2HG0A

Structure of the west nile virus envelope glycoprotein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
400
structure length
400
Chain Sequence
b'FNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLAEVRSYCYLATVSDLSTKAACPTMGEAHNDKRADPAFVCRQGVVDRGWGNGCGLFGKGSIDTCAKFACSTKAIGRTILKENIKYEVAIFVHGPTTVESHGNYSTQVGATQAGRFSITPAAPSYTLKLGEYGEVTVDCEPRSGIDTNAYYVMTVGTKTFLVHREWFMDLNLPWSSAGSTVWRNRETLMEFEEPHATKQSVIALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Crystal structure of the West Nile virus envelope glycoprotein.
pubmed doi rcsb
source organism West nile virus
molecule tags Viral protein
total genus 65
structure length 400
sequence length 400
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2hg0A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 2hg0A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 2hg0A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 2hg0A03
5KVFE 3MUUA 5KVGE 2R29A 4GSXA 5B1CA 1RERA 4X42A 3UZEC 2P5PA 4UTBA 1Z3RA 2R69A 5IZ7A 5GZNA 5LBSA 2V33A 2HG0A 5KVEE 4UTAA 4FG0A 2GG1A 3UZVA 5H37A 3N40F 5IREA 2JSFA 4UTCA 4ALAC 1S6NA 5AAMC 1OKEA 3G7TA 3C5XA 4BZ2A 2JQMA 3IRCA 5LBVA 4AL8C 5JHMA 4UT9A 3N41F 2I69A 3C6EA 1SVBA 4FFZA 1PJWA 4L5FE 1TG8A 1ZTXE 4FFYA 4AM0Q 4UT6A 3UYPB 3UAJA 5LCVA 3J27A 3J2PA 5KVDE 2JV6A 2H0PA 5AAWC 5JHLA 4GT0A 3UC0A 1Z66A 3P54A 3N44F 3UZQB 1UZGA 2ALAA 3WE1A 5GZOA 3I50E 3N42F 3N43F 1URZA 1OANA 1OK8A 3VTTA 4BZ1A
chains in the Genus database with same CATH superfamily
4JFWA 1DQQB 4B9YA 4PG2A 1KC5H 3G6JE 4P3DA 1FFRA 4LU5H 2Q2EB 3STBA 1NLBL 1S3KL 4A39A 1WQVT 3L6FB 2ZOUA 3GSVB 1X7TA 2W38A 3T08A 3CN2A 1DE4B 2OI9C 5CBEA 4E41D 5JA9A 1T03H 4KZEH 5D72L 4F2EA 3VAEA 4GMSH 4XCCH 1WFNA 2XYBA 4U1GC 1FZKA 3K2MC 4A04A 3NFPB 1PZUB 4PAZA 5HHMB 1J8HB 1SMDA 3FUDA 4XXWC 1QSZA 2VMEA 2EABA 3D4GA 3MYJB 3HUJA 1MCLA 1UEYA 3ERXA 4XZ4A 3TL5A 4N0UA 1O6TA 1SUHA 4MZ3A 4A6YL 4UM9D 5HTSA 3BPOC 3HRZC 3FXIC 1UWXH 3QWOB 4UINL 2AV1B 3R8QA 1HXYB 1WISA 2YSSA 1GIGL 4PM1A 5K9OB 1QYGH 3CZUB 1YUKB 1GAFL 4KX9A 3ZDYB 1VESA 4LLQA 1F45A 1WP6A 2QLYA 1JNJA 1HI6A 1ZJAA 4GRMA 4CRPA 4BZ2A 4MXQC 3TFKC 4PJIB 2WLMA 3SDDA 3MRGB 1EQWA 3Q7JA 3RVTC 4OLXL 1RZQA 4FLOA 2JQAA 2H32A 4PG9B 2P49B 4WWPA 4MWFA 2A1WH 3TCTA 3TT1H 4JDZA 4GBXC 2Y1ZA 1JVKA 1S8DB 4OSUH 4JKPL 5HHOB 3OKNB 1JTOA 5EU7E 1K3ZA 1JWUB 1NCWL 3O11B 4M7JH 3KLQA 1OGAB 3X1BA 1KLFA 4KK8D 2DTML 2PMZA 2I07B 2XN0A 4NWTH 2XKUA 2A0LC 3FU8A 1F56A 4FTVD 2HFGH 4UMGA 1M7DB 4E36A 4CGUB 3QAZB 4POZC 4X0KA 3CFUA 2Y2TA 5B38B 4N8CL 2OMVB 2IDCA 3OPZH 2H0PA 4JGUA 2BCKB 1JWMA 5MEPB 1E4XH 4M02A 2QPDB 2GI7A 2VR4A 1T5WA 4HK3N 3EADA 4AEIH 2JCCE 1T1XB 4WWKA 4AYFA 5BMFH 2I60L 1VIWA 5E1HB 5FECA 3VXRD 1AQMA 1S9XA 3IGAB 2BSCA 4MKTA 3F05A 1CD9B 4MNGB 1XGZA 2R0WH 1HNFA 4TS6A 2E7LA 4LEOB 4LSTH 1GCYA 5ITFB 4KY1L 5IBUG 3D06A 5ILTH 4OZGA 1D5MA 5KZCD 1T6WA 3P4NB 4P5KA 2NDFA 5CR1A 2Z65C 2OYLA 2Y5TA 5GQBA 1OY3B 3CSGA 1DJIA 4RCAA 3MSPA 5B7FA 3TO4B 4TUUA 5T1KB 3L3HA 1CFVH 2LU3A 2CDEB 1JGVL 4E0RA 2OR8A 3GJEB 3P3SA 4QNPE 1OQXA 2Y9RT 2NTSP 1U8OA 2APSA 4P4KD 4HV8B 4BZ1L 1H9DA 1Z3GL 1GPOH 3MFFB 3N55A 3GIZL 1BVLB 4EEEA 2PTTA 3X1GA 1U8CB 1OD9A 4JQVC 2X3AA 3A4DA 3TLRA 4U3HA 4PJEA 2EICA 1HJBC 4BM7A 4QRQA 1QVOA 2K0RA 3PGFL 5DF0A 4FS0A 3U7AA 4KROC 2UZXA 4OH2A 4NSKA 2Z31D 5J1SC 1KWKA 4QJ3B 4JN1H 1C5DB 4XWOD 1KMGA 5C0CB 2HJLA 2PWGA 4C83A 3UDWC 1SJEA 3HG1E 1X5JA 1J5DA 4MJIE 1TEYA 5EPMB 4F1SA 3QR0A 3L3OC 3FT4B 5FW6A 1NUGA 4QOKB 5HJBA 1KB5H 1KDIA 1AQ8A 4BHUI 3ZJAA 3A4FA 1VKXB 5I0YA 5HYJD 4N5UA 5KAQG 1U95B 1JPFA 1RZKC 3EAKA 2J56A 3MCLL 1OAQL 1BBJB 3K2UH 3DIVA 2GSGA 1J0ZA 4HJGA 3S4SA 3S88L 1U8LA 1W0VB 1B0RB 4FFWD 5D7JC 5BJTB 5DVPA 4K73A 3S37X 2P42B 2X42A 5LCVL 4ANVA 2IPKB 2WO2B 2P5ED 4Q89A 1XMEB 4JB9L 5IWLA 1PNDA 3GBNH 4FQCL 3WDHA 5C08D 3FN0H 4MNQD 5KVGH 1RZ8A 4U6XA 4Y1AE 5A3IC 2NX5A 4B53A 2YPLB 4NAQA 3ARFB 3D39B 4A2GA 2HA1A 3M7FB 4RSVA 5C71A 3D4ZA 2NCMA 4WY7H 1KPRB 1F8TH 1O7SA 3DDFA 3HEIB 3IE4A 3FZUD 4MVBD 2R23A 3HC2A 4HIIA 1FI8C 5C9KA 2VUOA 5J56B 5JDSA 1C1EH 3QO1B 1JF5A 3V4UL 4PLNC 3HE6D 4NJAH 1KCRH 2F53E 4JL1A 4N8PA 4BJLA 1WUZA 3D52A 2DIJA 2IPTH 5LAXB 2XCMC 5ACMA 5GGRA 3V0GA 2IH3A 5E6UB 3AM8A 5A2CA 4KDTC 4YXHL 4A2MA 5HYIA 2N0KA 3NIFB 2OJEA 2P8MB 3TBBA 1E3ZA 2PW1B 4P99A 4E41B 1UB6A 2A9ML 5JHDE 3FO9B 3MRBB 2GJRA 2AW2A 3QIWA 3V4PL 5DMIL 4XTRD 2NZIA 1YEJL 4ORZC 3TJPA 5JNYA 2G2RA 4MQ7B 4H44C 4NDMB 4QHLA 1IM9A 3GUTA 2J1WA 3CVDA 3HNTL 3MUHL 3V0FA 5LKNA 5ICYA 4C59B 2I5YL 2NZ9D 3HZVB 3T3PE 4NP4L 3EOBA 3TBTA 5LXGH 3RFZC 4X7SH 5F7HA 4IBTA 3QZWG 4R8WH 3AVEA 4UM9B 4XCFH 5EC1B 3CHQA 2NXZC 3EFFB 1CLOL 4KMLB 1NFKA 5KVDL 3VXPA 3C2SA 1NBVL 5FEBA 3EDJA 4Z7UA 1B4RA 4G43B 3REWA 2A6JB 4ELME 3KWVA 4H0IA 2WNKA 3EJYD 1SJHB 2E8ZA 5LLIC 3MHZA 4O2EA 3SJVD 4A67A 1JN6B 4HWZA 3FUEA 1X44A 3FB8A 4W81A 5HDWA 3EJQA 3MLTB 2PWHA 2ZAIA 5DD5L 1M4KA 1IFGA 4MMYA 3U9UA 3AXLB 2DN7A 3VWJC 5D6DC 5CEXA 3BGMB 4ZMWA 3RRQA 4XNUL 4C57C 4N90E 2NRDA 3ARBC 3UP6A 3W57A 2FBJL 1GMEA 1C5BH 2UZYA 3SPVB 5EU4A 4LT7A 5ITBH 5EEZA 2AJXL 2IH9A 2BCMA 5D1XD 3DLQR 5KJ7E 2CHWA 3FHQA 4FTVB 4Q0XL 1TU2B 2DF3A 4OF3A 4JPKH 2VXSH 5L0QB 4H88L 5B21A 3MO1A 3K7UA 4YH6A 4OQTH 1DANU 1MCKA 3RNKA 1AOZA 5LGKA 1Z9MA 2DIEA 3VXRB 1F2XK 1KJ2H 5GZOC 5I8OH 5T5NG 1IKNC 2APBA 2JKJA 3P3YA 4OCRL 3RX9A 3VFOB 1UT1A 2BH0A 3CVBA 5GRJH 5KZCB 1H0DA 4N25A 5E6ZA 1Q1PA 2R29L 4XVJH 4U1IA 4WTZA 1CDHA 5D55A 3NEXA 5EC2B 4DZBB 3SOTA 9PCYA 2EIMB 1EGJH 2DMKA 1LP9A 1TJGH 2YPKB 3BWUF 1THAA 3NQIA 1PCSA 1QA9B 2W65B 3ALWA 4JO4H 1ACCA 1JYVA 3BUYA 1KCSL 2LU4A 2NY5L 2KBGA 4MDIB 4ZMQA 4HWBH 4FL4B 1L9OA 1RI8A 3T0VA 4P4KB 5MI0C 3DX0A 2VMDA 1X5ZA 4ESKA 3HHSA 4YSQA 1F1AA 1TFPA 4EI0A 5F7KC 3MFGB 3X11A 3DXAB 3L1GA 4X83A 1NA8A 1PGRB 5D9SB 1OAXL 2ZOTA 3QAQA 5IVOA 2ZXCA 4WHTB 5DK2A 3ZE0B 3D1MC 4CN1A 2UVFA 5LJYH 4F7TA 1R24B 2AERT 1IL1A 2ESVA 4J3TA 4AWJC 1IKFH 1FFOA 1I7TB 1X7SA 2B20A 3SDAB 3UJJL 1BGXL 1WITA 3LEXB 2VAJA 3FCGA 3OX8B 1FPTL 4BFFA 4UB0H 3WGUB 4FADA 2BVEA 1AP2A 3RPIA 4K9EC 5EZIH 4R5VA 1SYSB 1F5WA 1T1ZA 2IVFC 3LXUX 4IHOB 3W11D 4BQ9A 1JZ6A 3S34L 4IGBC 1CK0H 2V4LA 4BDVA 4KI5D 2QADC 4IKLA 3T71A 2WTRB 1OE2A 4WTZG 4QTHB 4I9WE 1HXMA 5FF6B 5GJSL 4PVNA 1HEJC 5C9JA 1QR1A 4PYGA 4P49A 3ESUF 2A74C 4PJGE 1NCAL 2LW3A 1BJMA 4AMKL 1NIDA 3MV8D 4YSPA 2DKUA 4YMPA 3V4PB 1Y0LA 3L4TA 3G6DH 3GHEL 1DN2A 3A21A 3IJYA 4N2CA 3BWAA 3QR2A 3CFEB 3B7TA 1HKLH 3C5ZC 4MNQB 2H47C 5D70H 3N41F 4AV0A 3CJJA 5SWZA 3CC5A 3U4EB 2JNZA 2FWOB 5EBLA 2WLYA 2CH8A 4AGLA 5F44A 3V0EA 2XZZA 2A7BA 2QL1A 1KBKA 3BPNB 3BP6B 5K59F 4DJMA 3FT3A 2PCFB 2DYPA 3C2AL 2WQWA 3BDXA 2ZXDA 1C8QA 2X1WL 4OZHA 3HE6B 5IIEB 5C07A 1PCXA 3UAJA 1GJWA 4NNYA 3QORA 3WFBH 5GRZA 1UGNA 3BP5B 1GKEA 1PW3A 1S7TB 2PWEA 3PIQB 1FZJB 2VC2H 2NTFB 3U1PA 4JDEB 1SEQH 4NIKB 1MPAL 3VD7A 5DVOA 3K8KA 2VLRA 1OAKL 1F6AB 4UQ9A 5IFJA 3L9BA 1WO2A 4KTDL 3N06B 2BZDA 1BEYH 3VXTA 3W0WD 3WFCH 1M1XB 1WA2X 3QFJA 4P2RE 3T1FA 3TIEB 2YAHA 3F7LA 4AQZA 5TF1H 2ZIDA 1KN2L 1L0PA 2WVVB 3MGOA 8FABA 2VH5L 3RGHA 3RZCD 1JPTH 3V10A 2P1YA 4BA8A 3LEVL 5GS0D 4UTBL 3EYFA 1D5IL 4X6CB 4U1LB 2L7QA 3AGWA 1IGIH 5FW8A 2W60A 1IFRA 4GO8A 1QRNA 3P3UA 1JPGB 1KXVA 2MOGA 4OM1L 4P57B 3VMOA 2WBXA 1PZ3A 4WUUA 2AEQL 1DLFL 2AMUA 5EU6A 1IC0A 4ZMOA 1Z5LB 5JYMA 4FYSA 5DLMH 3Q05A 4WNSA 1NEUA 3MROA 5IZ7A 2MOQA 3QEGL 4I3SH 1I7RB 1ZHKB 4ZW6A 1AO7D 1JPST 5IY5B 1COBA 3BAXA 3GXDA 1LK2B 3SJVB 6FABL 1QI5A 4XOBA 4NZUH 3O6LL 4PRNB 2QR0A 3QULA 1NDMB 2XXMB 4PJ9D 4LNVA 1KGWA 3E6HB 1Z5HA 5IQ7L 2QPSA 2DDQH 5FAAA 2IEPA 4HLZG 2O5NA 2NNCA 2OSWA 2WQUA 5KANG 1IC7L 1FNSL 2OMUB 5TE6L 2DAVA 3R7QA 2OPCA 3TASA 4NM4L 4JM0A 1N10A 3VUAA 5GS0L 1WTGT 3BO8A 3LN5B 5I30L 5D1XB 1U6AL 3IDXL 4MD4A 2OX5A 4IK7A 2O1AA 3V5HA 2R0ZH 3D85A 4QHKI 4QY8B 5HVHC 5T1LA 4ICWA 5DZVA 3MPCA 3MV9D 4H5SB 2JXMA 1QFWL 3X12B 3WN6A 1OCCB 4OD1H 1J5CA 1T21A 2VO8A 1FRGL 5KVEH 1SXCA 4JFFD 4X9YA 2V2XB 1KV7A 1HAUA 1K5NA 2OL3A 3ZMRA 1FO0A 1XH3A 4GXVH 2ZP9A 4NUJB 4Y8AA 5IW1B 2OYKA 4BQ6A 5EO0B 3VX1A 3I74A 2WNGA 3D09A 3RL1B 3ILDA 4POUB 4RFNB 5JPNA 1UYWH 4XC3H 4CAGA 2HKFH 4O9HH 2DQGL 3UC0A 1JYWA 1LO0H 2ZG2A 5EO9A 1BBDH 3F8UB 3Q3GA 5GJTH 2DYRB 2GJ6D 4JJOA 3VG0H 4XCYA 1T83A 3CTTA 4J1UB 3EO0A 5CGMA 2ALWA 4UQ3B 4JG0L 5JXED 1CBJA 3MNWB 5I6KA 1SOKA 2ERJB 2YPVH 2BNUB 2FJHB 4G80B 1B9KA 3OBAA 5E9DD 2XY1A 3FFCD 2I9TA 5CGBA 5IB4A 4E9WA 1IU1A 4NHCH 4CBZA 4C4UA 4O02L 4AEEA 1IAOA 1EXUB 1T4KA 3FQWB 4I8DA 2P7TB 3T4AA 1UOLA 4NQUA 5C7XH 1IAIH 4P04A 5ABAA 1MVFA 1NGQL 1S78D 5DHVB 1GOGA 1ZVSA 1NMAL 3NCMA 5AW5B 2OXGB 1PIFA 2P45B 2XN1A 4ENZA 2BDNH 5T1JA 2X9XA 2FB4L 5CEZE 3NJXA 3EYVA 2G9HA 3ZTJH 4RESB 5EDXA 1MHEB 2CA3A 5I0ZA 1ETZA 1PS3A 1KSRA 2J8UF 3DVGB 5L2KD 1MDAA 1MY5A 1MJ7H 2EDBA 3DETD 2FO4B 5DD6A 3U0TA 3WNKA 1DVFA 1A7PH 3BVWA 4FP8L 5B4MC 5FM5O 4JQIL 5KANI 1JD9A 4UTAH 5CWSA 2YOAA 4QHMB 5H94B 2R0KH 4RBPH 1IQDB 3MV8B 3QHFH 4KQ0A 4BV1A 4TVPD 4M8QA 2BPBA 4GG6E 4UZGA 4YDVB 3VD1A 1CDCA 1R75A 1A14L 2GIYA 2XZQH 4OF5A 3K80A 5J1AB 4B9ZA 2VSDA 5E00B 3FRUA 1K6QL 3BJLA 4HF5H 1ZEAH 4Z7WA 4YDIH 5EUKB 1ONQA 4JFQA 1A7QH 3RFRA 5BV7C 1U3YA 4ZOEA 4ISVB 5KYUA 3ARFC 5EORL 1L5GA 3IDNB 4R3SB 2AXHA 4G6ML 3SO5A 1YY8B 1L7IH 2WXRA 2WKOA 2D2CC 3PAVA 3SE4C 3LKPA 3PL6D 4LP4A 5E5MB 1YCSA 1PDKB 1U91A 4LSUL 3VMPA 1X5KA 3CXHJ 3FU0A 1ZA6B 3I75B 3IBOA 1TVHA 2G2PA 2RALA 2VRAA 1GVIA 1PG7W 3ZSTA 3GHBH 3QEQD 5EUOB 3NH7H 4Y19E 4DQAA 5KS9F 2XJLA 2H7WA 2WWNA 3CFNA 5FA3A 4MQTB 3ZHLA 5D7HA 3HLAA 3PV6B 3TYFB 4KDWA 1YNKL 2E5EA 1YPZB 1JPSH 1LL1A 1MUJA 3MV7D 4TVPL 1AQKH 5B8CA 4RX4D 3W0WB 3CMOH 3UPAA 1P5VB 4NZJA 2GT9A 5J3HC 2WZ0A 1U8KB 1X3DA 3B2UD 5GGRY 2HSIA 2RMNA 3TC9A 1HILA 4M5YL 3T2QA 4NO5A 3PQYE 5ISZE 4TLSA 2XZCH 4JZNB 3OAZH 5CEYA 4Y9CA 1OAUH 2Z8SA 4XP4H 2B2XL 2WZPA 2ZKYA 1KLUA 3MV01 5EOTB 2VLME 5C0RH 4X4ZA 2YBRB 4E5XG 5FYLH 1EEYA 3RIKA 3O3BB 4WLCA 1G7IB 2Z91B 7PAZA 4BSWB 3VI4F 3FPXA 1JG9A 4R7XA 2VR9A 4RZCA 3ZT6A 3NFNB 1PPIA 3GRBA 3A67H 3LKRA 2DQ6A 2XKNA 1IC5H 4PH8A 1AO7B 3PCYA 2AJYL 4X5QA 3NDYE 3JTBA 5DRXB 1DQDL 3IDMA 2XWBA 1HHGB 5D8JL 3BWSA 1BFSA 1RPQA 3QA3B 1CB4A 5E0QA 4L9DA 2VL4A 5I0XA 2E74C 2WBKA 2Y3NA 2YEZB 3CFKB 5D7KD 3C60D 1TDQA 1RJLA 5KYYA 3MOAL 4XN7A 3ZVVA 4XBGA 1XDTT 2QQLL 2WZ6A 3U7WL 3HS9A 4H2CA 2K4WA 2D3NA 5D7SH 1U42A 2XA8L 5HHVH 4V2CB 3TO2B 1XGPB 1U3JA 3P11L 2OR9H 1RZFL 2W80C 3TONA 3GXTA 5J57B 2A6IA 1DHKA 3SPIA 1F4YH 4KKQA 1KGCE 4KK8C 4XHQA 1A6TA 3LKSA 5E8OA 1XAUA 3DIFA 2DQUH 1JYXA 2P4AB 4JDTH 1NAKL 1G84A 2QQNH 3B83A 1ZJBA 1FNHA 2FSEB 2WV3A 3COOA 1RUKH 3U6RA 3MLYH 3FQ2A 2XWJA 1TO4A 2GJZB 2TSAA 1N0XL 2VUKA 4O02B 4JHWL 1EHNA 4JFFB 5T8IA 3KPLA 2RHEA 2GJJA 5HVGB 5ADOH 4RMTA 5E8DL 4K7PX 1NFDA 3QI9A 3ZDXF 1I9RH 4YPJA 3J7HA 1WZMA 1AHWA 1T1YA 5TDOB 1BZ9B 1B4LA 2ATPA 2QZ5A 3RHWK 1LQBC 1KWGA 3KAAA 1SHXA 3PUCA 2FECI 4KXBA 3O81A 2W0KA 2Z93B 4L4TE 1JZDC 3WEOA 5I1DA 2CO4A 3VI3A 3OPUA 5H35A 1NKGA 4N2OA 2WK2A 2PTUA 4H1LA 4FL4C 4Z7OE 2BHFA 3U4AA 2GJ6B 4JRWA 4P4KC 2BNRD 2GQHA 3ISRA 2EEFA 4M4RA 1KEML 3EZJB 1BXVA 1MF2L 3VXSE 1HIMH 3QQDA 3BFWA 2C34A 4AGNA 2B59B 4JPWL 1TZGL 3LAFA 1BAGA 3ULVF 4G7VL 1C16B 1MCRA 4BQ8A 3PF2A 4ODWB 5E9DB 2X6BA 4PWFA 4YFLF 3VD4A 3G5ZA 4Z9KB 3FFCB 3CLFH 3RDTD 4NRZB 4PCTA 5T5NF 2Z31C 2YD1A 4WTWA 4P2OB 1D9KD 1P1ZA 1TNMA 1YQ2A 3IFPA 4XWOC 3AACA 2BO0A 4PJFB 4X6BA 4K23H 2GUOB 5E6IA 2ROYA 1LVEA 3ZHDA 3IKCB 1S7RB 5KSAB 4WFHD 5ENWA 1IAKA 2HLEB 4PJBA 2YN3A 4L3AA 1BYPA 5DI8B 2CGZA 3PAZA 3EBGA 5ESQB 1DJWA 2PWFA 1Q9WB 5L2KB 4A66A 3O3DA 4PJAA 4NNXA 4I1PA 3Q06A 5DDHB 4QRPD 5G4OA 3MREB 3QCVL 4Q4EA 1CDBA 3LH2H 3EDEA 4ZMZA 3NZUA 4L29A 1WBYA 2AAVA 2P5WE 3MRFA 4FFWC 4UV7L 2D7OA 3GJFA 4LL9A 3NGBB 2ADFH 3QARA 3K4DA 1E28A 3GLEA 3HC0B 2W95A 3BXNB 2EO9A 3LV3B 1SQ2N 2CKNA 4RH4A 5KSVA 1I3RA 2ZUSA 4EDXA 4TUJA 4XPGH 1UB5B 4I3RH 4ZAKA 3CCHB 4ADIA 5SWQB 2DBJA 2JSFA 3OF6A 2BSTB 3ZK0A 1OP3K 5TE7L 3FZUC 4MVBC 3FB7B 3PL6B 1MSPA 2VDQL 5HHME 4ZQTA 1J8HE 2GCYA 3KWXA 2QGDA 1CLYL 3OLEA 1FORH 3QWRA 5CGYD 4NO2B 1CFNB 3TA4D 2VM4A 2FJGA 3HE6C 1QW8A 3GPSA 4G9FE 4F3FA 1AY1H 3FCSA 1SPDA 5A7EA 3S3PA 2JQZA 2ZCZA 3NA9H 2OS7A 1E4XI 2NW2A 2FIKB 3P2DA 3L08A 1KFGA 2AXFA 2EUWA 1B2WL 2WLZA 2E7HA 1XTLA 1INEH 2MWCA 2VDPH 5IEHB 2R8SH 3MZGB 1DZ0A 1MEXH 5JQ6L 3U83A 3ARWA 5ID1A 4IU2A 3DX9B 3MV7B 1A5FL 4TSCH 3T2NL 3SPGA 3ZDYE 4PY8I 4XTRC 3DYOA 2H8PA 4UMSA 5CXPA 1ZGLB 3FTGB 4G8GD 4XBEL 3IJEB 3B1UA 4PJIE 4BGDA 1KFAL 3LNIA 4S0SD 4LF3A 4NT6B 3GMPB 2ITCA 4YHKH 1EZVX 1F11A 1CCZA 4JPQA 3LRGA 3LS5L 1N6UA 3MRKB 3T0BA 2NW3B 4ZYKB 5HHOE 2N59A 3L9YA 1NBYA 1WC7B 4IYKA 3QJXA 1OVZA 2MQCA 4PS4L 4POYA 1OGAE 2XV0A 4BELD 1I8MB 1ZTXH 4YXLH 3QHZL 5DJDB 5BXFA 2JJSA 1AR1D 3EJYC 1UD3A 4PJDF 3ZIMA 1ULVA 2LU5A 4L9LA 1R19A 4L18A 3X14B 4AGOA 4NJ9L 3FK3A 2JIXB 4CC0A 1DLHA 3C60B 4J8RA 1E5AA 4KHTH 4N0RA 4X9IA 3N1GC 5FDYA 4HCRH 2HKAA 3QFDA 4LLVB 1I8AA 4F7KA 4U1SB 4MNGE 4ODHL 3UTTA 2NY1D 2NY5C 2WKGA 4OZIA 2ITFA 4PCYA 4JZJB 1LNUA 1LMKA 3Q6GL 4PWJA 3NRPA 1G1KA 4M9PA 4YSRA 3BD3A 3MRCB 4NCDA 4NWUH 4C47A 1HHIB 5D1XC 5FW7A 2NNXA 1VSCA 2VDOH 1MJUH 1E3FA 3QJHA 3A6BH 4O4YL 1PX8A 3KXFB 1U8HB 1FNGA 2BNQD 3QW9A 3QIBD 2E0PA 2JI1A 4M7LT 1QWUA 5I1JL 2DEYX 3CDCA 1CFMA 2ZCLL 3NACL 2BY0A 4TNVF 3SDCD 4P5TD 2PABA 4XMVA 4JE4B 3C87A 3CSPA 4G8EB 1WZLA 2O5XL 5AVUB 3GXPA 4LCIH 5HHXH 3C6LA 3WXVL 3P0YL 5E0FA 3MUY1 5HGHA 4E68A 2WQSA 3CFCL 5I8CA 1NFIB 2R1WB 4B9GA 2UYLA 1I3UA 4JO1L 1XMWA 1J7VR 5C0CE 4NNPH 4FFYH 3SGJA 4XMPH 2ZKWA 2EDWA 5EU5A 3VFVA 4U1HB 2N01B 2ZWKA 2OMXA 3NAAH 4S11A 3ARGD 1NCDL 2GI0A 2OCCB 3U36B 5F89A 1MCFA 1S7UB 2MTAA 1QP1A 3L9RB 4QOKE 2ICEB 5KWYC 4C8XA 1WLHA 5E1AB 5B7EA 4UQBA 2WLIB 2JK5B 5DRNA 1MLBA 3HCVB 5JHLA 3T77A 4N1HB 1FL3B 1R3IH 3RDTB 1DUZB 3I2CH 4HDIA 2DQTH 1LO4L 1EAPB 5TPWH 3WIHH 4BZYA 2ALAA 3FHAA 3SE6A 1D9KB 3RVWD 3DX6A 5IQNA 4HJJH 3N1PC 5KBDA 3D34A 3OB0K 2HJKA 1A7OL 2K7QA 3HMXL 2J55A 1DQJB 1UOVA 1NGXA 5I1GL 4MJ5A 4ZTOH 3W11C 5DJ6A 2WWKO 4F57L 2YPLE 1WFJA 2OMNA 1IQWH 3ZIYA 2EILB 2H5UA 1GS6X 4KI5C 4NOBA 4JEGB 1LYQA 2X4OB 3GSQB 4BFBD 3L5IA 3BP7A 3DV6A 2VDLH 3RL2B 4PGBB 1YEGH 4QRPB 3V0VA 1ZKAA 2EYRB 4MDJA 3ZO0A 2EC9T 2A9CA 3F12B 4B27A 4GO9A 4QHUA 2FEDD 3VA6A 1NIEA 25C8L 2JCCA 4PWEA 3T2PA 5EBMB 1UD5A 1ERNA 4G6AD 1IEHA 4HBCL 1HXKA 2ISDA 2WXJA 5GZNA 2Y5EA 3FO1A 1X5LA 2C3VB 2YLHA 1A6ZA 1JFQH 1NC4A 4HCGA 3ZX1A 3NIFE 2AC0A 4M61B 4JG1L 2J88H 4GQRA 3WEXA 4DVRH 4HXBH 4E41E 2Y7LA 5LXVA 1N12A 4ONFH 4QRBA 2IWGA 1XCQA 2DQIL 4HC1A 2FJSA 3FQTA 5SX5H 3GBML 2K6YA 5CU5A 5D71H 4I18B 5KYWB 5JHBA 1FCGA 1OWRM 5KSUA 4G59C 2D31A 1UD2A 1CDYA 1YEWA 5IV2A 1A02N 4HJTA 1G7JB 1M2OA 4YR6B 1MVUB 3S3JA 4GQ9H 2EH7L 5AWNL 2YMTA 5IBTL 2F2HA 3FC8A 4BZ2H 2H1PL 1FVCB 1VFAA 3BP4B 4KJPD 5IR1B 1ZANH 4TSBH 4IIQA 2BRRL 2IFGA 3QK0A 4AC4A 4F8NA 2H32H 1DDHB 5DVMA 3NYKA 5CJXC 2DMCA 1OM9A 3FRPB 3IU3B 5F72S 3NOIA 1YNTF 3HMWL 3T8XB 4U3SB 3A22A 2SEBB 3O3AB 1NEZB 1N9PA 3EH4B 1XSKA 1YMMD 5C92A 1DP0A 4XOAA 4GFTB 3BPCA 3V6BR 3ILEA 4C4KO 2VDPB 3HG1A 3V9EA 3RZCC 5IESH 2E6JA 4MJIA 3GMQA 4NKMB 4UILH 5GS0C 1AHMA 3SE8H 2G5BA 1FYTD 3GSOA 2ZCKH 1TITA 2BW4A 4UM8A 3ENEA 3GXMA 2EDTA 5MENB 3W2DL 1AKPA 3LSOB 4UV4H 4FZ8H 6CGTA 1L0XA 3N0PB 4FXGA 2QMJA 4AV4A 1EO5A 1KYUA 1YEDA 3VGFA 4M7LH 1BOGA 4ZOAA 1QSVA 1AR1B 2ZCHH 4GAYB 3V0IA 4FTVE 1QO3A 1RIVL 3PPSA 3LMJL 1N8OE 2QHRL 2YUWA 1A6UL 1KJVB 1R5VB 1E5UI 2BRQA 1TJIL 4Y1AA 5FKPA 3RNQA 3GKWH 3SCMA 4XMUA 2ZKHH 4HUVA 1B2YA 1UT2A 3JV6B 4HUNB 2IOOA 4PJ9C 5T1DH 4X4XB 3QUKB 3VXRE 4AVHA 5I71C 1XZ0B 5DRWA 2PPCA 5AB1A 2NY1B 1FGVH 1W8NA 1YMHB 4PMFA 4WI0B 3RY5A 3DURB 3S9DB 2QT6A 4HFUH 2GC7C 1E7VA 2OW7A 5AVRB 2J1ZA 2NLJB 2F9BT 4M9OA 3U30B 2LFGA 2F53A 3AS2A 3EGXB 4LPXA 4KVCH 5TFSL 3FQUB 2KPNA 4WJG3 3BUDA 2ITDB 4AIZA 3DO7A 4D3CL 3H9SD 5LUMA 1KGIA 1H3VA 2AFNA 2ZXEB 1CIUA 3L7EB 3QIBB 4HJUA 2HCZX 3IB4A 5IVXE 2ZT9C 3QH3B 3FTUA 2Z92A 3IXTA 4OJDH 5JHDA 3SDCB 4YSCA 2VXUL 3Q8FA 4AGMA 3I50L 3LQMA 4RVBA 3DXAE 1QLFA 1S6NA 5IUSA 5IJKA 3ZE0E 1UC6A 1AZUA 4JCLA 1ZLSL 2VE6A 4OCXH 5E7FA 3ME0A 2Z6FA 3QIUB 1WZ1H 2IFFL 4DP6X 3CX5K 3T3MF 4HEME 4XBMA 3ELAT 1TQUA 2FUTA 3HI1A 3QQ4A 4MJ4A 5HHNB 4Q9QL 4PTUB 4G1MA 4WJKB 2X4RB 5DMGD 2VT0A 5IGXH 4K3JL 5GS2H 5MEOA 3VXNA 1KZYA 1CL7L 1G6VK 4JO2H 2DV6A 1QBML 1G1OA 2Y36L 4ELMA 4NZRH 5JXEC 5DHMC 2E6QA 1BJ8A 2HVJB 3OMNB 4K7FA 5HYJE 4ZX3A 2L7JA 5DA4A 1ZA3B 1QHQA 5GS2D 2XWTB 4M4PA 4FHKA 2EYSA 1D5ZB 5K9KA 3KD4A 3NCFB 1CICB 2WNWA 12E8H 4HMDA 3TIDA 4YO0B 5A2IH 5ES4B 1ZGLM 2BOLA 2EDEA 2P5EE 4LLMB 5ADPH 4JY5L 1S78C 4XP1H 1BXAA 3LPFA 4GP4B 4MNQE 1K85A 1TR7A 3Q1SH 4FXKA 2OV0A 1QZNA 2X4UB 4GXUN 4HUWB 1RUML 4WF7A 1J0IA 1LD9B 4DVBA 2F61A 4L2YA 5AVSB 3OAYH 1O5PA 1CYGA 3HC4L 1QFUH 2N1TE 3HZ3A 5KVGE 3S3SA 5IBLC 4AJWA 1QLEL 3HZKA 3JV5A 4JFSA 4J3WA 4P23D 3SPHA 2VR8A 4I5BB 4ODUB 5F7WC 4KQ3L 3VGAC 3OKMA 5JW5B 5AYQA 3NGBC 4CJ0A 1YAIA 2CAKA 5DEZA 3WJMB 1EMTH 3D87B 3SQRA 5JXAH 1H8OA 2PR9A 2GAZA 3LKNB 3QIWD 3HR5B 3RWCB 3BT2H 3RWIA 2M2DA 4KZEL 3FT1A 1ADQA 4Q56A 3DX8B 4Z78A 1CO1A 3DMMA 2J72A 3OHMB 3S48A 3P73B 1S7SB 1J9SA 3SBWA 1S7QB 4EUPB 2VXQA 1OSPH 1U8NA 4DN3H 2IWKA 3OLDA 4K94L 3HPLB 1BXUA 1CYXA 1CXHA 4N0UB 4WGKA 5F6HI 4FYRA 4Z7QF 3PL6C 3VNYA 5CZRA 3P4MA 4LSSL 4JMXA 1IBGH 2FBRA 3FSWA 4GW1A 3ULVD 1VERA 3RWEA 1XR9B 1ZSHA 4XPAH 5GGUA 3MA9L 4X6CE 1PLAA 3NBNA 1UM5H 3V79C 1ZHBB 4HIPA 3N1QC 2HJFB 1FCCA 4NO3A 1MLCA 1P6WA 5IBUB 3POHA 2IQ9H 5FX3A 5INCB 3QXDB 4DSYA 4L3FA 4LDCA 1L6XA 3GSRA 2XJKA 4IS6A 4OLWL 4LNRA 1YMMB 4YIQA 2OMTA 3K4AA 3CWGA 4ALAH 2OMYB 4PGCB 5DD3H 3B2UC 1A1OA 2MFNA 4KK5D 2J8UB 3SJVE 1WIOA 2AV7B 2EXTA 3AT8A 1UFUA 3FH5A 5L4MA 2BSBA 3DUUB 4OLVL 4MB5A 1JVOA 3US9A 1FYTB 2R2BA 3IBEA 1HHKB 1GYCA 1SM3L 2CLRA 4D9QE 3TH2T 5JIIA 3PYCA 4Y16B 2Y23A 3PGCB 5L2JB 4WGWB 5IVNA 2F58L 1SOQA 1S9WA 3MXVH 3ULVL 1E50A 1NGYB 4X0KB 4F9LA 1ZDQA 4IEFA 4KHXL 1RMFL 1TENA 5D1XE 1EDYA 2KQNA 4AYFB 1TSRA 3T5WA 3DHPA 2ATKA 4MA7L 1TVDA 4A2EA 2MSPA 1BQLH 1IAII 2WXIA 4Z77A 4K3EH 4QRSA 5DRZA 4C58B 4G8FA 3LZOA 4YHNA 5C0FA 1MCWM 1D5MB 2VSMB 4M1CD 1UM6H 3O6ML 3PWJB 4RA0C 3UO1L 3NJNA 1DBBH 4PB0L 2WAHA 5JZ7D 5DT1H 2NUPB 2EVGA 2ZWYA 4L1TA 2WWOA 4XXWA 5KS9B 2AQQA 2IAMD 2VR3A 1I4FA 3GI9H 3UX9B 2HT2D 1WD8A 3WFDH 3C12A 4LPUA 5TDPA 4C4BA 2ORBL 5TQ2H 3INUH 1LLAA 2X6CA 1K8IB 2YAOA 4AE0A 1CDGA 1Q94A 3H9SB 1EX0A 2DYSB 3HA0A 4RWHA 1D5RA 2EEBA 5DEGA 2MJWA 5GSRB 1VAHA 3V9CA 3GZOA 1EO8H 3WKQA 3TBYA 5JLZA 1D2PA 1DBJL 4B9CA 4Q8BA 1U8JB 4TMPA 4PGJA 3P77B 4P2RA 5T3XD 2ESVD 2QGBA 3KPSD 3S35L 3PHQA 5IMLA 5AVVB 2X53A 1QW9A 4K3GA 3P30L 3UCQA 3WTYA 4BHUA 4ZI8A 1U8PA 4M1DH 3SIKA 1P7KA 3WXWH 1RJYA 3VI4B 1F02I 3ABKB 4GBXA 1PZBA 1W15A 1S2EA 1XGYH 4OFDA 1DL7H 1NKOA 3KJ4B 1QLEB 3LS4L 4G7YH 1LE9A 2E9GA 3FU6A 4I88A 3KPRB 3IJ8A 5HI4D 3VH8G 2ICEC 4KI5E 5LN4A 2E27L 3IF1B 5CJQH 3P2BA 3VFUB 1HL5A 2X1XR 2PO6D 3B2VH 1N5AB 4NKOB 3EFOB 1BP3B 2ZKXA 1HE8A 4Y2DD 2OA9A 2WQRA 2NYYD 3LNFA 3MV8E 4G71B 3RDTC 4WU5B 2D0GA 3WFHA 2HVBA 5E99H 5JUEL 1KCKA 5SWZD 3QZWB 3ZYZA 3BE1L 4H7VA 3V0HA 5T3XL 4B3VA 4ZFOL 5KUKA 5CMAB 4ZO6A 2RBLA 2W59A 1M71B 1VB9A 3QS2A 2QHLA 2BP0B 1U0QA 3QEUA 1DO5A 2Q0ZX 4M6AA 3CLEH 4QJ4B 1OHZA 3ARPA 5C07D 4H26A 2YXVA 3S96A 3UAJD 4WV1A 1Q0EA 2QMKA 3NCWA 2Y1AA 4HLZH 5ERWB 1AXIB 3SDYH 1A8ZA 3S36X 4JR9H 2ZZUT 4P23B 2B15A 4KKLD 3GI8L 4DKEL 2H6UA 1KBGL 3ZY7A 1A6WL 2EUXA 4XCEB 4UAHA 2OKMA 3L3KB 4HK3J 3ZDXB 3EBIA 3AWEA 2OJEB 3MUUA 4AK2A 4EIZC 5EUOE 2HH0L 3N43B 5F21B 2QFPA 3DDGA 3W39B 2EXWD 2JB6A 4EO5A 3L5WB 3EYSL 4MXVE 1XBRA 1QEWA 3BWUC 1S7WA 1QPPA 1YPZE 3GUTB 2EE2A 4G9DB 3DSNA 3FHEA 1F6LL 1NDTA 1YECL 5DZPA 1V3MA 5ICYB 3L5HA 1A6AA 4ODVL 3W0WE 3VRIB 2W9DH 5C0GB 1DQMH 3B4NA 3CDZB 3GGWB 2DJUA 5TH2A 5DD1H 4ZSOB 3UDWA 2VR7A 4YGVB 2ZUYA 1DQVA 1GYUA 5A6MA 2AK1H 3CZKA 3F58H 5CGYC 5JIHA 3DYPA 2VMCA 3E9TA 3MR9B 2WD0A 5GHWL 3L3OA 3MU3A 2JKRM 4N2AA 3PNRB 3ET9F 5EU6D 5C2BH 4ONHB 3RWGA 1A3QA 5F3HA 3APCA 5AB2A 2C3XA 2YKKA 3E0GA 3QRLA 2A73A 4W9EC 2EH8L 4GW4B 3BEVA 4IOIA 4YVUA 3LKQB 5D7JA 3O6FA 4UTCA 5CNHA 1O9WA 4R6UA 1VPOL 3QNFA 5GGQH 2FJFA 1F4XL 1AO7E 4LSDA 3R4DA 2PWDA 3K5SA 1XGRA 1YN7B 4FQQA 2X09A 5I1LB 2CK0L 3GMLA 2OSLA 3LEYL 3GEFA 5F88A 3BRDA 5LGJA 2X5PA 5I8EB 1RHHA 1VF5C 4LVOB 2WXKA 3MJ9L 5D5MF 1PX3A 3VG9B 1XIWB 1FFNA 2WKLA 5E94B 4A2FA 3TGXA 2IDUA 2LLLA 1FHNA 3RWDB 3SY0B 4NM8L 1KNOB 1SMAA 4JANA 2WXMA 1UKQA 3HC3H 2CDFA 4WKXA 2VISB 1JVLA 1S5HB 3D85D 2WCSA 1XF5B 4HS3A 4PREB 4HLJA 5T1LD 2YSTA 2OL3H 3NPZB 4K2UL 4A7GF 3PP4L 3HKZA 1N7MH 3LNGA 4GG6A 4EVNB 1AR1C 4X9FA 1WK0A 3CPUA 4OTXL 5FWQA 4YDKH 3GS0A 2IPUG 2KS0A 1ECYA 4HZLB 4KDTA 1GGYA 2O6FA 1SOSA 32C2B 4P5SA 4QF1A 5BS0D 3UAFA 3DV4A 3BQUD 1BXXA 1VFBB 3UC0H 2ED9A 2DQCL 5BVPL 3I6GA 1YJDL 4JFFE 5I74B 2G4GA 1Q0YL 4U1IB 5FCUH 2C8NA 2NY1C 4RFEA 2I9LB 4DZ8B 2JJTC 1LP9B 3V0AC 4OBSA 4Y88A 2IAMB 3EO9H 5F7DB 4IRSB 1NWOA 1PD0A 4K5PA 4PQXA 5FKAB 3U30C 4W70A 1MCDA 1BW8A 3Q8BA 3ROOA 4AE1A 2C9PA 3NQKA 5JOPE 5B1CA 4DW2H 1AZBA 1ET7A 4HIHA 2CJ3A 3HNSH 4JGJA 1OALA 2R27A 3UZEC 3QIBC 4NKQB 2GJ6E 3J07A 2ZOLA 4LASL 4PJXF 5LNEA 3BEWB 3KVQA 3Q6FA 3OTTA 3SDCC 4AT6A 4OJFL 1ZWIA 4P5TC 4B97A 2YIHA 1IM3B 3DARA 1MDTA 2DEWX 5F96H 2ESVB 5HI3D 4ZFOB 3KPSB 5AW6B 3VFNA 4Z3JA 1ITBB 4ZPVA 3DRTB 5E9DE 5EWIH 1NMCC 4RAUB 2E9IA 3E9UA 3FFCE 3KNBA 3MUZ1 3PQYA 5DJXB 5IHWA 5ISZA 3VWKD 2GUYA 4QXGL 3TV3H 1HWGB 5CBAB 5A2LH 3FONB 4M48H 1SJVA 2XKSA 3KYOB 4XP9L 1Q72H 1BIIA 3TBWB 5D6DA 1UA6L 4PJFE 1JDCA 4NZTH 3QG6A 4X99A 1A7BA 1KENL 1NCGA 3JTSB 1XB6A 4HGMA 3GQFA 4MCZA 3UPRB 3BSZA 4ODXA 4R96A 3WAJA 4ZW8A 1THCA 2YAQA 2WIIB 1DVFD 4PJDB 1OTUD 3ARGC 5C9JB 1ZLDA 1PFOA 3CVIL 1GZPA 3AROA 3AU1B 3NCEB 5FFGA 2EUVA 4M6MH 4MD5B 5L2KE 5HYQA 4KKCD 4AQ1B 1BQ5A 4J3UA 1HNYA 4XOEA 3WELA 2PO6B 5DS8A 1SF3A 5JOEA 2HLAA 1JHLL 1RZGA 1YA5A 1YYLH 1YO4A 4UT6L 1RSYA 1E4KC 2W07B 3BWAB 4Y2DB 1MWAL 2CR0A 3B2MA 4ZT1A 1BWMA 1XX9C 1JZ5A 2XZAH 4TVPE 1HZHL 1QNZH 2UUDK 3ZXAC 4A7UA 3RVWC 1H3PH 3B8SA 3RX5A 2CU9A 5EBLB 1IKNA 2XQYA 4L8CB 2AXWA 1KN4L 3O45B 5I1KL 2ZX5A 2H26A 2BVQB 3DPBA 1D6VH 3IJHA 1G4RA 1VGEL 5C0EA 2CRZA 1DVUA 4TF4A 4JHVA 3NSCA 2VIRA 1P4LA 4LBEA 4N1CA 4LCCB 1XTMA 1YZZA 4B96A 2E4FA 1IGYA 1AANA 1HINH 1OSEA 4PV8B 1CS6A 1JE6A 2V7HB 4TSAL 1O6SB 2X38A 4YAQB 4GAJL 5C07B 1UJ3B 2R4SL 4LVHB 3SE9H 3RAJL 2FD6H 1OTTD 5CZVL 1A4KA 3QDMD 2VABB 2OTWB 3B34A 4J4PD 4PG2C 3AXHA 3WTTA 2FEDC 4S1RH 4CGTA 3OJDB 1EHXA 3ABGA 3ZBMA 4OT1H 3EOAB 2HFEB 3JTTB 4R97C 5BO1H 1EBPA 2AEOA 1JSYA 1A3RL 4Z95H 3JV0A 3WY3A 4ZDHA 3A4EA 1HH9A 4WK0B 2P80A 4WEBL 3UYRL 1N6VA 1QUNB 5I5RA 1MFCH 1UWEH 3MLUH 2FYYA 4DN4H 3CD4A 4ZUTB 3KPOA 3CC1A 4JY6B 4EIBA 1T3FA 3OHXB 3MV7E 3DGDA 5CHNB 8FABB 5CN1A 1E7UA 4LCVA 4LEXH 1JRHH 2Y22A 5DWPA 3QUHA 4L4TA 4MA3A 3W81A 2V17H 2CBOA 1DVSA 1FE8L 4YDJB 5FM5M 4CSTA 1XSIA 2VXTL 1SN5A 3ZE2F 2X4SB 2UVEA 2N3JA 2BHUA 2XPZA 4Z3IA 1R5IB 2QKIB 3WTWA 4IGBA 3VXSA 4KJPC 4JREC 4YLCA 5INDB 3GSXB 4M6NL 1RQ5A 3S8FB 5LG6A 4CN4A 2F8XC 2G0LA 1DCEA 2J25A 3GYRA 4FAAB 5I1AA 2YA0A 3VCLA 5MERA 1CN4A 3KVDD 4EJ1C 1LDSA 1X5IA 4OLYL 5T3ZH 3QQNA 4H25A 4C56D 1MG3C 4KO6A 5FO9A 3IMBA 3ATBA 2AMGA 3BHBB 4TOYH 3BUTA 3HFML 3U1SL 4P5MB 1BLIA 1R9FA 3HG4A 3EGSA 3C5ZA 1N3NB 1JCKA 3ZLQC 5IF0A 3CDGA 5D7KE 3WS6C 4FI8A 3ZKSD 2CIKB 1F4WL 5GGTA 2O5ZL 4WI3A 4WW2A 1VHPA 3AS3A 1KTDA 4DFHA 2DWYA 1IAMA 5C1MB 3HKFA 4W9FC 1NJ9B 4Q14A 2DTSA 1LO5B 4FYTA 4KKAD 1FGNL 4MD4B 5FHBH 5DEFA 5E8PB 2Y07H 3L3JA 4UNIA 3HPJB 3HI5H 4GRWF 5T1LB 1NGWB 4Y2LA 3ARDA 2P5WA 3GK8L 3I6SA 3WD5H 4LQFH 4BFEA 1KXTB 3N50A 3D0AA 2H3NB 4RNRB 4H8QA 4F7EB 1RZJL 4CA4A 1DQQA 3KPQB 3C8HA 4RMRA 4RRPM 1I8IB 3IYLW 3L6FA 3SHSA 2CGRL 3GSVA 2B08A 5J0BA 5BS0B 1DE4A 3BQUB 2FR4A 1I1AD 1UURA 3PFUA 4IRZL 1PTZA 1MFBL 5E5UB 1EAOA 3GFUA 4LSPL 1L6ZA 3F7YA 2BWDA 3B5HA 5AKVA 4L48A 3NFPA 3AXIA 1J8HA 1MAKA 3PPEA 1KYFA 1KJ3L 5D1ZD 3MYJA 4N22A 2E8YA 5T33L 2IXQB 1MRFH 2LE9A 3UBXB 4Z8FH 1YNTB 1MCBA 3FTYA 5IHZB 2P52A 1ZGLP 2E75C 1G7LB 3JWDH 1DBKH 3I9PA 3D0VB 2Y06H 3QWOA 2CHXA 2ARJB 2AV1A 5HDQL 1HXYA 1MWAB 2HRHA 5K9OA 2BNRE 4YQXH 2LLNA 3NJIA 5F70A 1XO8A 1RUAH 2P44B 5TGBB 3KPTA 2LT9A 2YRZA 3GXNA 2AJ3B 3OAUL 1BD2D 3DGGB 3FN9A 4YZWA 1S7XB 2VN5A 4NKIH 3VX0A 1VJSA 1X5GA 3MBWB 4PJIA 3KH3A 3MRGA 1E30A 5E6ID 3VWKB 5J13C 4U1NB 1ZVSB 3NMEA 4ZTEA 4DQOH 4PG9A 1KZQA 1WTLA 1E0OB 3CFDB 2YAFA 3MMEB 3T0ED 4YXKH 5J4MA 5DJ2B 5JDJA 1S8DA 3GJFH 5HHOA 4U4BA 3OKNA 4WFHE 4X4YB 1X6NA 5DMGC 3S35X 3KJ4C 1JWUA 1DSFL 1DVFB 1AXTL 3TJHD 4NFBA 1OGAA 4XWGL 2AZUA 1ZOXA 5LDUA 1RLWA 1RFDL 2I07A 2P47B 2BY3A 4GSRA 1M7DA 2QSQA 4QRPE 3APNA 1OKEA 3GTTA 4GYBA 5B38A 2OMVA 4P3CL 2GTQA 2XFGB 2BCKA 4H0HB 5FWRA 5MEPA 4DPAX 1IILE 1T1XA 3CSBA 1K4DB 2PR4L 3Q8CA 1NPUA 2GW5A 1JFHA 3V6ZA 4A37A 3IGAA 3IFLH 2MCPL 1X9QA 3LRHA 4E5XB 1RU9H 3OF6D 4LEOA 3LY6A 4JFPB 3VE0B 4XOCA 2ZUVA 1HN1A 4H8UA 1TT6A 2OMBA 3QWRD 1QATA 1KIPB 3VFWB 4S0TD 3TO4A 4FABH 3QRGH 4HIEB 4KZDH 5T1KA 1LILA 3MRQB 4KK6D 1FLRL 2CDEA 3QDMB 3W9EB 4EF3A 1A1MB 5C6TH 1TZHB 5E23A 3GJEA 4J3OG 1E6OL 4P23C 3EOTH 2C3GA 3MLRL 4HV8A 2ZPKL 3QISA 4XRCB 1EZLA 3V0WH 3M07A 1PLGL 3TCXA 4AQOA 3MFFA 1BVLA 4FLHA 5A2KH 1U8CA 5I8KL 3UAEA 3QIWC 1Z0MA 5JIPA 2YAMA 4EN3A 3T3MB 2RCSL 2WB7A 4MZIA 2JKWA 5E56A 2EO7A 2IV8A 3C75A 4OCYL 5B38G 1Z9SB 3L9EA 2XU9A 1C5DA 3SE3C 3VGDA 4ZTPL 4G8GE 5CEYB 5C0CA 1ZS8B 1MW2A 1JF6A 2VZVA 5K9JL 5F7EL 2DQHL 1NOAA 2FT8A 4OIAA 3ULVC 1CQKA 5EPMA 1ICTA 5HDOA 3CHRA 3MZTA 4PJ7F 3AY4C 3FT4A 4FZEH 4F7MB 4QOKA 2N7BA 3SO3B 1DYZA 3WKNA 4WW1A 3QNXB 4MAZA 1VKXA 4KH2A 5EF0A 1YEHL 3MACL 1U95A 4PBDA 1FFPA 4GQPH 4U31A 5KVFL 2RQ8A 3S5LA 4CU7A 1C7SA 1BBJA 2Z3FA 3A24A 4OGXL 1J5OH 3IDMB 4P59H 4C56B 1W0VA 1B0RA 5BJTA 5AQ0A 3QEHB 5E7BA 2WCPA 4TNWF 2YQ2A 3HE7D 2P43B 2HG0A 2IPKA 1AFVL 4FG0A 4KXDA 2QTVA 3KPPB 2W81C 1YNLL 2YGQA 4KK5C 4JVUA 2G60L 5K59E 1A7NH 5GGSY 1FBIH 1KTCA 1UT9A 2E7BA 2Z1KA 3MODL 2YPLA 3B37A 2CPCA 3ARFA 4HQQH 3D39A 3LVEA 2XOTA 4LVOC 2GITB 3B56A 5A2BA 3VG9C 1JS4A 1KPRA 4A6YA 4ALAC 5IROD 2NQCA 1I7ZB 1NCOA 1WZAA 3K72B 2EDLA 3NJLA 4IBVA 3QO1A 4TRPH 4XPFH 2ZUTA 2OXHB 1XAKA 3DVIA 4BYHA 4OIBA 4XAWH 5DJAB 2ODIA 1YEIH 2FUQA 1MAMH 4GP5B 3ABLB 5LAXA 2ZSWB 3HB3D 2YGOA 3HLKA 3CK0H 1QBAA 1JDAA 4YUEH 3ZPDA 2KERA 2P8MA 1OWWA 2PW1A 4CMMB 1CYWA 4E41A 1I1AB 4Z7QB 1I8LA 3B7SA 1XVSA 4OGQC 3FO9A 4MJHA 3QZMA 2IAAC 3K71B 1RUPH 4KXZH 3S5LG 4M1CC 3H6JA 5DZAA 5I74C 3WUZA 1Q1JH 1CLZH 1Z1WA 1Z9OA 2ADGB 4NDMA 4O58L 5JZ7C 5AKRA 3AG3B 4P2CG 3O2DL 5D1QD 5E4AA 4TPRL 5D1ZB 1CZ8L 2IAMC 3HZVA 5AW0B 4V1DD 5CCKL 1DCLA 1DTUA 2J6WA 4AUUA 1TMCB 2EDJA 3LXCA 5JHLH 4K5MA 3JYBA 4M8RA 3V6OA 2X28A 3A6CH 4NQVB 5L6YH 4UM9A 4X6DF 3BESR 4AYID 5EC1A 3W3BA 5DVLA 3EFFA 4HK0B 1P4IL 3I9GH 2G2NA 2HX8A 2X2IA 1CR9H 4QR7A 4IJTA 2B4CH 4G43A 1WUNT 2VDMB 2A6JA 2D9CA 3KYKH 1PFCA 3OZKA 2D3VA 2KZBA 4QTIH 3TBCA 1BD2B 3R7RA 3QQ9D 4OF6A 1NCBL 4M43H 1GGBH 1AGDB 1JN6A 1XR8B 2P48B 3CN1A 2FDBP 3TCLB 3IDYB 4LGPB 2JE8A 2OP4H 2FX9L 4OV5B 4MMXB 3MLTA 2IG2H 4HPYL 2VQUA 3AXLA 3BZFB 3I84A 2D7QA 3BGMA 1KCUH 2EZ0D 3T0EB 2DI9A 1UUSA 1A3LL 1WAAF 4OLZH 3BISA 1UUNA 3SPVA 2FO1A 3MAWA 4UNUA 3ILQD 5E51A 4LSRL 1BREA 4GAGH 3NK3A 5HI4C 3ARZA 4WHYG 3T6VA 1C9SA 4NI6A 1CVRA 1VFOA 2D03H 1WBYB 3MRFB 3BVTA 1UZ8B 4FTVA 3ZGHA 3WO4B 1TU2A 4PD4J 4HC1H 4QD2E 1TETL 3D9AH 2GVYA 4LCUB 3FSOA 4ZODA 5GZND 3ZRSA 2IADB 4K07A 4NBYB 4UT9L 4Y2DC 5GGVY 2NYYC 4YC2B 1A4JB 2XVKA 1NC4D 4ZX4A 4WO4D 2F7IA 1AG0A 3GSWB 3T0XA 2L3BA 1A66A 3CUPB 1WWCA 2F7OA 4AL8L 3VFOA 2Y2WA 4ZX6A 2X4NB 2YARA 3RPBA 1A0QL 4QI3A 5CFHA 3TV8A 4D0BB 4ABVA 3Q0HA 3SPJA 3LXBA 4YWGL 5AW8B 5KSBF 3RJQB 2GIXA 4B0MB 4DZBA 5EC2A 3RX8A 1BZ8A 1G0DA 4HYTB 1UJ3C 2YPKA 3UAJC 3FTWA 1SVZA 4E9QA 4N0UE 1QA9A 2W65A 1SN2A 1IVTA 4MDIA 2YK1H 2VSCA 1BF5A 1WIPA 4OAWA 1N2RB 4HOWA 3T8VA 4KKLC 1KCVH 4FQ1H 4P4KA 1BMWA 2AABL 4D8PB 1AQDB 5LCVA 2X1OA 3BLPX 1NCCH 3DXAA 1ACYH 2EXWC 2NY4D 3FCBA 1M6UA 3QO0B 3MUJA 5D9SA 5L9DL 4WHTA 2A77H 5CUSH 2XPYA 3OHXC 2DB8A 1R24A 3IS1X 3HG1D 5IMMB 2HRLA 1I7TA 1TTCA 3SDAA 1YMME 3DX3A 3DSFL 1SRDA 3LEXA 4HEMA 3RHWF 3BUPA 3OX8A 3QQ3B 1MQ8A 5K33A 5HGDB 3QRFM 2BVUA 2ZTBA 2J8UE 4FI7A 1SYSA 4IHOA 4FJYA 4CL7A 1KIUA 3VTTA 3U2SB 2NY7H 1KXVC 3NZHL 1NBYB 2DH2A 2PCPB 2QKIC 4U7MA 2LAGB 4GKOA 1GY1A 3K6FA 1FYTE 1WEJL 2DLEA 3JWOH 4K8RH 3BKCH 2X3BA 1RULH 2WTRA 4QTHA 3ULSB 5FF6A 1XD0A 5EA0L 5LHDA 1NUNB 2ZICA 4QCIB 4ZS7H 2QV2A 1ANUA 4HWEL 4IDJL 3V4PA 3WS3B 3HE7B 3LZQA 5T5FL 2HPTA 3L2NA 3CFEA 4MNQA 3IJSB 1UQSB 3ARSA 1SHWA 3DJZA 1CGUA 4F8TA 2WUBL 3U4EA 3X13B 3K6SB 2FWOA 3OC8A 4GIPD 4UQ2B 4ZW7A 3CSYB 1G7PB 1SHSA 3R1GL 1FSKB 3THML 4GB9A 2F53D 1BJ1H 4HFWB 2PCFA 2XV3A 2AXJA 2IGTA 5KS9E 3GZKA 4YK4B 4NERA 5TJWK 5IIEA 3HE6A 4Y8DC 2NOYA 3ZMNA 5JW3H 4KPHH 1GC1L 1ZCRA 1N59B 1FC1A 2BINA 3H56A 2E86A 4LPYA 4R7LA 3BP5A 1S7TA 2VQ1B 4XNQB 3PIQA 3VQ2C 3HB3B 1FZJA 3E7JA 4MXWL 2NTFA 1I1YB 3H9SE 4WI4A 4JDEA 4DAGH 4KVNH 2QBWA 4J3VA 3OXSA 4DGUA 1INQB 3H9HB 1MREH 2A9NH 1F6AA 5K93A 1FZMB 2OSYA 3BQUC 2QZQA 1JWSB 4X7TB 1TF4A 4N3UA 1AI1L 1I3GH 1M1XA 4ONGL 4FNLH 3TIEA 3ULUF 3E80A 3KDMB 2FHBA 3Q9QA 5JPNC 2WVVA 1G7MB 5D1QB 1WS7A 1BVOA 4P9ML 3U9WA 1R6VA 4G6FB 4Q4IA 4V1DB 5BRZB 4W6WB 3ZQ9A 1G5AA 4MRBA 2OMXB 3OKLB 3VI4E 1NCTA 1VFMA 1MFAH 4NGHH 1GMIA 4X6CA 3LHAA 2EQDA 1MQKH 1FAIL 4U1LA 1T83C 5F89B 5F0JB 2AEPL 1XF3B 1JPGA 4P57A 3OKEB 2XQBL 2Q8BH 4DGVH 1MLBB 4MX7B 2K7PA 1QACA 2ENJA 4ZD3H 4WJ5B 3KPRE 1Z5LA 5K39B 3U46B 2NNAB 4QWWD 4KTEH 1UXMA 1I7RA 1ZHKA 3QCTL 5HI3C 5D5MB 4YEEA 2R4RL 4FMVA 3SJVA 1LK2A 3QZBA 1ILUA 1JGLL 4PRNA 4AZUA 4S0HA 4N90D 4N0CD 1XZWA 1KBWA 2VDKH 1NDMA 2W9EH 1YYML 4RGNB 2R29A 4RGOH 1N4XH 5F1NB 3VWKC 4ZMNA 1CVSC 3E6HA 15C8L 1I9IL 2YBGA 5FOJA 5TQ0L 3UFIA 5CLZA 5DJ6B 2YC1B 1CIDA 5DZLA 2YWYA 3NSYA 4FG4A 2CM5A 5TE4L 5I1IH 2C1PA 2QSCH 2OMUA 4AQAB 3UTQB 4PJHF 5IT2H 5KW9L 3BP7B 1DVFC 2VW4A 1OTUC 4I0KA 3CH8A 3ZGIA 4XP5L 3UG3A 1CG9B 1ADQH 3LN5A 1M56B 4M5SA 1E4JA 1XH0A 5E4OA 4KKCC 2NY6C 4QY8A 2DQJH 3PRZA 3JSSA 2WLLB 4XPHH 1XFPA 2VXQH 4D7BA 2HXAA 2X0VA 4H5SA 3FTVA 4XC1L 5ANHA 5I5IA 4N0YL 2PPAA 4M93B 1OP9A 2HN7B 2V8MA 3EYOB 4UU9B 1NC4B 4WO4B 3FOLB 4UNTA 4XN5A 3SKMB 3WIIH 4ZFGL 1IGJA 4O51B 1UCBL 3FQXB 4PP1D 2V2XA 1J1OL 5DUJA 3HIZA 5HVWA 1HCYA 4FCAA 4JHUA 1EERB 2GK0B 2FSDA 4ADJA 3HZMA 1CE1H 4NUJA 5IW1A 3RE0A 1C12B 1U2YA 3MBXL 2NSQA 3NPSC 1IZKA 3RL1A 3FMGH 3UGEA 5BZDB 5HDBF 3D2UB 4PJXB 1TTBA 4KDVA 3TJEH 1CMOA 4ZSOE 1QTSA 2H4EA 2Q3XA 1OTTC 3FTXA 3GMMB 4X5WB 2AGJH 4EKXA 4J4PC 1ZPUA 2BIOA 3NVQA 3ULVE 1F58H 4TYUA 4IM8A 2XRAL 4J1UA 4XT1C 2IAND 3RIAK 4UQ3A 3LYRA 1EGJA 1F18A 1GOHA 1N5YH 1PZSA 3MNWA 2BNUA 2R59A 2FJHA 1CGSL 2HWZL 4G80A 1PBYA 1YYCA 2CXKA 1D5XB 1EFXB 2QDVA 35C8L 3CX2A 5E4EB 4WIQA 5D93B 1K9TA 1JGUL 5FM8A 5GSVB 3FQWA 1EXUA 2P7TA 5F93C 2X4QB 4NQXB 4DPCX 3KW7A 2G5UA 3K91A 5FFOA 1VEPA 4X6EB 5DHVA 4APQD 3E8UH 4ELKB 2YGNA 4ZBJA 5I19L 2BY2A 2OXGA 5DUBB 1LO2L 2EKJA 2WANA 3WE1A 5ECGA 2BMKA 3FCTB 1MHEA 3WTUA 3SO3C 3DVGA 4DUVA 3L45A 1G4MA 4J3OF 4YDMA 2FO4A 3WDJA 2ADYA 4DGYH 5F7LB 3ZKXB 3VYOA 1UG9A 4QHMA 5F7NC 4FJZA 1UWXK 1EXHA 5H94A 1IQDA 3MV8A 3RUGF 3MLZL 3MOBL 2LLGA 3MUGA 1L9SA 4FI6A 4TVUA 4YDVA 3HBPA 4HALA 3CIAA 3CU1A 2B5IB 1F3RB 2V2TB 4IOFD 5J1AA 3L1OL 5E00A 5EUKA 1E4WL 2IWEA 4LEBA 4HJEA 2PTVA 5TD4A 1OT4A 4TULL 3MI6A 4ISVA 4UTBA 2HRPL 5DZJA 1OEZW 3IU4H 3UIZA 3IDNA 4R3SA 3CBKB 4N8VB 1SBSL 4IJ3C 1D7BA 1YY8A 1BA9A 2Q5BA 1N64H 4Y4FD 3ZKQD 4HULB 5AOJA 5LQBH 4KKAC 3FUHA 1OPGL 2Z8VC 1LP9E 4K4KA 2JTYA 5E5MA 1PDKA 2VITB 4R83A 3GM0A 3IFNL 3QDJD 3I75A 1ZA6A 1ZV9A 2FNBA 2IMNA 4MNHB 4Y1TA 2OJ1A 5AG8A 1QSED 4Q2ZB 5EUOA 2XBTA 1OCWH 4YE0A 2WB1A 3EUUA 3E2HC 1XCTB 4ZOBA 5CJXA 3PV6A 4YHYB 3TYFA 1PIGA 2X40A 2VDNH 3C5XA 1YPZA 4QXVA 1I1AC 3ZE2B 3MLWH 1CF8L 2X10A 4WU7A 4WO0A 3W0WA 3L5JA 1P5VA 5T3XE 2BX5A 2ESVE 4DEWA 3KPSE 1U8KA 1PG7H 2CDGB 3UMNA 1KELH 1A7RH 4GIAA 3CAFA 4I48B 4Y0GA 3IK2A 3K6OA 4JZNA 4B0MM 5EU3A 1T22B 3HFFA 3KH4A 2FT7A 3DHUA 2WXLA 1NSNL 1J9TA 5EOTA 3P0VH 2YBRA 5CLYA 1H15B 3D3VA 4MZ2A 2K9UA 3A4AA 3O3BA 4KJQD 4Y9EA 4BSWA 1ET8A 3J27A 2Y7NA 4PJDE 3SYAA 1YDPB 5FUZL 3NFNA 3ELQA 1GH7A 1OT2A 1QBLL 4Z76B 2AVGA 3JWDC 4M00A 2C4FT 3QUYD 1AO7A 4H20H 3KS0H 5TK2A 4Y5XB 2GPZA 5DRXA 1JRHI 1HHGA 3QA3A 1MW3A 3U4BL 5E6IC 4F7CB 3CFKA 2YEZA 3BD4A 4MMXC 2F8VA 4NQDD 4R4ND 4GRWB 3T0EC 3H7BB 3TO2A 1XGPA 2AP2A 2AEWA 5CINH 1HZKA 3BKJL 3UPCA 3KLAB 2X6UA 4KUZL 3VFSB 3OD3A 4HPOL 3TJHC 5E2VL 1Q4NX 4NN6B 3O4LA 1RERA 4ZFZB 5C07E 1JF1B 2R1YB 4OD3L 4S1QH 4IBQA 3VM5A 4GMTL 4TM9A 3WO4C 4YSTA 1DBMH 2FSEA 4LSVH 2XPGB 3NJMA 4J6RL 5DK0B 4ODSL 5EOCH 4APXB 2DL2A 2GJZA 3UEQA 4YC2C 4Z78B 1OAZL 2WXNA 4O02A 4QXUH 4G83A 4LEEA 2HKHH 4YN3A 2C9UA 4JFFA 5BCAA 2LR4A 4G42B 1JXKA 1OLZA 3CN0A 3D07A 1JXGA 1PD6A 2C7UB 3BIBX 3BPLC 3O0RL 5F3FA 1JZ8A 1KPVB 5TDOA 2FO8A 2WYIA 5KJRH 1BZ9A 4WVRA 5D4JA 3VFRB 2OK0L 2V7NA 1I7UB 4PJAF 2Z93A 2VW7A 5C8JB 3UXFA 4KK6C 5H4YA 4Q7DA 4U6TA 1TLMA 3TN0B 1Q38A 4PWHA 4PJ8D 1K4CB 2GJ6A 5LBVA 4LL1A 2IANB 3MA7B 5AYUL 3M86A 4HIXH 3ZTEA 5JXEA 4ZW5A 1T5KA 1MKFA 5FB8A 2B59A 5EU6E 4PJ6A 3O6FD 5DWUH 5CEZH 1C16A 3F7PC 1QPKA 3WFEL 4QRFA 1L3NA 2BJMH 1G6RH 2I25N 4ODWA 5E9DA 4XE0A 3FFCA 2V5SA 1QHPA 2EDNA 4JM4L 2C26A 1RURL 2WUCL 3FUIA 3L4VA 1MCIA 4P2OA 1YLBB 2YPVA 1H6TA 4PJFA 2GUOA 4APQB 4HOZA 3AAZB 3IKCA 1S7RA 1JL8A 5KSAA 4Z0BL 2R2BB 2UXTA 5AZUA 3GXIA 4WSJA 3AQYA 5ESQA 4AKQA 4GT0A 1HSAB 1CBVH 1Q9WA 3MKGA 1J1XL 1VCBC 2H2SD 4MAUH 4PGEB 4H8HA 4LSQH 4N2MA 5L2KA 1PZ2A 1IE5A 4ILDA 2YQBA 3EYUH 3BD5A 4R5TA 4URKA 5DDHA 3DOSB 3EDKA 4DH2A 1JNLH 3KLKA 2F5AH 2V9RA 3LRSA 3IFOB 4L9LC 1OANA 4X5XB 3IGKA 1E2ZA 4IKJA 2APXA 2AKRB 4DGIL 3HE7C 5EZOL 1FC2D 4ZX5A 3HC0A 2V3DA 3I02B 3IDIB 3ECUA 3BXNA 1OM3H 1KIQA 1GHFH 2A4ZA 2FLBT 3LV3A 3S3CB 5DMKB 5BS0E 1UB5A 1FH5L 4U3XA 5HYFA 3CCHA 3ULAB 5SWQA 3UO8B 3MRJB 3QS3A 2BSTA 4XB7A 3VH8B 1BM3L 5ACLA 3TEZA 3LIZL 4Y4FB 3BZEB 1F4HA 2YR3A 1IC4H 1TPXC 3FB7A 43CAB 3PL6A 2GHWB 5TDNB 2GSMB 4YK4C 1CFQB 1XSOA 3V2AR 1H5BB 4NO2A 1CFNA 3QDJB 3OGOE 4HJ1A 4KWUA 3KBHE 3EZ8A 1JOIA 2YMXH 4YSOA 1DVZA 4XR8C 1RK1B 4UIMB 1QSEB 4BH7B 3IDUA 2FIKA 1TVBB 4G72B 4GUCA 3HB3C 1BECA 1H9VA 1WVZA 1DSYA 1ED3B 5IEHA 1CJYA 2IQAB 3ES6B 1ETB1 2VYRE 4JHAH 2B1HL 1G7HB 3DX9A 2P28B 3MV7A 5LNDA 2CLVB 2XUWA 3BSZH 4HWNA 5GGVH 4RX4A 1PF3A 5EZJB 3FT9A 1U8PB 5D96B 1P7KB 5CSZB 1ZGLA 3FTGA 4G8AC 4PJ7B 1EHLL 3FQ1A 3ARQA 5ALBL 3UGUA 1MIEH 5B3NA 1QPXA 4M1DL 3HN8A 5D1QC 2QPUA 2EDKA 4N4YB 1LXMA 4NUGL 3WG7B 5I1HH 1A6VL 4NT6A 3GMPA 3FBQA 3WMPA 4HWUA 3KZ8A 4PVBA 1LK3H 3G6JF 1RLBA 5AB9A 1I1RA 1P7BA 1Z6JT 2NW3A 4ZYKA 4Z7AA 2RQEA 2YRBA 1WC7A 1WF5A 1ZAGA 3CVCA 1I8MA 4W9JC 5HGBB 5DJDA 2EDQA 2JI3A 3CBRA 3HVNA 4OGYH 1NBQA 3QUYB 4JVWA 3KPNB 3QQ9C 3WFHB 3BW9B 1XGUB 4U2ZA 2RR3A 3X14A 5CILL 2WXQA 4XAKD 2YWZA 5IQLA 2JIXA 1LMIA 1V7ML 5A2FA 1UM4L 3F7RA 2B4CC 3RWFB 3C60A 4WWOA 1WBXB 2AJZB 5J6HB 4YHOL 2IDFA 3GLZA 4NQDB 3EUDA 4LLVA 1UZGA 2EZ0C 4IOSA 4U1SA 4ZNCD 2VL5B 2EDRA 4YZFF 3CLWA 4H26B 1YAZA 3GRWA 4WV1B 3QJQB 5I18L 4ZG1A 4JZJA 3L4YA 4HGWB 3ILQC 3WNNA 1QFPA 1CTOA 2AJVL 3MRCA 2CRYA 1HHIA 5JMOC 4QUOA 4RDQG 1ECZA 1HHHB 4LIQH 2YLKA 3KXFA 4YX2H 1U8HA 3GMOB 3Q2LA 2F1EA 3QDME 1HH6B 1TFHA 3QUML 3ECWA 5GZNC 5FHAL 5DZ9A 1A4BA 1EUUA 2DBLH 3O41B 1HZLA 3SKJH 4LKXA 4XMTA 3PABB 4XVTL 4WO4C 1U92B 4NUMA 2X70B 4MKMA 2A4CA 1RV6X 4G8EA 1U30A 4KK9D 3UYOD 4TUKL 4NHUA 3T3ME 4QRTB 4X8XA 4X6DB 4WI6A 2CHNA 2WY3B 1WT5C 4KX8A 4EXKA 4GI9A 4EXPX 3DTDA 1NFIA 3M1OA 2R1WA 2J4WL 4ZUVB 3S37L 1YC8A 2FX7H 3IMTA 2E47A 3PHSA 4U1HA 4CC4A 1BAFL 4IIQC 3D0LB 1S46A 4PJ8B 3TA3A 4NPJA 2EP6A 5F3HB 3U7YH 1CFSB 3DHMA 2NPLX 5FA4B 5GGSB 3U36A 5I6OA 4M7KH 1S7UA 4LOVA 3L9RA 2ICEA 3V4VH 4KQ4H 5E1AA 1RH8A 2WLIA 3P1VA 2JK5A 4N85A 4OUOA 1HWWA 1N26A 4KXZI 2NY4C 3HCVA 4G3YH 3ULUL 1I31A 3HAEB 4HKJA 1DUZA 3RDTA 4C56E 5D93C 4PU2A 5E2TH 1EAPA 3GUFA 2OSLB 3BVNB 5DXWA 1D9KA 1L9PA 3WJJC 5MP6L 4EI5D 2G75B 3KJ6H 1G6RB 2OULB 4PUBH 1DQJA 1X5AA 1V3KA 4L1DA 4YHZH 3G3LA 5DJ8B 5FO7A 5L88H 2FL5B 1PSKL 1AYOA 3HJ0A 2X4OA 1XBDA 3ARDD 3QJSB 3PFQA 3GSQA 4L0PB 4XNXL 2F54D 3ECBB 1QD0A 3QG7H 3RL2A 1EFQA 4PGBA 4QRPA 3WIAA 2M8XA 3ZKXC 1M3IA 1FO0L 2J3SA 2EYRA 4J2QA 3F12A 2X3CA 3UTSA 1G94A 3R19A 5EBMA 1WCQA 3D4YA 1M2VB 5EIIB 4G1EB 4BRJA 4ES8A 2B39A 5E4IA 5F1SA 5KSBB 2Y6SD 3T1WA 4PS7A 2C3VA 3V8CA 1MCOH 3UC0L 2FGZA 5DD0H 4M61A 5HPMB 1OW0C 4BGLA 5EBGA 2NYKA 1AOHA 3QC6X 2ZYHA 5F9DC 1EZVY 2DLHA 5KYWA 4I18A 3GTVA 4MMZB 3UOAB 1G7JA 4YR6A 5I75B 2CJUL 1XD1A 3HW7A 3WBDA 4DP9X 1MVUA 3N9GL 1U8QB 4UDTB 5DUMH 1T0MB 3UBHA 5IR1A 1FVCA 3BP4A 4JX0A 2M83A 3D18B 2W8CA 3MXWL 4G5ZH 2M1KA 4Q9RL 3EFDH 1DDHA 5GRYA 4X8JB 2MPAH 3FRPA 2F15A 3IU3A 1RUQL 1WAPA 5B3JE 1LDPH 4P9HH 4YHYC 3T6QC 4J3OH 3T8XA 4U3SA 3O3AA 2SEBA 1NEZA 5DUPL 4AQ8C 2F68X 2LHAA 1L7TL 2BFVH 4M5ZH 5J11C 1WCBB 4M62L 4WI8A 3OKYA 5A6LA 1FA4A 1BD2E 1RY7B 3NJVA 3NCBB 2BY1A 2D73A 4HUXB 2TAAA 2R0LH 4CVUA 3H42H 4J3OD 3B9AA 4Z3HA 3FQYA 3Q1EA 3Q5OA 4NKMA 5L7XL 3MRIA 1EHAA 1RIHH 3MRPB 3P3TA 2ETWA 3E1ZA 3RU8H 4AG4L 3T0EE 3OB0H 5I6LA 2BP3A 2UZIH 3G9AB 3QUMB 5MENA 4CDHA 4PWKA 3VTAA 3LSOA 3RJDA 5E2UH 1ML0A 2AF2A 3RVVD 1NZRA 1JNNL 4DIXA 5C0JB 4JFUA 2FK9A 4QO1B 4QWWC 1DANT 4BFIB 4GAYA 2X1PA 2XETA 3T2OA 8CGTA 1GRWA 2NXYD 3O2VH 4Y5XC 5E24E 4NRXB 2C4FU 2DM4A 3OJMB 1KJVA 1R5VA 4L8DA 4N0CC 4R4BA 3NTCL 2Q86B 2XWCA 3JV6A 1MHPL 4X4XA 3FRPG 3PHOB 1UACL 3J2PA 3QUKA 4MAYD 1XZ0A 5CIPH 1E6JH 5K9QG 1MH5B 3PDOB 2AHIA 4F91B 4RAVB 3CVHL 3SKUD 2JJTA 1YMHA 4WI0A 4AEHL 1T2JA 4XVUD 5E2WL 3DURA 2J12B 3TO4D 1IJNA 4W9GC 3VACA 2NLJA 3PWVB 5EEWA 1JZ4A 1U9KA 2EDHA 3EGXA 1RSFA 1UENA 2F8OA 4PP2B 4TQEL 4GUOA 3CMGA 3FQUA 4KMTH 4Z7NB 3EGDB 3UABA 1RKRA 1RXLA 3F83A 3NABL 4FERA 4XNZB 3UZEA 2CM6A 3L7EA 3QIBA 3GMRB 3DI3B 3LHPL 3LRKA 5KVFE 4KVPA 3TBVB 3QH3A 4EN3D 2PPFA 3VFGH 3C5JB 1B4JL 5AVTB 5AZEH 3SDCA 3DMMC 4RBPK 4CVXA 4PP1C 3L54A 3AREA 1T89A 3ZQXA 1R3HB 3VD9A 4J23A 3Q9PA 3SBWC 3DBSA 4FQJH 1EA9C 2F74B 4LLDB 5F9WB 3HMXA 3PGDB 4C54A 1JNHB 5C09A 3TT3L 2WBJD 3CFJB 5E8EB 1KYOK 3EJJX 5IP4A 7FABL 3QIUA 1NLBH 1S3KH 2JB5L 5ETUB 3FO2B 4CVZB 4O2CB 2IBZY 1RL1A 4QOKD 5D72H 5HHNA 4PTUA 2X4RA 3RPKA 1FV1B 3MX0A 2JLLA 4HAKA 3F7KA 1SF5A 1L9NA 1UZ6E 3DVNB 2HVJA 4TKWA 4LOUC 3CX5J 2R51A 5AVXB 4ZNEE 2MNWA 2TRYA 2Q87A 3OZ9L 3L2LA 1SDDB 1ZA3A 2CG9X 3WKPA 4A6YH 1E4KA 3DJ9A 2YFOA 1D5ZA 3W82A 3H54A 3DO4A 4PTTB 4UINH 4PJHB 3V4VB 1CICA 1SZNA 4PHXA 2CZNA 1J11A 3CU7A 4YO0A 4EI5B 4X4MA 1GIGH 5JHMA 5CD5D 3D39D 2QFRA 3S6CA 4EZLA 4APQC 1TIUA 1GAFH 3LZPA 4PN6A 3E3QC 5C0DB 1S3RA 5ID0B 3LPOA 1SVBA 2JMRA 4I77L 1FH2A 5AOLA 2X4UA 2NR6D 2OMZB 3PWPA 4F37K 3NN8B 4L3CB 1FN4B 3ZYOA 3S7GA 2Y07L 4OLXH 2F54B 1K3IA 5IHUL 3O3EA 2ZX7A 5BOPA 2GTWB 4KBPA 4RA3A 4DP8X 2AZAA 4N2DA 4U7SA 1FAKT 1X6LA 3P40A 4CW1B 3IXAB 4I5BA 4ODUA 4ZK8A 4JKPH 5JW5A 4U49A 1HL9A 3H3KA 3WJMA 2D3JA 4WHYH 1NCWH 1R3KA 1JTPA 4AQEB 2FR4B 2O6DA 3QBTB 3LKNA 4OCSL 4FQHB 3HR5A 2YJQA 2DLFL 3RWCA 4IOFC 2WO3B 3KMDA 2DTMH 3SDXF 5HDBB 1E5CA 3F7YB 3SN6N 3BAKA 3DX8A 1A64A 4JGNA 4GY4A 4RIRB 3P73A 2DKSA 1S7SA 4LESA 3GKZA 4N8CH 1S7QA 3N85L 4C55A 4EUPA 2KHAA 3IMSA 2R15A 5IB3B 3AABA 4Y4FC 3HPLA 4PSPA 1PEZA 4PJGF 2I60H 2ZX6A 5AW3B 1WWBX 1NBZB 2ADJB 3QWQB 1LO3L 4L0ZA 2K9FB 5D1QE 3Q44A 2J7LA 3CFBB 5JW4R 2A6KB 1WHOA 2R69L 4V1DE 2XWDA 5AVWB 1XR9A 4GSXA 4KY1H 5BRZE 1C5CL 4I2XB 1NPJA 1JMXA 1XEDA 4D0CB 1ZHBA 3LD8B 3EH1A 5E08L 2WP3O 3DWTA 4RZKA 4KGJA 3UJTL 2HJFA 1OIOA 1TCRB 2BOCB 4KGLA 5INCA 3QXDA 4RISL 3S3DB 3WYRA 5EDSA 2ZOWA 1JGVH 2OMWB 3CG8A 1U3ZA 4P06A 1YMMA 4JRFA 2B1AL 2FHCA 1II4E 3LKOB 2HP4A 5D96C 1MCSA 5CU9A 4BZ1H 1FJ1B 5D5ME 1Z3GH 2OMYA 2D7TL 4JKWA 4PGCA 4JO5A 4UBDD 2YXWA 2XA3A 3CVHB 2J8UA 3GIZH 2AV7A 2RAMA 4N2GA 3WS6A 3IJ7A 5A43C 4HS8L 3DUUA 4OB5L 1FYTA 3PGFH 3B8YA 4KJYB 3RUGB 1HHKA 4L0YA 3II3A 3BAWA 2A9AA 3CXDL 4LXFA 4EUPG 4KJQC 2E9WA 4Y16A 3PGCA 5L2JA 1NGYA 5GS1B 1XF4B 3ARYA 1N6QL 2NQ3A 1SBBA 4WFGD 4OFPA 3QUYC 5EF1A 2H3XC 2NXYB 1JK8B 2XG4B 3V6ZB 1U3NA 1QWNA 3GB7B 2QVKA 1BZOA 1E2VA 5F97E 5I5MA 2HB0A 5EN2B 2CO6B 1JZIA 3UADA 1O7VA 1YEFL 1OAQH 3MCLH 4MAYB 3PWJA 4R4NC 4WFFD 2EE0A 3S88H 3R06A 4OCWH 5CP7B 5EEUA 4IBUA 2NUPA 5KS9A 4WV1C 5LCVH 4P46A 5F9JB 4DPRA 1T0NB 4JB9H 4FQCH 4AKPA 1NGZB 1PZ5B 2VXVL 3HZYB 5CIPB 4PJXE 5LWYL 1OD7A 1AS8A 2BSSB 1K8IA 3PWLB 5D6CB 5KYNA 3H9SA 1S9YB 3DXAD 3R4RA 4IMLB 5DMJB 5GSRA 3ZQWA 2KT6A 4FF9A 3GS7A 1GGIL 4EN3B 4FHJA 3ASWA 4FA8A 1HSBB 4PWGA 5DJCA 4YVNA 3V4UH 1E9PB 2VZ3A 1U8JA 4RMQA 4CNIB 3P77A 3S5YA 3IEAA 1BX2B 4TNEA 4F8OA 3VFPB 2B3RA 3SDAD 2ZJSL 2J5LB 2QPFA 2WYHA 3ARRA 2WBJB 2CIIB 4YXHH 3VI4A 2PP7A 4JQXA 2Q8AL 4AYBA 2WLJA 3IDGB 1XF2B 1CDJA 5DEJA 3PREA 4L1HA 5IB2B 1G0XA 2A9MH 3O2WL 4Z3FA 1ZVHA 2X89D 3V4PH 3FNKA 3DA0A 5DMIH 4WW1B 3O8XD 2ICWJ 1YEJH 2BSRB 2AJSL 4PJ8C 3BYYA 5F9OL 2LAAA 4YDNA 4K71B 4RDQF 2Q3AA 1FFPB 5AALA 3KPRA 4Y2OB 1BG1A 3S5LB 3HNTH 5IFAL 4WTXA 1EPFA 2I5YH 3IF1A 3PUUA 1NIAA 3O6FC 3VFUA 4NP4H 2MCAA 2HLFD 2BVYA 1N5AA 4NKOA 3APDA 5LG1A 3EFOA 4RRPA 3K0WA 3WDIA 2K70A 1DJHA 3US1A 4JFED 1IVLA 1L9MA 1DN0B 3WNLA 3IPEA 1N67A 2JF1A 4WU5A 5I0DA 4YSUA 4I0PD 4F93B 1CLOH 1IFHL 1V54B 5KVDH 1NBVH 3QZWA 4FFVD 1A4CA 3WSQL 4BWTA 4F5CE 3VW3L 4XBPB 5CMAA 2PYED 1M71A 4A6YB 2PP8A 3ZDZF 1JV5B 1QASA 3K0YA 2BP0A 2NZ1A 2ZYIA 4CU8A 4EZMA 2H2SC 3KR3L 5FDWB 4WQOA 1LE5B 2P24B 4X5RA 2V5YA 1X5HA 2BK8A 1WHPA 4LPTA 4N1EA 4N9GB 5ERWA 4XN8A 2DEXX 5DD5H 2UY6B 1FL5A 4P23A 4XNUH 4N2NA 4XCEA 3I6LE 3L3KA 3VVWA 4WK4B 4GKNB 2FBJH 2WQAA 4GPVA 3WLBB 1FNEB 4U1MB 1QI4A 1M9WA 2XSKA 1T2QL 5DFTA 4MZRA 3W39A 1BZEA 1OAYL 3L5WA 4IRJA 1IT9L 2VRKA 5I15H 2BIMA 1FG2B 5FUOL 4FA6A 4G9DA 4PJCF 2YAEA 4OM0L 4ZMYA 4RRPG 5HHPB 4H88H 4DK5A 1ORSB 4F8LA 3VRIA 3SE3A 5C0GA 3O3UN 4MMZC 3CDZA