 C;  3S1N J;  2M1B A;  3J7A O;  2K5C A;  1S3J A;  3SZT A;  3KP2 A;  1MNE A;  2L3D A;  3ZQC A;  1S5L C;  1MGT A;  2QBY B;  4V19 K;  4ANJ A;  1RKW A;  1X1C A;  3E6D A;  3ZMT A;  2CJJ A;  4KIC A;  2XV4 S;  4NC8 A;  1D1A A;  2P7C B;  1MH4 A;  5F6F A;  1YOV B;  3ZMU A;  3EQL F;  4L9V A;  3CMY A;  3K70 D;  3WGI A;  2H1L A;  3L9F A;  2M8E A;  2DT6 A;  4I99 C;  2V6C A;  3E5X A;  4Y17 A;  4LG0 A;  5FLX Z;  4BE2 A;  1TC3 C;  2LY2 A;  3SDB A;  2I10 A;  3T8T A;  2Y31 A;  2JSC A;  4BQA A;  1OCC H;  5CPR B;  3ZR8 X;  4ZYG A;  2DAO A;  3PFI A;  3TOB A;  5K7Z A;  2RAE A;  3LAJ A;  1LE8 A;  2VOO A;  1BI3 A;  2XAS A;  4AIH A;  4G12 A;  2DPU A;  1I27 A;  3I59 B;  4KIB A;  3H9G A;  3OIQ A;  2XAH A;  2OQR A;  1VQM I;  1Y0N A;  3TED A;  1WWX A;  1R23 A;  2FX0 A;  4DIQ A;  1K78 B;  2JA7 J;  3RZD J;  3ECO A;  3PQJ A;  3JAM K;  2K7L A;  4ESB A;  1B59 A;  4A2U A;  3PNV A;  3TO7 A;  5ERI A;  2KT0 A;  3HSR A;  4D9J A;  2WC2 A;  1MND A;  2FEZ A;  3MKY B;  2LNB A;  1J2X A;  3DEW A;  1FT9 A;  3DKW A;  5JLW A;  1T6S A;  3IRR A;  3E1S A;  1ZGJ A;  3WGG A;  4WK8 F;  4M6V A;  5HDG A;  2DQR A;  4RA2 A;  5FJ8 J;  1XMK A;  1U0J A;  3M1E A;  1UHW A;  2KJC A;  5KVR A;  5E8I A;  2Y0S A;  2W82 A;  2E2J J;  3GTQ J;  2WAF A;  2R7X A;  2EH3 A;  3ABT A;  5D8K B;  3F8M A;  1W5S A;  5LD2 C;  1OYY A;  1YS6 A;  3IAS 2;  1W1W E;  3Q0W A;  3F21 A;  4ENK A;  2V9V A;  2GXB A;  2L4M A;  4FX0 A;  2XPW A;  1I39 A;  3VOD A;  2OA4 A;  1NK2 P;  2ZJ2 A;  2J5O A;  2K9S A;  3M8F A;  2VE8 A;  2D5V A;  2CS3 A;  3QYF A;  2F5C A;  3CF5 F;  3SJM A;  4A6D A;  3LQQ A;  3H3V K;  1W36 D;  1ETQ A;  3CO6 C;  1RET A;  1G4D A;  3DV8 A;  9ANT A;  3VOE A;  2NVY J;  2CSO A;  3HSE A;  3WG9 A;  2L5Q A;  1DGW Y;  5E1W A;  2PJR A;  2NOG A;  1LEA A;  4N9H A;  1IDY A;  3IAM 2;  1AWC A;  3S2H J;  4CZC A;  4JX6 A;  4HNV A;  5CLS A;  1PDN C;  2PJP A;  1FBS A;  2F4I A;  1RR7 A;  3B6C A;  5GAE J;  1B9M A;  1GXP A;  2YX7 A;  3BG9 A;  3AFH A;  1JGS A;  1KQ0 A;  2M45 A;  4P5O A;  4HPQ A;  1G8X A;  5J6X A;  3L2U A;  2EIK H;  1QHH D;  2NS7 A;  4EM1 A;  3IC7 A;  2DYR H;  5E1X A;  3GVA A;  1FIP A;  2E2H J;  4I0B A;  3BG6 A;  5HS9 A;  1W7P A;  3ELK A;  4A3M J;  3LFK A;  1JJ6 C;  1POG A;  3BQY A;  3MZY A;  1UHM A;  3CZ6 A;  3K4M A;  2Q2E A;  3TMO A;  5D5U B;  4CIC A;  1IF1 A;  4HBL A;  2E7W A;  5GP9 A;  1G6N A;  3JRF A;  2UXN A;  3G3Z A;  2KQR A;  3AG2 H;  1K6O A;  1AU7 A;  2O0Y A;  4IHV A;  3SXY A;  1DQU A;  3J80 K;  3GTJ J;  1IJW C;  3SFI A;  3WTS C;  3VYR B;  1UST A;  3QPT A;  1LKX A;  1V54 H;  1ZG3 A;  1BIB A;  1XD7 A;  4EJO A;  1JHH A;  4M3E A;  2PQ8 A;  3NEU A;  4OIR F;  4EAT A;  2I8D A;  3B02 A;  3C2G A;  5HVQ C;  3CQZ J;  3G6E I;  1YJN I;  3ROU A;  4CUG A;  5IYC J;  1IXC A;  2TRT A;  5JHU A;  1FBQ A;  3MKZ A;  2VOP A;  1O4X A;  4V2G A;  1O7F A;  5D6E A;  2IS4 A;  2HDC A;  3CLO A;  5DYM A;  4QPQ A;  1YO5 C;  1GUU A;  1BI1 A;  3MEX A;  5IT3 A;  1YRN A;  2W84 A;  2UUZ A;  5DUI A;  2P6S A;  1I6H J;  1XB4 A;  1LEB A;  2BYV E;  1R1U A;  5F27 A;  1A6Q A;  1K6Y A;  2RKH A;  1BW5 A;  1Z7U A;  4JX4 A;  4UUT A;  2Z5U A;  4LD5 A;  4XKB A;  4E7S A;  2V9P A;  3K2A A;  2XKP A;  3HOY J;  4MTE A;  5F64 A;  1FSH A;  1ZRF A;  3OOU A;  4V2F A;  5EEG A;  3WU0 A;  1R58 A;  3TW6 A;  4RM2 A;  3BJO A;  3CCV I;  3JR9 A;  4PJM A;  3R6S A;  2OAZ A;  5H2F C;  1XGM A;  2E60 A;  4S05 A;  1Z91 A;  1ZAO A;  3SHF A;  3D0S A;  1IN8 A;  2CU7 A;  5E20 A;  4F52 A;  1OJL A;  3GXO A;  3JCU C;  5CVI A;  4IJA A;  2V6E A;  5CVU A;  1Y39 A;  3WTV C;  1W36 C;  2HWV A;  1A35 A;  4IHS A;  1A36 A;  5AIQ A;  3KET A;  4IEJ A;  1R00 A;  4AUX A;  4PDK A;  4HDU A;  2JA8 J;  2PLY A;  5KCM A;  1OCZ H;  2DOE A;  2KRC A;  2W48 A;  4HSR A;  1YIO A;  3DTI A;  5GAG J;  3F8F A;  2DPD A;  4A3J J;  1BOB A;  3KP5 A;  3BZ6 A;  5E79 C;  2XGE A;  3S8P A;  4MTD A;  1XSV A;  3W6K B;  3TDZ C;  2CFO A;  4GO1 A;  4R79 A;  1ITY A;  4OIO F;  3ASN H;  3DU6 A;  3CC2 I;  3JRC A;  2JMW A;  3ASO H;  1QNT A;  3L2W A;  3OL4 A;  3DPT A;  2E1C A;  3ABL H;  1WZ2 A;  2YX4 A;  4KUM A;  4DJA A;  2ECB A;  5K5O A;  4BJ5 C;  4CDG A;  3OR2 C;  1SD4 A;  2WV1 A;  4N9I A;  5L3G A;  3HB9 A;  1IDZ A;  2XAQ A;  3K6G A;  2JZY A;  1VI0 A;  4A5N A;  2LSO A;  4JX5 A;  1ZLJ A;  4HX8 A;  3KYD B;  3BCA A;  3LA3 A;  2CQN A;  1Z0X A;  2KZV A;  1WI3 A;  2EK5 A;  4MQV A;  4ENM A;  3TQN A;  2QKL B;  1LFB A;  3GZ5 A;  3ZN1 A;  1X1B A;  1OIS A;  4HX7 A;  1TZL A;  5ICF A;  2ZNY A;  2W1O A;  3M9A A;  3DLL F;  3ZCO A;  2Y9Y A;  1BI2 A;  4I0A A;  2DFI A;  1Z7L A;  1YIT I;  4Z6Y A;  5J4Y A;  1HF0 A;  3L7W A;  4MHG A;  5LRS A;  4G94 A;  1D1C A;  2HPM A;  1RPW A;  2EFP A;  3OOP A;  1J75 A;  4OIN F;  4R8H A;  3ML6 A;  3E3V A;  1T38 A;  1TTY A;  3PSI A;  4GCV A;  4B09 A;  2OD5 A;  1Q1V A;  3S3N A;  2IGN A;  3JRH A;  3HEF A;  4P96 A;  4XBF A;  2H6B A;  2L7Z A;  2HVR A;  2VJ4 A;  3A01 A;  3DLA A;  5H6R A;  1GV5 A;  4KMU X;  3ZPL A;  5JVT A;  1I1S A;  4HV5 A;  4UUS A;  2UWM A;  4L9N A;  4L5E A;  3IKT A;  2V1N A;  2B7E A;  2KDZ A;  1GVD A;  3M07 A;  1A5J A;  2X6X A;  3DF8 A;  3H3Z A;  3RYP A;  1MMS A;  3BZC A;  3SEQ A;  4DNC A;  2GM4 A;  1WRJ A;  2JVG A;  3V4G A;  4XID A;  2P4W A;  4KDP A;  2BW3 B;  5FFZ A;  2W24 A;  2H8R A;  3C1D A;  1UHS A;  2DQL A;  1WPK A;  4BHC A;  1DGR M;  3F0C A;  4XM3 A;  2FBK A;  2L7F P;  5LHH A;  2M87 A;  1TWC J;  5KNL A;  2QKM B;  5BNG A;  2DCE A;  5K5Q A;  4BH9 A;  2O8K A;  1STZ A;  1VND A;  2YUS A;  4RS8 A;  2NAZ A;  2XDV A;  4HAM A;  1ETK A;  5K1Y A;  2FF4 A;  1D0Y A;  4BAY A;  4A93 J;  1H89 C;  1AKH B;  3M4O J;  3FK7 A;  1O3Q A;  2RQQ A;  4PFO A;  1UMQ A;  1TNS A;  4UUS B;  3MKW B;  4DZJ A;  4BXU A;  4WWC A;  4GDF A;  4I2O A;  2FA5 A;  2WAE A;  4UVA A;  1O3T A;  2YR2 A;  2TDX A;  5J1R A;  1FYK A;  3A01 B;  4YRV A;  4IL6 C;  4XLH A;  5C44 J;  4II3 A;  1OYW A;  4DYC A;  3JRD A;  2M7A A;  1TWF J;  1ETX A;  2LK2 A;  4Q47 A;  3ZOB A;  3HOT A;  1HDP A;  2BOL A;  2DMP A;  4AU7 A;  2EZH A;  2OTJ I;  1YI2 I;  1VQP I;  3REO A;  2DA3 A;  4M9Z A;  1XGO A;  2GXG A;  2QQB A;  4KJZ A;  1FX7 A;  3V7R A;  4BEH A;  5H20 A;  4B4C A;  2O9L A;  1P7I A;  2WAQ A;  3DU5 A;  1W0U A;  4IKF A;  2AO9 A;  2MSY A;  1HC8 A;  3K7A J;  2XAF A;  4UUV A;  2DA4 A;  2MFZ A;  4HNT A;  3CJR B;  1BI0 A;  2R5Z B;  2ZKZ A;  2OCC H;  2IEK A;  1PUF A;  1NH3 A;  2F4M B;  4HYE A;  4FAS D;  1YE9 A;  3O8H A;  4YFX F;  1SVL A;  3OYK A;  3M3Y J;  4B3X A;  3CTA A;  3P5J A;  3GYH X;  5IOZ A;  2DOA A;  1SMY F;  1V5E A;  5IT9 Z;  3PUF A;  4I02 A;  3AG1 H;  4HF0 A;  5DCM B;  4XK4 A;  1T39 A;  2K9N A;  1RUO A;  2CV0 A;  1FY7 A;  2CW8 A;  2VQH A;  2FRH A;  2K3P A;  4XLF A;  3HL2 A;  3QP5 A;  3DEU A;  3LSK A;  1V3F A;  3KPH A;  3B73 A;  4II2 A;  1ZYR F;  2V1X A;  3N4M A;  3L09 A;  4F3Q A;  3VSK A;  3TOA A;  2R92 J;  1XMA A;  2O7O A;  2VKH A;  3BP8 A;  1SD7 A;  1T95 A;  3FIW A;  4G7O F;  2FU4 A;  2ZO4 A;  1A6I A;  3GFJ A;  4IZZ A;  3QWL A;  4DQ2 A;  4XRS G;  1TW2 A;  1ETV A;  2D2W A;  3BDD A;  3AKZ A;  3LSI A;  2L01 A;  2A69 F;  2HOE A;  5ILS A;  2IA1 A;  1I3Q J;  3CDL A;  3SFZ A;  2A3S A;  2QLZ A;  4WF2 A;  5FKM A;  4U87 A;  4A3L J;  2HDW A;  3DBH B;  3K10 A;  1MKM A;  3PL8 A;  3QP6 A;  3HKZ N;  1KU2 A; 
#chains in the Genus database with same CATH homology
 4OMZ A;  1ZH5 A;  4IRI A;  5TJJ A;  1V4R A;  1USS A;  4MGR A;  3QOP A;  1TQP A;  3K69 A;  2CW0 F;  3DPL C;  4U88 A;  3FHZ A;  2BV6 A;  4HV6 A;  2PFB A;  1FLI A;  1B9N A;  4YIF A;  5DUK A;  3K9T A;  2G9W A;  1FYL A;  3P7N A;  4P55 A;  2LF7 A;  1KU9 A;  3RPU A;  3R0A A;  2Z9O A;  2F5F A;  3W6J B;  1I1G A;  3U1D A;  1Z1D A;  5ICE A;  4UNO A;  4KYW A;  2QVO A;  1F1Z A;  4YG2 F;  1L0O C;  2HQN A;  1HBX G;  2V1D A;  5FGM A;  4CGZ A;  1L3L A;  4A0Z A;  1XGN A;  1YW7 A;  3DQV C;  4M73 A;  4RB1 A;  2W57 A;  2FSW A;  2EV0 A;  1YQA A;  4NHJ A;  1ODD A;  4CXF A;  1XSX A;  2FMY A;  2JPB A;  2LKP A;  5L3C A;  2A61 A;  2CYY A;  4RB2 C;  1BM9 A;  4XSZ F;  4GYG A;  3FF5 A;  1T98 A;  1WQ2 A;  1TQM A;  1TLH B;  3EET A;  3EYI A;  2CG4 A;  2EFN A;  5FFX A;  2OQG A;  2STT A;  5CYV A;  3AAF A;  3GFM A;  1ON2 A;  3VFZ A;  4BYY A;  1KQ8 A;  1KYZ A;  1R1T A;  4LLL A;  3VB2 A;  5BPD A;  4UVC A;  1T0F A;  3MWM A;  2EV5 A;  2NNN A;  1BIA A;  3FWE A;  2NRA C;  2H09 A;  5LGN A;  4ETS A;  1W4M A;  4A0Y A;  2RGV A;  4LK1 F;  4M9S A;  2WWY A;  3HRS A;  3V7S A;  1LJ9 A;  5LGU A;  2H94 A;  1SMT A;  1MJA A;  2QM3 A;  2W25 A;  2XAG A;  1K78 A;  2IRF G;  3BY6 A;  3Q9V A;  3I59 A;  1YG2 A;  5CVR A;  4RGU A;  3R60 A;  2YU3 A;  4WXH A;  4GGG A;  4MEY F;  1S8N A;  3C3W A;  3KLO A;  4H0E A;  1O3R A;  2HS5 A;  3LA7 A;  3CUQ C;  1DUX C;  1Z6T A;  4AIK A;  1PP8 F;  2QYO A;  3IL2 A;  4GXO A;  3MCZ A;  3HOS A;  4ZH4 F;  3J80 Z;  1KGS A;  2L54 A;  1VTN C;  5FO5 A;  1OKR A;  1FPQ A;  1ZG1 A;  4WCG A;  4I7H A;  4EGY A;  4EJT A;  3GX4 X;  1B4A A;  2IPQ X;  4WXD A;  2HKO A;  2XRO A;  1DPU A;  1QO0 D;  1B1B A;  5HLH A;  1KQ9 A;  3IRQ A;  3HRM A;  5LHI A;  2K27 A;  3KEO A;  1DPR A;  1X3U A;  1U3E M;  4HA8 A;  4NB5 A;  2QQA A;  5EEH A;  3ZMS A;  4CZZ A;  4L9T A;  4U7B A;  2R7F A;  2A6E F;  1ZRC A;  1A04 A;  1R1V A;  1MDM A;  4R1H A;  4P9U A;  3K1N A;  1FYM A;  3TGN A;  2NYX A;  4A0X A;  2Z33 A;  1C0W A;  1HKT A;  1P4A A;  4I98 B;  1CF7 B;  4BHP A;  3GFI A;  2LDU A;  2RDP A;  4HQE A;  2CWE A;  3LAP A;  2F2E A;  2QUF A;  5LRR A;  3DXJ F;  4XSX F;  3RDI A;  5CVJ A;  1DP7 P;  2YPR A;  2MH9 A;  1J0R A;  2PI0 A;  5LEJ A;  2R3S A;  2D1H A;  1IN7 A;  4KA4 A;  3RIR A;  1HW5 A;  1GVJ A;  2O8X A;  3KZZ A;  4LJZ F;  4HW0 A;  2ELH A;  2VBY A;  2Y0M A;  2HKX A;  4HX4 A;  1YTY A;  1S7O A;  2Q0O A;  4L5I A;  1R7J A;  4L18 B;  2IVM A;  3RKX A;  3BRO A;  1HKS A;  1LDK B;  3GFL A;  2QZ8 A;  3I71 A;  4KN7 X;  2XKO A;  1D5V A;  4MNU A;  3R4K A;  3KEQ A;  2XUB A;  3Q9S A;  2ZBK A;  2JTV A;  3C18 A;  4G7Z F;  4IHT A;  1SAX A;  3FXR A;  2ZFW A;  3ZMV A;  1KU7 A;  2VXZ A;  5DV5 A;  4KIG A;  2ETH A;  4M6X A;  4EVI A;  4WXC A;  3FZV A;  3ABU A;  3I4P A;  2ZXJ A;  4UV9 A;  5E8G A;  3QPH A;  3TKY A;  4RGR A;  2VBZ A;  2O03 A;  3V7C A;  3BPX A;  2OZU A;  5ILV A;  5HOO A;  4AVP A;  5AON A;  1E17 A;  1IAW A;  2O3F A;  2HTJ A;  2QQ9 A;  4Y15 A;  1LNW A;  4OMY A;  3HSF A;  2WTE A;  1KU3 A;  1QBJ A;  3ULQ B;  1T2K A;  4LFU A;  1QGP A;  2O61 A;  1ZHF A;  2V79 A;  2OBP A;  2BBY A;  3F8B A;  3MFK A;  4HZF A;  3GWZ A;  2L02 A;  1K79 A;  5JR3 A;  3T8R A;  1W7P D;  1OMI A;  4PZJ A;  1W5T A;  1YLF A;  1IW7 F;  1QZZ A;  4HDV A;  4OU0 A;  5FD6 A;  5DEQ A;  3T1B A;  3ZMZ A;  1BJA A;  4M71 A;  4AIJ A;  3L00 A;  4Y13 A;  2GQQ A;  4AWX B;  3HHH A;  4O5V A;  1FBU A;  1YW8 A;  2DLL A;  3GZ6 A;  4M6Y A;  1ONV A;  5D6F A;  3RPQ A;  2VE9 A;  5JFR A;  2DK8 A;  2BGC A;  3WTW C;  3GF2 A;  3WTZ A;  4ESJ A;  4ENJ A;  3I54 A;  3BPV A;  1P4X A;  1G3W A;  3HHG A;  2K86 A;  5ICC A;  5CJ9 A;  3HTU A;  2P5L C;  3R61 A;  1REP C;  2DBB A;  3COA C;  1D3Y A;  2JT1 A;  2DI3 A;  1QPM A;  1R36 A;  5F1R A;  2PBI A;  2E1N A;  4B8X A;  2HYF A;  3EUH A;  2A68 F;  2HYG D;  1I5Z A;  2FE3 A;  4RGS A;  2KRF A;  1TBX A;  2A5Y B;  2EJR A;  4UVB A;  4ON0 A;  3WU1 B;  3CJN A;  2JRT A;  5LGT A;  4FHT A;  2KKO A;  5L3E A;  1IRF A;  4KIF A;  4N0B A;  4Q4Z F;  2RNJ A;  3KP7 A;  3ZP5 A;  2XVC A;  4M9X A;  5BOX A;  1SFU A;  5DCM A;  3MQ0 A;  5BMZ A;  3GUD A;  1XCB A;  1U8R A;  1R5H A;  4RGX A;  4LLN A;  2HEO A;  3F6O A;  1PP7 U;  1EH7 A;  4ZYE A;  2EV6 A;  3QRF F;  5AIP A;  3Q5F A;  2F5D A;  2EA4 A;  2L4A A;  3U9G A;  5IT9 K;  4Z2Y A;  2XIG A;  2B0L A;  3WE2 A;  4OIP F;  1ZAR A;  2IJL A;  3EYY A;  5E18 F;  2PMH A;  2FXA A;  4EGZ A;  1P2F A;  2RV8 A;  2KJB A;  2DTR A;  4G8X A;  4M74 A;  2HQR A;  1G3Y A;  4EM2 A;  1R5G A;  4XLN F;  1HKQ A;  2MLK A;  5HLI A;  2ACJ A;  1LQ1 A;  4KNY A;  4WX9 A;  1Q1H A;  4XRF A;  1ZLK A;  3I0T A;  2W85 A;  3CO7 C;  1XDU A;  3HIF A;  3MAJ A;  2VOD A;  1ZN2 A;  2UZK A;  4Q48 A;  1FZP B;  1RUN A;  2PMU A;  1YYV A;  3DP7 A;  5D5X B;  5BPI A;  5FD5 A;  3BJA A;  1FWZ A;  2HFH A;  4A12 A;  2DU9 A;  1IN4 A;  3WOD F;  5L3B A;  3IWZ A;  3IWF A;  2D45 A;  2Z3Y A;  2HR3 A;  5L3D A;  3FXQ A;  1ULY A;  4HLY A;  4EJV A;  4CO8 A;  2UXX A;  5DD8 A;  3ZMD A;  3RYR A;  2M5W A;  5L3F A;  2M30 A;  4EJU A;  4JQF A;  2FQ3 A;  2CFX A;  1F4K A;  2D1V A;  2KIU A;  2DT5 A;  1IRG A;  5D5V B;  4KT5 C;  1FOK A;  1ZG5 A;  1RZ4 A;  2VT2 A;  3WGH A;  3V8K A;  1IUY A;  3JAM Z;  3T0Y A;  2Y75 A;  4UHT A;  4HLX A;  1RI7 A;  4HQM A;  1HXD A;  5E17 F;  4D0P A;  1BBY A;  4JK1 X;  1Z9C A;  2VBW A;  1XCV A;  1O7L A;  2RQP A;  3H3U A;  3F8N A;  4HF2 A;  4EV0 A;  3N97 A;  2PN6 A;  5HS8 A;  1DDN A;  4NQW A;  2A6H F;  1UB9 A;  1MDM B;  1IXR C;  2WV0 A;  1D8K A;  1OYI A;  4A6E A;  1I6X A;  1EH6 A;  2IA2 A;  4UXN A;  3KE2 A;  5ICG A;  5A2Q Z;  1IN6 A;  3WTY C;  5JI6 A;  3FXU A;  4I01 A;  4G9Y A;  5LHG A;  4RB3 C;  1WI9 A;  2IP2 A;  3TDU C;  4U0V A;  2KIM A;  3R0J A;  4KN4 X;  1NHA A;  6PAX A;  3RKY A;  3KCC A;  1WKM A;  2VC0 A;  3I53 A;  2IT0 A;  3T5X A;  2H27 A;  4L0Z B;  5BS6 A;  2MH2 A;  3K1P A;  1SFE A;  3HRU A;  4Q5S F;  4KFC A;  1EV7 A;  2LF8 A;  3QU3 A;  3G73 A;  1Y0U A;  5D4R A;  1HW2 A;  1XSD A;  2ESH A;  3ECH A;  1RNL A;  2DW4 A;  4EJW A;  2G7H A;  3S2W A;  3D5L A;  1TNT A;  2P6T A;  4IRH A;  3HUG A;  1XGS A;  3P9I A;  4O6J A;  5HLG A;  2FBH A;  3E6C C;  2FOK A;  1FC3 A;  3E5U A;  3JTH A;  1W7P B;  3RI4 A;  1HSJ A;  4KMF A;  2GIV A;  4PGG A;  1H0M A;  1Z05 A;  5ED4 A;  2MC3 A;  5HS7 A;  3SQN A;  2PEX A;  2BEO A;  2YSR A;  5DCF A;  2ZNZ A;  3CUQ B;  2GWR A;  3ZN0 A;  5K5R A;  5FLX K;  1R22 A;  3QAH A;  4TV7 A;  4QLC U;  2E7X A;  2DO7 A;  2OU2 A;  3OV8 A;  5LEK A;  1MD0 A;  3HRT A;  4S04 A;  3J81 Z;  2PG4 A;  1JE8 A;  1OPC A;  1P92 A;  4UV8 A;  1U2W A;  4I09 A;  2O6G E;  1FP2 A;  1J59 A;  4LGW A;  4G7H F;  2J5P A;  1XN7 A;  4O3M A;  4G6Q A;  4LB6 B;  1J9I A;  1JHF A;  5LBQ A;  4F7Z A;  1O57 A;  3I58 A;  2NS0 A;  4AD9 A;  3KP4 A;  4ESF A;  3M8E A;  3WTX C;  2EFW A;  3SZP A;  1QQI A;  1B6A A;  2FBI A;  2VC1 A;  1ON1 A;  2MLG A;  5DDG A;  3P9K A;  4YFN F;  1UFM A;  2AXL A;  1BC7 C;  1CGP A;  3M7G A;  2MA3 A;  1MJB A;  1JXS A;  3HTS B;  1D8J A;  1HQC A;  1LVA A;  1LB2 A;  3FMS A;  2RVC A;  1S6L A;  2DK5 A;  2FML A;  4L9J A;  1LDD A;  3F22 A;  4IRG A;  3P9C A;  2XHK A;  1YFH A;  4EM0 B;  4ENN A;  3HYI A;  1U5T A;  1AOY A;  5H6Q A;  4MEX F;  3KP3 A;  2K4B A;  4PGH A;  2R7D A;  4M72 A;  1MJ9 A;  2RN7 A;  3MZH A;  2P5V A;  2X0L A;  3RKW A;  3L2C A;  3BWG A;  2XAJ A;  2ISZ A;  4OIQ F;  2C6Y A;  3GEZ A;  4EMS A;  2STW A;  2Y48 A;  4GYI A;  2EFQ A;  3IHU A;  1SFX A;  2GA2 A;  3WE3 A;  1SD6 A;  1WSU A;  3GW2 A;  1HST A;  1KYW A;  5D5W B;  3DFG A;  1ZRE A;  5J8F A;  4RB0 A;  4A5M A;  3TO9 A;  4IVN A;  1GXQ A;  5D4S A;  3GLX A;  3CUQ A;  3KZY A;  5E1Z B;  2AS5 F;  2ISY A;  3JSO A;  5BQT A;  4YII A;  1TQI A;  1HW1 A;  4U0Y A;  3E6M A;  1MZB A;  4BHB A;  1S7A A;  2EFO A;  3IKV A;  5D8L B;  3I64 A;  2K4J A;  4L5J A;  4HOB A;  2QWW A;  3F6V A;  3GO5 A;  3LA2 A;  3PQK A;  1PUE E;  1U6G A;  2VBX A;  2CGP A;  4LG0 B;  2OZ6 A;  1BN5 A;  5A2Q K;  1ZGA A;  3RTR A;  2JPC A;  5LLQ A;  5FB2 A;  2EB7 A;  2K02 A;  1TW3 A;  3K2Z A;  1U78 A;  3VEP A;  3F72 A;  3E5Q A;  4ASN A;  1H9T A;  2COM A;  3O6B B;  4PCQ A;  1E2X A;  2CQK A;  4LLG F;  2EA2 A;  3JSP A;  2X4H A;  3FM3 A;  4IPA A;  3NQO A;  1G3S A;  5ILU A;  4CYD A;  3WTU C;  1IXS B;  2BE5 F;  3JW4 A;  2F5E A;  1UCR A;  1J5Y A;  2VN2 A;  5J8C A;  4IXA A;  1LDJ A;  4P9F A;  2EWN A;  1KA8 A;  3E6B A;  4K2E A;  4LB5 A;  3FX3 A;  2HZT A;  2FNA A;  4JBA A;  5DD4 A;  1FNN A;  4ZYD A;  1GHC A;  3FM5 A;  2KIF A;  3H92 A;  4FX4 A;  1FSE A;  3K1M A;  3F8C A;  1P6R A;  3LQR A;  3RJP A;  4YFK F;  2GZW A;  2RC4 A;  3LWF A;  3FMR A;  1OR7 A;  2Z99 A;  1F9N A;  2Q8K A;  4EQQ A;  2H6C A;  1XDS A;  3J81 K;  4OOI A;  2QEN A;  2P7V B;  2MD5 A;  3E97 A;  4L0Y B;  2ZME B;  3BJ6 A;  3O3K A;  2P8T A;  2ADU A;  3I5U A;  4XLP F;  4LMY A;  1ZRD A;  4ZZD A;  4QWQ A;  2NNY A;  3C7J A;  2IW5 A;  2HGC A;  1RIO H;  1O3S A;  2G7U A;  3KFW X;  3BOQ A;  3CDH A;  5HDN A;  1Z6R A;  4ZZL A;  3NRV A;  3ZQ7 A;  1BC8 C;  4MQ9 F;  2ZME A;  1J7K A;  2P5K A;  3U2R A;  2IA0 A;  5KK1 A;  1G3T A;  2FNP A;  4CHU A;  2A07 F;  3JTG A;  2GA1 A;  1FP1 D;  2CO5 A;  1IN5 A;  1S29 A;  4E70 A;  3ISP A;  1F5T A;  3F23 A;  1H9G A;  3K0L A;  4RAY A;  1EH8 A;  4FT8 A;  4U7D A;  3WTT C;  2XRN A;  3CUO A;  1YS7 A;  5TRD A;  4LK0 F;  2VON A;  1BOA A;  4IF4 A;  5HDK A;  1CF7 A;  3F3X A;  2XGX A;  4ZYH A;  2ZCW A;  1IZ1 A;  1P4W A;  4G6D A;  1YW9 A;  1SD5 A;  2HTS A;  3V8L A;  3V8J A;  3LST A;  2QBY A;  5CVV A;  2VT3 A;  4RAZ A;  3KP6 A;  1K7A A;  4HF1 A;  4BNC A;  4U0W A;  1U5T C;  3FMQ A;  3KLN A;  2GAU A;  2ESN A;  3QU6 A;  3TO6 A;  2MBF A;  3ERE D;  1QZY A;  2V1U A;  3EDP A;  3O2P E;  1U5T B;  2M1B A;  3J7A O;  1S3J A;  3SZT A;  3KP2 A;  2L3D A;  2QBY B;  1MGT A;  3E6D A;  3ZMT A;  4KIC A;  2XV4 S;  2P7C B;  5F6F A;  3ZMU A;  3EQL F;  4L9V A;  3WGI A;  3L9F A;  2M8E A;  2V6C A;  3E5X A;  4Y17 A;  4LG0 A;  5FLX Z;  3T8T A;  2JSC A;  4BQA A;  4ZYG A;  2DAO A;  3PFI A;  3TOB A;  3LAJ A;  2VOO A;  1BI3 A;  2XAS A;  4AIH A;  2DPU A;  1I27 A;  3I59 B;  4KIB A;  2XAH A;  2OQR A;  1WWX A;  1R23 A;  1K78 B;  3ECO A;  3PQJ A;  3JAM K;  2K7L A;  4ESB A;  1B59 A;  4A2U A;  3TO7 A;  5ERI A;  3HSR A;  2WC2 A;  2FEZ A;  2LNB A;  1J2X A;  1FT9 A;  3DKW A;  1T6S A;  3IRR A;  1ZGJ A;  3WGG A;  4WK8 F;  5HDG A;  2DQR A;  1XMK A;  3M1E A;  1UHW A;  2KJC A;  5KVR A;  5E8I A;  3ABT A;  5D8K B;  3F8M A;  1W5S A;  1OYY A;  1YS6 A;  4ENK A;  3F21 A;  2V9V A;  2GXB A;  2L4M A;  4FX0 A;  3VOD A;  2OA4 A;  2ZJ2 A;  2J5O A;  3M8F A;  2VE8 A;  2F5C A;  4A6D A;  3LQQ A;  3CO6 C;  1G4D A;  3DV8 A;  3VOE A;  2CSO A;  3HSE A;  3WG9 A;  5E1W A;  1LEA A;  4N9H A;  1AWC A;  5CLS A;  1PDN C;  2PJP A;  1FBS A;  1B9M A;  1GXP A;  2YX7 A;  1KQ0 A;  1JGS A;  2M45 A;  4P5O A;  5J6X A;  4EM1 A;  3IC7 A;  5E1X A;  3GVA A;  4I0B A;  5HS9 A;  1W7P A;  3ELK A;  3LFK A;  3MZY A;  1UHM A;  2Q2E A;  5D5U B;  4CIC A;  1IF1 A;  4HBL A;  2E7W A;  1G6N A;  2UXN A;  3G3Z A;  1K6O A;  2O0Y A;  3SXY A;  3J80 K;  3WTS C;  1UST A;  3QPT A;  1ZG3 A;  1BIB A;  1XD7 A;  4EJO A;  1JHH A;  2PQ8 A;  3NEU A;  4OIR F;  3B02 A;  5HVQ C;  3ROU A;  1IXC A;  5JHU A;  1FBQ A;  2VOP A;  1O7F A;  5D6E A;  2HDC A;  3CLO A;  5DYM A;  1YO5 C;  1BI1 A;  3MEX A;  5IT3 A;  2W84 A;  5DUI A;  2P6S A;  1XB4 A;  1LEB A;  2BYV E;  1R1U A;  2RKH A;  1Z7U A;  2Z5U A;  4LD5 A;  2XKP A;  4MTE A;  5F64 A;  1FSH A;  1ZRF A;  5EEG A;  3WU0 A;  1R58 A;  3BJO A;  3R6S A;  2OAZ A;  1XGM A;  4S05 A;  1Z91 A;  1ZAO A;  3SHF A;  3D0S A;  1IN8 A;  5E20 A;  3GXO A;  5CVI A;  4IJA A;  5CVU A;  3WTV C;  2HWV A;  4IHS A;  5AIQ A;  3KET A;  1R00 A;  4PDK A;  4HDU A;  2PLY A;  1YIO A;  3F8F A;  2DPD A;  3KP5 A;  3BZ6 A;  4MTD A;  1XSV A;  3W6K B;  3TDZ C;  4GO1 A;  4R79 A;  4OIO F;  1QNT A;  3DPT A;  2E1C A;  2YX4 A;  4KUM A;  5K5O A;  4CDG A;  1SD4 A;  4N9I A;  5L3G A;  2XAQ A;  2JZY A;  4A5N A;  2LSO A;  1ZLJ A;  4HX8 A;  3LA3 A;  2EK5 A;  4MQV A;  4ENM A;  3TQN A;  3GZ5 A;  3ZN1 A;  4HX7 A;  5ICF A;  2ZNY A;  3M9A A;  1BI2 A;  4I0A A;  2DFI A;  3L7W A;  4MHG A;  5LRS A;  4G94 A;  3OOP A;  2EFP A;  1J75 A;  4OIN F;  4R8H A;  3ML6 A;  3E3V A;  1T38 A;  1TTY A;  4GCV A;  4B09 A;  2OD5 A;  4P96 A;  4XBF A;  2H6B A;  5H6R A;  4KMU X;  3ZPL A;  5JVT A;  1I1S A;  4HV5 A;  2UWM A;  4L9N A;  3IKT A;  3DF8 A;  3H3Z A;  3RYP A;  4DNC A;  1WRJ A;  3V4G A;  2P4W A;  4KDP A;  5FFZ A;  2W24 A;  3C1D A;  2DQL A;  4BHC A;  2FBK A;  5LHH A;  2M87 A;  5K5Q A;  4BH9 A;  1STZ A;  4RS8 A;  2NAZ A;  4HAM A;  5K1Y A;  2FF4 A;  4BAY A;  1O3Q A;  1TNS A;  4BXU A;  4WWC A;  4I2O A;  2FA5 A;  4UVA A;  1O3T A;  2YR2 A;  2TDX A;  1FYK A;  1OYW A;  4Q47 A;  3HOT A;  3REO A;  4M9Z A;  1XGO A;  2GXG A;  3V7R A;  2QQB A;  1FX7 A;  5H20 A;  2XAF A;  4UUV A;  1BI0 A;  2ZKZ A;  4HYE A;  4YFX F;  3CTA A;  3GYH X;  1SMY F;  5IT9 Z;  4I02 A;  4HF0 A;  5DCM B;  1T39 A;  1RUO A;  1FY7 A;  2FRH A;  3QP5 A;  3DEU A;  1V3F A;  3B73 A;  1ZYR F;  2V1X A;  3N4M A;  3L09 A;  3TOA A;  1XMA A;  3BP8 A;  1SD7 A;  4G7O F;  2FU4 A;  2ZO4 A;  3GFJ A;  4DQ2 A;  1TW2 A;  2D2W A;  3BDD A;  2L01 A;  2A69 F;  2HOE A;  5ILS A;  2IA1 A;  3SFZ A;  2A3S A;  2QLZ A;  4WF2 A;  1MKM A;  3QP6 A;  1KU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...