2HFHA

The nmr structures of a winged helix protein: genesis, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
MVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENESIS
publication title Structural changes in the region directly adjacent to the DNA-binding helix highlight a possible mechanism to explain the observed changes in the sequence-specific binding of winged helix proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hnf-3 homologues
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1998-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hfhA00
3EYYA 2WV0A 3FMRA 2Z3YA 1T2KA 1G6NA 3R0JA 4FX4A 3S2WA 1DP7P 4LFUA 1I5ZA 2Z9OA 1ZRFA 2DPDA 3DEUA 4NQWA 2K4JA 3T1BA 3WTUC 3HRTA 2L01A 2A69F 5D8LB 1SD4A 2CW0F 2RN7A 1IZ1A 1OYIA 1ZREA 1ZG3A 3VFZA 4JK1X 2KJBA 2LNBA 1O3QA 2HQNA 3M7GA 3QU3A 4M73A 1E17A 4WXHA 5ED4A 1G4DA 3GFJA 3HSFA 2D45A 3T8RA 2DTRA 2QENA 2XAHA 1RI7A 5DD4A 4EM0B 3BJOA 1U3EM 3MEXA 1WQ2A 2OA4A 5E17F 3LWFA 2ZJ2A 5HLHA 4O6JA 2OZ6A 3KP5A 4G7OF 2LSOA 3V8LA 4RGXA 4A0YA 4HX7A 1ON2A 3KP6A 2M30A 3F6VA 4KNYA 5KVRA 3QPTA 5E20A 1S7AA 2P7CB 3N97A 1BC7C 3CUOA 3WGIA 1KYWA 3KP2A 3GZ5A 3RKYA 2XAQA 3M8EA 4XSXF 2CO5A 2HZTA 3U1DA 4OIRF 3SZTA 3E6CC 5F64A 3KZYA 5D4RA 3BPVA 4A5NA 1L3LA 2GA2A 5D5WB 4PDKA 1R1UA 1UHWA 1C0WA 4BHBA 1LB2A 1D8JA 3FZVA 2Y48A 3DXJF 2FE3A 2W24A 2VE9A 5D6FA 4L5IA 2NS0A 4ENMA 1K78B 1EH8A 3LAJA 2IT0A 1BM9A 5LEKA 1U5TA 4A12A 1EH7A 3F22A 2ZKZA 1XN7A 2YX4A 1W7PB 2Y75A 2Y0MA 2L3DA 2VBWA 1IXSB 3TDUC 1FYLA 1PP8F 3WE3A 1R5GA 4FHTA 2MLGA 5HLGA 4CICA 3QRFF 2E7WA 3IKVA 3F23A 4RB0A 2YSRA 4ESFA 4XBFA 5BQTA 3F72A 4LG0A 2HYFA 2QQBA 4A6DA 3P9CA 3BPXA 2FBHA 3LQRA 1FSEA 4U0WA 2ELHA 2HQRA 5H6RA 4EQQA 3IWZA 3ZN0A 3V4GA 4YIFA 2JRTA 1HBXG 4EJVA 1CGPA 1SD7A 2QVOA 4RGRA 2W84A 4HQEA 5L3BA 4B8XA 2RDPA 4DNCA 3BY6A 3FHZA 5KK1A 5J8CA 4KIFA 2DQRA 2HTSA 1HSJA 4YG2F 2V6CA 4O3MA 2ADUA 2RVCA 2LF7A 3CDHA 3V7RA 2F5DA 1V4RA 2EFQA 3E6BA 3RDIA 1HW2A 1I1GA 2FEZA 1SAXA 3ECOA 3O6BB 5HDKA 5E1ZB 2BE5F 1RUNA 2RNJA 4I98B 3MCZA 2AS5F 1OKRA 4XLNF 5HS9A 4IPAA 6PAXA 2L4AA 1XDSA 1REPC 5FD5A 5E8GA 2HTJA 2HR3A 3T8TA 3HHGA 3R60A 3GFIA 4YFNF 3HTUA 2E1CA 5LGTA 4ZZLA 5DDGA 3JAMK 1TQMA 4G6QA 1MJ9A 4UVAA 5JFRA 1O3RA 1B9NA 3OOPA 1OMIA 2JPBA 3GW2A 3Q9SA 5DD8A 3GFLA 2GXBA 4H0EA 3R6SA 4KN4X 5D5UB 1FP2A 5J6XA 5D6EA 2VODA 3VODA 1USSA 2QWWA 2HDCA 3GFMA 3FM5A 3TO6A 3O3KA 5DCMA 5LGUA 1MZBA 2P5VA 4BNCA 4MTDA 2CQKA 2IA2A 3CO7C 1TQPA 4GCVA 2O61A 2PI0A 2J5PA 3KE2A 3D0SA 5DYMA 2HGCA 2XVCA 2E1NA 1ZARA 2F5EA 2XUBA 2PEXA 4EJUA 4IF4A 4EJTA 3V8KA 1ZRDA 3J80K 4BYYA 1XCVA 1XGMA 1LQ1A 3WTZA 1XGOA 1F1ZA 1YO5C 4N9HA 1D8KA 1R1VA 3HIFA 4S05A 2GWRA 3C18A 5F1RA 1J75A 5BOXA 3BDDA 5DUKA 2OD5A 3WTTC 1IW7F 2OAZA 1G3YA 1H9TA 1U6GA 5J8FA 4ZZDA 2WC2A 3WTWC 5LHGA 1T39A 1K78A 4IJAA 3REOA 3TOBA 3RYPA 2K7LA 3TO7A 4ENKA 3KLOA 1V3FA 4ESBA 4HW0A 2ZO4A 1KU2A 4CO8A 2V1UA 3JSPA 5CVUA 1FNNA 4I2OA 2E7XA 3ROUA 4I0AA 2DO7A 3K9TA 2CYYA 5DUIA 5DEQA 2STTA 1K7AA 4R1HA 4WXCA 1Z05A 4HX4A 3ECHA 2ISZA 1WKMA 2X4HA 1GXPA 1MKMA 4EV0A 4RGUA 2FMYA 1U2WA 4Y17A 3IC7A 1YW8A 2Q2EA 2H94A 4DQ2A 1BN5A 2MA3A 2R3SA 4RGSA 3PQJA 4EJWA 4HBLA 4N0BA 2RKHA 2BV6A 1T6SA 2EFPA 2PMUA 1YQAA 3BJAA 5K5QA 1UFMA 2IVMA 3O2PE 1L0OC 4PGGA 1HKTA 3ZP5A 1WWXA 4L0YB 2LF8A 1MD0A 4WCGA 2V1DA 4P55A 2CWEA 4A2UA 4WXDA 2A3SA 1QQIA 2WWYA 4Y15A 4HX8A 3HOTA 2QQ9A 3H3ZA 2P8TA 3DF8A 4JQFA 3E5UA 2ZMEA 1P92A 2B0LA 5LEJA 3G3ZA 2L54A 3BJ6A 1IN7A 2UXXA 1QO0D 1P6RA 4OU0A 1SMTA 1XB4A 3GZ6A 3B02A 2TDXA 3HRUA 4L9NA 2XGXA 3QP6A 2ACJA 2KIUA 3F6OA 1XMKA 2QZ8A 3RTRA 2RQPA 1HXDA 3FX3A 3ERED 3KETA 3I54A 5LRSA 1P4XA 4HZFA 3IRRA 1QZZA 3DFGA 3RKWA 3J81K 1QBJA 4HDUA 3BOQA 4A6EA 1RUOA 1R36A 3GVAA 5D4SA 1Z9CA 4KYWA 1Z91A 3WG9A 3SFZA 5DCMB 5L3EA 1STZA 4UVBA 3HRSA 3RI4A 3E3VA 1NHAA 1E2XA 5BPDA 1HKSA 3DQVC 4RAZA 3KP4A 1AOYA 2FNAA 4L5JA 1D3YA 1X3UA 4ETSA 4HYEA 3MZYA 1EH6A 3WGHA 4B09A 5DV5A 5AIQA 2IW5A 1F4KA 5FLXK 4HQMA 1SMYF 4U0VA 4FX0A 4Q4ZF 1KQ9A 2FRHA 3COAC 1FSHA 1S8NA 3ML6A 4OIQF 2L4MA 2QM3A 1J9IA 4EGZA 2NYXA 4CDGA 1IXCA 1IN8A 1S6LA 5BMZA 1YW7A 3HRMA 2MLKA 1ZYRF 1U78A 1P4WA 2LKPA 4Q48A 2FF4A 1FT9A 1J7KA 4G6DA 3LA2A 2HKOA 4AIKA 2STWA 1TTYA 2ZNYA 1JHHA 1UB9A 4RAYA 4G94A 1KGSA 3JAMZ 3K2ZA 4RB1A 4G9YA 1FBSA 2P5KA 2IA0A 4UVCA 2O8XA 4I09A 4LLGF 1IN6A 1O7FA 4XSZF 1B9MA 3LFKA 5FGMA 5CVJA 3MQ0A 4P9UA 1B1BA 1IF1A 4UUVA 3TO9A 5CVIA 2BBYA 1ONVA 2VC1A 1R1TA 3PFIA 2PFBA 4A0XA 3GLXA 1ZGAA 4QWQA 3C3WA 2H6CA 3BZ6A 5FFZA 3VEPA 2BYVE 1YG2A 4KICA 3F8CA 4IHTA 3EUHA 2QQAA 5CLSA 3TKYA 3F8NA 4G8XA 1R00A 1FBQA 1FLIA 3B73A 4LK1F 3ABTA 1ZGJA 1ULYA 3R61A 1CF7B 2EFWA 2VT2A 4U7BA 2IP2A 1Y0UA 4O5VA 3HSEA 2Q8KA 1LDDA 1IN4A 2UWMA 4KIBA 3J80Z 2W85A 4YFKF 1RNLA 3F8FA 2IRFG 4GYIA 2RV8A 5A2QK 1JGSA 4OMYA 1Z6RA 1U5TC 2EFOA 1J5YA 3WODF 3V7CA 1SFEA 1J59A 4LK0F 1YIOA 4CZZA 2QLZA 2VC0A 2ZMEB 4MHGA 1WSUA 1XGSA 2DK5A 1JE8A 3QP5A 5HOOA 3CUQA 2XRNA 1KU3A 3EDPA 1G3TA 3LQQA 4AIHA 1JHFA 1BIBA 2VBYA 5DCFA 1OYYA 5LBQA 3P9IA 4AVPA 1F5TA 1FBUA 2XV4S 4M6XA 2YU3A 4HLYA 1LJ9A 2DT5A 4ASNA 5K1YA 4G7ZF 3MZHA 3WTSC 2EA4A 4U88A 1P4AA 3HYIA 2XKPA 1USTA 2MC3A 2X0LA 3IHUA 3KFWX 2P4WA 1YLFA 1ODDA 2EB7A 2AXLA 4FT8A 3TOAA 4PGHA 3WTYC 2QBYB 5EEHA 2VT3A 1W5SA 3F3XA 3LA7A 2COMA 4HLXA 2H27A 1BIAA 1YTYA 2A5YB 1YYVA 1TW3A 2F5CA 5ILVA 1O7LA 3I5UA 3ZPLA 1HW1A 2EV6A 4ZYEA 3ZMSA 1U8RA 4QLCU 4LLNA 3KLNA 4GYGA 3K69A 2PMHA 3FXRA 3GXOA 2A6HF 3R4KA 4MEYF 2G9WA 4KUMA 5H6QA 2IPQX 4IHSA 1DPUA 3CO6C 2NAZA 3M1EA 3WGGA 3RJPA 2EV0A 3LAPA 1DPRA 2ISYA 2OQGA 1P2FA 4M72A 1QNTA 2DPUA 3E5QA 1MDMB 5E18F 1RZ4A 1FWZA 1T98A 3IKTA 2FXAA 3N4MA 1EV7A 5BS6A 1LDKB 2Z99A 3PQKA 1HSTA 1XSXA 3BP8A 2P6SA 5HLIA 3RYRA 2EWNA 2KJCA 1KU9A 4HF2A 4D0PA 1TW2A 5CJ9A 5JI6A 3GO5A 2VOPA 4Q47A 1XDUA 2JTVA 1BOAA 3V7SA 4G7HF 1Q1HA 3EQLF 2Z5UA 4CGZA 1XMAA 2ESNA 5LHIA 5ICGA 2HKXA 4Y13A 1FC3A 1D5VA 3J81Z 3T0YA 3WTVC 4KT5C 2BEOA 2D1VA 4OOIA 4WX9A 5IT9Z 3BWGA 4M74A 2VBXA 5TJJA 2Z33A 4A5MA 1H0MA 3W6KB 1B6AA 4ZYDA 4R79A 5CVVA 2JSCA 2PQ8A 3I59A 3ZMZA 2DI3A 1HKQA 1FZPB 3C1DA 3MAJA 2NNYA 2P6TA 1G3WA 4A0ZA 3F21A 3BROA 3IL2A 1T38A 1WI9A 1S3JA 5F6FA 5HDNA 4BAYA 3L9FA 3F8MA 4RB3C 4GGGA 1FPQA 4ON0A 3RPQA 2DBBA 5FLXZ 2DLLA 2QYOA 1HW5A 1TNSA 3KZZA 1VTNC 2CGPA 1Z7UA 4MQVA 3TDZC 3FWEA 1KU7A 1FYKA 5L3FA 4KMUX 1ZLJA 2V1XA 1BI2A 1CF7A 4HF0A 2MD5A 4L9VA 1W7PD 3SQNA 1GXQA 1K6OA 4AWXB 3CTAA 2V79A 2M1BA 1SFUA 4KFCA 4I02A 3OV8A 3CUQB 5LHHA 2O03A 1OYWA 2VOOA 2UZKA 5E1WA 3ZMUA 4K2EA 3LSTA 4LJZF 2NNNA 5HS8A 3I4PA 1FY7A 4EMSA 1KQ0A 1IAWA 3I53A 3VOEA 1G3SA 4KDPA 3JW4A 4P9FA 4E70A 1J0RA 1BC8C 2M87A 2Q0OA 1LEBA 3QPHA 1FYMA 4LB6B 2XROA 4R8HA 2HFHA 4I01A 2NRAC 1LDJA 2H6BA 5E8IA 4NHJA 2M5WA 1PUEE 5HS7A 1YS6A 2FBKA 1IRGA 2M8EA 3P9KA 5FB2A 3WU1B 2DAOA 1BI0A 3NEUA 5ILUA 4YIIA 2JZYA 3ZMVA 2XASA 3FF5A 1J2XA 1UHMA 2MBFA 4L18B 1IN5A 1QZYA 1IXRC 1ZG5A 3F8BA 4BHPA 3M8FA 2QBYA 4XLPF 3E97A 3L7WA 3L00A 5IT9K 3TQNA 2IA1A 3SXYA 4AD9A 5IT3A 2CSOA 3GUDA 4U0YA 4OIPF 2PJPA 2GA1A 5A2QZ 1R5HA 1XSVA 3QOPA 3W6JB 1YFHA 2EA2A 5JR3A 5K5RA 4M71A 3EYIA 5AONA 1DUXC 2EK5A 2L02A 2O3FA 4OMZA 2GXGA 4ENJA 1MGTA 1ZRCA 1F9NA 4PCQA 1BBYA 2UXNA 2P5LC 2VONA 3E5XA 1BJAA 1A04A 4BH9A 1I6XA 2ZXJA 1TBXA 1S7OA 2WTEA 1MDMA 1IRFA 4L9TA 2M45A 1OPCA 4ZYHA 5AIPA 2GIVA 4IXAA 2A68F 2OZUA 4P96A 2W25A 4UV9A 1IUYA 3K1MA 3FMSA 1OR7A 2ZCWA 2VXZA 5L3DA 4RB2C 1XSDA 4L0ZB 1PDNC 1R58A 3DPLC 3SZPA 2EJRA 3L09A 2KIMA 2XAFA 4GXOA 2CFXA 3V8JA 1R7JA 4UNOA 1GHCA 2XIGA 3I59B 4KIGA 4L9JA 4IRGA 4MNUA 2C6YA 4WF2A 2FOKA 4M9SA 1R23A 4UHTA 4CXFA 3E6MA 1LEAA 3K1NA 1ZHFA 1ZN2A 4EJOA 5LRRA 1I27A 5EEGA 3ZQ7A 3IRQA 2FU4A 3CJNA 1I1SA 3GX4X 4EVIA 4LD5A 3MFKA 1O3TA 4ZYGA 3ZMDA 4HF1A 4M6YA 5ERIA 1B59A 5ICEA 3LA3A 2W57A 4HAMA 3DKWA 4I7HA 3JTHA 2DFIA 4IRHA 2RC4A 1YW9A 2XKOA 2HWVA 3DPTA 5D5VB 2K02A 1JXSA 2FQ3A 4EM1A 4YFXF 1QPMA 3H3UA 4HOBA 1Z1DA 4RS8A 2R7DA 2FNPA 2K27A 1KQ8A 1MJBA 3DV8A 4LMYA 4CYDA 3D5LA 3VB2A 2OU2A 4OIOF 5TRDA 1FX7A 5CYVA 3WU0A 2ZNZA 2K4BA 2BGCA 4KN7X 3RKXA 2EFNA 4WWCA 3CLOA 2KKOA 2JPCA 1ZAOA 1KA8A 4BQAA 2A6EF 5L3CA 4IRIA 2GZWA 2P7VB 2ZBKA 1KYZA 4LB5A 3HHHA 2ZFWA 3AAFA 4EM2A 4UXNA 2V9VA 4UV8A 3FM3A 1H9GA 2PG4A 3QU6A 2VN2A 2F2EA 3KEOA 3ABUA 3GYHX 4Z2YA 3C7JA 3EETA 5D5XB 2EV5A 2A61A 3SHFA 1O57A 2J5OA 2FSWA 1K79A 2HS5A 3I0TA 3CUQC 3K1PA 4M9ZA 5BPIA 5E1XA 3Q5FA 1XD7A 2A07F 3HOSA 4HV6A 2R7FA 1FP1D 5ILSA 4PZJA 1TNTA 3ISPA 5FO5A 2YPRA 2LDUA 3RPUA 4NB5A 4HA8A 2G7UA 4KMFA 4LLLA 3ULQB 3GWZA 4OINF 3KEQA 1O3SA 4ESJA 3FXQA 1DDNA 3E6DA 4XRFA 3WE2A 2GAUA 4LGWA 1W4MA 5K5OA 5H20A 2YX7A 5CVRA 3NQOA 3H92A 1QGPA 1WRJA 4MGRA 2O6GE 3G73A 3JTGA 1YS7A 5LGNA 3L2CA 3K0LA 3GF2A 4BXUA 5JHUA 5ICCA 5FD6A 4TV7A 4WK8F 4JBAA 4F7ZA 3WTXC 3KP7A 4M9XA 2OBPA 1MJAA 1LNWA 2FBIA 5JVTA 2PN6A 2PLYA 2D1HA 1U5TB 3U9GA 1Z6TA 3NRVA 2RGVA 3KCCA 1RIOH 3R0AA 4GO1A 4MTEA 2VE8A 2MH2A 2F5FA 3Q9VA 2KIFA 1S29A 2XAGA 2G7HA 2KRFA 1FOKA 3ZMTA 1BI1A 3FMQA 3DP7A 3JSOA 4CHUA 4IVNA 3TGNA 2K86A 2QUFA 5D8KB 2OQRA 1SFXA 5HDGA 1ZG1A 1W7PA 4LG0B 2DK8A 3T5XA 3P7NA 3I58A 2FA5A 4P5OA 1TLHB 1ON1A 3I64A 2DW4A 2YR2A 1AWCA 1GVJA 5L3GA 1T0FA 5ICFA 2XAJA 1B4AA 3MWMA 1R22A 4N9IA 3I71A 5LLQA 4HDVA 4KA4A 2HEOA 2CG4A 1XCBA 2H09A 4Q5SF 2XHKA 1PP7U 3U2RA 2DQLA 2FMLA 5FFXA 1XGNA 5HVQC 4EGYA 2HOEA 3IWFA 1SD5A 2MH9A 3M9AA 4I0BA 2PBIA 2HYGD 1ZH5A 2O0YA 3RIRA 3ELKA 2ETHA 4MQ9F 3J7AO 2IJLA 1BI3A 2DU9A 4ZH4F 1UCRA 4S04A 4ENNA 3KP3A 3HTSB 1SD6A 2JT1A 2D2WA 1TQIA 4MEXF 3ZN1A 4U7DA 4BHCA 3QAHA 4HV5A 3FXUA 4AIJA 3GEZA 1ZLKA 1HQCA 1LVAA 2ESHA 3HSRA 3HUGA 2GQQA 2VBZA 1W5TA
chains in the Genus database with same CATH superfamily
2E1OA 3E0JB 4RM2A 1FJLA 3EYYA 2WV0A 4AIDA 3FMRA 5JLXA 1Y1WJ 2Z3YA 1T2KA 1G6NA 3R0JA 3JRHA 4FX4A 3S2WA 1DP7P 4LFUA 2K9NA 4PJLA 1JKOC 1I5ZA 4G12A 4XRSG 2H8RA 1DGRM 1MNMC 2Z9OA 2V1NA 2ZXIA 1ZRFA 3SYTA 2DPDA 3DEUA 4NQWA 2K4JA 2L7KA 3T1BA 3I9V2 2NXNB 4Y4RA 3WTUC 3HRTA 2L01A 2A69F 5D8LB 1SD4A 5EGOA 2CW0F 2RN7A 1IZ1A 1OYIA 2LK2A 2GLOA 1ZREA 1ZG3A 3VFZA 4JK1X 2KJBA 2BY1A 3DBRB 1K4TA 2LNBA 1O3QA 2HQNA 3M7GA 3QU3A 4M73A 1E17A 4CUGA 4WXHA 4C9YA 1KZHA 5ED4A 2EIJH 3LMMA 1G4DA 3CCJI 3GFJA 3M4OJ 3HSFA 4II3A 2LREA 2D45A 3T8RA 2DTRA 3KEYA 2E1MC 2QENA 4IHYA 2XAHA 1RI7A 5DD4A 3H35A 1JT6A 4IHXA 4EM0B 3BJOA 3QOEA 1U3EM 4AC0A 3MEXA 2MABA 4E7JA 3C2GA 1WQ2A 2OA4A 5E17F 3LWFA 2ZJ2A 5HLHA 3S8PA 4O6JA 2OZ6A 3B6AA 3DKYA 3KP5A 1IGNA 3OYAA 2LSOA 2XB5A 1SFOJ 4G7OF 3V8LA 3A0BC 4RGXA 4A0YA 3RKQA 4NNJA 2AXTC 2Y0SA 4HX7A 4XLEA 2FQ4A 1ON2A 2P81A 1F36A 4XKCA 1MSEC 3PIPF 3KP6A 2M30A 3F6VA 1PUFA 2GXAA 1UAAA 2LKSA 4KNYA 2E5ZA 4OWRB 4UUSA 5KVRA 3QPTA 5E20A 1S7AA 2P7CB 3N97A 4XONA 1BC7C 2IGMA 3CUOA 3OYFA 3WGIA 3OYLA 1JUPA 2CV1A 1KYWA 2CQXA 3KP2A 2L7MP 3GZ5A 1IRXA 3D1NI 2KZGA 3RKYA 1YJWI 2XAQA 3LSPA 4MFDA 3M8EA 4EEFG 2MYSA 4XSXF 2CO5A 2HZTA 3U1DA 4OIRF 5C3EJ 3QODA 1V5FA 3SZTA 2MW8A 3E6CC 5F64A 3KZYA 5D4RA 3BPVA 2EIMH 4A5NA 3CZ6A 2GOMA 3RSNA 1YI2I 1L3LA 2GA2A 3NWSA 5D5WB 4PDKA 3UNGC 3ZGKA 3H1CA 1ITYA 2CW7A 1R1UA 1UHWA 1C0WA 4BHBA 1LB2A 2WAFA 4JX6A 5C4XJ 2M0MA 1D8JA 2CV0A 3FZVA 2K3FA 2KZVA 2L2OA 4E7ZA 2Y48A 2JQ7A 4XLHA 5LD2C 3DXJF 2FE3A 2W24A 3CCUI 2R7RA 3TMOA 1AKHB 4AVZA 1FTZA 2VE9A 2HOTA 5D6FA 1R6RA 5E3OA 4L5IA 2NS0A 4ENMA 1OJLA 1K78B 4F92B 3MMYB 1IUFA 1EH8A 3LAJA 3DU5A 2EBIA 2IT0A 3HOUJ 2ZSIB 1BM9A 1KONA 5LEKA 1U5TA 4A12A 1EH7A 1FMWA 3F22A 3K4KA 2ZKZA 3N05A 1XN7A 2YX4A 3OS0A 1W7PB 3ESWB 4B4CA 2Y75A 3AKZA 1W36C 1JKPC 2Y0MA 2L3DA 2KHMA 4V2GA 3J7AY 2Z2SB 3GCMA 4NC7A 2VBWA 4ZYAA 2OC6A 3ZCOA 3CCQI 1IXSB 3TDUC 5IP9J 4PJ0C 1PP8F 1FYLA 3WE3A 3HOWJ 2BHZA 4A3KJ 1R5GA 1TT5B 4FHTA 3LOCA 5EEAA 2MLGA 5HLGA 4CICA 3QRFF 2E7WA 3HOYJ 3IKVA 1WHUA 2KRCA 3BCBA 1OR7C 2O7OA 1VQNI 2EINH 4J00A 3F23A 4RB0A 1AHDP 4G6TB 3ZQCA 2R7ZJ 2YSRA 2EPFA 5F27A 4ESFA 4RLFA 2JK3A 5GAHJ 3EUKL 4XBFA 3PIOF 3OSFA 5BQTA 3F72A 3FDYA 4LG0A 2HYFA 1POGA 2QQBA 4A3GJ 1JTYA 2VPRA 3P9CA 3BPXA 4A6DA 2CQQA 5FKMA 2QSGX 2FBHA 3LQRA 2BOLA 1MSFC 3DTIA 2LY2A 1FSEA 4U0WA 2LBFB 2X1DA 2ELHA 3KIOA 2HQRA 1W0UA 5H6RA 4EQQA 3RQ4A 3IWZA 1MMDA 3CMAI 3CQZJ 3ZN0A 2LD5A 2YU9J 2E60A 2EZKA 3H0GJ 3V4GA 5E79C 4YIFA 2JRTA 1HBXG 4EJVA 2NVXJ 3LNQA 3S3OA 1CGPA 3WG7H 1SD7A 2DA7A 2QVOA 3K2AA 4MIMA 4RGRA 2W84A 4HQEA 5EJCA 2M2EA 1BOBA 4CYCA 5L3BA 4B8XA 3K4MA 1SAUA 2RDPA 5K7ZA 2LP0A 3C2BA 5IYBJ 4DNCA 3UKGA 3BY6A 1AA7A 5KK1A 1U0JA 5J8CA 3FHZA 4KIFA 2DQRA 2BY0A 2EZLA 4CCOA 3B6CA 3K70C 4E7LA 3V42A 1B72B 2HTSA 3CP2A 1HSJA 3HGGA 2V9KA 3IH4A 4YG2F 3L2RA 1WH5A 2V6CA 2ZJPF 1VQ6I 2BW3A 4O3MA 2ADUA 2V4JC 3VDXA 2RVCA 2LF7A 2XPUA 2BVLA 3CDHA 2LKXA 3V7RA 2F5DA 1V4RA 2MSYA 4A3LJ 2EFQA 4D1QA 3QQAA 3CJTB 3E6BA 2PJRA 2WADA 2JJ7A 3RDIA 2PX9A 1QHHD 4IX7A 2HVQA 2K9QA 1HW2A 4RAGA 1I1GA 2FEZA 1SAXA 3ECOA 4DZPA 2R5YA 3O6BB 2H1LA 2DA5A 1JJ8C 5HDKA 5E1ZB 2BE5F 4BY7J 1RUNA 2RNJA 2DA6A 4I98B 3MCZA 2B9SA 4BXFA 2AS5F 1OKRA 3X2QH 4XLNF 2FX0A 4FCYA 3M1CA 5HS9A 4IPAA 3JRBA 6PAXA 4ZJZA 5M5YJ 2JA7J 2L4AA 1XDSA 1BA5A 5KHDA 4C2MJ 1REPC 2M34A 5E8GA 5FD5A 3OS1A 3AG3H 4RDUA 2HTJA 3ZQLA 3FXMA 2HR3A 5KNLA 3T8TA 3HHGA 1MBKA 3R60A 1T56A 3GFIA 1IG7A 3DWLE 2TCTA 4YFNF 1MH3A 3HTUA 4D7NA 2E1CA 4B43A 2B7EA 5LGTA 4ZZLA 4CCKA 4M3GA 5DDGA 2NOGA 3JAMK 1TQMA 1X1DA 2R7VA 4G6QA 1MJ9A 4UVAA 5JFRA 2W7NA 1O3RA 2OF7A 1B9NA 1UG2A 4I6ZA 2M3AA 1WJEA 2E34A 3OOPA 1OMIA 3QYBA 3OYHA 4M3EA 4CCLA 2W48A 2JPBA 1Z7LA 1OQYA 3GW2A 3Q9SA 5DD8A 3GFLA 4HNTA 2WAEA 3MKWB 2GXBA 4H0EA 2R7QA 3R6SA 5JLWA 4KN4X 5D5UB 1FP2A 1GUUA 3HKZN 5J6XA 5D6EA 1DU0A 2VODA 3VODA 1USSA 3BZKA 2LYCA 2QWWA 2OJED 1PUFB 2HDCA 3GFMA 3FM5A 3TO6A 3O3KA 5DCMA 4B47A 4UUSB 3HPGA 5LGUA 1MZBA 2P5VA 1SC7A 3CCRI 1CQTA 3CESA 2Z16A 4BNCA 3WU2C 4MTDA 2CQKA 1W1WE 2IA2A 3CO7C 5HLTA 2DT7B 1NG7A 1GV5A 2H8WA 1TQPA 4GCVA 1X58A 2O61A 2PI0A 2J5PA 3MN2A 3KE2A 4LOCA 2VLAA 1SEUA 1QVUA 3D0SA 1MNEA 5DYMA 1TWHJ 2HGCA 2XVCA 2E1NA 4C30A 1ZARA 2F5EA 3FKIJ 1RRJA 2DFFA 2VQHA 2XUBA 1MBJA 2PEXA 1VQ7I 4EJUA 4A3JJ 1WJ5A 4IF4A 3RPUD 4EJTA 3V8KA 1D0YA 2L9RA 4XMYA 1ZRDA 3J80K 4BYYA 1XCVA 3A01A 1OISA 1I3QJ 2GIZA 1T08B 1XGMA 1LQ1A 5B5EC 3WTZA 4HNVA 1XGOA 1F1ZA 2L5QA 1YO5C 2IXSA 4N9HA 3G1MA 5IYDJ 3M8JA 1D8KA 2X1CA 2JWTA 2A6TA 1R1VA 3E1SA 3HIFA 2QGUA 1QZEA 1SVOA 4S05A 5EDNA 2GWRA 3S1RJ 4DIQA 3C18A 3CMYA 4BEHA 3CMEI 3BR2A 2JSPA 2DMNA 5J4YA 5F1RA 2VJIA 4HSRA 1J75A 2KMUA 1TC3C 4QIWN 5BOXA 1I39A 3BDDA 3JREA 1IRZA 5DUKA 3S2DJ 2OD5A 2KP6A 1K4SA 1G2HA 3WTTC 1IW7F 2OAZA 1G3YA 1H9TA 3FK6A 1U6GA 3PO3J 2XSJC 4B3XA 5J8FA 1ZQ3P 4ZZDA 2WC2A 3VYRB 5LHGA 3WTWC 1Y56A 1T39A 3A4CA 1K78A 4HG2A 3AL0C 4IJAA 2VKHA 3REOA 3OYEA 5B3SH 3NARA 3TOBA 3K4BA 3RYPA 2K7LA 1P7IA 3TO7A 4ENKA 1M1EB 5LFAA 1MMGA 4PUSA 3KLOA 1V3FA 4ESBA 4HW0A 2ZO4A 1KU2A 3PNVA 2A05A 4XNFA 4CO8A 4MFEA 1WZ2A 1IDYA 2V1UA 4EATA 3JSPA 5CVUA 1FNNA 2AO9A 1N75A 4I2OA 1FEXA 1MMSA 2E7XA 1WI3A 5JHFA 3ROUA 4PFOA 2L7ZA 2DO7A 3QPLA 3K9TA 4I0AA 2CYYA 3TP3A 5DEQA 5DUIA 3OYMA 3OYIA 2LRDA 4AM3A 3L1PA 2STTA 4F55A 1K7AA 4XK4A 1G59A 4F91B 4R1HA 4WXCA 1Y8RB 1Z05A 4HX4A 3ECHA 3S14J 2ISZA 2JA2A 1TWAJ 1WKMA 2X4HA 1GXPA 1TWGJ 1MKMA 3HXLA 4EV0A 4RGUA 2QKLB 2FMYA 1U2WA 4Y17A 3FBIB 3G1OA 3IC7A 1YX5A 1YW8A 5J4VA 2EZHA 4CYCB 2Q2EA 2H94A 4DQ2A 1BN5A 2MA3A 2R3SA 2ID6A 2Y30A 3CJRB 4RGSA 3PQJA 4EJWA 5FRMA 4HBLA 4XLAA 4N0BA 2RKHA 1N77A 2BV6A 1T6SA 3CF5F 2EFPA 2PMUA 4DBQA 2L9NA 3QPSA 4LIVA 1YQAA 4J01A 3HKZA 3BJAA 5K5QA 1UFMA 3HB9A 2IVMA 4IZZA 3O2PE 1L0OC 4PGGA 4X1EA 1HKTA 2BW3B 1UJ8A 2VXDA 4BS9A 2ZJRF 1WWXA 3ZP5A 3JCUC 4L0YB 1S7EA 2LF8A 5EF6A 3LSKA 1YJNI 3MVPA 1MD0A 4M3DA 4WCGA 3FIWA 3RQIA 2V1DA 1Z21A 3GTGJ 4P55A 2CWEA 5KCMA 4A2UA 1U9OA 2LOOA 2HI3A 4WXDA 3TEDA 2A3SA 1QQIA 2WWYA 4Y15A 4HX8A 1FTTA 3HOTA 1BJZA 2R5YB 2E2IJ 2QQ9A 3H3ZA 4H4KC 2DA4A 2P8TA 3DF8A 2DDAA 4JQFA 3E5UA 2ZMEA 1P92A 4DBRA 2B0LA 2CFOA 3FKJA 5LEJA 2G0EA 3G3ZA 2BXYA 2L7FP 2L54A 3KPHA 1HC8A 4E7KA 1NH3A 3BJ6A 3A1YA 1ZTRA 1F43A 2DOFA 1IN7A 2UXXA 1WPKA 1QO0D 1P6RA 3CJQB 1EA3A 2QEXI 4OU0A 1ERDA 1RESA 1SMTA 1XB4A 3GZ6A 3B02A 1T0FC 2TDXA 2X85A 1VQ4I 3L2UA 2F4MB 2WA0A 2JA5J 1QPIA 3HRUA 4L9NA 2R5ZA 3H5RA 4UB6C 2XGXA 3QP6A 2LFBA 2WV1A 1Y1VJ 2KIUA 4BJTA 2KDZA 2ACJA 1MBGA 3F6OA 2V26A 1XMKA 1XMXA 2QZ8A 3RTRA 2RQPA 3W2AA 2ZJQF 1IDZA 1HXDA 2M4KA 3FX3A 5J1YA 1E3OC 1BR4A 3ERED 4ABZA 3KETA 3I54A 5LRSA 1P4XA 4Y7NJ 4HZFA 4DYRA 1XTAA 2M0CA 3IRRA 1QZZA 4F93B 4ANJA 3DFGA 5JVGF 1YOVB 3RKWA 1ETYA 3W2WA 1PYVA 5IY5H 3J81K 1APLC 1QBJA 1WCMJ 3H5AA 3F0CA 4HDUA 2E2HJ 3MKLA 3FBNB 2DTZA 3BOQA 4A6EA 1RUOA 1R36A 3DPUA 3GVAA 3MD2A 5D4SA 1Z9CA 5FKKA 1D0ZA 2N8GA 3BR5A 3LSJA 3SJMA 4KYWA 1Z91A 3WG9A 3SFZA 5DCMB 5L3EA 1STZA 3BR0A 3DBHB 4Y33A 3OR2C 4J19A 5DM7F 4UVBA 1YHQI 3HRSA 3BTLA 3RI4A 3E3VA 3G6EI 4DGWB 5FROA 1NHAA 1WFXA 1E2XA 5BPDA 1HKSA 3LFUA 3DQVC 4RAZA 1MIJA 4LG3A 3KP4A 1UELB 4A3DJ 4D7MA 1AOYA 2FNAA 3OR1C 4L5JA 1D3YA 1X3UA 3S1NJ 3DCFA 4ETSA 2CW8A 3SDBA 4HYEA 1HA8A 3S93A 3MZYA 1EH6A 3WGHA 5GAGJ 4B09A 5DV5A 2K40A 5AIQA 3RCOA 1MMNA 3QYFA 4OAYA 2IW5A 2DOAA 4FETA 1VF9A 2L0KA 4B44A 4HRIA 4C3HJ 1JKQC 1F4KA 5FLXK 3IAM2 2K9SA 5GPAA 2VJJA 4HQMA 1N78A 1SMYF 4U0VA 4FX0A 1ETKA 2XF7A 4Q4ZF 1KQ9A 2FRHA 3A01B 1JGGA 3COAC 1FSHA 2ZFUA 5CKTA 1S8NA 3BG3A 5DM6F 2ME6A 3W3CA 3ML6A 4OIQF 5FKOA 2L4MA 2QM3A 1J9IA 3KYDB 4EGZA 2NYXA 4CDGA 1IXCA 1IN8A 1S6LA 4BE1A 5BMZA 1YW7A 3HRMA 2K9MA 3PM1A 2WB1N 4BACA 2EZIA 2MLKA 4P1WA 2RQQA 1ZYRF 1U78A 3PL8A 2NVTJ 1P4WA 3O8GA 3W6VA 4V2FA 4BEHB 2LKPA 4Q48A 4XLCA 1PJRA 3BC8A 3HM5A 2FF4A 1DGWY 1FT9A 1MMAA 1J7KA 2VI6A 1W36D 4G6DA 2R7TA 3LA2A 2HKOA 2ID3A 4XLFA 4AIKA 2STWA 2ZXHA 1TTYA 2ZNYA 1JHHA 1UB9A 2HQ5A 4RAYA 4G94A 2OPTA 1KGSA 3JAMZ 4IOCF 1EKEA 3LL7A 3K2ZA 4RB1A 4G9YA 2RAEA 1FBSA 2P5KA 2IA0A 4UVCA 2O8XA 4I09A 4LLGF 1QHGA 1IN6A 1O7FA 4XSZF 1Z67A 1B9MA 3LFKA 2UV1A 3CCYA 5FGMA 1IV8A 1W5CC 5CVJA 3MQ0A 1RETA 4BDZA 4P9UA 1B1BA 1IF1A 2K3PA 4DZJA 4PJMA 1VQKI 4UUVA 3TO9A 3HEFA 5CVIA 2BBYA 1ONVA 3GTPJ 1JUMA 2VC1A 4S0HB 1R1TA 3PFIA 2PFBA 2X48A 4A0XA 3HOVJ 3GLXA 4XR6A 1ZGAA 4QWQA 3C3WA 1ORKA 3CD6I 2H6CA 3BZ6A 4YELA 5FFZA 1TL8A 3VEPA 2BYVE 1YG2A 5GP9A 4KICA 3F8CA 1E0EA 4IHTA 1IV6A 2IS2A 2DMTA 3EUHA 2E5NA 2QQAA 3MZ8A 5CLSA 3TKYA 3F8NA 2HYJA 2I5UA 3BG7A 4G8XA 1R00A 1FBQA 4KT6A 1FLIA 1Y8QB 2Q2EB 3B73A 4LK1F 4A69C 3OOUA 2WAQA 2JN6A 3ABTA 1ZGJA 1ULYA 3R61A 3L2WA 1CF7B 3CC4I 5HODA 1T33A 2EFWA 5J40A 3K70D 4F3QA 2VT2A 4CZCA 4U7BA 4RA2A 1DP3A 2IP2A 1VQPI 1Y0UA 4O5VA 3HSEA 2Q8KA 1LDDA 1IN4A 3GTLJ 1WJCA 2W4SA 2UWMA 3LSMA 5J1UA 1LFPA 4KIBA 3J80Z 2W85A 4YFKF 1RNLA 3F8FA 4W97A 2IRFG 4GYIA 2RV8A 3LSIA 2GOXB 5GTHC 1D1AA 5H2FC 5A2QK 1JGSA 4BE2A 1BL0A 2ECBA 4OMYA 5GPCA 3Q0VA 1Z6RA 3S2HJ 2OCCH 1RC9A 1U5TC 4BJ6C 3A02A 2EFOA 1J5YA 1LPQA 3WODF 3V7CA 1SFEA 1J59A 2QKMB 4LK0F 1YIOA 4CZZA 2QLZA 2Y2ZA 1I3AA 1OCRH 2VC0A 2ZMEB 4MHGA 3OYNA 1ACIA 4BKXA 1WSUA 1XGSA 2DK5A 3K7AJ 1JE8A 2DDBA 3QP5A 2VIXA 5HOOA 3CUQA 1LE8B 3RZDJ 2XRNA 1KU3A 4MLOA 3EDPA 2HOAA 2VL8A 1X3WB 1G3TA 3DTKA 3TP0A 3JR9A 2E1MB 4IHWA 3LQQA 4AIHA 1JHFA 3K4NA 3S3MA 1BIBA 4QSHA 3SDGA 1A6QA 2VBYA 5DCFA 2R5ZB 1OYYA 5LBQA 3FK7A 3P9IA 4AVPA 1F5TA 1FBUA 2XV4S 2DA1A 4M6XA 3GTOJ 2YU3A 4HLYA 3CC7I 1LJ9A 2DT5A 3H5NA 3ERMA 4ASNA 4XOTA 1UMQA 5K1YA 1OLTA 2WB1A 4G7ZF 3MZHA 4NC8A 1EF4A 3WTSC 1MNDA 2EA4A 4U88A 4B1RA 1P4AA 1ZR4A 2R92J 2FD5A 3HYIA 1D1CA 2XKPA 1USTA 2MC3A 2X0LA 3IHUA 3KFWX 2NVYJ 1TWFJ 1YLFA 2P4WA 4B3AA 1ODDA 2EB7A 2AXLA 3A2KA 4FT8A 3SEZA 1D5YA 3TOAA 4PGHA 3BTJA 3S17J 4UB8C 1DU6A 3CC2I 5IOZA 4E7IA 3WTYC 5F0FA 2QBYB 4C3JJ 3H3VK 5EEHA 3I4NJ 3DLLF 2DA3A 2VT3A 1W5SA 2HPIA 3TL4X 3FXKA 5FLVA 3F3XA 2F5VA 3LA7A 4BJ5C 2COMA 5IP6A 1MBHA 4HLXA 4FASD 5HNFA 2H27A 1QRYA 3SFIA 1BIAA 1VQ8I 5TGTA 5F0HA 2CUJA 1BR1A 1AU7A 1YTYA 4FISA 4QTRA 4BE0A 2A5YB 1YYVA 1TW3A 2F5CA 2X6YA 4YIRX 4CCJA 5ILVA 1O7LA 3H9GA 4A3MJ 2M4GA 3I5UA 3ZPLA 3J7ZI 1T8IA 1HW1A 1E3PA 2EV6A 4ZYEA 4N4NB 3ZMSA 3I4MJ 1U8RA 4QLCU 4LLNA 3KLNA 4GYGA 3IV5A 1D1BA 3K69A 4KISA 2PMHA 2R7XA 3FXRA 5KAFC 2IS1A 3GXOA 2A6HF 3JRCA 3R4KA 4MEYF 2G9WA 4KUMA 1JJ6C 3M3YJ 4OAZA 5H6QA 2IPQX 4BQOA 4IHSA 2LY1A 1OCZH 1DPUA 3CO6C 1FOXA 2NAZA 3M1EA 3WGGA 3RJPA 2EV0A 3LAPA 1DPRA 2ISYA 1HOMA 2OQGA 1P2FA 4PSWA 4M72A 2VKVA 1QNTA 5F0CA 2DPUA 4RAFA 4KJZA 3E5QA 1MDMB 5E18F 1RZ4A 5F08A 2DA2A 1FWZA 3PJRA 4CH7A 1T98A 3IKTA 2FXAA 3FISA 4RMNA 3N4MA 3HG9A 2BY3A 1EV7A 1EJ9A 5BS6A 1LDKB 2Z99A 3K4LA 3PQKA 1W0TA 3GLLA 1HSTA 1XSXA 5CQGA 3PO2J 3BP8A 2P6SA 4XN0A 3JRIA 5HLIA 1B8IB 3RYRA 2KPMA 2EWNA 5DS9A 2KJCA 1KU9A 2OV7A 4D0PA 4HF2A 4V19K 1TW2A 4BQNA 2ICWG 5CQEA 2LTPA 5CJ9A 1R5ID 3OIQA 1V5GA 3OIOA 5GTIC 5JI6A 4IQ4A 3GO5A 2VOPA 4Q47A 1XDUA 2JTVA 1MBFA 1IC8A 1BOAA 3V7SA 2XPWA 4NC6A 3BT9A 1SANA 3VPRA 4DOZA 3CCSI 4G7HF 1Q1HA 2KDOA 2XSDC 2CS3A 2W1OA 3EQLF 2Z5UA 5B1AH 1GT0C 4CGZA 1XMAA 3QYEA 2ESNA 5LHIA 2LR8A 2XRLA 5ICGA 3ABMH 2BHYA 1I6HJ 1V54H 5EG0A 3DEEA 1Z77A 2HKXA 4Y13A 1FC3A 1LUJB 1D5VA 3CCLI 1FOWA 3J81Z 1MH4A 4CA0A 3T0YA 4D5CA 1HLVA 3WTVC 4KT5C 4BDYA 2BEOA 1A35A 3PFYA 4HPQA 2D1VA 4ZDLA 4OOIA 2CV2A 2DYRH 4WX9A 4XN3A 1YITI 5IT9Z 3HPHA 3BWGA 4M74A 2VBXA 3IH3A 3IP4B 5TJJA 4AU7A 2Z33A 4C2TA 2NVQJ 2VUMJ 4A5MA 1H0MA 2UUZA 3W6KB 1SFKA 1B6AA 4ZYDA 4R79A 5CVVA 2JSCA 2PQ8A 3I59A 3ZMZA 2DI3A 3H9JA 1HKQA 5IP7J 1I50J 2ELKA 1HCRA 1FZPB 2ZB9A 3C1DA 3MAJA 2P6TA 2NNYA 4FTHA 1WJDA 3G1LA 2XDVA 4CSWA 1G3WA 4A0ZA 5IYCJ 4X0GA 3BROA 3F21A 2R7WA 1X4PA 3IL2A 1T38A 2DODA 2F48A 2EH3A 4PK4A 2OUMA 2VQCA 1WI9A 1S3JA 5F6FA 5HDNA 4BAYA 3L9FA 3F8MA 4RB3C 3KZIC 2EQRA 1WJFA 4GGGA 1FPQA 4ON0A 1VQMI 3RPQA 1ETXA 2DBBA 5FLXZ 2DLLA 2QYOA 1HW5A 1TNSA 3KZZA 1VTNC 2CGPA 1Z7UA 4MQVA 2LLKA 3GZNB 4ZTFA 1V55H 3TDZC 3W2VA 5FKNA 4BBRJ 5B66C 3FWEA 3CF2A 1PVEA 1KU7A 2KLOA 3HBLA 1FYKA 4Z6YA 5L3FA 4KMUX 3K6GA 5FLMJ 2AQEA 4ZDOA 1Q1VA 1ZLJA 2V1XA 1BI2A 1ENHA 1CF7A 4HF0A 3ZQIA 2KL4A 1R4MB 3CCVI 1YJ9I 2K9LA 2MD5A 1MBEA 4L9VA 5C44J 1W7PD 2IAIA 3SQNA 1GXQA 1ETWA 1K6OA 4AWXB 3CTAA 2V79A 2M1BA 3EUAA 4XL9A 1SFUA 4KFCA 3OMYA 2IS4A 4I02A 3OV8A 3CUQB 5LHHA 2O03A 1QVTA 1QA6A 1OYWA 3OYJA 2VOOA 2UZKA 1Y39A 5E1WA 3FXJA 2DFHA 3ZMUA 5K7FA 4FQGA 4K2EA 3LSTA 4LJZF 1XS9A 2NNNA 1GV2A 5HS8A 4YRVA 3I4PA 1FY7A 4EMSA 1KQ0A 2HOSA 4L5EA 3I53A 4ZC3A 3QWLA 1IAWA 3VOEA 1G3SA 2E71A 4KDPA 3JW4A 4P9FA 2DYSH 4E70A 4QPQA 1SVLA 1YRNA 1LFBA 1J0RA 1BC8C 2M87A 1X1BA 5BNGA 2Q0OA 1A5JA 1LEBA 3QPHA 2LG4A 1FYMA 2HVRA 4LB6B 2XROA 2BVMA 1X1CA 4CCMA 4R8HA 4B48A 5M3MJ 1LE8A 2GM4A 2H1KA 1OCCH 4FE7A 1FOYA 3BQZA 2HFHA 2QQ8A 4I01A 2F4IA 3MKZA 3HDDA 3BG5A 1FMVA 2QSFX 2NRAC 1LDJA 2H6BA 4HSTA 5E8IA 4NHJA 2R4GA 1JT0A 1XC5A 1BR2A 2M5WA 1PUEE 5HS7A 1YS6A 1OCOH 1X2MA 2X9DA 3SZGA 2FBKA 1IRGA 2M8EA 1NTCA 1NK3P 3P9KA 4D5FA 5FB2A 3WU1B 2DAOA 1BI0A 3NEUA 4MO7A 2Q1ZB 3HOZJ 1JI8A 1X19A 5ILUA 2XB0X 3VWBA 4YIIA 3BCAA 4M3BA 3WHCA 1HF0A 3NWTA 2JZYA 3ZMVA 4GFBA 4NUBA 2XASA 1UZCA 2WAQN 3OY9A 1VI0A 3FF5A 1JTXA 4PJJA 1TZLA 1J2XA 2JRMA 1UHMA 2MBFA 4L18B 1IN5A 1QZYA 1IXRC 3OYBA 1ZG5A 3F8BA 5IPAA 4BHPA 3M8FA 3PSFA 3OYKA 2QBYA 4XLPF 3E97A 3L7WA 3L00A 5IT9K 3TQNA 2IA1A 3SXYA 4AD9A 5IT3A 2CSOA 2F6CA 3U21A 2XGCA 1RKTA 3BG9A 3GUDA 4BBSJ 2IGKA 4U0YA 2OTJI 4OIPF 2PJPA 5TISC 2DMPA 2GA1A 2DMUA 5A2QZ 3ZQFA 2IGOA 1R5HA 4A3IJ 1XSVA 4ZDPA 3QOPA 2ZMEC 3W6JB 5M5XJ 2MC4A 3ZR8X 1YFHA 2EA2A 5JR3A 5K5RA 4M71A 2VB6A 3CLQA 4XKWA 3EYIA 2V7FA 5AONA 4XICA 2HDDA 4PJNA 3OS2A 1GVDA 1DUXC 2A5WA 1UHSA 2EK5A 2L02A 3AG2H 4W1UA 3PSIA 2O3FA 1SVMA 2CRGA 4OMZA 3LSGA 2GXGA 3PUFA 4ENJA 2M9HA 3O8HA 1MGTA 3TBIA 3U1KA 1ZRCA 1F9NA 1RPWA 4PFPA 4YEJA 4PCQA 1WVRA 5J3LA 1LKXA 1BBYA 2E2JJ 2UXNA 2L9VA 2P5LC 1A36A 2VONA 1WJAA 3E5XA 1BJAA 4CCNA 3OYCA 1A04A 3AL0B 4FE4A 4BUPA 2KIQA 4BH9A 5HNHA 4ZTJA 1OCTC 1I6XA 3JRGA 3ZQGA 3I3LA 4M6VA 1S5LC 1Z3YA 2COBA 1JUSA 2ZXJA 1TBXA 1R49A 5E3LA 3GTKJ 1S7OA 2DCEA 2DMQA 2WTEA 3HOXJ 3TW6A 1MDMA 2BY2A 1IRFA 4L9TA 1X1AA 2M45A 1OPCA 3BG6A 1E3HA 3A03A 4BQQA 4ZYHA 5AIPA 1A6IA 2X51A 2GIVA 4Y3OA 4IXAA 4DJAA 4AUXA 1ZK8A 5EG0B 2A68F 5C4JJ 1BW6A 1MW7A 2OZUA 1B8IA 4P96A 2W25A 1K6YA 4UV9A 1IUYA 2CQNA 4XOPA 2QCOA 3K1MA 3FMSA 1OR7A 1J09A 9ANTA 2OCEA 1X2NA 3ASOH 2ZCWA 2VXZA 5L3DA 4RB2C 4A3FJ 1XSDA 4L0ZB 3AG4H 1PDNC 1R58A 3DPLC 3SZPA 2EJRA 3L09A 2KIMA 4E7SA 2ZXWH 3A0HC 2XAFA 3DEWA 2PMZN 4GXOA 2CFXA 1H89C 3V8JA 1R7JA 4UNOA 1GHCA 4NDLA 2XIGA 3I59B 4KIGA 4L9JA 1BW5A 4IRGA 3ONQA 3IUOA 3BQYA 4MNUA 1OCPA 5J47A 2C6YA 4WF2A 4XIDA 2R7SA 2FOKA 4M9SA 1R23A 4UHTA 4CXFA 2AHQA 2Y31A 3S16J 1LEAA 3E6MA 3K1NA 4DYQA 4II2A 1ZELA 1ZHFA 1ZN2A 4RLQA 4EJOA 4A3BJ 5LRRA 1I27A 2ZC2A 1RR8C 5EEGA 4JYKA 1GDTA 1HDDC 5E3MA 3OYGA 3JRFA 5GAEJ 3ZQ7A 3OL4A 1Y6IA 1ZR2A 3IRQA 2FU4A 3CJNA 3K4JA 1I1SA 4RBOA 3GX4X 3BTCA 4EVIA 2IEKA 3J7YJ 4LD5A 3MFKA 5FKLA 4IEJA 2JA6J 2M7AA 1O3TA 3ZXSA 4ZYGA 1XPXA 3ZMDA 3KX2A 2Y9ZA 4HF1A 4M6YA 1IJWC 5ERIA 1B59A 3H0DA 5ICEA 1TP4A 3LA3A 1HDPA 2LMDA 2HPMA 2W57A 2YUSA 1WH7A 4A3CJ 4HAMA 4IO9F 3DKWA 1VQ5I 4I7HA 2NS8A 3JTHA 2DFIA 4IRHA 5E3NA 4I76A 1ZKGA 2RC4A 4BXXJ 1YW9A 2XKOA 2HU9A 2HWVA 2NOJB 3HZJA 3ASNH 3DPTA 5D5VB 2RREA 2K02A 1JXSA 3GTQJ 4XORA 3S3NA 1GLNA 2CUFA 1U8BA 5GADJ 2X6WA 1TT0A 2FQ3A 4EM1A 4E7HA 5EZHA 4YFXF 2LC2A 3GTMJ 1FIAA 1QPMA 3H3UA 1ETVA 4HOBA 3KYLA 2JA8J 1Z1DA 2ME0A 2R7DA 2FNPA 4RS8A 2XGEA 3VYUB 4XRSA 2K27A 1KQ8A 2BXZA 1MJBA 2EILH 3JRAA 3DV8A 1YRNB 4LMYA 2XGDA 4CYDA 2E35A 5IOYA 4A93J 3D5LA 3VB2A 2E19A 2OU2A 4I99C 3OYDA 4OIOF 1H88C 5TRDA 2AQFA 3BLYA 1FX7A 3OWTA 2QF7A 2W00A 1OFCX 5K7HA 1A31A 5CYVA 1N25A 3WU0A 2ZNZA 3WHBA 2K4BA 3F9KA 1K83J 2BGCA 2JMWA 4KN7X 3GBGA 3RKXA 4LITA 2WY8Q 2DJNA 2EFNA 2MG4A 2XF6A 3KYCB 3FHNA 1K61A 4F52A 4JX5A 4WWCA 1P7JA 3CLOA 4C2UA 2KKOA 3EUHC 2JPCA 2JVHA 1ZAOA 1KA8A 2K5CA 4BQAA 2A6EF 2CUEA 4E4HA 1IO2A 3CDIA 4A3EJ 5L3CA 4IRIA 2GZWA 1R9TJ 2P7VB 2ZBKA 1RR7A 3HUGB 3MKYB 2ECCA 3S1MJ 1KYZA 4LB5A 3HHHA 2ZFWA 3AAFA 3S15J 4EM2A 2KFDA 4UXNA 2KQRA 2V9VA 4UV8A 4IOAF 2NVUB 3S32A 4DW6A 2V6EA 3FM3A 3PUBA 1H9GA 2X1EA 2V9PA 2R7OA 2PG4A 2DN0A 3Q0WA 4XRMA 3TW7A 3QU6A 2VN2A 2F2EA 3KEOA 3ABUA 3GYHX 4Z2YA 2FUG2 3C7JA 3EETA 4NBQA 2P0WA 2HNHA 3HC7A 2KRHA 5D5XB 4NQWB 2EV5A 2PMZA 5F1JA 2A61A 3SHFA 1O57A 2JUGA 2J5OA 2FSWA 2MD0A 5M5WJ 2L9SA 3ZOBA 5EGOB 2HS5A 1K79A 3PNYA 2QSHX 2FJ1A 4GDFA 2KISA 3I0TA 3ABKH 3OIPA 2VKEA 1U9NA 1V5EA 1XG1A 3ZRGA 2R0QC 3CUQC 3K1PA 4GRIA 4M9ZA 2HXOA 5BPIA 1LFUP 2Y9YA 5E1XA 5M3FJ 3CP8A 4UUTA 3CCEI 3Q5FA 1XD7A 3HJEA 2A07F 4E6KG 3HOSA 3G71I 4HV6A 2R7FA 1FP1D 5KAIC 5ILSA 4BGDA 4PZJA 1TNTA 3ISPA 5FO5A 2DFEA 4XM3A 2R7UA 1UG0A 2YPRA 3OL3A 2LDUA 1ETQA 3RPUA 4NB5A 3BR6A 2G7UA 3AFHA 4HA8A 3VSLA 4KMFA 3DBLB 4LLLA 1QU3A 2EIKH 2RNGA 2M7BA 4BU2A 2FOWA 3FXLA 1NG6A 1Z3XA 3M07A 3ULQB 4BY1J 3GWZA 3E7LA 4OINF 3JRDA 4JOMA 3BR1A 2HDWA 3KEQA 1O3SA 4ESJA 3FXQA 2WY7Q 1DDNA 3E6DA 3LSHA 4XRFA 3WE2A 2GAUA 2B63J 4LGWA 1VQOI 1W4MA 5K5OA 5H20A 3DTEA 2YX7A 3H9QA 1H8AC 5CVRA 1VFCA 3NQOA 3H92A 1QGPA 1WRJA 4MGRA 2HZDA 2YS9A 3BZCA 3D5RC 2O6GE 3G73A 2VQLA 4AYBN 4HNUA 3JTGA 1YS7A 1Z0XA 4LIUA 2WBMA 3DLAA 5LGNA 2BZTA 3L2CA 3K0LA 3VYSB 1X3ZB 2GBYA 3GF2A 4BXUA 3LSRA 3IH2A 3DU6A 5JHUA 3I56I 2DOEA 5ICCA 1XX5A 4XKVA 3VSKA 5FD6A 3BR3A 2VASA 1FIPA 4TV7A 3NAUA 4WK8F 2R93J 4JBAA 2D5VA 3AG1H 1ETOA 4F7ZA 3WTXC 4HEA2 1T95A 2VQGA 3KP7A 4M9XA 2OBPA 1MJAA 1LNWA 2HXIA 1LVKA 2FBIA 5FJ8J 3OSGA 5JVTA 3RZOJ 3HL2A 2PN6A 2PLYA 2JVGA 2D1HA 5F04A 2K85A 1U5TB 3U9GA 1Z6TA 3NRVA 1TWCJ 3K10A 2ELJA 2RGVA 2Z1DA 3CCMI 3KCCA 1RIOH 3R0AA 1NK2P 2O9LA 2XC7A 4GO1A 4MTEA 2IGNA 3BTIA 2VE8A 1ZGWA 2MH2A 2F5FA 1S72I 4M3FA 3CMMA 3Q9VA 2KIFA 1S29A 2XAGA 1AKHA 2G7HA 1VQLI 4QPOA 1WGXA 2TRTA 5DTDA 2KRFA 4C3IJ 1DQUA 5EZGA 5J1RA 2CJJA 3ZMTA 1FOKA 3FXOA 4IKFA 1BI1A 4X6AJ 2XPVA 3FMQA 1YE9A 3DP7A 2KT0A 3JSOA 2M8GX 4CHUA 4IVNA 2XAUA 3TGNA 2K86A 2QUFA 3GMEA 2QA4I 4IL6C 2E36A 5D8KB 2OQRA 1SFXA 3Q0UA 5HDGA 1ZG1A 1W7PA 2ZSHB 1O4XA 3CDLA 3L2QA 4LG0B 2DK8A 3T5XA 3P7NA 3I58A 3H36A 2FA5A 2VJ4A 4P5OA 1TLHB 1ON1A 1D0XA 3I64A 2Y0SN 2O5RA 3ABLH 1P9QC 2DW4A 2YR2A 1AWCA 1GVJA 3C2HA 4XKBA 2LVSA 5L3GA 1X4OA 1T0FA 4UY8I 1WJBA 5ICFA 2XAJA 2O8KA 2CU7A 1B4AA 3MWMA 1R22A 3DKXA 3I71A 4N9IA 2F4OB 5LLQA 4HDVA 1R71A 2DXIA 4KA4A 2HEOA 2CG4A 2CH0A 3HGYA 1XCBA 2H09A 4Q5SF 2XHKA 1PP7U 3U2RA 4BL0B 2DQLA 2FMLA 5FFXA 2LH9A 4D9JA 2IBDA 4KITB 1R4NB 2CQ7A 1XGNA 5HVQC 4EGYA 2HOEA 5CPRB 3IWFA 1SD5A 2MH9A 3M9AA 2OTLI 1RKWA 4I0BA 3G4SI 2PBIA 2HYGD 4IHVA 2X6OA 3IAS2 1ZH5A 3VYTB 2O0YA 3RIRA 3ELKA 2LBFA 2ETHA 4MQ9F 5B1BH 3ZQHA 3J7AO 2IJLA 3SEQA 4Y52J 2XF5A 1BI3A 3P5JA 3UR3C 2DU9A 4JX4A 3ZQQA 4ZH4F 4DYCA 1UCRA 4S04A 4ENNA 3KP3A 3HTSB 2X6XA 3S1QJ 4RM3A 5FRNA 1SD6A 2CMPA 2I8DA 2JT1A 3GTJJ 3D5SC 3EPZA 3L2VA 2HQAA 2D2WA 1VNDA 3Q3SA 1TQIA 2NS7A 2PJRB 4IQJA 3G2BA 1VQ9I 4MEXF 4N4OB 4PSXA 3ZN1A 4U7DA 2W82A 2MGQA 3I55I 2JUCA 2LY9A 2I10A 4BHCA 1JKRC 2VPLA 1VZ0A 2IS6A 2MFZA 3QAHA 3K4CA 4HV5A 3FXUA 2VJ5A 3GEZA 4AIJA 1B72A 4ITVA 4AYBA 4XQFA 2VKDA 1ZLKA 1HQCA 1LVAA 3PNTA 2ESHA 1X1PA 1YIJI 1G8XA 1S9HA 1YX3A 3HSRA 2DJIA 1Y0NA 3HUGA 5EYRA 2GQQA 2DT6A 2Y69H 4U87A 2CUZA 2VBZA 2HVSA 1W5TA 4JP0A
chains in the Genus database with same CATH topology
3EYYA 2WV0A 3FMRA 2Z3YA 1T2KA 1G6NA 3R0JA 4FX4A 3S2WA 1DP7P 4LFUA 1I5ZA 2Z9OA 1ZRFA 2DPDA 3DEUA 4NQWA 2K4JA 3T1BA 3WTUC 3HRTA 2L01A 2A69F 5D8LB 1SD4A 2CW0F 2RN7A 1IZ1A 1OYIA 1ZREA 1ZG3A 3VFZA 4JK1X 2KJBA 2LNBA 1O3QA 2HQNA 3M7GA 3QU3A 4M73A 1E17A 4WXHA 5ED4A 1G4DA 3GFJA 3HSFA 2D45A 3T8RA 2DTRA 2QENA 2XAHA 1RI7A 5DD4A 4EM0B 3BJOA 1U3EM 3MEXA 1WQ2A 2OA4A 5E17F 3LWFA 2ZJ2A 5HLHA 4O6JA 2OZ6A 3KP5A 4G7OF 2LSOA 3V8LA 4RGXA 4A0YA 4HX7A 1ON2A 3KP6A 2M30A 3F6VA 4KNYA 5KVRA 3QPTA 5E20A 1S7AA 2P7CB 3N97A 1BC7C 3CUOA 3WGIA 1KYWA 3KP2A 3GZ5A 3RKYA 2XAQA 3M8EA 4XSXF 2CO5A 2HZTA 3U1DA 4OIRF 3SZTA 3E6CC 5F64A 3KZYA 5D4RA 3BPVA 4A5NA 1L3LA 2GA2A 5D5WB 4PDKA 1R1UA 1UHWA 1C0WA 4BHBA 1LB2A 1D8JA 3FZVA 2Y48A 3DXJF 2FE3A 2W24A 2VE9A 5D6FA 4L5IA 2NS0A 4ENMA 1K78B 1EH8A 3LAJA 2IT0A 1BM9A 5LEKA 1U5TA 4A12A 1EH7A 3F22A 2ZKZA 1XN7A 2YX4A 1W7PB 2Y75A 2Y0MA 2L3DA 2VBWA 1IXSB 3TDUC 1FYLA 1PP8F 3WE3A 1R5GA 4FHTA 2MLGA 5HLGA 4CICA 3QRFF 2E7WA 3IKVA 3F23A 4RB0A 2YSRA 4ESFA 4XBFA 5BQTA 3F72A 4LG0A 2HYFA 2QQBA 4A6DA 3P9CA 3BPXA 2FBHA 3LQRA 1FSEA 4U0WA 2ELHA 2HQRA 5H6RA 4EQQA 3IWZA 3ZN0A 3V4GA 4YIFA 2JRTA 1HBXG 4EJVA 1CGPA 1SD7A 2QVOA 4RGRA 2W84A 4HQEA 5L3BA 4B8XA 2RDPA 4DNCA 3BY6A 3FHZA 5KK1A 5J8CA 4KIFA 2DQRA 2HTSA 1HSJA 4YG2F 2V6CA 4O3MA 2ADUA 2RVCA 2LF7A 3CDHA 3V7RA 2F5DA 1V4RA 2EFQA 3E6BA 3RDIA 1HW2A 1I1GA 2FEZA 1SAXA 3ECOA 3O6BB 5HDKA 5E1ZB 2BE5F 1RUNA 2RNJA 4I98B 3MCZA 2AS5F 1OKRA 4XLNF 5HS9A 4IPAA 6PAXA 2L4AA 1XDSA 1REPC 5FD5A 5E8GA 2HTJA 2HR3A 3T8TA 3HHGA 3R60A 3GFIA 4YFNF 3HTUA 2E1CA 5LGTA 4ZZLA 5DDGA 3JAMK 1TQMA 4G6QA 1MJ9A 4UVAA 5JFRA 1O3RA 1B9NA 3OOPA 1OMIA 2JPBA 3GW2A 3Q9SA 5DD8A 3GFLA 2GXBA 4H0EA 3R6SA 4KN4X 5D5UB 1FP2A 5J6XA 5D6EA 2VODA 3VODA 1USSA 2QWWA 2HDCA 3GFMA 3FM5A 3TO6A 3O3KA 5DCMA 5LGUA 1MZBA 2P5VA 4BNCA 4MTDA 2CQKA 2IA2A 3CO7C 1TQPA 4GCVA 2O61A 2PI0A 2J5PA 3KE2A 3D0SA 5DYMA 2HGCA 2XVCA 2E1NA 1ZARA 2F5EA 2XUBA 2PEXA 4EJUA 4IF4A 4EJTA 3V8KA 1ZRDA 3J80K 4BYYA 1XCVA 1XGMA 1LQ1A 3WTZA 1XGOA 1F1ZA 1YO5C 4N9HA 1D8KA 1R1VA 3HIFA 4S05A 2GWRA 3C18A 5F1RA 1J75A 5BOXA 3BDDA 5DUKA 2OD5A 3WTTC 1IW7F 2OAZA 1G3YA 1H9TA 1U6GA 5J8FA 4ZZDA 2WC2A 3WTWC 5LHGA 1T39A 1K78A 4IJAA 3REOA 3TOBA 3RYPA 2K7LA 3TO7A 4ENKA 3KLOA 1V3FA 4ESBA 4HW0A 2ZO4A 1KU2A 4CO8A 2V1UA 3JSPA 5CVUA 1FNNA 4I2OA 2E7XA 3ROUA 4I0AA 2DO7A 3K9TA 2CYYA 5DUIA 5DEQA 2STTA 1K7AA 4R1HA 4WXCA 1Z05A 4HX4A 3ECHA 2ISZA 1WKMA 2X4HA 1GXPA 1MKMA 4EV0A 4RGUA 2FMYA 1U2WA 4Y17A 3IC7A 1YW8A 2Q2EA 2H94A 4DQ2A 1BN5A 2MA3A 2R3SA 4RGSA 3PQJA 4EJWA 4HBLA 4N0BA 2RKHA 2BV6A 1T6SA 2EFPA 2PMUA 1YQAA 3BJAA 5K5QA 1UFMA 2IVMA 3O2PE 1L0OC 4PGGA 1HKTA 3ZP5A 1WWXA 4L0YB 2LF8A 1MD0A 4WCGA 2V1DA 4P55A 2CWEA 4A2UA 4WXDA 2A3SA 1QQIA 2WWYA 4Y15A 4HX8A 3HOTA 2QQ9A 3H3ZA 2P8TA 3DF8A 4JQFA 3E5UA 2ZMEA 1P92A 2B0LA 5LEJA 3G3ZA 2L54A 3BJ6A 1IN7A 2UXXA 1QO0D 1P6RA 4OU0A 1SMTA 1XB4A 3GZ6A 3B02A 2TDXA 3HRUA 4L9NA 2XGXA 3QP6A 2ACJA 2KIUA 3F6OA 1XMKA 2QZ8A 3RTRA 2RQPA 1HXDA 3FX3A 3ERED 3KETA 3I54A 5LRSA 1P4XA 4HZFA 3IRRA 1QZZA 3DFGA 3RKWA 3J81K 1QBJA 4HDUA 3BOQA 4A6EA 1RUOA 1R36A 3GVAA 5D4SA 1Z9CA 4KYWA 1Z91A 3WG9A 3SFZA 5DCMB 5L3EA 1STZA 4UVBA 3HRSA 3RI4A 3E3VA 1NHAA 1E2XA 5BPDA 1HKSA 3DQVC 4RAZA 3KP4A 1AOYA 2FNAA 4L5JA 1D3YA 1X3UA 4ETSA 4HYEA 3MZYA 1EH6A 3WGHA 4B09A 5DV5A 5AIQA 2IW5A 1F4KA 5FLXK 4HQMA 1SMYF 4U0VA 4FX0A 4Q4ZF 1KQ9A 2FRHA 3COAC 1FSHA 1S8NA 3ML6A 4OIQF 2L4MA 2QM3A 1J9IA 4EGZA 2NYXA 4CDGA 1IXCA 1IN8A 1S6LA 5BMZA 1YW7A 3HRMA 2MLKA 1ZYRF 1U78A 1P4WA 2LKPA 4Q48A 2FF4A 1FT9A 1J7KA 4G6DA 3LA2A 2HKOA 4AIKA 2STWA 1TTYA 2ZNYA 1JHHA 1UB9A 4RAYA 4G94A 1KGSA 3JAMZ 3K2ZA 4RB1A 4G9YA 1FBSA 2P5KA 2IA0A 4UVCA 2O8XA 4I09A 4LLGF 1IN6A 1O7FA 4XSZF 1B9MA 3LFKA 5FGMA 5CVJA 3MQ0A 4P9UA 1B1BA 1IF1A 4UUVA 3TO9A 5CVIA 2BBYA 1ONVA 2VC1A 1R1TA 3PFIA 2PFBA 4A0XA 3GLXA 1ZGAA 4QWQA 3C3WA 2H6CA 3BZ6A 5FFZA 3VEPA 2BYVE 1YG2A 4KICA 3F8CA 4IHTA 3EUHA 2QQAA 5CLSA 3TKYA 3F8NA 4G8XA 1R00A 1FBQA 1FLIA 3B73A 4LK1F 3ABTA 1ZGJA 1ULYA 3R61A 1CF7B 2EFWA 2VT2A 4U7BA 2IP2A 1Y0UA 4O5VA 3HSEA 2Q8KA 1LDDA 1IN4A 2UWMA 4KIBA 3J80Z 2W85A 4YFKF 1RNLA 3F8FA 2IRFG 4GYIA 2RV8A 5A2QK 1JGSA 4OMYA 1Z6RA 1U5TC 2EFOA 1J5YA 3WODF 3V7CA 1SFEA 1J59A 4LK0F 1YIOA 4CZZA 2QLZA 2VC0A 2ZMEB 4MHGA 1WSUA 1XGSA 2DK5A 1JE8A 3QP5A 5HOOA 3CUQA 2XRNA 1KU3A 3EDPA 1G3TA 3LQQA 4AIHA 1JHFA 1BIBA 2VBYA 5DCFA 1OYYA 5LBQA 3P9IA 4AVPA 1F5TA 1FBUA 2XV4S 4M6XA 2YU3A 4HLYA 1LJ9A 2DT5A 4ASNA 5K1YA 4G7ZF 3MZHA 3WTSC 2EA4A 4U88A 1P4AA 3HYIA 2XKPA 1USTA 2MC3A 2X0LA 3IHUA 3KFWX 2P4WA 1YLFA 1ODDA 2EB7A 2AXLA 4FT8A 3TOAA 4PGHA 3WTYC 2QBYB 5EEHA 2VT3A 1W5SA 3F3XA 3LA7A 2COMA 4HLXA 2H27A 1BIAA 1YTYA 2A5YB 1YYVA 1TW3A 2F5CA 5ILVA 1O7LA 3I5UA 3ZPLA 1HW1A 2EV6A 4ZYEA 3ZMSA 1U8RA 4QLCU 4LLNA 3KLNA 4GYGA 3K69A 2PMHA 3FXRA 3GXOA 2A6HF 3R4KA 4MEYF 2G9WA 4KUMA 5H6QA 2IPQX 4IHSA 1DPUA 3CO6C 2NAZA 3M1EA 3WGGA 3RJPA 2EV0A 3LAPA 1DPRA 2ISYA 2OQGA 1P2FA 4M72A 1QNTA 2DPUA 3E5QA 1MDMB 5E18F 1RZ4A 1FWZA 1T98A 3IKTA 2FXAA 3N4MA 1EV7A 5BS6A 1LDKB 2Z99A 3PQKA 1HSTA 1XSXA 3BP8A 2P6SA 5HLIA 3RYRA 2EWNA 2KJCA 1KU9A 4HF2A 4D0PA 1TW2A 5CJ9A 5JI6A 3GO5A 2VOPA 4Q47A 1XDUA 2JTVA 1BOAA 3V7SA 4G7HF 1Q1HA 3EQLF 2Z5UA 4CGZA 1XMAA 2ESNA 5LHIA 5ICGA 2HKXA 4Y13A 1FC3A 1D5VA 3J81Z 3T0YA 3WTVC 4KT5C 2BEOA 2D1VA 4OOIA 4WX9A 5IT9Z 3BWGA 4M74A 2VBXA 5TJJA 2Z33A 4A5MA 1H0MA 3W6KB 1B6AA 4ZYDA 4R79A 5CVVA 2JSCA 2PQ8A 3I59A 3ZMZA 2DI3A 1HKQA 1FZPB 3C1DA 3MAJA 2NNYA 2P6TA 1G3WA 4A0ZA 3F21A 3BROA 3IL2A 1T38A 1WI9A 1S3JA 5F6FA 5HDNA 4BAYA 3L9FA 3F8MA 4RB3C 4GGGA 1FPQA 4ON0A 3RPQA 2DBBA 5FLXZ 2DLLA 2QYOA 1HW5A 1TNSA 3KZZA 1VTNC 2CGPA 1Z7UA 4MQVA 3TDZC 3FWEA 1KU7A 1FYKA 5L3FA 4KMUX 1ZLJA 2V1XA 1BI2A 1CF7A 4HF0A 2MD5A 4L9VA 1W7PD 3SQNA 1GXQA 1K6OA 4AWXB 3CTAA 2V79A 2M1BA 1SFUA 4KFCA 4I02A 3OV8A 3CUQB 5LHHA 2O03A 1OYWA 2VOOA 2UZKA 5E1WA 3ZMUA 4K2EA 3LSTA 4LJZF 2NNNA 5HS8A 3I4PA 1FY7A 4EMSA 1KQ0A 1IAWA 3I53A 3VOEA 1G3SA 4KDPA 3JW4A 4P9FA 4E70A 1J0RA 1BC8C 2M87A 2Q0OA 1LEBA 3QPHA 1FYMA 4LB6B 2XROA 4R8HA 2HFHA 4I01A 2NRAC 1LDJA 2H6BA 5E8IA 4NHJA 2M5WA 1PUEE 5HS7A 1YS6A 2FBKA 1IRGA 2M8EA 3P9KA 5FB2A 3WU1B 2DAOA 1BI0A 3NEUA 5ILUA 4YIIA 2JZYA 3ZMVA 2XASA 3FF5A 1J2XA 1UHMA 2MBFA 4L18B 1IN5A 1QZYA 1IXRC 1ZG5A 3F8BA 4BHPA 3M8FA 2QBYA 4XLPF 3E97A 3L7WA 3L00A 5IT9K 3TQNA 2IA1A 3SXYA 4AD9A 5IT3A 2CSOA 3GUDA 4U0YA 4OIPF 2PJPA 2GA1A 5A2QZ 1R5HA 1XSVA 3QOPA 3W6JB 1YFHA 2EA2A 5JR3A 5K5RA 4M71A 3EYIA 5AONA 1DUXC 2EK5A 2L02A 2O3FA 4OMZA 2GXGA 4ENJA 1MGTA 1ZRCA 1F9NA 4PCQA 1BBYA 2UXNA 2P5LC 2VONA 3E5XA 1BJAA 1A04A 4BH9A 1I6XA 2ZXJA 1TBXA 1S7OA 2WTEA 1MDMA 1IRFA 4L9TA 2M45A 1OPCA 4ZYHA 5AIPA 2GIVA 4IXAA 2A68F 2OZUA 4P96A 2W25A 4UV9A 1IUYA 3K1MA 3FMSA 1OR7A 2ZCWA 2VXZA 5L3DA 4RB2C 1XSDA 4L0ZB 1PDNC 1R58A 3DPLC 3SZPA 2EJRA 3L09A 2KIMA 2XAFA 4GXOA 2CFXA 3V8JA 1R7JA 4UNOA 1GHCA 2XIGA 3I59B 4KIGA 4L9JA 4IRGA 4MNUA 2C6YA 4WF2A 2FOKA 4M9SA 1R23A 4UHTA 4CXFA 3E6MA 1LEAA 3K1NA 1ZHFA 1ZN2A 4EJOA 5LRRA 1I27A 5EEGA 3ZQ7A 3IRQA 2FU4A 3CJNA 1I1SA 3GX4X 4EVIA 4LD5A 3MFKA 1O3TA 4ZYGA 3ZMDA 4HF1A 4M6YA 5ERIA 1B59A 5ICEA 3LA3A 2W57A 4HAMA 3DKWA 4I7HA 3JTHA 2DFIA 4IRHA 2RC4A 1YW9A 2XKOA 2HWVA 3DPTA 5D5VB 2K02A 1JXSA 2FQ3A 4EM1A 4YFXF 1QPMA 3H3UA 4HOBA 1Z1DA 4RS8A 2R7DA 2FNPA 2K27A 1KQ8A 1MJBA 3DV8A 4LMYA 4CYDA 3D5LA 3VB2A 2OU2A 4OIOF 5TRDA 1FX7A 5CYVA 3WU0A 2ZNZA 2K4BA 2BGCA 4KN7X 3RKXA 2EFNA 4WWCA 3CLOA 2KKOA 2JPCA 1ZAOA 1KA8A 4BQAA 2A6EF 5L3CA 4IRIA 2GZWA 2P7VB 2ZBKA 1KYZA 4LB5A 3HHHA 2ZFWA 3AAFA 4EM2A 4UXNA 2V9VA 4UV8A 3FM3A 1H9GA 2PG4A 3QU6A 2VN2A 2F2EA 3KEOA 3ABUA 3GYHX 4Z2YA 3C7JA 3EETA 5D5XB 2EV5A 2A61A 3SHFA 1O57A 2J5OA 2FSWA 1K79A 2HS5A 3I0TA 3CUQC 3K1PA 4M9ZA 5BPIA 5E1XA 3Q5FA 1XD7A 2A07F 3HOSA 4HV6A 2R7FA 1FP1D 5ILSA 4PZJA 1TNTA 3ISPA 5FO5A 2YPRA 2LDUA 3RPUA 4NB5A 4HA8A 2G7UA 4KMFA 4LLLA 3ULQB 3GWZA 4OINF 3KEQA 1O3SA 4ESJA 3FXQA 1DDNA 3E6DA 4XRFA 3WE2A 2GAUA 4LGWA 1W4MA 5K5OA 5H20A 2YX7A 5CVRA 3NQOA 3H92A 1QGPA 1WRJA 4MGRA 2O6GE 3G73A 3JTGA 1YS7A 5LGNA 3L2CA 3K0LA 3GF2A 4BXUA 5JHUA 5ICCA 5FD6A 4TV7A 4WK8F 4JBAA 4F7ZA 3WTXC 3KP7A 4M9XA 2OBPA 1MJAA 1LNWA 2FBIA 5JVTA 2PN6A 2PLYA 2D1HA 1U5TB 3U9GA 1Z6TA 3NRVA 2RGVA 3KCCA 1RIOH 3R0AA 4GO1A 4MTEA 2VE8A 2MH2A 2F5FA 3Q9VA 2KIFA 1S29A 2XAGA 2G7HA 2KRFA 1FOKA 3ZMTA 1BI1A 3FMQA 3DP7A 3JSOA 4CHUA 4IVNA 3TGNA 2K86A 2QUFA 5D8KB 2OQRA 1SFXA 5HDGA 1ZG1A 1W7PA 4LG0B 2DK8A 3T5XA 3P7NA 3I58A 2FA5A 4P5OA 1TLHB 1ON1A 3I64A 2DW4A 2YR2A 1AWCA 1GVJA 5L3GA 1T0FA 5ICFA 2XAJA 1B4AA 3MWMA 1R22A 4N9IA 3I71A 5LLQA 4HDVA 4KA4A 2HEOA 2CG4A 1XCBA 2H09A 4Q5SF 2XHKA 1PP7U 3U2RA 2DQLA 2FMLA 5FFXA 1XGNA 5HVQC 4EGYA 2HOEA 3IWFA 1SD5A 2MH9A 3M9AA 4I0BA 2PBIA 2HYGD 1ZH5A 2O0YA 3RIRA 3ELKA 2ETHA 4MQ9F 3J7AO 2IJLA 1BI3A 2DU9A 4ZH4F 1UCRA 4S04A 4ENNA 3KP3A 3HTSB 1SD6A 2JT1A 2D2WA 1TQIA 4MEXF 3ZN1A 4U7DA 4BHCA 3QAHA 4HV5A 3FXUA 4AIJA 3GEZA 1ZLKA 1HQCA 1LVAA 2ESHA 3HSRA 3HUGA 2GQQA 2VBZA 1W5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYY A;  2WV0 A;  3FMR A;  2Z3Y A;  1T2K A;  1G6N A;  3R0J A;  4FX4 A;  3S2W A;  1DP7 P;  4LFU A;  1I5Z A;  2Z9O A;  1ZRF A;  2DPD A;  3DEU A;  4NQW A;  2K4J A;  3T1B A;  3WTU C;  3HRT A;  2L01 A;  2A69 F;  5D8L B;  1SD4 A;  2CW0 F;  2RN7 A;  1IZ1 A;  1OYI A;  1ZRE A;  1ZG3 A;  3VFZ A;  4JK1 X;  2KJB A;  2LNB A;  1O3Q A;  2HQN A;  3M7G A;  3QU3 A;  4M73 A;  1E17 A;  4WXH A;  5ED4 A;  1G4D A;  3GFJ A;  3HSF A;  2D45 A;  3T8R A;  2DTR A;  2QEN A;  2XAH A;  1RI7 A;  5DD4 A;  4EM0 B;  3BJO A;  1U3E M;  3MEX A;  1WQ2 A;  2OA4 A;  5E17 F;  3LWF A;  2ZJ2 A;  5HLH A;  4O6J A;  2OZ6 A;  3KP5 A;  4G7O F;  2LSO A;  3V8L A;  4RGX A;  4A0Y A;  4HX7 A;  1ON2 A;  3KP6 A;  2M30 A;  3F6V A;  4KNY A;  5KVR A;  3QPT A;  5E20 A;  1S7A A;  2P7C B;  3N97 A;  1BC7 C;  3CUO A;  3WGI A;  1KYW A;  3KP2 A;  3GZ5 A;  3RKY A;  2XAQ A;  3M8E A;  4XSX F;  2CO5 A;  2HZT A;  3U1D A;  4OIR F;  3SZT A;  3E6C C;  5F64 A;  3KZY A;  5D4R A;  3BPV A;  4A5N A;  1L3L A;  2GA2 A;  5D5W B;  4PDK A;  1R1U A;  1UHW A;  1C0W A;  4BHB A;  1LB2 A;  1D8J A;  3FZV A;  2Y48 A;  3DXJ F;  2FE3 A;  2W24 A;  2VE9 A;  5D6F A;  4L5I A;  2NS0 A;  4ENM A;  1K78 B;  1EH8 A;  3LAJ A;  2IT0 A;  1BM9 A;  5LEK A;  1U5T A;  4A12 A;  1EH7 A;  3F22 A;  2ZKZ A;  1XN7 A;  2YX4 A;  1W7P B;  2Y75 A;  2Y0M A;  2L3D A;  2VBW A;  1IXS B;  3TDU C;  1FYL A;  1PP8 F;  3WE3 A;  1R5G A;  4FHT A;  2MLG A;  5HLG A;  4CIC A;  3QRF F;  2E7W A;  3IKV A;  3F23 A;  4RB0 A;  2YSR A;  4ESF A;  4XBF A;  5BQT A;  3F72 A;  4LG0 A;  2HYF A;  2QQB A;  4A6D A;  3P9C A;  3BPX A;  2FBH A;  3LQR A;  1FSE A;  4U0W A;  2ELH A;  2HQR A;  5H6R A;  4EQQ A;  3IWZ A;  3ZN0 A;  3V4G A;  4YIF A;  2JRT A;  1HBX G;  4EJV A;  1CGP A;  1SD7 A;  2QVO A;  4RGR A;  2W84 A;  4HQE A;  5L3B A;  4B8X A;  2RDP A;  4DNC A;  3BY6 A;  3FHZ A;  5KK1 A;  5J8C A;  4KIF A;  2DQR A;  2HTS A;  1HSJ A;  4YG2 F;  2V6C A;  4O3M A;  2ADU A;  2RVC A;  2LF7 A;  3CDH A;  3V7R A;  2F5D A;  1V4R A;  2EFQ A;  3E6B A;  3RDI A;  1HW2 A;  1I1G A;  2FEZ A;  1SAX A;  3ECO A;  3O6B B;  5HDK A;  5E1Z B;  2BE5 F;  1RUN A;  2RNJ A;  4I98 B;  3MCZ A;  2AS5 F;  1OKR A;  4XLN F;  5HS9 A;  4IPA A;  6PAX A;  2L4A A;  1XDS A;  1REP C;  5FD5 A;  5E8G A;  2HTJ A;  2HR3 A;  3T8T A;  3HHG A;  3R60 A;  3GFI A;  4YFN F;  3HTU A;  2E1C A;  5LGT A;  4ZZL A;  5DDG A;  3JAM K;  1TQM A;  4G6Q A;  1MJ9 A;  4UVA A;  5JFR A;  1O3R A;  1B9N A;  3OOP A;  1OMI A;  2JPB A;  3GW2 A;  3Q9S A;  5DD8 A;  3GFL A;  2GXB A;  4H0E A;  3R6S A;  4KN4 X;  5D5U B;  1FP2 A;  5J6X A;  5D6E A;  2VOD A;  3VOD A;  1USS A;  2QWW A;  2HDC A;  3GFM A;  3FM5 A;  3TO6 A;  3O3K A;  5DCM A;  5LGU A;  1MZB A;  2P5V A;  4BNC A;  4MTD A;  2CQK A;  2IA2 A;  3CO7 C;  1TQP A;  4GCV A;  2O61 A;  2PI0 A;  2J5P A;  3KE2 A;  3D0S A;  5DYM A;  2HGC A;  2XVC A;  2E1N A;  1ZAR A;  2F5E A;  2XUB A;  2PEX A;  4EJU A;  4IF4 A;  4EJT A;  3V8K A;  1ZRD A;  3J80 K;  4BYY A;  1XCV A;  1XGM A;  1LQ1 A;  3WTZ A;  1XGO A;  1F1Z A;  1YO5 C;  4N9H A;  1D8K A;  1R1V A;  3HIF A;  4S05 A;  2GWR A;  3C18 A;  5F1R A;  1J75 A;  5BOX A;  3BDD A;  5DUK A;  2OD5 A;  3WTT C;  1IW7 F;  2OAZ A;  1G3Y A;  1H9T A;  1U6G A;  5J8F A;  4ZZD A;  2WC2 A;  3WTW C;  5LHG A;  1T39 A;  1K78 A;  4IJA A;  3REO A;  3TOB A;  3RYP A;  2K7L A;  3TO7 A;  4ENK A;  3KLO A;  1V3F A;  4ESB A;  4HW0 A;  2ZO4 A;  1KU2 A;  4CO8 A;  2V1U A;  3JSP A;  5CVU A;  1FNN A;  4I2O A;  2E7X A;  3ROU A;  4I0A A;  2DO7 A;  3K9T A;  2CYY A;  5DUI A;  5DEQ A;  2STT A;  1K7A A;  4R1H A;  4WXC A;  1Z05 A;  4HX4 A;  3ECH A;  2ISZ A;  1WKM A;  2X4H A;  1GXP A;  1MKM A;  4EV0 A;  4RGU A;  2FMY A;  1U2W A;  4Y17 A;  3IC7 A;  1YW8 A;  2Q2E A;  2H94 A;  4DQ2 A;  1BN5 A;  2MA3 A;  2R3S A;  4RGS A;  3PQJ A;  4EJW A;  4HBL A;  4N0B A;  2RKH A;  2BV6 A;  1T6S A;  2EFP A;  2PMU A;  1YQA A;  3BJA A;  5K5Q A;  1UFM A;  2IVM A;  3O2P E;  1L0O C;  4PGG A;  1HKT A;  3ZP5 A;  1WWX A;  4L0Y B;  2LF8 A;  1MD0 A;  4WCG A;  2V1D A;  4P55 A;  2CWE A;  4A2U A;  4WXD A;  2A3S A;  1QQI A;  2WWY A;  4Y15 A;  4HX8 A;  3HOT A;  2QQ9 A;  3H3Z A;  2P8T A;  3DF8 A;  4JQF A;  3E5U A;  2ZME A;  1P92 A;  2B0L A;  5LEJ A;  3G3Z A;  2L54 A;  3BJ6 A;  1IN7 A;  2UXX A;  1QO0 D;  1P6R A;  4OU0 A;  1SMT A;  1XB4 A;  3GZ6 A;  3B02 A;  2TDX A;  3HRU A;  4L9N A;  2XGX A;  3QP6 A;  2ACJ A;  2KIU A;  3F6O A;  1XMK A;  2QZ8 A;  3RTR A;  2RQP A;  1HXD A;  3FX3 A;  3ERE D;  3KET A;  3I54 A;  5LRS A;  1P4X A;  4HZF A;  3IRR A;  1QZZ A;  3DFG A;  3RKW A;  3J81 K;  1QBJ A;  4HDU A;  3BOQ A;  4A6E A;  1RUO A;  1R36 A;  3GVA A;  5D4S A;  1Z9C A;  4KYW A;  1Z91 A;  3WG9 A;  3SFZ A;  5DCM B;  5L3E A;  1STZ A;  4UVB A;  3HRS A;  3RI4 A;  3E3V A;  1NHA A;  1E2X A;  5BPD A;  1HKS A;  3DQV C;  4RAZ A;  3KP4 A;  1AOY A;  2FNA A;  4L5J A;  1D3Y A;  1X3U A;  4ETS A;  4HYE A;  3MZY A;  1EH6 A;  3WGH A;  4B09 A;  5DV5 A;  5AIQ A;  2IW5 A;  1F4K A;  5FLX K;  4HQM A;  1SMY F;  4U0V A;  4FX0 A;  4Q4Z F;  1KQ9 A;  2FRH A;  3COA C;  1FSH A;  1S8N A;  3ML6 A;  4OIQ F;  2L4M A;  2QM3 A;  1J9I A;  4EGZ A;  2NYX A;  4CDG A;  1IXC A;  1IN8 A;  1S6L A;  5BMZ A;  1YW7 A;  3HRM A;  2MLK A;  1ZYR F;  1U78 A;  1P4W A;  2LKP A;  4Q48 A;  2FF4 A;  1FT9 A;  1J7K A;  4G6D A;  3LA2 A;  2HKO A;  4AIK A;  2STW A;  1TTY A;  2ZNY A;  1JHH A;  1UB9 A;  4RAY A;  4G94 A;  1KGS A;  3JAM Z;  3K2Z A;  4RB1 A;  4G9Y A;  1FBS A;  2P5K A;  2IA0 A;  4UVC A;  2O8X A;  4I09 A;  4LLG F;  1IN6 A;  1O7F A;  4XSZ F;  1B9M A;  3LFK A;  5FGM A;  5CVJ A;  3MQ0 A;  4P9U A;  1B1B A;  1IF1 A;  4UUV A;  3TO9 A;  5CVI A;  2BBY A;  1ONV A;  2VC1 A;  1R1T A;  3PFI A;  2PFB A;  4A0X A;  3GLX A;  1ZGA A;  4QWQ A;  3C3W A;  2H6C A;  3BZ6 A;  5FFZ A;  3VEP A;  2BYV E;  1YG2 A;  4KIC A;  3F8C A;  4IHT A;  3EUH A;  2QQA A;  5CLS A;  3TKY A;  3F8N A;  4G8X A;  1R00 A;  1FBQ A;  1FLI A;  3B73 A;  4LK1 F;  3ABT A;  1ZGJ A;  1ULY A;  3R61 A;  1CF7 B;  2EFW A;  2VT2 A;  4U7B A;  2IP2 A;  1Y0U A;  4O5V A;  3HSE A;  2Q8K A;  1LDD A;  1IN4 A;  2UWM A;  4KIB A;  3J80 Z;  2W85 A;  4YFK F;  1RNL A;  3F8F A;  2IRF G;  4GYI A;  2RV8 A;  5A2Q K;  1JGS A;  4OMY A;  1Z6R A;  1U5T C;  2EFO A;  1J5Y A;  3WOD F;  3V7C A;  1SFE A;  1J59 A;  4LK0 F;  1YIO A;  4CZZ A;  2QLZ A;  2VC0 A;  2ZME B;  4MHG A;  1WSU A;  1XGS A;  2DK5 A;  1JE8 A;  3QP5 A;  5HOO A;  3CUQ A;  2XRN A;  1KU3 A;  3EDP A;  1G3T A;  3LQQ A;  4AIH A;  1JHF A;  1BIB A;  2VBY A;  5DCF A;  1OYY A;  5LBQ A;  3P9I A;  4AVP A;  1F5T A;  1FBU A;  2XV4 S;  4M6X A;  2YU3 A;  4HLY A;  1LJ9 A;  2DT5 A;  4ASN A;  5K1Y A;  4G7Z F;  3MZH A;  3WTS C;  2EA4 A;  4U88 A;  1P4A A;  3HYI A;  2XKP A;  1UST A;  2MC3 A;  2X0L A;  3IHU A;  3KFW X;  2P4W A;  1YLF A;  1ODD A;  2EB7 A;  2AXL A;  4FT8 A;  3TOA A;  4PGH A;  3WTY C;  2QBY B;  5EEH A;  2VT3 A;  1W5S A;  3F3X A;  3LA7 A;  2COM A;  4HLX A;  2H27 A;  1BIA A;  1YTY A;  2A5Y B;  1YYV A;  1TW3 A;  2F5C A;  5ILV A;  1O7L A;  3I5U A;  3ZPL A;  1HW1 A;  2EV6 A;  4ZYE A;  3ZMS A;  1U8R A;  4QLC U;  4LLN A;  3KLN A;  4GYG A;  3K69 A;  2PMH A;  3FXR A;  3GXO A;  2A6H F;  3R4K A;  4MEY F;  2G9W A;  4KUM A;  5H6Q A;  2IPQ X;  4IHS A;  1DPU A;  3CO6 C;  2NAZ A;  3M1E A;  3WGG A;  3RJP A;  2EV0 A;  3LAP A;  1DPR A;  2ISY A;  2OQG A;  1P2F A;  4M72 A;  1QNT A;  2DPU A;  3E5Q A;  1MDM B;  5E18 F;  1RZ4 A;  1FWZ A;  1T98 A;  3IKT A;  2FXA A;  3N4M A;  1EV7 A;  5BS6 A;  1LDK B;  2Z99 A;  3PQK A;  1HST A;  1XSX A;  3BP8 A;  2P6S A;  5HLI A;  3RYR A;  2EWN A;  2KJC A;  1KU9 A;  4HF2 A;  4D0P A;  1TW2 A;  5CJ9 A;  5JI6 A;  3GO5 A;  2VOP A;  4Q47 A;  1XDU A;  2JTV A;  1BOA A;  3V7S A;  4G7H F;  1Q1H A;  3EQL F;  2Z5U A;  4CGZ A;  1XMA A;  2ESN A;  5LHI A;  5ICG A;  2HKX A;  4Y13 A;  1FC3 A;  1D5V A;  3J81 Z;  3T0Y A;  3WTV C;  4KT5 C;  2BEO A;  2D1V A;  4OOI A;  4WX9 A;  5IT9 Z;  3BWG A;  4M74 A;  2VBX A;  5TJJ A;  2Z33 A;  4A5M A;  1H0M A;  3W6K B;  1B6A A;  4ZYD A;  4R79 A;  5CVV A;  2JSC A;  2PQ8 A;  3I59 A;  3ZMZ A;  2DI3 A;  1HKQ A;  1FZP B;  3C1D A;  3MAJ A;  2NNY A;  2P6T A;  1G3W A;  4A0Z A;  3F21 A;  3BRO A;  3IL2 A;  1T38 A;  1WI9 A;  1S3J A;  5F6F A;  5HDN A;  4BAY A;  3L9F A;  3F8M A;  4RB3 C;  4GGG A;  1FPQ A;  4ON0 A;  3RPQ A;  2DBB A;  5FLX Z;  2DLL A;  2QYO A;  1HW5 A;  1TNS A;  3KZZ A;  1VTN C;  2CGP A;  1Z7U A;  4MQV A;  3TDZ C;  3FWE A;  1KU7 A;  1FYK A;  5L3F A;  4KMU X;  1ZLJ A;  2V1X A;  1BI2 A;  1CF7 A;  4HF0 A;  2MD5 A;  4L9V A;  1W7P D;  3SQN A;  1GXQ A;  1K6O A;  4AWX B;  3CTA A;  2V79 A;  2M1B A;  1SFU A;  4KFC A;  4I02 A;  3OV8 A;  3CUQ B;  5LHH A;  2O03 A;  1OYW A;  2VOO A;  2UZK A;  5E1W A;  3ZMU A;  4K2E A;  3LST A;  4LJZ F;  2NNN A;  5HS8 A;  3I4P A;  1FY7 A;  4EMS A;  1KQ0 A;  1IAW A;  3I53 A;  3VOE A;  1G3S A;  4KDP A;  3JW4 A;  4P9F A;  4E70 A;  1J0R A;  1BC8 C;  2M87 A;  2Q0O A;  1LEB A;  3QPH A;  1FYM A;  4LB6 B;  2XRO A;  4R8H A;  2HFH A;  4I01 A;  2NRA C;  1LDJ A;  2H6B A;  5E8I A;  4NHJ A;  2M5W A;  1PUE E;  5HS7 A;  1YS6 A;  2FBK A;  1IRG A;  2M8E A;  3P9K A;  5FB2 A;  3WU1 B;  2DAO A;  1BI0 A;  3NEU A;  5ILU A;  4YII A;  2JZY A;  3ZMV A;  2XAS A;  3FF5 A;  1J2X A;  1UHM A;  2MBF A;  4L18 B;  1IN5 A;  1QZY A;  1IXR C;  1ZG5 A;  3F8B A;  4BHP A;  3M8F A;  2QBY A;  4XLP F;  3E97 A;  3L7W A;  3L00 A;  5IT9 K;  3TQN A;  2IA1 A;  3SXY A;  4AD9 A;  5IT3 A;  2CSO A;  3GUD A;  4U0Y A;  4OIP F;  2PJP A;  2GA1 A;  5A2Q Z;  1R5H A;  1XSV A;  3QOP A;  3W6J B;  1YFH A;  2EA2 A;  5JR3 A;  5K5R A;  4M71 A;  3EYI A;  5AON A;  1DUX C;  2EK5 A;  2L02 A;  2O3F A;  4OMZ A;  2GXG A;  4ENJ A;  1MGT A;  1ZRC A;  1F9N A;  4PCQ A;  1BBY A;  2UXN A;  2P5L C;  2VON A;  3E5X A;  1BJA A;  1A04 A;  4BH9 A;  1I6X A;  2ZXJ A;  1TBX A;  1S7O A;  2WTE A;  1MDM A;  1IRF A;  4L9T A;  2M45 A;  1OPC A;  4ZYH A;  5AIP A;  2GIV A;  4IXA A;  2A68 F;  2OZU A;  4P96 A;  2W25 A;  4UV9 A;  1IUY A;  3K1M A;  3FMS A;  1OR7 A;  2ZCW A;  2VXZ A;  5L3D A;  4RB2 C;  1XSD A;  4L0Z B;  1PDN C;  1R58 A;  3DPL C;  3SZP A;  2EJR A;  3L09 A;  2KIM A;  2XAF A;  4GXO A;  2CFX A;  3V8J A;  1R7J A;  4UNO A;  1GHC A;  2XIG A;  3I59 B;  4KIG A;  4L9J A;  4IRG A;  4MNU A;  2C6Y A;  4WF2 A;  2FOK A;  4M9S A;  1R23 A;  4UHT A;  4CXF A;  3E6M A;  1LEA A;  3K1N A;  1ZHF A;  1ZN2 A;  4EJO A;  5LRR A;  1I27 A;  5EEG A;  3ZQ7 A;  3IRQ A;  2FU4 A;  3CJN A;  1I1S A;  3GX4 X;  4EVI A;  4LD5 A;  3MFK A;  1O3T A;  4ZYG A;  3ZMD A;  4HF1 A;  4M6Y A;  5ERI A;  1B59 A;  5ICE A;  3LA3 A;  2W57 A;  4HAM A;  3DKW A;  4I7H A;  3JTH A;  2DFI A;  4IRH A;  2RC4 A;  1YW9 A;  2XKO A;  2HWV A;  3DPT A;  5D5V B;  2K02 A;  1JXS A;  2FQ3 A;  4EM1 A;  4YFX F;  1QPM A;  3H3U A;  4HOB A;  1Z1D A;  4RS8 A;  2R7D A;  2FNP A;  2K27 A;  1KQ8 A;  1MJB A;  3DV8 A;  4LMY A;  4CYD A;  3D5L A;  3VB2 A;  2OU2 A;  4OIO F;  5TRD A;  1FX7 A;  5CYV A;  3WU0 A;  2ZNZ A;  2K4B A;  2BGC A;  4KN7 X;  3RKX A;  2EFN A;  4WWC A;  3CLO A;  2KKO A;  2JPC A;  1ZAO A;  1KA8 A;  4BQA A;  2A6E F;  5L3C A;  4IRI A;  2GZW A;  2P7V B;  2ZBK A;  1KYZ A;  4LB5 A;  3HHH A;  2ZFW A;  3AAF A;  4EM2 A;  4UXN A;  2V9V A;  4UV8 A;  3FM3 A;  1H9G A;  2PG4 A;  3QU6 A;  2VN2 A;  2F2E A;  3KEO A;  3ABU A;  3GYH X;  4Z2Y A;  3C7J A;  3EET A;  5D5X B;  2EV5 A;  2A61 A;  3SHF A;  1O57 A;  2J5O A;  2FSW A;  1K79 A;  2HS5 A;  3I0T A;  3CUQ C;  3K1P A;  4M9Z A;  5BPI A;  5E1X A;  3Q5F A;  1XD7 A;  2A07 F;  3HOS A;  4HV6 A;  2R7F A;  1FP1 D;  5ILS A;  4PZJ A;  1TNT A;  3ISP A;  5FO5 A;  2YPR A;  2LDU A;  3RPU A;  4NB5 A;  4HA8 A;  2G7U A;  4KMF A;  4LLL A;  3ULQ B;  3GWZ A;  4OIN F;  3KEQ A;  1O3S A;  4ESJ A;  3FXQ A;  1DDN A;  3E6D A;  4XRF A;  3WE2 A;  2GAU A;  4LGW A;  1W4M A;  5K5O A;  5H20 A;  2YX7 A;  5CVR A;  3NQO A;  3H92 A;  1QGP A;  1WRJ A;  4MGR A;  2O6G E;  3G73 A;  3JTG A;  1YS7 A;  5LGN A;  3L2C A;  3K0L A;  3GF2 A;  4BXU A;  5JHU A;  5ICC A;  5FD6 A;  4TV7 A;  4WK8 F;  4JBA A;  4F7Z A;  3WTX C;  3KP7 A;  4M9X A;  2OBP A;  1MJA A;  1LNW A;  2FBI A;  5JVT A;  2PN6 A;  2PLY A;  2D1H A;  1U5T B;  3U9G A;  1Z6T A;  3NRV A;  2RGV A;  3KCC A;  1RIO H;  3R0A A;  4GO1 A;  4MTE A;  2VE8 A;  2MH2 A;  2F5F A;  3Q9V A;  2KIF A;  1S29 A;  2XAG A;  2G7H A;  2KRF A;  1FOK A;  3ZMT A;  1BI1 A;  3FMQ A;  3DP7 A;  3JSO A;  4CHU A;  4IVN A;  3TGN A;  2K86 A;  2QUF A;  5D8K B;  2OQR A;  1SFX A;  5HDG A;  1ZG1 A;  1W7P A;  4LG0 B;  2DK8 A;  3T5X A;  3P7N A;  3I58 A;  2FA5 A;  4P5O A;  1TLH B;  1ON1 A;  3I64 A;  2DW4 A;  2YR2 A;  1AWC A;  1GVJ A;  5L3G A;  1T0F A;  5ICF A;  2XAJ A;  1B4A A;  3MWM A;  1R22 A;  4N9I A;  3I71 A;  5LLQ A;  4HDV A;  4KA4 A;  2HEO A;  2CG4 A;  1XCB A;  2H09 A;  4Q5S F;  2XHK A;  1PP7 U;  3U2R A;  2DQL A;  2FML A;  5FFX A;  1XGN A;  5HVQ C;  4EGY A;  2HOE A;  3IWF A;  1SD5 A;  2MH9 A;  3M9A A;  4I0B A;  2PBI A;  2HYG D;  1ZH5 A;  2O0Y A;  3RIR A;  3ELK A;  2ETH A;  4MQ9 F;  3J7A O;  2IJL A;  1BI3 A;  2DU9 A;  4ZH4 F;  1UCR A;  4S04 A;  4ENN A;  3KP3 A;  3HTS B;  1SD6 A;  2JT1 A;  2D2W A;  1TQI A;  4MEX F;  3ZN1 A;  4U7D A;  4BHC A;  3QAH A;  4HV5 A;  3FXU A;  4AIJ A;  3GEZ A;  1ZLK A;  1HQC A;  1LVA A;  2ESH A;  3HSR A;  3HUG A;  2GQQ A;  2VBZ A;  1W5T A; 
#chains in the Genus database with same CATH topology
 2E1O A;  3E0J B;  4RM2 A;  1FJL A;  3EYY A;  2WV0 A;  4AID A;  3FMR A;  5JLX A;  1Y1W J;  2Z3Y A;  1T2K A;  1G6N A;  3R0J A;  3JRH A;  4FX4 A;  3S2W A;  1DP7 P;  4LFU A;  2K9N A;  4PJL A;  1JKO C;  1I5Z A;  4G12 A;  4XRS G;  2H8R A;  1DGR M;  1MNM C;  2Z9O A;  2V1N A;  2ZXI A;  1ZRF A;  3SYT A;  2DPD A;  3DEU A;  4NQW A;  2K4J A;  2L7K A;  3T1B A;  3I9V 2;  2NXN B;  4Y4R A;  3WTU C;  3HRT A;  2L01 A;  2A69 F;  5D8L B;  1SD4 A;  5EGO A;  2CW0 F;  2RN7 A;  1IZ1 A;  1OYI A;  2LK2 A;  2GLO A;  1ZRE A;  1ZG3 A;  3VFZ A;  4JK1 X;  2KJB A;  2BY1 A;  3DBR B;  1K4T A;  2LNB A;  1O3Q A;  2HQN A;  3M7G A;  3QU3 A;  4M73 A;  1E17 A;  4CUG A;  4WXH A;  4C9Y A;  1KZH A;  5ED4 A;  2EIJ H;  3LMM A;  1G4D A;  3CCJ I;  3GFJ A;  3M4O J;  3HSF A;  4II3 A;  2LRE A;  2D45 A;  3T8R A;  2DTR A;  3KEY A;  2E1M C;  2QEN A;  4IHY A;  2XAH A;  1RI7 A;  5DD4 A;  3H35 A;  1JT6 A;  4IHX A;  4EM0 B;  3BJO A;  3QOE A;  1U3E M;  4AC0 A;  3MEX A;  2MAB A;  4E7J A;  3C2G A;  1WQ2 A;  2OA4 A;  5E17 F;  3LWF A;  2ZJ2 A;  5HLH A;  3S8P A;  4O6J A;  2OZ6 A;  3B6A A;  3DKY A;  3KP5 A;  1IGN A;  3OYA A;  2LSO A;  2XB5 A;  1SFO J;  4G7O F;  3V8L A;  3A0B C;  4RGX A;  4A0Y A;  3RKQ A;  4NNJ A;  2AXT C;  2Y0S A;  4HX7 A;  4XLE A;  2FQ4 A;  1ON2 A;  2P81 A;  1F36 A;  4XKC A;  1MSE C;  3PIP F;  3KP6 A;  2M30 A;  3F6V A;  1PUF A;  2GXA A;  1UAA A;  2LKS A;  4KNY A;  2E5Z A;  4OWR B;  4UUS A;  5KVR A;  3QPT A;  5E20 A;  1S7A A;  2P7C B;  3N97 A;  4XON A;  1BC7 C;  2IGM A;  3CUO A;  3OYF A;  3WGI A;  3OYL A;  1JUP A;  2CV1 A;  1KYW A;  2CQX A;  3KP2 A;  2L7M P;  3GZ5 A;  1IRX A;  3D1N I;  2KZG A;  3RKY A;  1YJW I;  2XAQ A;  3LSP A;  4MFD A;  3M8E A;  4EEF G;  2MYS A;  4XSX F;  2CO5 A;  2HZT A;  3U1D A;  4OIR F;  5C3E J;  3QOD A;  1V5F A;  3SZT A;  2MW8 A;  3E6C C;  5F64 A;  3KZY A;  5D4R A;  3BPV A;  2EIM H;  4A5N A;  3CZ6 A;  2GOM A;  3RSN A;  1YI2 I;  1L3L A;  2GA2 A;  3NWS A;  5D5W B;  4PDK A;  3UNG C;  3ZGK A;  3H1C A;  1ITY A;  2CW7 A;  1R1U A;  1UHW A;  1C0W A;  4BHB A;  1LB2 A;  2WAF A;  4JX6 A;  5C4X J;  2M0M A;  1D8J A;  2CV0 A;  3FZV A;  2K3F A;  2KZV A;  2L2O A;  4E7Z A;  2Y48 A;  2JQ7 A;  4XLH A;  5LD2 C;  3DXJ F;  2FE3 A;  2W24 A;  3CCU I;  2R7R A;  3TMO A;  1AKH B;  4AVZ A;  1FTZ A;  2VE9 A;  2HOT A;  5D6F A;  1R6R A;  5E3O A;  4L5I A;  2NS0 A;  4ENM A;  1OJL A;  1K78 B;  4F92 B;  3MMY B;  1IUF A;  1EH8 A;  3LAJ A;  3DU5 A;  2EBI A;  2IT0 A;  3HOU J;  2ZSI B;  1BM9 A;  1KON A;  5LEK A;  1U5T A;  4A12 A;  1EH7 A;  1FMW A;  3F22 A;  3K4K A;  2ZKZ A;  3N05 A;  1XN7 A;  2YX4 A;  3OS0 A;  1W7P B;  3ESW B;  4B4C A;  2Y75 A;  3AKZ A;  1W36 C;  1JKP C;  2Y0M A;  2L3D A;  2KHM A;  4V2G A;  3J7A Y;  2Z2S B;  3GCM A;  4NC7 A;  2VBW A;  4ZYA A;  2OC6 A;  3ZCO A;  3CCQ I;  1IXS B;  3TDU C;  5IP9 J;  4PJ0 C;  1PP8 F;  1FYL A;  3WE3 A;  3HOW J;  2BHZ A;  4A3K J;  1R5G A;  1TT5 B;  4FHT A;  3LOC A;  5EEA A;  2MLG A;  5HLG A;  4CIC A;  3QRF F;  2E7W A;  3HOY J;  3IKV A;  1WHU A;  2KRC A;  3BCB A;  1OR7 C;  2O7O A;  1VQN I;  2EIN H;  4J00 A;  3F23 A;  4RB0 A;  1AHD P;  4G6T B;  3ZQC A;  2R7Z J;  2YSR A;  2EPF A;  5F27 A;  4ESF A;  4RLF A;  2JK3 A;  5GAH J;  3EUK L;  4XBF A;  3PIO F;  3OSF A;  5BQT A;  3F72 A;  3FDY A;  4LG0 A;  2HYF A;  1POG A;  2QQB A;  4A3G J;  1JTY A;  2VPR A;  3P9C A;  3BPX A;  4A6D A;  2CQQ A;  5FKM A;  2QSG X;  2FBH A;  3LQR A;  2BOL A;  1MSF C;  3DTI A;  2LY2 A;  1FSE A;  4U0W A;  2LBF B;  2X1D A;  2ELH A;  3KIO A;  2HQR A;  1W0U A;  5H6R A;  4EQQ A;  3RQ4 A;  3IWZ A;  1MMD A;  3CMA I;  3CQZ J;  3ZN0 A;  2LD5 A;  2YU9 J;  2E60 A;  2EZK A;  3H0G J;  3V4G A;  5E79 C;  4YIF A;  2JRT A;  1HBX G;  4EJV A;  2NVX J;  3LNQ A;  3S3O A;  1CGP A;  3WG7 H;  1SD7 A;  2DA7 A;  2QVO A;  3K2A A;  4MIM A;  4RGR A;  2W84 A;  4HQE A;  5EJC A;  2M2E A;  1BOB A;  4CYC A;  5L3B A;  4B8X A;  3K4M A;  1SAU A;  2RDP A;  5K7Z A;  2LP0 A;  3C2B A;  5IYB J;  4DNC A;  3UKG A;  3BY6 A;  1AA7 A;  5KK1 A;  1U0J A;  5J8C A;  3FHZ A;  4KIF A;  2DQR A;  2BY0 A;  2EZL A;  4CCO A;  3B6C A;  3K70 C;  4E7L A;  3V42 A;  1B72 B;  2HTS A;  3CP2 A;  1HSJ A;  3HGG A;  2V9K A;  3IH4 A;  4YG2 F;  3L2R A;  1WH5 A;  2V6C A;  2ZJP F;  1VQ6 I;  2BW3 A;  4O3M A;  2ADU A;  2V4J C;  3VDX A;  2RVC A;  2LF7 A;  2XPU A;  2BVL A;  3CDH A;  2LKX A;  3V7R A;  2F5D A;  1V4R A;  2MSY A;  4A3L J;  2EFQ A;  4D1Q A;  3QQA A;  3CJT B;  3E6B A;  2PJR A;  2WAD A;  2JJ7 A;  3RDI A;  2PX9 A;  1QHH D;  4IX7 A;  2HVQ A;  2K9Q A;  1HW2 A;  4RAG A;  1I1G A;  2FEZ A;  1SAX A;  3ECO A;  4DZP A;  2R5Y A;  3O6B B;  2H1L A;  2DA5 A;  1JJ8 C;  5HDK A;  5E1Z B;  2BE5 F;  4BY7 J;  1RUN A;  2RNJ A;  2DA6 A;  4I98 B;  3MCZ A;  2B9S A;  4BXF A;  2AS5 F;  1OKR A;  3X2Q H;  4XLN F;  2FX0 A;  4FCY A;  3M1C A;  5HS9 A;  4IPA A;  3JRB A;  6PAX A;  4ZJZ A;  5M5Y J;  2JA7 J;  2L4A A;  1XDS A;  1BA5 A;  5KHD A;  4C2M J;  1REP C;  2M34 A;  5E8G A;  5FD5 A;  3OS1 A;  3AG3 H;  4RDU A;  2HTJ A;  3ZQL A;  3FXM A;  2HR3 A;  5KNL A;  3T8T A;  3HHG A;  1MBK A;  3R60 A;  1T56 A;  3GFI A;  1IG7 A;  3DWL E;  2TCT A;  4YFN F;  1MH3 A;  3HTU A;  4D7N A;  2E1C A;  4B43 A;  2B7E A;  5LGT A;  4ZZL A;  4CCK A;  4M3G A;  5DDG A;  2NOG A;  3JAM K;  1TQM A;  1X1D A;  2R7V A;  4G6Q A;  1MJ9 A;  4UVA A;  5JFR A;  2W7N A;  1O3R A;  2OF7 A;  1B9N A;  1UG2 A;  4I6Z A;  2M3A A;  1WJE A;  2E34 A;  3OOP A;  1OMI A;  3QYB A;  3OYH A;  4M3E A;  4CCL A;  2W48 A;  2JPB A;  1Z7L A;  1OQY A;  3GW2 A;  3Q9S A;  5DD8 A;  3GFL A;  4HNT A;  2WAE A;  3MKW B;  2GXB A;  4H0E A;  2R7Q A;  3R6S A;  5JLW A;  4KN4 X;  5D5U B;  1FP2 A;  1GUU A;  3HKZ N;  5J6X A;  5D6E A;  1DU0 A;  2VOD A;  3VOD A;  1USS A;  3BZK A;  2LYC A;  2QWW A;  2OJE D;  1PUF B;  2HDC A;  3GFM A;  3FM5 A;  3TO6 A;  3O3K A;  5DCM A;  4B47 A;  4UUS B;  3HPG A;  5LGU A;  1MZB A;  2P5V A;  1SC7 A;  3CCR I;  1CQT A;  3CES A;  2Z16 A;  4BNC A;  3WU2 C;  4MTD A;  2CQK A;  1W1W E;  2IA2 A;  3CO7 C;  5HLT A;  2DT7 B;  1NG7 A;  1GV5 A;  2H8W A;  1TQP A;  4GCV A;  1X58 A;  2O61 A;  2PI0 A;  2J5P A;  3MN2 A;  3KE2 A;  4LOC A;  2VLA A;  1SEU A;  1QVU A;  3D0S A;  1MNE A;  5DYM A;  1TWH J;  2HGC A;  2XVC A;  2E1N A;  4C30 A;  1ZAR A;  2F5E A;  3FKI J;  1RRJ A;  2DFF A;  2VQH A;  2XUB A;  1MBJ A;  2PEX A;  1VQ7 I;  4EJU A;  4A3J J;  1WJ5 A;  4IF4 A;  3RPU D;  4EJT A;  3V8K A;  1D0Y A;  2L9R A;  4XMY A;  1ZRD A;  3J80 K;  4BYY A;  1XCV A;  3A01 A;  1OIS A;  1I3Q J;  2GIZ A;  1T08 B;  1XGM A;  1LQ1 A;  5B5E C;  3WTZ A;  4HNV A;  1XGO A;  1F1Z A;  2L5Q A;  1YO5 C;  2IXS A;  4N9H A;  3G1M A;  5IYD J;  3M8J A;  1D8K A;  2X1C A;  2JWT A;  2A6T A;  1R1V A;  3E1S A;  3HIF A;  2QGU A;  1QZE A;  1SVO A;  4S05 A;  5EDN A;  2GWR A;  3S1R J;  4DIQ A;  3C18 A;  3CMY A;  4BEH A;  3CME I;  3BR2 A;  2JSP A;  2DMN A;  5J4Y A;  5F1R A;  2VJI A;  4HSR A;  1J75 A;  2KMU A;  1TC3 C;  4QIW N;  5BOX A;  1I39 A;  3BDD A;  3JRE A;  1IRZ A;  5DUK A;  3S2D J;  2OD5 A;  2KP6 A;  1K4S A;  1G2H A;  3WTT C;  1IW7 F;  2OAZ A;  1G3Y A;  1H9T A;  3FK6 A;  1U6G A;  3PO3 J;  2XSJ C;  4B3X A;  5J8F A;  1ZQ3 P;  4ZZD A;  2WC2 A;  3VYR B;  5LHG A;  3WTW C;  1Y56 A;  1T39 A;  3A4C A;  1K78 A;  4HG2 A;  3AL0 C;  4IJA A;  2VKH A;  3REO A;  3OYE A;  5B3S H;  3NAR A;  3TOB A;  3K4B A;  3RYP A;  2K7L A;  1P7I A;  3TO7 A;  4ENK A;  1M1E B;  5LFA A;  1MMG A;  4PUS A;  3KLO A;  1V3F A;  4ESB A;  4HW0 A;  2ZO4 A;  1KU2 A;  3PNV A;  2A05 A;  4XNF A;  4CO8 A;  4MFE A;  1WZ2 A;  1IDY A;  2V1U A;  4EAT A;  3JSP A;  5CVU A;  1FNN A;  2AO9 A;  1N75 A;  4I2O A;  1FEX A;  1MMS A;  2E7X A;  1WI3 A;  5JHF A;  3ROU A;  4PFO A;  2L7Z A;  2DO7 A;  3QPL A;  3K9T A;  4I0A A;  2CYY A;  3TP3 A;  5DEQ A;  5DUI A;  3OYM A;  3OYI A;  2LRD A;  4AM3 A;  3L1P A;  2STT A;  4F55 A;  1K7A A;  4XK4 A;  1G59 A;  4F91 B;  4R1H A;  4WXC A;  1Y8R B;  1Z05 A;  4HX4 A;  3ECH A;  3S14 J;  2ISZ A;  2JA2 A;  1TWA J;  1WKM A;  2X4H A;  1GXP A;  1TWG J;  1MKM A;  3HXL A;  4EV0 A;  4RGU A;  2QKL B;  2FMY A;  1U2W A;  4Y17 A;  3FBI B;  3G1O A;  3IC7 A;  1YX5 A;  1YW8 A;  5J4V A;  2EZH A;  4CYC B;  2Q2E A;  2H94 A;  4DQ2 A;  1BN5 A;  2MA3 A;  2R3S A;  2ID6 A;  2Y30 A;  3CJR B;  4RGS A;  3PQJ A;  4EJW A;  5FRM A;  4HBL A;  4XLA A;  4N0B A;  2RKH A;  1N77 A;  2BV6 A;  1T6S A;  3CF5 F;  2EFP A;  2PMU A;  4DBQ A;  2L9N A;  3QPS A;  4LIV A;  1YQA A;  4J01 A;  3HKZ A;  3BJA A;  5K5Q A;  1UFM A;  3HB9 A;  2IVM A;  4IZZ A;  3O2P E;  1L0O C;  4PGG A;  4X1E A;  1HKT A;  2BW3 B;  1UJ8 A;  2VXD A;  4BS9 A;  2ZJR F;  1WWX A;  3ZP5 A;  3JCU C;  4L0Y B;  1S7E A;  2LF8 A;  5EF6 A;  3LSK A;  1YJN I;  3MVP A;  1MD0 A;  4M3D A;  4WCG A;  3FIW A;  3RQI A;  2V1D A;  1Z21 A;  3GTG J;  4P55 A;  2CWE A;  5KCM A;  4A2U A;  1U9O A;  2LOO A;  2HI3 A;  4WXD A;  3TED A;  2A3S A;  1QQI A;  2WWY A;  4Y15 A;  4HX8 A;  1FTT A;  3HOT A;  1BJZ A;  2R5Y B;  2E2I J;  2QQ9 A;  3H3Z A;  4H4K C;  2DA4 A;  2P8T A;  3DF8 A;  2DDA A;  4JQF A;  3E5U A;  2ZME A;  1P92 A;  4DBR A;  2B0L A;  2CFO A;  3FKJ A;  5LEJ A;  2G0E A;  3G3Z A;  2BXY A;  2L7F P;  2L54 A;  3KPH A;  1HC8 A;  4E7K A;  1NH3 A;  3BJ6 A;  3A1Y A;  1ZTR A;  1F43 A;  2DOF A;  1IN7 A;  2UXX A;  1WPK A;  1QO0 D;  1P6R A;  3CJQ B;  1EA3 A;  2QEX I;  4OU0 A;  1ERD A;  1RES A;  1SMT A;  1XB4 A;  3GZ6 A;  3B02 A;  1T0F C;  2TDX A;  2X85 A;  1VQ4 I;  3L2U A;  2F4M B;  2WA0 A;  2JA5 J;  1QPI A;  3HRU A;  4L9N A;  2R5Z A;  3H5R A;  4UB6 C;  2XGX A;  3QP6 A;  2LFB A;  2WV1 A;  1Y1V J;  2KIU A;  4BJT A;  2KDZ A;  2ACJ A;  1MBG A;  3F6O A;  2V26 A;  1XMK A;  1XMX A;  2QZ8 A;  3RTR A;  2RQP A;  3W2A A;  2ZJQ F;  1IDZ A;  1HXD A;  2M4K A;  3FX3 A;  5J1Y A;  1E3O C;  1BR4 A;  3ERE D;  4ABZ A;  3KET A;  3I54 A;  5LRS A;  1P4X A;  4Y7N J;  4HZF A;  4DYR A;  1XTA A;  2M0C A;  3IRR A;  1QZZ A;  4F93 B;  4ANJ A;  3DFG A;  5JVG F;  1YOV B;  3RKW A;  1ETY A;  3W2W A;  1PYV A;  5IY5 H;  3J81 K;  1APL C;  1QBJ A;  1WCM J;  3H5A A;  3F0C A;  4HDU A;  2E2H J;  3MKL A;  3FBN B;  2DTZ A;  3BOQ A;  4A6E A;  1RUO A;  1R36 A;  3DPU A;  3GVA A;  3MD2 A;  5D4S A;  1Z9C A;  5FKK A;  1D0Z A;  2N8G A;  3BR5 A;  3LSJ A;  3SJM A;  4KYW A;  1Z91 A;  3WG9 A;  3SFZ A;  5DCM B;  5L3E A;  1STZ A;  3BR0 A;  3DBH B;  4Y33 A;  3OR2 C;  4J19 A;  5DM7 F;  4UVB A;  1YHQ I;  3HRS A;  3BTL A;  3RI4 A;  3E3V A;  3G6E I;  4DGW B;  5FRO A;  1NHA A;  1WFX A;  1E2X A;  5BPD A;  1HKS A;  3LFU A;  3DQV C;  4RAZ A;  1MIJ A;  4LG3 A;  3KP4 A;  1UEL B;  4A3D J;  4D7M A;  1AOY A;  2FNA A;  3OR1 C;  4L5J A;  1D3Y A;  1X3U A;  3S1N J;  3DCF A;  4ETS A;  2CW8 A;  3SDB A;  4HYE A;  1HA8 A;  3S93 A;  3MZY A;  1EH6 A;  3WGH A;  5GAG J;  4B09 A;  5DV5 A;  2K40 A;  5AIQ A;  3RCO A;  1MMN A;  3QYF A;  4OAY A;  2IW5 A;  2DOA A;  4FET A;  1VF9 A;  2L0K A;  4B44 A;  4HRI A;  4C3H J;  1JKQ C;  1F4K A;  5FLX K;  3IAM 2;  2K9S A;  5GPA A;  2VJJ A;  4HQM A;  1N78 A;  1SMY F;  4U0V A;  4FX0 A;  1ETK A;  2XF7 A;  4Q4Z F;  1KQ9 A;  2FRH A;  3A01 B;  1JGG A;  3COA C;  1FSH A;  2ZFU A;  5CKT A;  1S8N A;  3BG3 A;  5DM6 F;  2ME6 A;  3W3C A;  3ML6 A;  4OIQ F;  5FKO A;  2L4M A;  2QM3 A;  1J9I A;  3KYD B;  4EGZ A;  2NYX A;  4CDG A;  1IXC A;  1IN8 A;  1S6L A;  4BE1 A;  5BMZ A;  1YW7 A;  3HRM A;  2K9M A;  3PM1 A;  2WB1 N;  4BAC A;  2EZI A;  2MLK A;  4P1W A;  2RQQ A;  1ZYR F;  1U78 A;  3PL8 A;  2NVT J;  1P4W A;  3O8G A;  3W6V A;  4V2F A;  4BEH B;  2LKP A;  4Q48 A;  4XLC A;  1PJR A;  3BC8 A;  3HM5 A;  2FF4 A;  1DGW Y;  1FT9 A;  1MMA A;  1J7K A;  2VI6 A;  1W36 D;  4G6D A;  2R7T A;  3LA2 A;  2HKO A;  2ID3 A;  4XLF A;  4AIK A;  2STW A;  2ZXH A;  1TTY A;  2ZNY A;  1JHH A;  1UB9 A;  2HQ5 A;  4RAY A;  4G94 A;  2OPT A;  1KGS A;  3JAM Z;  4IOC F;  1EKE A;  3LL7 A;  3K2Z A;  4RB1 A;  4G9Y A;  2RAE A;  1FBS A;  2P5K A;  2IA0 A;  4UVC A;  2O8X A;  4I09 A;  4LLG F;  1QHG A;  1IN6 A;  1O7F A;  4XSZ F;  1Z67 A;  1B9M A;  3LFK A;  2UV1 A;  3CCY A;  5FGM A;  1IV8 A;  1W5C C;  5CVJ A;  3MQ0 A;  1RET A;  4BDZ A;  4P9U A;  1B1B A;  1IF1 A;  2K3P A;  4DZJ A;  4PJM A;  1VQK I;  4UUV A;  3TO9 A;  3HEF A;  5CVI A;  2BBY A;  1ONV A;  3GTP J;  1JUM A;  2VC1 A;  4S0H B;  1R1T A;  3PFI A;  2PFB A;  2X48 A;  4A0X A;  3HOV J;  3GLX A;  4XR6 A;  1ZGA A;  4QWQ A;  3C3W A;  1ORK A;  3CD6 I;  2H6C A;  3BZ6 A;  4YEL A;  5FFZ A;  1TL8 A;  3VEP A;  2BYV E;  1YG2 A;  5GP9 A;  4KIC A;  3F8C A;  1E0E A;  4IHT A;  1IV6 A;  2IS2 A;  2DMT A;  3EUH A;  2E5N A;  2QQA A;  3MZ8 A;  5CLS A;  3TKY A;  3F8N A;  2HYJ A;  2I5U A;  3BG7 A;  4G8X A;  1R00 A;  1FBQ A;  4KT6 A;  1FLI A;  1Y8Q B;  2Q2E B;  3B73 A;  4LK1 F;  4A69 C;  3OOU A;  2WAQ A;  2JN6 A;  3ABT A;  1ZGJ A;  1ULY A;  3R61 A;  3L2W A;  1CF7 B;  3CC4 I;  5HOD A;  1T33 A;  2EFW A;  5J40 A;  3K70 D;  4F3Q A;  2VT2 A;  4CZC A;  4U7B A;  4RA2 A;  1DP3 A;  2IP2 A;  1VQP I;  1Y0U A;  4O5V A;  3HSE A;  2Q8K A;  1LDD A;  1IN4 A;  3GTL J;  1WJC A;  2W4S A;  2UWM A;  3LSM A;  5J1U A;  1LFP A;  4KIB A;  3J80 Z;  2W85 A;  4YFK F;  1RNL A;  3F8F A;  4W97 A;  2IRF G;  4GYI A;  2RV8 A;  3LSI A;  2GOX B;  5GTH C;  1D1A A;  5H2F C;  5A2Q K;  1JGS A;  4BE2 A;  1BL0 A;  2ECB A;  4OMY A;  5GPC A;  3Q0V A;  1Z6R A;  3S2H J;  2OCC H;  1RC9 A;  1U5T C;  4BJ6 C;  3A02 A;  2EFO A;  1J5Y A;  1LPQ A;  3WOD F;  3V7C A;  1SFE A;  1J59 A;  2QKM B;  4LK0 F;  1YIO A;  4CZZ A;  2QLZ A;  2Y2Z A;  1I3A A;  1OCR H;  2VC0 A;  2ZME B;  4MHG A;  3OYN A;  1ACI A;  4BKX A;  1WSU A;  1XGS A;  2DK5 A;  3K7A J;  1JE8 A;  2DDB A;  3QP5 A;  2VIX A;  5HOO A;  3CUQ A;  1LE8 B;  3RZD J;  2XRN A;  1KU3 A;  4MLO A;  3EDP A;  2HOA A;  2VL8 A;  1X3W B;  1G3T A;  3DTK A;  3TP0 A;  3JR9 A;  2E1M B;  4IHW A;  3LQQ A;  4AIH A;  1JHF A;  3K4N A;  3S3M A;  1BIB A;  4QSH A;  3SDG A;  1A6Q A;  2VBY A;  5DCF A;  2R5Z B;  1OYY A;  5LBQ A;  3FK7 A;  3P9I A;  4AVP A;  1F5T A;  1FBU A;  2XV4 S;  2DA1 A;  4M6X A;  3GTO J;  2YU3 A;  4HLY A;  3CC7 I;  1LJ9 A;  2DT5 A;  3H5N A;  3ERM A;  4ASN A;  4XOT A;  1UMQ A;  5K1Y A;  1OLT A;  2WB1 A;  4G7Z F;  3MZH A;  4NC8 A;  1EF4 A;  3WTS C;  1MND A;  2EA4 A;  4U88 A;  4B1R A;  1P4A A;  1ZR4 A;  2R92 J;  2FD5 A;  3HYI A;  1D1C A;  2XKP A;  1UST A;  2MC3 A;  2X0L A;  3IHU A;  3KFW X;  2NVY J;  1TWF J;  1YLF A;  2P4W A;  4B3A A;  1ODD A;  2EB7 A;  2AXL A;  3A2K A;  4FT8 A;  3SEZ A;  1D5Y A;  3TOA A;  4PGH A;  3BTJ A;  3S17 J;  4UB8 C;  1DU6 A;  3CC2 I;  5IOZ A;  4E7I A;  3WTY C;  5F0F A;  2QBY B;  4C3J J;  3H3V K;  5EEH A;  3I4N J;  3DLL F;  2DA3 A;  2VT3 A;  1W5S A;  2HPI A;  3TL4 X;  3FXK A;  5FLV A;  3F3X A;  2F5V A;  3LA7 A;  4BJ5 C;  2COM A;  5IP6 A;  1MBH A;  4HLX A;  4FAS D;  5HNF A;  2H27 A;  1QRY A;  3SFI A;  1BIA A;  1VQ8 I;  5TGT A;  5F0H A;  2CUJ A;  1BR1 A;  1AU7 A;  1YTY A;  4FIS A;  4QTR A;  4BE0 A;  2A5Y B;  1YYV A;  1TW3 A;  2F5C A;  2X6Y A;  4YIR X;  4CCJ A;  5ILV A;  1O7L A;  3H9G A;  4A3M J;  2M4G A;  3I5U A;  3ZPL A;  3J7Z I;  1T8I A;  1HW1 A;  1E3P A;  2EV6 A;  4ZYE A;  4N4N B;  3ZMS A;  3I4M J;  1U8R A;  4QLC U;  4LLN A;  3KLN A;  4GYG A;  3IV5 A;  1D1B A;  3K69 A;  4KIS A;  2PMH A;  2R7X A;  3FXR A;  5KAF C;  2IS1 A;  3GXO A;  2A6H F;  3JRC A;  3R4K A;  4MEY F;  2G9W A;  4KUM A;  1JJ6 C;  3M3Y J;  4OAZ A;  5H6Q A;  2IPQ X;  4BQO A;  4IHS A;  2LY1 A;  1OCZ H;  1DPU A;  3CO6 C;  1FOX A;  2NAZ A;  3M1E A;  3WGG A;  3RJP A;  2EV0 A;  3LAP A;  1DPR A;  2ISY A;  1HOM A;  2OQG A;  1P2F A;  4PSW A;  4M72 A;  2VKV A;  1QNT A;  5F0C A;  2DPU A;  4RAF A;  4KJZ A;  3E5Q A;  1MDM B;  5E18 F;  1RZ4 A;  5F08 A;  2DA2 A;  1FWZ A;  3PJR A;  4CH7 A;  1T98 A;  3IKT A;  2FXA A;  3FIS A;  4RMN A;  3N4M A;  3HG9 A;  2BY3 A;  1EV7 A;  1EJ9 A;  5BS6 A;  1LDK B;  2Z99 A;  3K4L A;  3PQK A;  1W0T A;  3GLL A;  1HST A;  1XSX A;  5CQG A;  3PO2 J;  3BP8 A;  2P6S A;  4XN0 A;  3JRI A;  5HLI A;  1B8I B;  3RYR A;  2KPM A;  2EWN A;  5DS9 A;  2KJC A;  1KU9 A;  2OV7 A;  4D0P A;  4HF2 A;  4V19 K;  1TW2 A;  4BQN A;  2ICW G;  5CQE A;  2LTP A;  5CJ9 A;  1R5I D;  3OIQ A;  1V5G A;  3OIO A;  5GTI C;  5JI6 A;  4IQ4 A;  3GO5 A;  2VOP A;  4Q47 A;  1XDU A;  2JTV A;  1MBF A;  1IC8 A;  1BOA A;  3V7S A;  2XPW A;  4NC6 A;  3BT9 A;  1SAN A;  3VPR A;  4DOZ A;  3CCS I;  4G7H F;  1Q1H A;  2KDO A;  2XSD C;  2CS3 A;  2W1O A;  3EQL F;  2Z5U A;  5B1A H;  1GT0 C;  4CGZ A;  1XMA A;  3QYE A;  2ESN A;  5LHI A;  2LR8 A;  2XRL A;  5ICG A;  3ABM H;  2BHY A;  1I6H J;  1V54 H;  5EG0 A;  3DEE A;  1Z77 A;  2HKX A;  4Y13 A;  1FC3 A;  1LUJ B;  1D5V A;  3CCL I;  1FOW A;  3J81 Z;  1MH4 A;  4CA0 A;  3T0Y A;  4D5C A;  1HLV A;  3WTV C;  4KT5 C;  4BDY A;  2BEO A;  1A35 A;  3PFY A;  4HPQ A;  2D1V A;  4ZDL A;  4OOI A;  2CV2 A;  2DYR H;  4WX9 A;  4XN3 A;  1YIT I;  5IT9 Z;  3HPH A;  3BWG A;  4M74 A;  2VBX A;  3IH3 A;  3IP4 B;  5TJJ A;  4AU7 A;  2Z33 A;  4C2T A;  2NVQ J;  2VUM J;  4A5M A;  1H0M A;  2UUZ A;  3W6K B;  1SFK A;  1B6A A;  4ZYD A;  4R79 A;  5CVV A;  2JSC A;  2PQ8 A;  3I59 A;  3ZMZ A;  2DI3 A;  3H9J A;  1HKQ A;  5IP7 J;  1I50 J;  2ELK A;  1HCR A;  1FZP B;  2ZB9 A;  3C1D A;  3MAJ A;  2P6T A;  2NNY A;  4FTH A;  1WJD A;  3G1L A;  2XDV A;  4CSW A;  1G3W A;  4A0Z A;  5IYC J;  4X0G A;  3BRO A;  3F21 A;  2R7W A;  1X4P A;  3IL2 A;  1T38 A;  2DOD A;  2F48 A;  2EH3 A;  4PK4 A;  2OUM A;  2VQC A;  1WI9 A;  1S3J A;  5F6F A;  5HDN A;  4BAY A;  3L9F A;  3F8M A;  4RB3 C;  3KZI C;  2EQR A;  1WJF A;  4GGG A;  1FPQ A;  4ON0 A;  1VQM I;  3RPQ A;  1ETX A;  2DBB A;  5FLX Z;  2DLL A;  2QYO A;  1HW5 A;  1TNS A;  3KZZ A;  1VTN C;  2CGP A;  1Z7U A;  4MQV A;  2LLK A;  3GZN B;  4ZTF A;  1V55 H;  3TDZ C;  3W2V A;  5FKN A;  4BBR J;  5B66 C;  3FWE A;  3CF2 A;  1PVE A;  1KU7 A;  2KLO A;  3HBL A;  1FYK A;  4Z6Y A;  5L3F A;  4KMU X;  3K6G A;  5FLM J;  2AQE A;  4ZDO A;  1Q1V A;  1ZLJ A;  2V1X A;  1BI2 A;  1ENH A;  1CF7 A;  4HF0 A;  3ZQI A;  2KL4 A;  1R4M B;  3CCV I;  1YJ9 I;  2K9L A;  2MD5 A;  1MBE A;  4L9V A;  5C44 J;  1W7P D;  2IAI A;  3SQN A;  1GXQ A;  1ETW A;  1K6O A;  4AWX B;  3CTA A;  2V79 A;  2M1B A;  3EUA A;  4XL9 A;  1SFU A;  4KFC A;  3OMY A;  2IS4 A;  4I02 A;  3OV8 A;  3CUQ B;  5LHH A;  2O03 A;  1QVT A;  1QA6 A;  1OYW A;  3OYJ A;  2VOO A;  2UZK A;  1Y39 A;  5E1W A;  3FXJ A;  2DFH A;  3ZMU A;  5K7F A;  4FQG A;  4K2E A;  3LST A;  4LJZ F;  1XS9 A;  2NNN A;  1GV2 A;  5HS8 A;  4YRV A;  3I4P A;  1FY7 A;  4EMS A;  1KQ0 A;  2HOS A;  4L5E A;  3I53 A;  4ZC3 A;  3QWL A;  1IAW A;  3VOE A;  1G3S A;  2E71 A;  4KDP A;  3JW4 A;  4P9F A;  2DYS H;  4E70 A;  4QPQ A;  1SVL A;  1YRN A;  1LFB A;  1J0R A;  1BC8 C;  2M87 A;  1X1B A;  5BNG A;  2Q0O A;  1A5J A;  1LEB A;  3QPH A;  2LG4 A;  1FYM A;  2HVR A;  4LB6 B;  2XRO A;  2BVM A;  1X1C A;  4CCM A;  4R8H A;  4B48 A;  5M3M J;  1LE8 A;  2GM4 A;  2H1K A;  1OCC H;  4FE7 A;  1FOY A;  3BQZ A;  2HFH A;  2QQ8 A;  4I01 A;  2F4I A;  3MKZ A;  3HDD A;  3BG5 A;  1FMV A;  2QSF X;  2NRA C;  1LDJ A;  2H6B A;  4HST A;  5E8I A;  4NHJ A;  2R4G A;  1JT0 A;  1XC5 A;  1BR2 A;  2M5W A;  1PUE E;  5HS7 A;  1YS6 A;  1OCO H;  1X2M A;  2X9D A;  3SZG A;  2FBK A;  1IRG A;  2M8E A;  1NTC A;  1NK3 P;  3P9K A;  4D5F A;  5FB2 A;  3WU1 B;  2DAO A;  1BI0 A;  3NEU A;  4MO7 A;  2Q1Z B;  3HOZ J;  1JI8 A;  1X19 A;  5ILU A;  2XB0 X;  3VWB A;  4YII A;  3BCA A;  4M3B A;  3WHC A;  1HF0 A;  3NWT A;  2JZY A;  3ZMV A;  4GFB A;  4NUB A;  2XAS A;  1UZC A;  2WAQ N;  3OY9 A;  1VI0 A;  3FF5 A;  1JTX A;  4PJJ A;  1TZL A;  1J2X A;  2JRM A;  1UHM A;  2MBF A;  4L18 B;  1IN5 A;  1QZY A;  1IXR C;  3OYB A;  1ZG5 A;  3F8B A;  5IPA A;  4BHP A;  3M8F A;  3PSF A;  3OYK A;  2QBY A;  4XLP F;  3E97 A;  3L7W A;  3L00 A;  5IT9 K;  3TQN A;  2IA1 A;  3SXY A;  4AD9 A;  5IT3 A;  2CSO A;  2F6C A;  3U21 A;  2XGC A;  1RKT A;  3BG9 A;  3GUD A;  4BBS J;  2IGK A;  4U0Y A;  2OTJ I;  4OIP F;  2PJP A;  5TIS C;  2DMP A;  2GA1 A;  2DMU A;  5A2Q Z;  3ZQF A;  2IGO A;  1R5H A;  4A3I J;  1XSV A;  4ZDP A;  3QOP A;  2ZME C;  3W6J B;  5M5X J;  2MC4 A;  3ZR8 X;  1YFH A;  2EA2 A;  5JR3 A;  5K5R A;  4M71 A;  2VB6 A;  3CLQ A;  4XKW A;  3EYI A;  2V7F A;  5AON A;  4XIC A;  2HDD A;  4PJN A;  3OS2 A;  1GVD A;  1DUX C;  2A5W A;  1UHS A;  2EK5 A;  2L02 A;  3AG2 H;  4W1U A;  3PSI A;  2O3F A;  1SVM A;  2CRG A;  4OMZ A;  3LSG A;  2GXG A;  3PUF A;  4ENJ A;  2M9H A;  3O8H A;  1MGT A;  3TBI A;  3U1K A;  1ZRC A;  1F9N A;  1RPW A;  4PFP A;  4YEJ A;  4PCQ A;  1WVR A;  5J3L A;  1LKX A;  1BBY A;  2E2J J;  2UXN A;  2L9V A;  2P5L C;  1A36 A;  2VON A;  1WJA A;  3E5X A;  1BJA A;  4CCN A;  3OYC A;  1A04 A;  3AL0 B;  4FE4 A;  4BUP A;  2KIQ A;  4BH9 A;  5HNH A;  4ZTJ A;  1OCT C;  1I6X A;  3JRG A;  3ZQG A;  3I3L A;  4M6V A;  1S5L C;  1Z3Y A;  2COB A;  1JUS A;  2ZXJ A;  1TBX A;  1R49 A;  5E3L A;  3GTK J;  1S7O A;  2DCE A;  2DMQ A;  2WTE A;  3HOX J;  3TW6 A;  1MDM A;  2BY2 A;  1IRF A;  4L9T A;  1X1A A;  2M45 A;  1OPC A;  3BG6 A;  1E3H A;  3A03 A;  4BQQ A;  4ZYH A;  5AIP A;  1A6I A;  2X51 A;  2GIV A;  4Y3O A;  4IXA A;  4DJA A;  4AUX A;  1ZK8 A;  5EG0 B;  2A68 F;  5C4J J;  1BW6 A;  1MW7 A;  2OZU A;  1B8I A;  4P96 A;  2W25 A;  1K6Y A;  4UV9 A;  1IUY A;  2CQN A;  4XOP A;  2QCO A;  3K1M A;  3FMS A;  1OR7 A;  1J09 A;  9ANT A;  2OCE A;  1X2N A;  3ASO H;  2ZCW A;  2VXZ A;  5L3D A;  4RB2 C;  4A3F J;  1XSD A;  4L0Z B;  3AG4 H;  1PDN C;  1R58 A;  3DPL C;  3SZP A;  2EJR A;  3L09 A;  2KIM A;  4E7S A;  2ZXW H;  3A0H C;  2XAF A;  3DEW A;  2PMZ N;  4GXO A;  2CFX A;  1H89 C;  3V8J A;  1R7J A;  4UNO A;  1GHC A;  4NDL A;  2XIG A;  3I59 B;  4KIG A;  4L9J A;  1BW5 A;  4IRG A;  3ONQ A;  3IUO A;  3BQY A;  4MNU A;  1OCP A;  5J47 A;  2C6Y A;  4WF2 A;  4XID A;  2R7S A;  2FOK A;  4M9S A;  1R23 A;  4UHT A;  4CXF A;  2AHQ A;  2Y31 A;  3S16 J;  1LEA A;  3E6M A;  3K1N A;  4DYQ A;  4II2 A;  1ZEL A;  1ZHF A;  1ZN2 A;  4RLQ A;  4EJO A;  4A3B J;  5LRR A;  1I27 A;  2ZC2 A;  1RR8 C;  5EEG A;  4JYK A;  1GDT A;  1HDD C;  5E3M A;  3OYG A;  3JRF A;  5GAE J;  3ZQ7 A;  3OL4 A;  1Y6I A;  1ZR2 A;  3IRQ A;  2FU4 A;  3CJN A;  3K4J A;  1I1S A;  4RBO A;  3GX4 X;  3BTC A;  4EVI A;  2IEK A;  3J7Y J;  4LD5 A;  3MFK A;  5FKL A;  4IEJ A;  2JA6 J;  2M7A A;  1O3T A;  3ZXS A;  4ZYG A;  1XPX A;  3ZMD A;  3KX2 A;  2Y9Z A;  4HF1 A;  4M6Y A;  1IJW C;  5ERI A;  1B59 A;  3H0D A;  5ICE A;  1TP4 A;  3LA3 A;  1HDP A;  2LMD A;  2HPM A;  2W57 A;  2YUS A;  1WH7 A;  4A3C J;  4HAM A;  4IO9 F;  3DKW A;  1VQ5 I;  4I7H A;  2NS8 A;  3JTH A;  2DFI A;  4IRH A;  5E3N A;  4I76 A;  1ZKG A;  2RC4 A;  4BXX J;  1YW9 A;  2XKO A;  2HU9 A;  2HWV A;  2NOJ B;  3HZJ A;  3ASN H;  3DPT A;  5D5V B;  2RRE A;  2K02 A;  1JXS A;  3GTQ J;  4XOR A;  3S3N A;  1GLN A;  2CUF A;  1U8B A;  5GAD J;  2X6W A;  1TT0 A;  2FQ3 A;  4EM1 A;  4E7H A;  5EZH A;  4YFX F;  2LC2 A;  3GTM J;  1FIA A;  1QPM A;  3H3U A;  1ETV A;  4HOB A;  3KYL A;  2JA8 J;  1Z1D A;  2ME0 A;  2R7D A;  2FNP A;  4RS8 A;  2XGE A;  3VYU B;  4XRS A;  2K27 A;  1KQ8 A;  2BXZ A;  1MJB A;  2EIL H;  3JRA A;  3DV8 A;  1YRN B;  4LMY A;  2XGD A;  4CYD A;  2E35 A;  5IOY A;  4A93 J;  3D5L A;  3VB2 A;  2E19 A;  2OU2 A;  4I99 C;  3OYD A;  4OIO F;  1H88 C;  5TRD A;  2AQF A;  3BLY A;  1FX7 A;  3OWT A;  2QF7 A;  2W00 A;  1OFC X;  5K7H A;  1A31 A;  5CYV A;  1N25 A;  3WU0 A;  2ZNZ A;  3WHB A;  2K4B A;  3F9K A;  1K83 J;  2BGC A;  2JMW A;  4KN7 X;  3GBG A;  3RKX A;  4LIT A;  2WY8 Q;  2DJN A;  2EFN A;  2MG4 A;  2XF6 A;  3KYC B;  3FHN A;  1K61 A;  4F52 A;  4JX5 A;  4WWC A;  1P7J A;  3CLO A;  4C2U A;  2KKO A;  3EUH C;  2JPC A;  2JVH A;  1ZAO A;  1KA8 A;  2K5C A;  4BQA A;  2A6E F;  2CUE A;  4E4H A;  1IO2 A;  3CDI A;  4A3E J;  5L3C A;  4IRI A;  2GZW A;  1R9T J;  2P7V B;  2ZBK A;  1RR7 A;  3HUG B;  3MKY B;  2ECC A;  3S1M J;  1KYZ A;  4LB5 A;  3HHH A;  2ZFW A;  3AAF A;  3S15 J;  4EM2 A;  2KFD A;  4UXN A;  2KQR A;  2V9V A;  4UV8 A;  4IOA F;  2NVU B;  3S32 A;  4DW6 A;  2V6E A;  3FM3 A;  3PUB A;  1H9G A;  2X1E A;  2V9P A;  2R7O A;  2PG4 A;  2DN0 A;  3Q0W A;  4XRM A;  3TW7 A;  3QU6 A;  2VN2 A;  2F2E A;  3KEO A;  3ABU A;  3GYH X;  4Z2Y A;  2FUG 2;  3C7J A;  3EET A;  4NBQ A;  2P0W A;  2HNH A;  3HC7 A;  2KRH A;  5D5X B;  4NQW B;  2EV5 A;  2PMZ A;  5F1J A;  2A61 A;  3SHF A;  1O57 A;  2JUG A;  2J5O A;  2FSW A;  2MD0 A;  5M5W J;  2L9S A;  3ZOB A;  5EGO B;  2HS5 A;  1K79 A;  3PNY A;  2QSH X;  2FJ1 A;  4GDF A;  2KIS A;  3I0T A;  3ABK H;  3OIP A;  2VKE A;  1U9N A;  1V5E A;  1XG1 A;  3ZRG A;  2R0Q C;  3CUQ C;  3K1P A;  4GRI A;  4M9Z A;  2HXO A;  5BPI A;  1LFU P;  2Y9Y A;  5E1X A;  5M3F J;  3CP8 A;  4UUT A;  3CCE I;  3Q5F A;  1XD7 A;  3HJE A;  2A07 F;  4E6K G;  3HOS A;  3G71 I;  4HV6 A;  2R7F A;  1FP1 D;  5KAI C;  5ILS A;  4BGD A;  4PZJ A;  1TNT A;  3ISP A;  5FO5 A;  2DFE A;  4XM3 A;  2R7U A;  1UG0 A;  2YPR A;  3OL3 A;  2LDU A;  1ETQ A;  3RPU A;  4NB5 A;  3BR6 A;  2G7U A;  3AFH A;  4HA8 A;  3VSL A;  4KMF A;  3DBL B;  4LLL A;  1QU3 A;  2EIK H;  2RNG A;  2M7B A;  4BU2 A;  2FOW A;  3FXL A;  1NG6 A;  1Z3X A;  3M07 A;  3ULQ B;  4BY1 J;  3GWZ A;  3E7L A;  4OIN F;  3JRD A;  4JOM A;  3BR1 A;  2HDW A;  3KEQ A;  1O3S A;  4ESJ A;  3FXQ A;  2WY7 Q;  1DDN A;  3E6D A;  3LSH A;  4XRF A;  3WE2 A;  2GAU A;  2B63 J;  4LGW A;  1VQO I;  1W4M A;  5K5O A;  5H20 A;  3DTE A;  2YX7 A;  3H9Q A;  1H8A C;  5CVR A;  1VFC A;  3NQO A;  3H92 A;  1QGP A;  1WRJ A;  4MGR A;  2HZD A;  2YS9 A;  3BZC A;  3D5R C;  2O6G E;  3G73 A;  2VQL A;  4AYB N;  4HNU A;  3JTG A;  1YS7 A;  1Z0X A;  4LIU A;  2WBM A;  3DLA A;  5LGN A;  2BZT A;  3L2C A;  3K0L A;  3VYS B;  1X3Z B;  2GBY A;  3GF2 A;  4BXU A;  3LSR A;  3IH2 A;  3DU6 A;  5JHU A;  3I56 I;  2DOE A;  5ICC A;  1XX5 A;  4XKV A;  3VSK A;  5FD6 A;  3BR3 A;  2VAS A;  1FIP A;  4TV7 A;  3NAU A;  4WK8 F;  2R93 J;  4JBA A;  2D5V A;  3AG1 H;  1ETO A;  4F7Z A;  3WTX C;  4HEA 2;  1T95 A;  2VQG A;  3KP7 A;  4M9X A;  2OBP A;  1MJA A;  1LNW A;  2HXI A;  1LVK A;  2FBI A;  5FJ8 J;  3OSG A;  5JVT A;  3RZO J;  3HL2 A;  2PN6 A;  2PLY A;  2JVG A;  2D1H A;  5F04 A;  2K85 A;  1U5T B;  3U9G A;  1Z6T A;  3NRV A;  1TWC J;  3K10 A;  2ELJ A;  2RGV A;  2Z1D A;  3CCM I;  3KCC A;  1RIO H;  3R0A A;  1NK2 P;  2O9L A;  2XC7 A;  4GO1 A;  4MTE A;  2IGN A;  3BTI A;  2VE8 A;  1ZGW A;  2MH2 A;  2F5F A;  1S72 I;  4M3F A;  3CMM A;  3Q9V A;  2KIF A;  1S29 A;  2XAG A;  1AKH A;  2G7H A;  1VQL I;  4QPO A;  1WGX A;  2TRT A;  5DTD A;  2KRF A;  4C3I J;  1DQU A;  5EZG A;  5J1R A;  2CJJ A;  3ZMT A;  1FOK A;  3FXO A;  4IKF A;  1BI1 A;  4X6A J;  2XPV A;  3FMQ A;  1YE9 A;  3DP7 A;  2KT0 A;  3JSO A;  2M8G X;  4CHU A;  4IVN A;  2XAU A;  3TGN A;  2K86 A;  2QUF A;  3GME A;  2QA4 I;  4IL6 C;  2E36 A;  5D8K B;  2OQR A;  1SFX A;  3Q0U A;  5HDG A;  1ZG1 A;  1W7P A;  2ZSH B;  1O4X A;  3CDL A;  3L2Q A;  4LG0 B;  2DK8 A;  3T5X A;  3P7N A;  3I58 A;  3H36 A;  2FA5 A;  2VJ4 A;  4P5O A;  1TLH B;  1ON1 A;  1D0X A;  3I64 A;  2Y0S N;  2O5R A;  3ABL H;  1P9Q C;  2DW4 A;  2YR2 A;  1AWC A;  1GVJ A;  3C2H A;  4XKB A;  2LVS A;  5L3G A;  1X4O A;  1T0F A;  4UY8 I;  1WJB A;  5ICF A;  2XAJ A;  2O8K A;  2CU7 A;  1B4A A;  3MWM A;  1R22 A;  3DKX A;  3I71 A;  4N9I A;  2F4O B;  5LLQ A;  4HDV A;  1R71 A;  2DXI A;  4KA4 A;  2HEO A;  2CG4 A;  2CH0 A;  3HGY A;  1XCB A;  2H09 A;  4Q5S F;  2XHK A;  1PP7 U;  3U2R A;  4BL0 B;  2DQL A;  2FML A;  5FFX A;  2LH9 A;  4D9J A;  2IBD A;  4KIT B;  1R4N B;  2CQ7 A;  1XGN A;  5HVQ C;  4EGY A;  2HOE A;  5CPR B;  3IWF A;  1SD5 A;  2MH9 A;  3M9A A;  2OTL I;  1RKW A;  4I0B A;  3G4S I;  2PBI A;  2HYG D;  4IHV A;  2X6O A;  3IAS 2;  1ZH5 A;  3VYT B;  2O0Y A;  3RIR A;  3ELK A;  2LBF A;  2ETH A;  4MQ9 F;  5B1B H;  3ZQH A;  3J7A O;  2IJL A;  3SEQ A;  4Y52 J;  2XF5 A;  1BI3 A;  3P5J A;  3UR3 C;  2DU9 A;  4JX4 A;  3ZQQ A;  4ZH4 F;  4DYC A;  1UCR A;  4S04 A;  4ENN A;  3KP3 A;  3HTS B;  2X6X A;  3S1Q J;  4RM3 A;  5FRN A;  1SD6 A;  2CMP A;  2I8D A;  2JT1 A;  3GTJ J;  3D5S C;  3EPZ A;  3L2V A;  2HQA A;  2D2W A;  1VND A;  3Q3S A;  1TQI A;  2NS7 A;  2PJR B;  4IQJ A;  3G2B A;  1VQ9 I;  4MEX F;  4N4O B;  4PSX A;  3ZN1 A;  4U7D A;  2W82 A;  2MGQ A;  3I55 I;  2JUC A;  2LY9 A;  2I10 A;  4BHC A;  1JKR C;  2VPL A;  1VZ0 A;  2IS6 A;  2MFZ A;  3QAH A;  3K4C A;  4HV5 A;  3FXU A;  2VJ5 A;  3GEZ A;  4AIJ A;  1B72 A;  4ITV A;  4AYB A;  4XQF A;  2VKD A;  1ZLK A;  1HQC A;  1LVA A;  3PNT A;  2ESH A;  1X1P A;  1YIJ I;  1G8X A;  1S9H A;  1YX3 A;  3HSR A;  2DJI A;  1Y0N A;  3HUG A;  5EYR A;  2GQQ A;  2DT6 A;  2Y69 H;  4U87 A;  2CUZ A;  2VBZ A;  2HVS A;  1W5T A;  4JP0 A; 
#chains in the Genus database with same CATH homology
 3EYY A;  2WV0 A;  3FMR A;  2Z3Y A;  1T2K A;  1G6N A;  3R0J A;  4FX4 A;  3S2W A;  1DP7 P;  4LFU A;  1I5Z A;  2Z9O A;  1ZRF A;  2DPD A;  3DEU A;  4NQW A;  2K4J A;  3T1B A;  3WTU C;  3HRT A;  2L01 A;  2A69 F;  5D8L B;  1SD4 A;  2CW0 F;  2RN7 A;  1IZ1 A;  1OYI A;  1ZRE A;  1ZG3 A;  3VFZ A;  4JK1 X;  2KJB A;  2LNB A;  1O3Q A;  2HQN A;  3M7G A;  3QU3 A;  4M73 A;  1E17 A;  4WXH A;  5ED4 A;  1G4D A;  3GFJ A;  3HSF A;  2D45 A;  3T8R A;  2DTR A;  2QEN A;  2XAH A;  1RI7 A;  5DD4 A;  4EM0 B;  3BJO A;  1U3E M;  3MEX A;  1WQ2 A;  2OA4 A;  5E17 F;  3LWF A;  2ZJ2 A;  5HLH A;  4O6J A;  2OZ6 A;  3KP5 A;  4G7O F;  2LSO A;  3V8L A;  4RGX A;  4A0Y A;  4HX7 A;  1ON2 A;  3KP6 A;  2M30 A;  3F6V A;  4KNY A;  5KVR A;  3QPT A;  5E20 A;  1S7A A;  2P7C B;  3N97 A;  1BC7 C;  3CUO A;  3WGI A;  1KYW A;  3KP2 A;  3GZ5 A;  3RKY A;  2XAQ A;  3M8E A;  4XSX F;  2CO5 A;  2HZT A;  3U1D A;  4OIR F;  3SZT A;  3E6C C;  5F64 A;  3KZY A;  5D4R A;  3BPV A;  4A5N A;  1L3L A;  2GA2 A;  5D5W B;  4PDK A;  1R1U A;  1UHW A;  1C0W A;  4BHB A;  1LB2 A;  1D8J A;  3FZV A;  2Y48 A;  3DXJ F;  2FE3 A;  2W24 A;  2VE9 A;  5D6F A;  4L5I A;  2NS0 A;  4ENM A;  1K78 B;  1EH8 A;  3LAJ A;  2IT0 A;  1BM9 A;  5LEK A;  1U5T A;  4A12 A;  1EH7 A;  3F22 A;  2ZKZ A;  1XN7 A;  2YX4 A;  1W7P B;  2Y75 A;  2Y0M A;  2L3D A;  2VBW A;  1IXS B;  3TDU C;  1FYL A;  1PP8 F;  3WE3 A;  1R5G A;  4FHT A;  2MLG A;  5HLG A;  4CIC A;  3QRF F;  2E7W A;  3IKV A;  3F23 A;  4RB0 A;  2YSR A;  4ESF A;  4XBF A;  5BQT A;  3F72 A;  4LG0 A;  2HYF A;  2QQB A;  4A6D A;  3P9C A;  3BPX A;  2FBH A;  3LQR A;  1FSE A;  4U0W A;  2ELH A;  2HQR A;  5H6R A;  4EQQ A;  3IWZ A;  3ZN0 A;  3V4G A;  4YIF A;  2JRT A;  1HBX G;  4EJV A;  1CGP A;  1SD7 A;  2QVO A;  4RGR A;  2W84 A;  4HQE A;  5L3B A;  4B8X A;  2RDP A;  4DNC A;  3BY6 A;  3FHZ A;  5KK1 A;  5J8C A;  4KIF A;  2DQR A;  2HTS A;  1HSJ A;  4YG2 F;  2V6C A;  4O3M A;  2ADU A;  2RVC A;  2LF7 A;  3CDH A;  3V7R A;  2F5D A;  1V4R A;  2EFQ A;  3E6B A;  3RDI A;  1HW2 A;  1I1G A;  2FEZ A;  1SAX A;  3ECO A;  3O6B B;  5HDK A;  5E1Z B;  2BE5 F;  1RUN A;  2RNJ A;  4I98 B;  3MCZ A;  2AS5 F;  1OKR A;  4XLN F;  5HS9 A;  4IPA A;  6PAX A;  2L4A A;  1XDS A;  1REP C;  5FD5 A;  5E8G A;  2HTJ A;  2HR3 A;  3T8T A;  3HHG A;  3R60 A;  3GFI A;  4YFN F;  3HTU A;  2E1C A;  5LGT A;  4ZZL A;  5DDG A;  3JAM K;  1TQM A;  4G6Q A;  1MJ9 A;  4UVA A;  5JFR A;  1O3R A;  1B9N A;  3OOP A;  1OMI A;  2JPB A;  3GW2 A;  3Q9S A;  5DD8 A;  3GFL A;  2GXB A;  4H0E A;  3R6S A;  4KN4 X;  5D5U B;  1FP2 A;  5J6X A;  5D6E A;  2VOD A;  3VOD A;  1USS A;  2QWW A;  2HDC A;  3GFM A;  3FM5 A;  3TO6 A;  3O3K A;  5DCM A;  5LGU A;  1MZB A;  2P5V A;  4BNC A;  4MTD A;  2CQK A;  2IA2 A;  3CO7 C;  1TQP A;  4GCV A;  2O61 A;  2PI0 A;  2J5P A;  3KE2 A;  3D0S A;  5DYM A;  2HGC A;  2XVC A;  2E1N A;  1ZAR A;  2F5E A;  2XUB A;  2PEX A;  4EJU A;  4IF4 A;  4EJT A;  3V8K A;  1ZRD A;  3J80 K;  4BYY A;  1XCV A;  1XGM A;  1LQ1 A;  3WTZ A;  1XGO A;  1F1Z A;  1YO5 C;  4N9H A;  1D8K A;  1R1V A;  3HIF A;  4S05 A;  2GWR A;  3C18 A;  5F1R A;  1J75 A;  5BOX A;  3BDD A;  5DUK A;  2OD5 A;  3WTT C;  1IW7 F;  2OAZ A;  1G3Y A;  1H9T A;  1U6G A;  5J8F A;  4ZZD A;  2WC2 A;  3WTW C;  5LHG A;  1T39 A;  1K78 A;  4IJA A;  3REO A;  3TOB A;  3RYP A;  2K7L A;  3TO7 A;  4ENK A;  3KLO A;  1V3F A;  4ESB A;  4HW0 A;  2ZO4 A;  1KU2 A;  4CO8 A;  2V1U A;  3JSP A;  5CVU A;  1FNN A;  4I2O A;  2E7X A;  3ROU A;  4I0A A;  2DO7 A;  3K9T A;  2CYY A;  5DUI A;  5DEQ A;  2STT A;  1K7A A;  4R1H A;  4WXC A;  1Z05 A;  4HX4 A;  3ECH A;  2ISZ A;  1WKM A;  2X4H A;  1GXP A;  1MKM A;  4EV0 A;  4RGU A;  2FMY A;  1U2W A;  4Y17 A;  3IC7 A;  1YW8 A;  2Q2E A;  2H94 A;  4DQ2 A;  1BN5 A;  2MA3 A;  2R3S A;  4RGS A;  3PQJ A;  4EJW A;  4HBL A;  4N0B A;  2RKH A;  2BV6 A;  1T6S A;  2EFP A;  2PMU A;  1YQA A;  3BJA A;  5K5Q A;  1UFM A;  2IVM A;  3O2P E;  1L0O C;  4PGG A;  1HKT A;  3ZP5 A;  1WWX A;  4L0Y B;  2LF8 A;  1MD0 A;  4WCG A;  2V1D A;  4P55 A;  2CWE A;  4A2U A;  4WXD A;  2A3S A;  1QQI A;  2WWY A;  4Y15 A;  4HX8 A;  3HOT A;  2QQ9 A;  3H3Z A;  2P8T A;  3DF8 A;  4JQF A;  3E5U A;  2ZME A;  1P92 A;  2B0L A;  5LEJ A;  3G3Z A;  2L54 A;  3BJ6 A;  1IN7 A;  2UXX A;  1QO0 D;  1P6R A;  4OU0 A;  1SMT A;  1XB4 A;  3GZ6 A;  3B02 A;  2TDX A;  3HRU A;  4L9N A;  2XGX A;  3QP6 A;  2ACJ A;  2KIU A;  3F6O A;  1XMK A;  2QZ8 A;  3RTR A;  2RQP A;  1HXD A;  3FX3 A;  3ERE D;  3KET A;  3I54 A;  5LRS A;  1P4X A;  4HZF A;  3IRR A;  1QZZ A;  3DFG A;  3RKW A;  3J81 K;  1QBJ A;  4HDU A;  3BOQ A;  4A6E A;  1RUO A;  1R36 A;  3GVA A;  5D4S A;  1Z9C A;  4KYW A;  1Z91 A;  3WG9 A;  3SFZ A;  5DCM B;  5L3E A;  1STZ A;  4UVB A;  3HRS A;  3RI4 A;  3E3V A;  1NHA A;  1E2X A;  5BPD A;  1HKS A;  3DQV C;  4RAZ A;  3KP4 A;  1AOY A;  2FNA A;  4L5J A;  1D3Y A;  1X3U A;  4ETS A;  4HYE A;  3MZY A;  1EH6 A;  3WGH A;  4B09 A;  5DV5 A;  5AIQ A;  2IW5 A;  1F4K A;  5FLX K;  4HQM A;  1SMY F;  4U0V A;  4FX0 A;  4Q4Z F;  1KQ9 A;  2FRH A;  3COA C;  1FSH A;  1S8N A;  3ML6 A;  4OIQ F;  2L4M A;  2QM3 A;  1J9I A;  4EGZ A;  2NYX A;  4CDG A;  1IXC A;  1IN8 A;  1S6L A;  5BMZ A;  1YW7 A;  3HRM A;  2MLK A;  1ZYR F;  1U78 A;  1P4W A;  2LKP A;  4Q48 A;  2FF4 A;  1FT9 A;  1J7K A;  4G6D A;  3LA2 A;  2HKO A;  4AIK A;  2STW A;  1TTY A;  2ZNY A;  1JHH A;  1UB9 A;  4RAY A;  4G94 A;  1KGS A;  3JAM Z;  3K2Z A;  4RB1 A;  4G9Y A;  1FBS A;  2P5K A;  2IA0 A;  4UVC A;  2O8X A;  4I09 A;  4LLG F;  1IN6 A;  1O7F A;  4XSZ F;  1B9M A;  3LFK A;  5FGM A;  5CVJ A;  3MQ0 A;  4P9U A;  1B1B A;  1IF1 A;  4UUV A;  3TO9 A;  5CVI A;  2BBY A;  1ONV A;  2VC1 A;  1R1T A;  3PFI A;  2PFB A;  4A0X A;  3GLX A;  1ZGA A;  4QWQ A;  3C3W A;  2H6C A;  3BZ6 A;  5FFZ A;  3VEP A;  2BYV E;  1YG2 A;  4KIC A;  3F8C A;  4IHT A;  3EUH A;  2QQA A;  5CLS A;  3TKY A;  3F8N A;  4G8X A;  1R00 A;  1FBQ A;  1FLI A;  3B73 A;  4LK1 F;  3ABT A;  1ZGJ A;  1ULY A;  3R61 A;  1CF7 B;  2EFW A;  2VT2 A;  4U7B A;  2IP2 A;  1Y0U A;  4O5V A;  3HSE A;  2Q8K A;  1LDD A;  1IN4 A;  2UWM A;  4KIB A;  3J80 Z;  2W85 A;  4YFK F;  1RNL A;  3F8F A;  2IRF G;  4GYI A;  2RV8 A;  5A2Q K;  1JGS A;  4OMY A;  1Z6R A;  1U5T C;  2EFO A;  1J5Y A;  3WOD F;  3V7C A;  1SFE A;  1J59 A;  4LK0 F;  1YIO A;  4CZZ A;  2QLZ A;  2VC0 A;  2ZME B;  4MHG A;  1WSU A;  1XGS A;  2DK5 A;  1JE8 A;  3QP5 A;  5HOO A;  3CUQ A;  2XRN A;  1KU3 A;  3EDP A;  1G3T A;  3LQQ A;  4AIH A;  1JHF A;  1BIB A;  2VBY A;  5DCF A;  1OYY A;  5LBQ A;  3P9I A;  4AVP A;  1F5T A;  1FBU A;  2XV4 S;  4M6X A;  2YU3 A;  4HLY A;  1LJ9 A;  2DT5 A;  4ASN A;  5K1Y A;  4G7Z F;  3MZH A;  3WTS C;  2EA4 A;  4U88 A;  1P4A A;  3HYI A;  2XKP A;  1UST A;  2MC3 A;  2X0L A;  3IHU A;  3KFW X;  2P4W A;  1YLF A;  1ODD A;  2EB7 A;  2AXL A;  4FT8 A;  3TOA A;  4PGH A;  3WTY C;  2QBY B;  5EEH A;  2VT3 A;  1W5S A;  3F3X A;  3LA7 A;  2COM A;  4HLX A;  2H27 A;  1BIA A;  1YTY A;  2A5Y B;  1YYV A;  1TW3 A;  2F5C A;  5ILV A;  1O7L A;  3I5U A;  3ZPL A;  1HW1 A;  2EV6 A;  4ZYE A;  3ZMS A;  1U8R A;  4QLC U;  4LLN A;  3KLN A;  4GYG A;  3K69 A;  2PMH A;  3FXR A;  3GXO A;  2A6H F;  3R4K A;  4MEY F;  2G9W A;  4KUM A;  5H6Q A;  2IPQ X;  4IHS A;  1DPU A;  3CO6 C;  2NAZ A;  3M1E A;  3WGG A;  3RJP A;  2EV0 A;  3LAP A;  1DPR A;  2ISY A;  2OQG A;  1P2F A;  4M72 A;  1QNT A;  2DPU A;  3E5Q A;  1MDM B;  5E18 F;  1RZ4 A;  1FWZ A;  1T98 A;  3IKT A;  2FXA A;  3N4M A;  1EV7 A;  5BS6 A;  1LDK B;  2Z99 A;  3PQK A;  1HST A;  1XSX A;  3BP8 A;  2P6S A;  5HLI A;  3RYR A;  2EWN A;  2KJC A;  1KU9 A;  4HF2 A;  4D0P A;  1TW2 A;  5CJ9 A;  5JI6 A;  3GO5 A;  2VOP A;  4Q47 A;  1XDU A;  2JTV A;  1BOA A;  3V7S A;  4G7H F;  1Q1H A;  3EQL F;  2Z5U A;  4CGZ A;  1XMA A;  2ESN A;  5LHI A;  5ICG A;  2HKX A;  4Y13 A;  1FC3 A;  1D5V A;  3J81 Z;  3T0Y A;  3WTV C;  4KT5 C;  2BEO A;  2D1V A;  4OOI A;  4WX9 A;  5IT9 Z;  3BWG A;  4M74 A;  2VBX A;  5TJJ A;  2Z33 A;  4A5M A;  1H0M A;  3W6K B;  1B6A A;  4ZYD A;  4R79 A;  5CVV A;  2JSC A;  2PQ8 A;  3I59 A;  3ZMZ A;  2DI3 A;  1HKQ A;  1FZP B;  3C1D A;  3MAJ A;  2NNY A;  2P6T A;  1G3W A;  4A0Z A;  3F21 A;  3BRO A;  3IL2 A;  1T38 A;  1WI9 A;  1S3J A;  5F6F A;  5HDN A;  4BAY A;  3L9F A;  3F8M A;  4RB3 C;  4GGG A;  1FPQ A;  4ON0 A;  3RPQ A;  2DBB A;  5FLX Z;  2DLL A;  2QYO A;  1HW5 A;  1TNS A;  3KZZ A;  1VTN C;  2CGP A;  1Z7U A;  4MQV A;  3TDZ C;  3FWE A;  1KU7 A;  1FYK A;  5L3F A;  4KMU X;  1ZLJ A;  2V1X A;  1BI2 A;  1CF7 A;  4HF0 A;  2MD5 A;  4L9V A;  1W7P D;  3SQN A;  1GXQ A;  1K6O A;  4AWX B;  3CTA A;  2V79 A;  2M1B A;  1SFU A;  4KFC A;  4I02 A;  3OV8 A;  3CUQ B;  5LHH A;  2O03 A;  1OYW A;  2VOO A;  2UZK A;  5E1W A;  3ZMU A;  4K2E A;  3LST A;  4LJZ F;  2NNN A;  5HS8 A;  3I4P A;  1FY7 A;  4EMS A;  1KQ0 A;  1IAW A;  3I53 A;  3VOE A;  1G3S A;  4KDP A;  3JW4 A;  4P9F A;  4E70 A;  1J0R A;  1BC8 C;  2M87 A;  2Q0O A;  1LEB A;  3QPH A;  1FYM A;  4LB6 B;  2XRO A;  4R8H A;  2HFH A;  4I01 A;  2NRA C;  1LDJ A;  2H6B A;  5E8I A;  4NHJ A;  2M5W A;  1PUE E;  5HS7 A;  1YS6 A;  2FBK A;  1IRG A;  2M8E A;  3P9K A;  5FB2 A;  3WU1 B;  2DAO A;  1BI0 A;  3NEU A;  5ILU A;  4YII A;  2JZY A;  3ZMV A;  2XAS A;  3FF5 A;  1J2X A;  1UHM A;  2MBF A;  4L18 B;  1IN5 A;  1QZY A;  1IXR C;  1ZG5 A;  3F8B A;  4BHP A;  3M8F A;  2QBY A;  4XLP F;  3E97 A;  3L7W A;  3L00 A;  5IT9 K;  3TQN A;  2IA1 A;  3SXY A;  4AD9 A;  5IT3 A;  2CSO A;  3GUD A;  4U0Y A;  4OIP F;  2PJP A;  2GA1 A;  5A2Q Z;  1R5H A;  1XSV A;  3QOP A;  3W6J B;  1YFH A;  2EA2 A;  5JR3 A;  5K5R A;  4M71 A;  3EYI A;  5AON A;  1DUX C;  2EK5 A;  2L02 A;  2O3F A;  4OMZ A;  2GXG A;  4ENJ A;  1MGT A;  1ZRC A;  1F9N A;  4PCQ A;  1BBY A;  2UXN A;  2P5L C;  2VON A;  3E5X A;  1BJA A;  1A04 A;  4BH9 A;  1I6X A;  2ZXJ A;  1TBX A;  1S7O A;  2WTE A;  1MDM A;  1IRF A;  4L9T A;  2M45 A;  1OPC A;  4ZYH A;  5AIP A;  2GIV A;  4IXA A;  2A68 F;  2OZU A;  4P96 A;  2W25 A;  4UV9 A;  1IUY A;  3K1M A;  3FMS A;  1OR7 A;  2ZCW A;  2VXZ A;  5L3D A;  4RB2 C;  1XSD A;  4L0Z B;  1PDN C;  1R58 A;  3DPL C;  3SZP A;  2EJR A;  3L09 A;  2KIM A;  2XAF A;  4GXO A;  2CFX A;  3V8J A;  1R7J A;  4UNO A;  1GHC A;  2XIG A;  3I59 B;  4KIG A;  4L9J A;  4IRG A;  4MNU A;  2C6Y A;  4WF2 A;  2FOK A;  4M9S A;  1R23 A;  4UHT A;  4CXF A;  3E6M A;  1LEA A;  3K1N A;  1ZHF A;  1ZN2 A;  4EJO A;  5LRR A;  1I27 A;  5EEG A;  3ZQ7 A;  3IRQ A;  2FU4 A;  3CJN A;  1I1S A;  3GX4 X;  4EVI A;  4LD5 A;  3MFK A;  1O3T A;  4ZYG A;  3ZMD A;  4HF1 A;  4M6Y A;  5ERI A;  1B59 A;  5ICE A;  3LA3 A;  2W57 A;  4HAM A;  3DKW A;  4I7H A;  3JTH A;  2DFI A;  4IRH A;  2RC4 A;  1YW9 A;  2XKO A;  2HWV A;  3DPT A;  5D5V B;  2K02 A;  1JXS A;  2FQ3 A;  4EM1 A;  4YFX F;  1QPM A;  3H3U A;  4HOB A;  1Z1D A;  4RS8 A;  2R7D A;  2FNP A;  2K27 A;  1KQ8 A;  1MJB A;  3DV8 A;  4LMY A;  4CYD A;  3D5L A;  3VB2 A;  2OU2 A;  4OIO F;  5TRD A;  1FX7 A;  5CYV A;  3WU0 A;  2ZNZ A;  2K4B A;  2BGC A;  4KN7 X;  3RKX A;  2EFN A;  4WWC A;  3CLO A;  2KKO A;  2JPC A;  1ZAO A;  1KA8 A;  4BQA A;  2A6E F;  5L3C A;  4IRI A;  2GZW A;  2P7V B;  2ZBK A;  1KYZ A;  4LB5 A;  3HHH A;  2ZFW A;  3AAF A;  4EM2 A;  4UXN A;  2V9V A;  4UV8 A;  3FM3 A;  1H9G A;  2PG4 A;  3QU6 A;  2VN2 A;  2F2E A;  3KEO A;  3ABU A;  3GYH X;  4Z2Y A;  3C7J A;  3EET A;  5D5X B;  2EV5 A;  2A61 A;  3SHF A;  1O57 A;  2J5O A;  2FSW A;  1K79 A;  2HS5 A;  3I0T A;  3CUQ C;  3K1P A;  4M9Z A;  5BPI A;  5E1X A;  3Q5F A;  1XD7 A;  2A07 F;  3HOS A;  4HV6 A;  2R7F A;  1FP1 D;  5ILS A;  4PZJ A;  1TNT A;  3ISP A;  5FO5 A;  2YPR A;  2LDU A;  3RPU A;  4NB5 A;  4HA8 A;  2G7U A;  4KMF A;  4LLL A;  3ULQ B;  3GWZ A;  4OIN F;  3KEQ A;  1O3S A;  4ESJ A;  3FXQ A;  1DDN A;  3E6D A;  4XRF A;  3WE2 A;  2GAU A;  4LGW A;  1W4M A;  5K5O A;  5H20 A;  2YX7 A;  5CVR A;  3NQO A;  3H92 A;  1QGP A;  1WRJ A;  4MGR A;  2O6G E;  3G73 A;  3JTG A;  1YS7 A;  5LGN A;  3L2C A;  3K0L A;  3GF2 A;  4BXU A;  5JHU A;  5ICC A;  5FD6 A;  4TV7 A;  4WK8 F;  4JBA A;  4F7Z A;  3WTX C;  3KP7 A;  4M9X A;  2OBP A;  1MJA A;  1LNW A;  2FBI A;  5JVT A;  2PN6 A;  2PLY A;  2D1H A;  1U5T B;  3U9G A;  1Z6T A;  3NRV A;  2RGV A;  3KCC A;  1RIO H;  3R0A A;  4GO1 A;  4MTE A;  2VE8 A;  2MH2 A;  2F5F A;  3Q9V A;  2KIF A;  1S29 A;  2XAG A;  2G7H A;  2KRF A;  1FOK A;  3ZMT A;  1BI1 A;  3FMQ A;  3DP7 A;  3JSO A;  4CHU A;  4IVN A;  3TGN A;  2K86 A;  2QUF A;  5D8K B;  2OQR A;  1SFX A;  5HDG A;  1ZG1 A;  1W7P A;  4LG0 B;  2DK8 A;  3T5X A;  3P7N A;  3I58 A;  2FA5 A;  4P5O A;  1TLH B;  1ON1 A;  3I64 A;  2DW4 A;  2YR2 A;  1AWC A;  1GVJ A;  5L3G A;  1T0F A;  5ICF A;  2XAJ A;  1B4A A;  3MWM A;  1R22 A;  4N9I A;  3I71 A;  5LLQ A;  4HDV A;  4KA4 A;  2HEO A;  2CG4 A;  1XCB A;  2H09 A;  4Q5S F;  2XHK A;  1PP7 U;  3U2R A;  2DQL A;  2FML A;  5FFX A;  1XGN A;  5HVQ C;  4EGY A;  2HOE A;  3IWF A;  1SD5 A;  2MH9 A;  3M9A A;  4I0B A;  2PBI A;  2HYG D;  1ZH5 A;  2O0Y A;  3RIR A;  3ELK A;  2ETH A;  4MQ9 F;  3J7A O;  2IJL A;  1BI3 A;  2DU9 A;  4ZH4 F;  1UCR A;  4S04 A;  4ENN A;  3KP3 A;  3HTS B;  1SD6 A;  2JT1 A;  2D2W A;  1TQI A;  4MEX F;  3ZN1 A;  4U7D A;  4BHC A;  3QAH A;  4HV5 A;  3FXU A;  4AIJ A;  3GEZ A;  1ZLK A;  1HQC A;  1LVA A;  2ESH A;  3HSR A;  3HUG A;  2GQQ A;  2VBZ A;  1W5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...