2HG0A

Structure of the west nile virus envelope glycoprotein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
400
structure length
400
Chain Sequence
FNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLAEVRSYCYLATVSDLSTKAACPTMGEAHNDKRADPAFVCRQGVVDRGWGNGCGLFGKGSIDTCAKFACSTKAIGRTILKENIKYEVAIFVHGPTTVESHGNYSTQVGATQAGRFSITPAAPSYTLKLGEYGEVTVDCEPRSGIDTNAYYVMTVGTKTFLVHREWFMDLNLPWSSAGSTVWRNRETLMEFEEPHATKQSVIALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the West Nile virus envelope glycoprotein.
pubmed doi rcsb
source organism West nile virus
molecule tags Viral protein
molecule keywords Envelope glycoprotein
total genus 65
structure length 400
sequence length 400
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2hg0A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 2hg0A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 2hg0A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 2hg0A03
3UZQB 4ALAC 1OK8A 3I50E 3UZVA 3N41F 4UT6A 2V33A 2I69A 2JQMA 3J27A 3N43F 3IRCA 3P54A 4GSXA 5LBSA 5AAMC 4BZ2A 1PJWA 5H37A 5KVFE 4UTBA 2R69A 5KVDE 5B1CA 3UC0A 4L5FE 1OKEA 5GZNA 4X42A 1Z66A 2ALAA 5JHLA 4GT0A 1TG8A 5IZ7A 4UT9A 3J2PA 3UYPB 1SVBA 1URZA 3UAJA 4AL8C 4FG0A 5KVEE 4UTCA 4AM0Q 2JSFA 3C6EA 1RERA 2GG1A 2R29A 1UZGA 2JV6A 3N40F 5KVGE 4UTAA 4FFZA 5LCVA 3G7TA 3UZEC 3VTTA 3WE1A 3MUUA 5LBVA 5IREA 1ZTXE 2HG0A 2P5PA 3N42F 4FFYA 3C5XA 1Z3RA 5JHMA 3N44F 5AAWC 4BZ1A 5GZOA 1OANA 2H0PA 1S6NA
chains in the Genus database with same CATH superfamily
1RK0A 3HMWH 1FNAA 1DUZA 2ZE0A 1ZLUK 4POYA 5CLYA 4HUVA 2HJLA 3MMEA 1Q4NX 2Q3AA 5B1JC 3RKDD 1FVEA 1AVAA 2XETA 4KO5A 4WI7A 4XPBH 1OP9A 4YHMH 1UGKA 3ESOA 5IOPB 3MCLH 2VLRA 3KPRE 4P04A 5DUBB 1F4WH 3FOMB 4FCAA 1EJ8A 3LKNB 3VDAA 4N0CC 1RSYA 4DP0X 1JCVA 3CWGA 1IE4A 3PUUA 5B1AB 3H9HA 2X10A 1U8HB 1Z0MA 2WLZA 4P05A 1S5IH 5FR3A 3QJTB 3K2KA 4KROC 4J2XA 3T4AA 4HKJA 4XXDA 2YPLB 2IDSA 4FQCL 1QEWA 3CSYB 5DFVD 4NO3A 2DTMH 2EH8H 1H6EA 4K94L 4HHAB 4C58B 5KS9B 1EERB 1URZA 3WFDH 1CLZH 4Q4EA 2NTFA 2NSXA 4LPVA 3CFTA 1NBZA 1WJ3A 1U8CA 4OH2A 1N0LA 4LCYA 5EZLA 4WTZG 4OF6A 3VVVA 2MOVA 3HN8A 5JTWA 1J8RA 4LAJH 2R8SH 2G9HB 4HMCA 4UQIM 4NKIL 1JVLA 3NN8A 3PWNB 3VGEA 1RUAL 4NQXB 4OCWL 1JK9B 3ARFB 1OWRM 1WC7B 3WG7B 1RZ8A 5FYJD 4Y5YC 4PW3A 2XVKA 2W95A 4X8GA 2BZCA 3IU4L 1BBDL 1FJ1A 3OLIA 4GPVA 5MENA 5D7JC 3NZHH 2AJ3B 1IIKA 3WD5H 4DP7X 2QPDB 3STLA 1PYWB 4R8WL 1AI1L 1MNUH 5K9OA 1CUOA 1MHCA 3FBQA 4LCUA 3KPRB 5CEZL 5TE4L 4U0RB 5JPMC 2EACA 5DQDH 5JHAA 3WTUA 3QXAA 2KZWA 2HT3D 4JFED 3SGKC 1XL6A 2CGYA 4XI5D 1IMHC 3WLBA 1TQWA 3IXAA 4B50A 2IMMA 3PF2A 5M94B 4JM0A 2XY2A 3AFLA 3O4LD 3D2UD 2H8PB 1IGMH 2UY7B 3UPAA 3WO4B 1TTFA 4MD5A 5AVTB 1CICB 3DJ9A 5DFWH 4UI2A 3CK0H 4LU5H 3DXAA 5GRVK 3O3BA 2Q9OA 4HHWA 2FEJA 1I85C 4YZFE 1KLFA 4EOWL 2QSCH 4WFHD 4U49A 1QR4A 3VTAA 1FNFA 2HKAA 3N04A 3FH8A 1I8IA 4F5CA 4FNLH 2GY5A 2QKIA 2JKXA 1HJCA 2V2WB 4LQ1A 4NEHB 3E80A 3L3HB 2W94A 2Y6SD 1OCZB 4ZFOB 2IDQA 4RFNB 2CO7B 1OTUD 3QG7L 3B5TA 1C5CH 4NCC2 2YMOA 1Q9WA 1AANA 4KRPD 2CJ3A 3FQ1A 2AXHA 4Q6IA 2DQFB 3GHEH 5FYJE 4DGVH 5J1TC 4X5QA 3NGBB 3H9YA 5GGRY 4PJIF 4UU9B 1KTJA 5LAPA 6TAAA 4FHBD 1KV7A 1ZOXA 4KBPA 1D2OA 4ODVH 2B2XL 2QQNH 5DMKB 4LP4A 3B9EA 1MCOL 1ZJAA 3HG1B 2XWXA 4HUUB 1G43A 2GBTA 4R7NB 3OPZL 3GIVB 3SE4A 3AJ7A 2DJSA 3T0BA 1AXTH 3UBXA 3ZYIA 1RZQA 1GIGL 1L9NA 1E5AA 1DBBL 1CE1L 2A73A 2WP3O 5JHLH 1FAKT 1K6QL 3F7PC 1YEDA 3ARRA 2X05A 3ZE2F 5I1GH 3KBPA 3T04D 2K6YA 4PJ7E 4V33A 2YMXL 4HPYH 4Z3JA 4RX4D 1DFBH 1LDPH 2ZUYA 3B83A 2R69L 3CFBA 1ZLUH 3SYOA 5KBLA 4JPWL 3WIIH 1ED3B 2XA3A 1CFNA 3VRIB 3K81A 4AZUA 4Q6IC 5EZOH 5C08A 5MEND 1SVZA 2EZ0C 3SJVB 4PG2A 3T65B 1YSOA 4K71C 4PY7A 2P8LB 2COVD 1BMGA 1L9RA 3QQ4B 4NJ9H 4FADA 1U8OA 3L9BA 3VFMA 3OX8B 5F6HJ 1CMOA 3KM2A 5DYFA 1WD8A 1I7UB 3CSFA 3N3EA 2ATKB 3BSGA 4H88L 3LTVA 3FO2A 3DYPA 5TDOB 4F5CE 4X5WA 1U8QA 4X0KA 3DROB 4LKXA 2IQAB 2Z1KA 2DYSB 1V7NL 2I24N 3UMNA 1I3RA 3GXFA 3MXWH 1G4RA 4O02L 3IKKA 4HCRH 4Q9BA 4W6XB 4B96A 4M7LH 4R83A 3MMEB 3DPBA 2HJLB 3FONB 3EAKA 1ODAA 1VFMA 2DYPD 3BFWA 1YEEL 2H47C 1YNTB 1VPOH 1QOKA 4RGNC 5FO8B 4HISA 5LXVA 2NXZB 3W0WA 4OV5B 3E7JA 3RZCB 4K3HA 1N0XH 2YD0A 4HIXL 2I32A 4H8QA 4WUUE 4L1HA 3VXQA 3P11L 4RGOH 1JPFA 4XC1H 2AZAA 4BFOA 1UCBH 1DSYA 4Q9QH 3NFNA 4XGZA 1T1YA 3W9DA 3FAWA 5FW7A 3DDFA 1M1SA 4GRLB 1F86A 2NR6C 3QHZL 4KY2A 3MBWB 3GIZL 4NHCH 2VUOA 5ETUB 4PFEA 4UZGA 3ZKMC 4NN7B 4EJ1C 1KC5L 2F08A 1NINA 4H40A 1WBYA 3Q8BA 4NQDD 2ZWKA 4I0KA 4PJ7A 5ESAA 2JB6A 3QUKB 1P1VA 1GYCA 1R0AL 4QNPE 4PV9B 1Z3GL 5HI5C 2ETWA 1WAAA 3H6AA 3LQZA 3HMXH 4G71B 2EVIA 1JGIA 3OKMB 1IGTB 2IPKA 1AO7A 1QFPA 1WWAX 4M6ML 3GRWL 1KG0B 4DT2A 5J5EA 4AKQA 4BHUA 1F00I 3DI3B 3TIEA 2R0KH 4QWWC 2YD3A 3IFPA 3KPQA 2YHGA 3FU5A 1NFDE 3D39B 4O00A 4AC2A 1GGIL 4M7JH 4XB8A 3GHBH 1ZT7B 5KYUA 4E0RB 2OMVA 4YDLB 3WXWL 4GRWF 3S5ZA 4O02B 3S34H 5FFOA 5TH2B 2XPGB 3ENEA 3QIBA 5EOTB 3BWUC 4X6BB 4CN6A 1CCZA 4LCCA 3CSGA 2JFCA 4IBLT 2YPVA 4HDIA 3G5ZA 4XNAA 4OM0L 3TLRA 5B1CA 1V05A 1WD9A 5KSAA 3AQYA 5J6SA 1WZAA 3SPVA 3V10A 2DOCA 5TQ2H 1IBYA 3MREB 4QJ3B 1HZHL 1OGAE 2VLLB 1UB5B 2WYZA 1SOSA 3G08B 4J3BA 2GJ6A 4P5RA 2BVQA 2ESVA 3KDMA 3TA3A 3LZNA 4ZS7H 3BWSA 3HZKB 2CO6A 4LPWA 4ONFH 4LOUD 1OGPA 1HXYB 2E7MA 3DTUB 3ZKSD 3GBML 2IAMB 4LVEA 2W9EH 4GMSL 2YAFA 5E5MB 4DGYH 4PJDB 3BEVA 1QLFA 5IFHL 1IBDA 1SLXA 2CUHA 3CJJA 4JPKL 4N6RA 4NT6B 4RAVA 1RFDH 3EOAB 2L7EA 4FABL 2GHZA 5AW1B 5IHUH 1T7YA 1FE8L 2A77H 2X3AA 3MR9B 1DEEB 4PJFF 4ZTPH 1GA2A 5GRVL 5C9JB 3WD5L 1INQA 4JFDB 1WZKA 4ECNA 4HSCX 1Z7JA 2Z93A 5SWZB 2VZSA 3C2AL 1UCBL 1QRNB 4FA8A 4OFPA 1BREA 5HY9B 1PSKH 1PDKA 3MLYH 2VDML 4XO3A 2Q6WA 5L8KB 4MNQE 2DWTA 3QZLA 4I3RL 3MO1B 2Y23A 3EFDH 1IB5A 4H5SB 1BOGB 3FUIA 1L6ZA 3UBFA 3VI3E 1IBZA 1E5ZA 2BIQA 1SYVB 4JRWA 4AUUA 4Z7VF 1HVXA 5BUPA 2WGNB 3QA3B 3SPCA 3CFMA 4HAFA 4M6NL 4M1GL 1Q1PA 3L54A 1QSFB 4AKPA 5TE6H 2J55A 2NXYC 3DRQB 3EG9A 1S7UA 3VI4B 1S5HB 1B0RA 4MNGA 5FGBC 3SPGA 4EZJA 4JDVB 4L5FH 5LGKA 4WK2B 3T5WA 1ZKAA 3TV3H 2NNFA 1JNJA 1YJDH 2OSXA 4HUWA 5DD3H 1VSCA 3STBA 3RTLA 3K0WA 5F9OH 3QXDA 2QQKH 3V5KA 3X3GH 2DQJH 3CC5A 4UINL 3RX7A 3ZTJH 4KKNA 3PNWB 4IKKA 1CLOL 4LU5L 3KYOB 3SE8L 3TNNA 3D4CA 1XXFC 4IGBC 1IM9B 2W07B 3C8KB 1I9JL 4YR6A 1JERA 4P2QB 5DHXB 1Z5YD 2OCFD 1UCTA 2F9BT 5IW1A 3FCTA 1OSZB 4JDEB 3CQFA 2I9TA 3FUEA 1LO2H 1CGSH 1AAJA 2WO2B 4L3EA 2CA3A 3HVDA 5DD6A 3ETBJ 4XT1C 4MSWB 1E8XA 3ISRA 5I17A 1W0VB 2X6VA 2Y7LA 5B4MD 4I1PA 1NKGA 1DVXA 3CE1A 1RVFH 4G7SB 1MW1A 5DZOA 5HJ3A 5ICXA 1BM3L 4R96A 3MRNB 3DGGA 4M1GH 1QZ1A 1AFVL 4AIEA 1SQMA 1P7QA 3RJQB 3RY5A 5BW7A 2BDNH 4R6UA 2Z6FA 4PRIA 5H37G 2IO5A 1DJYA 2ZUVA 3OKDA 1OSPL 2FATH 1GIGH 4AYBA 1AMYA 3BDYH 1E6OH 2OL3L 3MUY1 1NA8A 2BVPB 5I0XA 3VFPB 4EI0A 4YS4A 2UWEF 4TVPL 5C0DA 2YUVA 3O6FB 4JQVA 1FDLL 1U8MA 4JRYE 5GRZA 5IHWA 3LN5B 1A7QH 3SKJH 5TGBA 2DW5A 4JFSA 1JI1A 2XLLA 1MOEA 4R2GC 3ZDXE 1IO4C 3BT0A 1QYGL 4PREA 1XGPB 4F8PA 4EZMA 3QG6A 1NMAL 3OAZH 3FRUB 4QJ4B 1GW6A 1M9WA 1A4AA 3BJLA 3QBTB 1A9EA 3F00A 1BVZA 3MUUA 3L9EA 3P4OA 2GK2A 3KXFA 4TRPL 3TU6A 3HI6H 3D25B 4EN3B 2ZKMX 4CDHA 3MRQB 2F54D 4H8WL 2MCAA 1LO0H 3AY2A 3A47A 3DIDA 5KSBA 4EUPB 4JFFA 2RR3A 5KS9F 3CPLA 4LCCC 4HZLA 3LZPA 4OY9A 4FD0A 5E00B 4PSRA 4O2EB 3QUYC 5FFGA 5JIDA 1NFDB 1TKWB 5C0BD 5DURB 3QS3A 3TT3L 1NBYB 4FQLL 3UFIA 4KJYB 1QNIA 2ADGA 2K9FB 2CR6A 3MLYL 1GJWA 3ARBC 4APQB 1MFDL 4Y9BA 5DTFA 1BBDH 2IANE 3QXWA 4WCYH 3CVBA 1ZD6A 2BNRD 4R97B 3VQLA 1VADB 5EORH 1MHPL 5TDNA 4LKCB 1F41A 1QLRB 3TO2B 4KJQC 1Q1JL 4OKVB 4R7XA 1EHXA 2QJDA 3W9EA 4PIRF 3HN3A 2X41A 3T3MB 5CUSH 4U1HA 3MOQA 3JV6A 6FABL 4ONOA 1TSRA 4JRYD 3ZDXB 1J5DA 3ZKXB 3FCTB 2JMRA 5E6ZA 2J1WA 5EUKA 1ES0A 1GR7A 4XP4H 3WI9A 1NL0L 5GIRB 4AV0A 5FYJU 5DMYA 5EEVA 2OZ4L 4FTVD 5CEYB 1RJLB 1JHKL 1ZT1A 2F8VA 2IDUA 2A38A 2X87A 4M6MH 3RDTB 3EDDA 2XKNA 5ANHA 2EJ1A 4AENA 4HUKB 4RGMB 4WTXA 1XTLA 1AMXA 1A64A 3AY4A 3MN8A 4GP5B 1PFOA 3QJOA 4M9PA 4MB3A 4MGXA 4MXVF 3VXQB 5KYWA 4ODUB 2R8SL 2UX6A 3DYOA 3JQOB 3GGWB 4GRMA 3L08A 4TKWA 4Y1AD 3S37L 4BH8B 2G2PA 2P5ED 1KWGA 4U1JA 2J6EH 1RPQA 3QORB 3MV8B 4JFQB 5EPMB 1OTUC 4XVUD 3VI4A 3KNBB 4ODSL 3P4MB 5E1QA 2VMJA 2HRGA 2X9YA 2O6FA 3PDGA 3TNMA 3BKMH 3C60C 1RZIA 5I1AA 3CDCA 2NXZD 4YBLC 2Y07L 4J3XA 3RY4A 3V7MA 3BZFB 3DBSA 2QKIC 4P57A 3AUVA 2BIHA 3MJ9A 3SE3A 2XQYA 2APBA 1HDMA 1DCLA 4B9YA 1YPZF 3SJVA 2ZX8A 2H32B 4D7PA 4AYDC 5CEZH 4AM0B 5HHVH 2N1TE 3JZYA 3L9RA 3IBEA 5F7HA 2IAAC 4TVPE 1ZMYA 1XSOA 2NY1C 1Z0NA 3HW7A 3KBEA 4X7DC 3X12B 1BMZA 1F6FB 2PCYA 5GRXG 1T5WA 4QRUA 3NJNA 4BWTA 1LDPL 1J05B 2ZPKH 1YLBB 3FQWB 3BKCL 1JZ8A 1XXDC 5FA4B 4QLRA 4OZIB 2CJUL 4WTWA 3HNVH 2DWSA 3OKNB 2NY7L 1D5IL 3CC1A 3MBED 3OAYK 4IRJB 4RDBA 2ENPA 1P9MC 3BW9B 1RZGB 1MDTA 4HJEA 1BJ8A 3PWJA 4YSDA 3OXSB 1A1MA 1T83A 2D9QB 4ORGB 1NEZA 2F7QA 1DO5A 4ZAKC 1UATA 2BXZA 5TF0A 5IVZB 1WS8A 5KSAB 1P4IH 3MFGB 4QAWA 4GSXA 1QSVA 3RTQA 3MYZA 2ENQA 4OJCA 4M48H 4IDJH 3BO8A 5I6XB 1X5HA 3LV3B 3LXUX 1Z9PA 3SIKA 2VDQH 3PABB 4ACTA 5J56B 2QSVA 2HKHH 3HA0A 3UPRB 3AXLB 4KOBA 4FE9A 4HKZB 1DHKA 4X99A 4XWOC 5E4EB 2WAHA 2F18A 5GQBA 3D51A 2QVIA 2OW6A 5JZ7C 3QEGH 4HJJH 4D7BA 2UUDH 1ZHKB 2D9CA 2FGZA 3G5YA 4MCZA 1NBCA 1V3KA 4N90D 1YEWA 5J6HB 3WEAA 1HYSD 3KHOA 2BVUA 5DO8A 2WPGA 4N9OB 1IJ9A 4ELMF 1KJ3L 4N9GB 1M05B 5FGCE 2XTJD 5CSBA 1UJTA 2I07B 2V0AA 4TNWK 1HHGA 3UDWA 3OKMA 3ORJA 1B9ZA 1YEJL 4ONHA 4J4PA 4W9LC 2EEDA 4D0BA 3Q7JA 5HDQL 2OBGA 3CN4A 2QGBA 3MRGA 2IGTA 4PV9A 3U9PH 4A6YL 5DCCA 4TQHA 3V4VL 1IBHA 3WFCH 5IHBA 1MQKL 5D4QA 3K2IA 1WHPA 3KPRA 1BZ9B 3R0NA 5D6DA 2I69A 2GJ6D 4L3EE 5I66A 2WTOA 3K6FA 1UWGH 3VWJD 2L3BA 2FLMA 4F7EA 3BVWA 1AKJD 1U95B 4PJDE 3SYCA 1TYRA 3VUAA 2HT3C 4RA0C 4ZUWA 4X4YB 3IU3B 1DANU 1IC0A 4IDJL 1N4XH 4AH2B 3QWRD 4AQ8C 2JJSA 1I1AC 1P4LB 4Z0BH 1E65A 4LF3A 1NFAA 1JCKA 3F12B 5IB1A 2Q3ZA 3U36A 1TZHB 4PIBA 1MIML 4XVJL 1B90A 3WXVH 2DEYX 2Y3NA 4LCWD 5KANI 2K7QA 2EAEA 1GZQB 1B4LA 4TQEH 2O6PA 3EOBA 1PX4A 1WA2X 3MCYA 2BDNL 2Z0UA 4XN4A 3HMXA 3RLSA 1GS7A 5D1ZB 1FZKA 4WUKH 3S7GA 3HAEB 3I75A 1QEWB 2H32H 2CUMA 4X4ZA 1NCCH 1A8ZA 5FA3A 2B14A 3VXUD 1BEYL 5C08E 1UM5H 3ILQC 2KYIA 3FBKA 5LBVA 1KJ2A 2E74C 3KM1A 1H3GA 2X4PB 1JZ2A 4NBXB 3OX8A 4AV5A 4AMWA 1LVEA 4NKMB 3C08L 3QUZC 4N2IA 4E5XB 1BWMA 1Y6KR 2BOCB 3GK8H 3M07A 4BH7A 4JQXC 1M7DB 1T4KA 1NCIA 1KB5L 5FX3A 4WSJA 5E8NB 3RFRA 3EJUA 3ZIMA 3FAXA 4N3TA 2NW2B 4OD3H 3D0VB 3V95A 3BN9C 1ZVYA 4HPOL 5B39B 1NGXB 1TNMA 5F70A 4WV1C 1J1OL 1XH0A 2P24A 3AT0A 3T2LA 4PG9B 5TE6L 2YPVH 3VVWA 4KV5F 3L5WA 2V17H 1QWNA 3C87A 4XHQA 5DVMA 2NXYB 3KGSA 5DK3A 2VDLH 3HZMB 2K7PA 2CHZA 2ENJA 3ZQWA 1HHHB 4PCSA 2NMSA 2FO4B 1RIVH 2FL5B 4RFOH 5DZVA 2Z0BA 3LKQA 1M1XA 3WGUB 4LCWB 1T80A 1WRFA 2XV3A 2F0CA 1VIWA 2K3HA 4JHUA 1I9RL 1MCLA 1VFBA 2J43A 3N9GH 4IK7A 1TZAA 3S3SA 4F7EB 1YMME 1DBJL 5I0VA 2QDVA 1FNGB 2V4LA 3QUZD 3GMLA 3BXNA 4DO6A 3BYTA 1MCKA 1BZ9A 2X6AA 4M8VA 4XPTH 3ULVD 1CICC 4ZMNA 5CCGE 4PGBA 5INDB 1IEAA 4R4ND 1EPFA 3LMJL 5DJZA 2C1OA 4AQ1B 3LH8A 2OULB 3D5OF 4PRNB 3T0EB 4DERA 1AZBA 3MRFB 4HBCL 4BXVA 4JFWA 4HMEA 2VC2L 2IANA 5D1ZD 1OPOA 1AS8A 4NENA 4UAOB 2Q8BH 1IZJA 3RU8L 3U6RB 3UZEA 1NGYB 3A6OA 1IGYA 1UJ3B 2P44B 4U7KA 3PY9A 5TPWL 4ZW3A 4N8PA 1VFUA 3U9UB 2XHNA 2VW7A 4G82A 2RH0A 4FQHA 2AJZA 1J1OH 4ODSH 2XX0A 2HG0A 2LE9A 3K0YA 4YSOA 5C0NC 3ZTEA 1MIEL 3FTGB 4I87A 4NENB 2C9SA 3ZTNL 5LGHL 2IV9A 3KWWB 3WHXB 1NAKL 4JE0A 1U8NB 1N6QL 1ACZA 3IXAB 1ORSB 3QNFA 2VE6A 5C0EB 5EUOB 1AJ7H 2VR8A 2RCSH 2DQDH 3PHOA 4H0GA 3S3JA 1W91A 5FYKE 3BO8B 4E68A 1KEGL 1U42A 5C0ND 5IP4A 3ZZQA 4IJ3C 4QLWA 4ANXA 1FNSL 5C86A 4MDIB 3FU7B 3GJEB 5F2FA 4HWBH 4DCQB 4Z7QE 5G2NA 4EPSA 1FNGA 3OB0H 1LQBC 4YWGH 1A2YA 1CLCA 4AJVA 4LHJB 2DI8A 4NQSA 3UYOD 3PWVA 4AEFA 1CL7I 3NRQA 3IAQA 4ERSH 2A9CA 1OTTC 1M1XB 4MQSB 3QDAA 1PZDA 1S9VB 4DGWC 5HYJE 3OB0K 3WTTA 3LKSA 1I3GL 1YHPA 1DLHA 1UZ8B 1WE5A 2QHLA 1OSPH 2FATL 4XNYH 3L1EA 4PJ6A 5C3IA 1JPGA 3PG2A 1WBXB 1DQIA 4UT7H 3EO9L 1X7SA 2VO5A 3QFJA 1IAKB 2M8XA 2AK1H 2QVMA 3ASNB 3OLGA 2Y7OA 3H85A 3O0RH 4HFUL 5DC4B 1KIQB 4JRYB 4IOIB 1KIRB 2ZKWA 5CJ8A 5DMIL 2OK0H 4G8IB 2ZP0T 2R59A 1WS7A 5DT1L 2K78A 3SDDA 2LTQC 3SE9L 2A6IB 1T22A 3D30A 4G59C 5D7IF 1KFGA 4WI4A 2V2XB 1GYAA 2BWQA 2R15A 1HHIA 4RQQB 3WKML 4LL1A 2Y4SA 2HG5B 5GSRA 4OVVA 1BLIA 3C5JA 1U3JA 5HGBB 3BZFA 3PGDB 2KS0A 3D2UA 4WFFD 1A66A 3RNKB 1YQVH 5DJ0A 4NXKA 1CYXA 3QUMA 1Q38A 2UZPA 2YC1A 3GMQA 4EI5B 4KJWD 3CDYA 4OT1L 1FCGA 2D7PA 2ADJA 3CG8A 1ILSA 2P8PA 1DQKA 4HKXB 3BP6B 1NWPA 3RE0A 4HUMB 3CSBA 1FNSH 3NFPA 3PWLB 1B3JA 1IEHA 1JSYA 1G9MC 1XGQB 2AJYL 5D2LA 3DO7A 5TQ2L 4EUPH 3L13A 3SOTA 2JCCB 4UDUB 3I9IA 3TA3C 5D55A 4I18C 4JB9L 4M93C 3TVMB 3MV8D 3QK0A 2KUTA 3GZPA 4HJSA 4XMKH 3GB7A 4Y16B 1E90A 1G0DA 1NMBH 2VUYA 2CUAA 2DKSA 3FF7A 1UGNA 1EQWA 4N5UA 1NBQA 3TWCL 2H1XA 2E7LA 3N44F 1D7DA 1JGDB 1INEH 1DL7L 4Q2ZB 1HIMH 5CEYA 1PIGA 2L7UA 5IY5B 5GGUB 4JRXD 2J8OA 1OM3L 1CXEA 4LEEA 1IVTA 1UWYA 3HHRB 2UWEB 4XNUH 2MWCA 4JO2L 4J2QA 4JQIL 1SMOA 1GHFH 1J1XL 2YK1L 3MZTA 5D1XA 3VXOA 3PQYD 4PV1C 4Q14A 4RAHA 1ZE3C 2P42B 3N5AA 4Y4KB 4P5TB 1X5JA 3GJFH 2ODIA 3TH2T 1KWKA 1OGSA 1Q94A 4LKCA 5B7EA 3HHMA 4QGTA 5C0GA 1G7JB 4GYBA 3WYRA 2G60H 3IDNA 3SODB 1CLYH 1GS6X 3VXTB 3ZU8A 4AKOA 4CW1B 1AQ8A 3OHXA 5D72H 1QEXA 4MNHB 2AQ3A 4K8RH 1RUKL 1OCWH 3V6ZA 2D2OA 3FRPA 1AS6A 3EF7A 2J4WH 1D6VH 4P48A 4XC3L 4UTBH 1K5NB 4I2XB 4B9FA 3QJXA 4MNQD 4UT7L 4BSWB 3BVUA 2X0UA 1N7MH 2NNXA 5T1DL 1G1CA 5I82A 5MEOB 4NQVA 4HVBA 5AB1A 5CIPA 5E5UB 2C9UA 4XMLL 2XVBA 3UYPA 2IVFC 4PRHA 5FYKU 3DIFB 3V7AE 3LQMA 4XCEB 1T20B 3KZ8A 1TCMA 4RCAA 1MFMA 3EFFB 3P30L 4GUOA 3RTQB 1A9EB 4P46D 5A2CA 1JRHL 5D2NB 4KI5D 3VFNA 3SDXB 4X6CA 3WJJC 3WOVA 1KTRL 1U3HB 5C0CB 3AMLA 2X2UA 5DLML 4E9YA 3S8GB 2YAOA 5FV1L 2NYKA 3OXSA 1N59A 3VXRE 4RSYA 5DJ8A 2FLBT 1NIFA 3TM6A 4PJAF 4IIZA 1OLZA 1CDIA 1ZVSA 1G9NC 3E38A 2XACC 4IBQA 3NCMA 4HG4K 4RZCB 1J9SA 3HIZA 5AKTA 5B22A 4PJEF 3Q13A 3WFBH 4GIAA 2WBWB 2ZAGA 5AYTA 5I0YA 2AW2A 3EJQA 4MB5A 4YHLH 2E27H 4Z78A 5ILTH 1A6TA 1QYGH 3TO4A 2LLGA 3VD3A 4HEMA 4I2XE 1YEIL 4F80A 1FFRA 1YQVL 4MQTB 1QBML 3GHPA 2FQFA 5C7XL 4MS8D 3LS4L 1YECL 3ZRSA 4BFIA 5LGJB 1PF3A 3W0WD 1NOFA 2AK4D 4NHCL 1FLRL 1NJ9B 5AL8A 4H7VA 2X7LA 2GIYA 4PD4K 1SOXA 4WEBL 2FR4A 2O5XL 3QNXB 2HJKB 3REVB 1KXTA 3QPQC 4EMZA 2CKBA 3CHPA 3K2UL 4APXA 4XO9A 4FA6A 5T3ZL 4I89A 1IU1A 4JBSA 5EPMA 1KB5A 5K59F 4IEFB 3MLSH 4ZRGA 1SFDA 3GGWA 4A6YA 4YK4B 4N87A 4HUXA 1I1AB 4ELMB 3SKMA 1KB3A 1UC6A 4G5ZL 1DUYB 4L23A 4ZNCD 3EGSA 4M3HA 4LHQB 5CCJA 1W6LA 3U4EA 2AK4B 4PBXA 1C12A 4GQRA 2VXQH 5CR8A 3V6OE 1XAKA 2F19L 4IRSB 3U9WA 3X11B 1HE8A 4GKSB 2J57A 1QWUA 1J10A 2HLEB 1PNCA 2LU4A 4HQQL 2SODB 4FLQA 4QRQB 2MOGA 5F7FA 4DWHA 1XGTB 1Z9LA 1G7IA 1P1ZA 2RCSL 4KKCC 4X9BA 3UDWC 5LVEA 4PLNC 5MI0B 4D9LH 4JFXA 2XOTA 3LPPA 2IF7A 5T8IA 4KKBD 2UV3A 2IWFA 2AAVA 4POUB 4WKXA 5C9JA 1ZS2A 1ZA3A 5JYMA 3VGGA 2ZOKA 3ZY7A 1CFMA 1MRFH 1EBPA 1E4XI 3CZFB 5FC9A 1BG9A 4PRDA 4ZQTA 4RAVB 2ZAHA 1G9EA 3WIHL 5JOFB 1NBYA 2IQ9L 5E2JA 4R2GB 2O6EA 4H8PA 4LIQL 4LXFA 4GG6A 2O5YL 2NXYD 5E9AA 5E00A 1NBVL 3ES6B 5FXCH 2JH2A 1OAXH 2Z31A 2BVQB 2ESVB 1F6AA 3KDMB 4AK1A 3U2GA 4WAFA 1LM8V 3QQDA 5EEZA 4N0CD 1U8KA 4XNXH 5E70A 1A14L 1TPXB 3O9WC 4TVSa 4NZTH 3DVIA 3GKWH 3Q3GB 4CN4A 1AKPA 4PTUB 2VNCA 1MLBB 4OFYA 4WO4A 4X6CB 2N4IA 3DUSB 4ZO8A 2MCG1 3K1DA 2J7LA 3IRPX 1MFEL 4W9EC 4AEHH 4YVNA 5ADPL 4LCCB 4S1DD 1KGXA 1O6TA 3QSKB 4XPAH 5FWRA 4WO4B 4XBMA 4X6BA 4PREB 3F6JA 3SDCA 1B2WL 3Q3GA 2EE6A 4HPOH 4HXAL 5LNGA 3CMOL 4L5FL 5KAQF 4O58H 5TJWK 5D1QE 1OK0A 2B9BA 3BX7C 5FGRA 1S4IA 3V0EA 3HS0B 4HLEA 3CQQA 5AW5B 4Y19D 5GJSL 4N2BA 3W38A 5IVXE 2CG9X 3GSWB 4AMXA 4UZUA 3P3RA 4Y1SA 2JIXA 4PJ9D 3IFPB 3KPQB 3PDDA 4GSUA 1AG6A 4CVUA 5C3LD 4GG6B 1JZFA 1AH1A 1TIUA 5JXAH 5D71H 4CUCA 1KZQA 3L1FA 4PGJA 1GPOL 2HVKA 3TBYB 3Q5OA 4MNHA 3BZ4A 4C55A 1EUTA 3D18A 4CW1A 3TA4D 1NCCL 3HB3C 4QO1B 5KG9A 1P4BL 4FNTA 4G7RB 4BK5C 4BKLA 4YHZL 4TOYL 5DS1A 2XTSA 1U9KA 1CGXA 1GL4B 3GSOA 4O9HL 1M57B 2ZYIA 4XHJD 2BOLA 2ENYA 3D3VD 3VFTA 4JFXB 1T0OA 3ZE0E 5CJ5A 2UZYB 4L05A 2GFBB 4HK0A 1YYML 2P5EE 2AQPA 2F74A 3X17A 4NSKB 4IK6A 5BZWA 4XTRD 5ABAA 2B1HL 4NQCB 3DTXB 4YDNA 1MJUH 1F56A 5FS5A 2LFGA 3IN0A 4LL9A 4TPRL 3WKPA 5GS0H 4J3SA 1PMYA 1J8HE 5KVFH 1H8SA 2C4FU 2Y22A 15C8H 4BQ8A 1WZ1L 1ZY9A 3KXFE 3TC9A 5IM7A 1MW2A 4X4ME 1GGTA 1LO4L 3RZCA 3PNWA 1I1AA 3GD1C 4ELMA 5DJCB 2PCPB 2ED8A 3Q5TA 4ZO7A 5DRNA 5IFAH 4U31A 2KBGA 4CDGC 3MTRA 4XBEH 4K23L 35C8L 1PAZA 3HB3D 1FPTH 1RY7B 2Y2YA 3DPBB 3FONA 3LIZH 5DA4A 2EXTA 4OFQA 3BP4A 3U46B 2W81C 3N42F 3NH7H 2IQAA 2AP2A 4UOJA 1QSFA 1RIHL 1IJNA 1MY7A 1A4BA 3EYSL 4XAKD 4GW4A 3S3PA 4TOYH 3U0PA 4K3JH 1YYLL 1EO7A 4N24A 4L29A 4I3SL 3CV5A 3KLHD 2NT1A 4M8RA 3IDGA 4YDIL 1MAJA 2I25N 2WMPA 3DARA 5CGBA 1PLGL 1FIEA 2UVEA 4A2EA 5SWQB 3EOTL 3RWHB 5I1HH 1FRGH 2A6IA 1OB1A 3BP5B 3VRIA 1JNHB 2V5MA 3GMOB 1WV7T 4KY1L 5EF3A 2VZTA 4AW7A 1GY1A 4NT6A 32C2B 4HWNA 1M4KA 5C2BL 3SN6N 3MOBL 1JPGB 5AKVA 4MA7H 3OG4B 4NUGL 3LRHA 5LG1A 3C9NB 3O2WH 4QRBA 1QUPA 1NGQL 3EDJA 5TPWH 1PW3A 3HE6A 5EDXA 4EBQL 3GSQA 4E9QA 3TA3B 4JG1H 2BCMA 2NNCA 5C7XH 1YY8A 1ZTXE 4U3HA 3RQ3A 5F88B 2ATAA 5IESL 3AXHA 5KVDL 4BQCA 1CN4A 1SFHA 3Q43A 4N8UA 4DCQA 3C5SA 1I9JH 4OZHB 4PJCF 1QPPA 2VH5H 4PJ8A 2ORBH 2OX5B 2EXYC 4Q6IB 4R4FL 3MRKB 1YEKH 2GJZA 3FU8A 5C0CD 4JHZA 3QWOB 1N5YH 3UYPB 4PVNA 4HCRL 1OXYA 5F6HI 4O02A 1T0NB 1UOKA 5AD0A 3QGVA 2FBJL 3ULUD 2Y6SC 3WHXA 3MOBH 4X7TA 1MFAL 2ZXDA 4BSWA 4UOW0 1IAMA 2AAAA 4FFYL 2X4UA 5IK3B 2CM5A 4XO8A 3DMMB 3FQTA 1CYWA 1PY4A 3DX7B 3IGFA 1H3UA 2HUEA 1UFGA 4AL8H 3O3BB 3L48A 5T1LB 1I8UA 2Y9RT 4W9CC 3K80A 3MCKB 1B4JH 4YFEA 4LOFA 1SEQH 2VERA 5GGVL 4URTB 2AABH 4JANA 4K5NA 1A6WH 4R90H 3WKQA 2ZQKA 3F05A 3QXAB 2EDWA 3M88A 3QZOA 5IVNA 4WZ9A 3SDYH 3VD1A 3C6SB 4F58L 1TETL 4JZJB 1BV8A 3H2PA 4XP6L 4H44C 3N43F 3STLB 4HEPA 4GRLC 1E3FA 4XMUA 2EIZB 3L45A 1J5OL 3M8OH 4XXCA 4H1LH 5GGUA 3MSPA 3L7FB 1QLEB 4Q2ZA 2NY5H 3DV4B 4C83A 1S9WA 2QSTA 4LCIH 2G9KA 3AS2A 5DSCA 5JIPA 1E50A 1PQZB 2FL5A 1KNOA 1UD8A 1FUNA 1JYNA 4ZFGL 1JK9A 3ARFA 25C8L 4EI5C 2GT9A 1KTLB 2J73A 4GG6F 3LCYA 2NSMA 1A5FH 1DE4B 3QI9D 2AJXH 5EDSA 2DL9A 5EUOF 2VLMD 3G5VA 2V8LA 2OM5A 2WHVA 3ILPA 5JW4Q 2AI0L 3CZUB 5MEPB 2BWDA 3BQUC 4XAWL 4JFZL 1MCPH 2YO3A 4Z95L 1RUQL 5DD0L 2BSBA 2PETA 1ACCA 3KPSD 1PS3A 1UM4L 4BZ2L 5I2IB 5TDOA 4N26A 2XUWA 4MASA 4G6AD 3VYPA 5ILTL 5E2WL 1FP5A 3K6OA 1E3ZA 4OZGB 4E5XA 1U8HA 1XD1A 2VLJA 1CQYA 3UEZA 3D2UB 2VZVA 3RVUC 2P28B 1AP2A 2BM3A 3U25A 5FUZL 3DHUA 1J5HA 3O4OC 1L9SA 3HZVA 3FOMA 3MV7B 2FX7L 4ZOBA 5IOPA 5C08B 2HPTA 3RWGA 4ETYA 1DVUA 3MV7E 5L4IA 1EAOA 4NO5A 5AZEL 1FNLA 1OHQA 1LP9E 2DQGL 5CJXA 1SVBA 1KIRA 3ZMEA 5BRZB 4BFNA 5L4JA 2DJUA 1MCDA 5MEPA 1LP9B 2NR6D 1MRCL 1QRND 2KHAA 4FYSA 3FB6A 3V4VB 4OQ1A 1KB9K 1TJMA 2ZCHL 2CRYA 4NOFA 4XO4A 5GRYA 1JPTL 5KN5B 2A73B 5I5RA 4GO8A 1DR9A 3ZN6A 5FYKD 2LAAA 1DLHB 3QAQA 3TP4A 5DSCB 1SGKA 3KH3A 4ZDHA 4KI5F 3A24A 1P7BA 1TQCC 1YEFH 1QO3B 5DMKA 4Y9EA 1FQ9C 3W5NA 5E6YA 3DJZA 4U1KB 3S98A 4A1RA 4ZFFB 4YNYB 3SE9H 1S9XB 3FPXA 5GRJH 5CN3A 3FU7A 3GJEA 4P5MB 3LRLA 5SWSB 2AXGB 2ZCKL 5A2FA 1PG7L 1CFBA 4JKWA 2MKLC 3MZGB 3QPQD 3O6MH 3PHOB 2ICES 5D7IA 2VR3A 1SJHB 3DXAE 1RAMA 5DHEA 4ZTEA 4PCYA 4Y89A 2EXWD 3QQ9D 4FG4A 5IGXH 1F2QA 2V2WA 1P5UC 3MNDA 4W6YB 2NLJB 7TAAA 5I1GL 1AZUA 1RP9A 3U1SH 2Q7AA 3QI9C 3TBCA 1MCQA 3SCMA 5HHVL 4WI0B 5JUEH 1MPAH 3QQ3A 4RMBA 5BMFL 2Q20A 4D3CL 4KGJA 2YKKA 3GSVA 2HWZL 1I3UA 1TVHB 3D0AA 2C5DC 4XPGH 1UT9A 2DWDA 3EH5B 4YSTA 3FUDA 5D4HA 4UM9A 1GSKA 3H7BA 1Z5LA 4XVUC 2C1OB 3HPJB 3MNZA 5AOLA 5GRJL 2MRYA 1S7VB 1KJ2L 4C56A 4L3CB 3PQYE 4JW3A 3FZUC 4YZWA 4GIOA 4AGLA 1E28A 2H3NA 2P80D 3K3QA 5F9WB 4LCUB 5GSVB 4BK4A 3ARBD 1GYUA 4CVZA 5F71A 4UQ3A 1PYWA 2VDKL 2V9TA 4OSUL 2BFVH 4KHTL 2Z1PA 1DDHA 2Q8AH 3HC0A 4HF5H 4MDRA 4W4OC 3UTTA 4F93B 3V52L 4JFPA 4OI7A 4Y19B 4M1DL 2XNAA 5BV7B 3Q0HA 2CZNA 4M5ZH 1CGVA 2GK0B 4YMPA 1CFQB 2I7OA 4QXUL 1EAPB 1H19A 3MPCA 2YQBA 3HZMA 4DFIA 3OLEA 3KS0J 4YHOH 3WTSA 1PZ3A 2I9LA 1IGML 1DJXA 1CGWA 5IIEA 3M1BA 1KPVB 1A7QL 3JWDL 2B0SL 2NTFB 4APQD 1TJIL 2GTQA 3VX1A 1D5ZB 3WKMH 4Z5RB 1BZ7A 1FVDB 1MREL 1GJUA 1NAMH 3VGBA 5I8OL 3APMA 2NW2A 3QCTH 3JTBA 5EV7A 1BQSA 1BFTA 2YPLA 1ML0A 2AJUL 2CK0L 3L4ZA 5FYLD 4ALAC 1GZPB 2YPKB 4LLQB 5FK9A 5M7QA 1HHKB 1KN2H 4R8WH 1OCRB 1M7DA 1T4KB 4LAQH 4GKNA 3HB3B 4MRCA 1R5VB 2WLKA 1IAIL 4S1DC 1I8LA 4W9GC 1XSJA 4MQ7B 1WEJL 1LK3H 4DESA 4JKMA 3EDEA 3UIZA 3V4VH 1M7UA 1PKQA 3P0VL 1TUPA 1VHPA 2FH6A 3VD7A 4OUUA 3RWCB 1JXJA 1DVQA 3WS6C 3GTTA 4HJIA 3MRIA 3KLSA 5GZOD 2EDKA 4PJBB 3B9KD 2J20A 3HAEA 4L4TD 2W80C 1LK2B 4JY5L 3DHMA 4IGBD 3DSFL 4G7VH 1SUHA 5CN1A 3U46A 3IFLH 4AZ8A 3PL6B 2BNRB 3V52H 1VGKA 2QLYA 3EOBB 5CP3H 1LO0L 3HC3L 4NZJA 4FQXB 1VENA 1FFPB 4XVTH 2FYYA 2BJML 3AG4B 4E5XG 1M2OA 1G9NH 2XV2A 5CXPA 4FP8H 4MQXD 5GRUH 4YZFF 1HSBB 3ZKNC 1MFBH 3LNIA 4JX0A 3VG0H 1QI5A 3F58H 5B39G 3U2SB 3FQUB 4UDTA 2HSIA 2VMCA 4PJXB 1DBKH 1ZHLA 3KL0A 1BQ5A 1XMWA 5DZNA 5EFIB 1HCYA 1SY6L 2VKWA 3MJ7A 4KDVA 1KTKE 5LBSH 3QULB 2AABL 2BNQE 1G7MA 3RWJB 2QGCA 5C07D 4JCMA 3FC8A 5FYLE 1R46A 3D33A 4L18A 1Y07A 3PAVA 5HVHC 5HHPA 1MFEH 4LPXA 3T3ME 3WDJA 3AUWB 4JFYB 3FXIC 4PB0L 3BPCA 5DC2A 4LSVL 2J8HA 3G6JF 4N90E 4WW1A 5KVGE 4AMKL 2W0PA 4AGNA 2AEIT 4JO4L 3C60D 4GW5B 4MAYA 3VI4F 5K5YA 1E43A 2ADIA 4HOXA 1E7UA 1B6DA 3QDMA 1HL4A 3CMOH 3DK2A 1HJBC 2XRAL 4QO1A 1ADQH 2PTTA 1G7HA 4ZFQA 3AS3A 4PJHF 3TXAA 1KBVA 5I75C 5HDLA 1KPRB 1R34A 1Y18B 3IDXL 4PLOB 5C0AE 3WUZA 1PZ5A 5TQ0L 1TKWA 1HC1A 2VXUL 4AQZA 3V0GA 1S9KC 4JO8A 4NM8H 3BD5A 3FB5B 1OPGL 1T6VN 2YA0A 2DQIL 4XRCB 4PJ7F 4OF8A 2CSPA 1USQA 1IE5A 2ITCA 3CVHH 3MJ8B 2ARJA 2XZCL 2NCEA 2B0SH 4KNUA 4L9DA 2GG1A 4HKZA 3X1EA 4IBWA 3K72A 2X5PA 5J1SC 5J13B 2PWFA 4UMGA 3O3AA 2NXZC 4A37A 2VDKH 4OGZA 1VAHA 4RFOL 4YSPA 4BUHA 4ZTOL 4L8CA 1FVCB 3T9WA 5DD1H 3B3BA 1OB0A 5FDWA 2GSIB 3KVDD 3MCLL 2ARJB 1X5KA 2KMWA 4PD4J 4PM1A 5JXED 4RMWA 2Y5QA 4FHKA 3BGFB 1T89A 2W1NA 2L0DA 4CMMB 1U8PB 5CM1A 2H3KA 1BZEA 2A9AA 3SKOB 2Y69B 4QR7A 1MRFL 2GITB 4KZ0A 5F89A 1A1MB 5J11C 4E41E 1Y18A 4L48A 2DI7A 2J6WA 3TV3L 4LSDA 3C5ZC 1UZGA 1WFUA 1GGUA 3HZYA 3IJSB 5KUMA 2NY6D 5G5DB 2X6UA 5E7FA 4L8SC 4M61B 4FGMA 2DQCL 5L7XH 2XN0A 5ID1B 2DL2A 5D1ZI 1USZA 3RU8H 1O0VA 2R23A 1O5DT 2O26U 5DD3L 3EJJX 3MRNA 3HHSB 3NCJH 2ZOKB 5FOJA 3HUJF 3VRJA 2Y1VA 2ZNWA 4EUPG 2OJEB 1MHHA 3MJ7B 5KVDH 4NQUA 3QT2A 4OZIE 4NAJA 4MSWA 2FTAA 3ARDD 1HL5A 2ZNXA 3KLAA 4X7SL 3CVHL 4G2AA 3SKNB 3TURA 4XPTL 2HT4C 1W9XA 1TJHH 4Y4FC 2BINA 1NCGA 1W0WA 4YEEA 3CXHJ 1AGCB 4QHLA 2VDMB 5B1JA 4BZ2A 5I1AB 3LZFL 1XV8A 4X6DE 3LOWA 4P59L 3FFCA 4N86A 4MZRA 5TFSL 1O9ZA 1JXGA 1MCEA 4JQIH 3C5ZD 5AKSA 5I30L 4QNPF 2E86A 3LQAH 3UAJD 3GJFA 4Z76A 5JYLA 4PTTB 1J5IA 4HS6A 4FG0A 3ULAB 3MDJA 5E1AB 4JFQA 4AGOA 1D5XA 5DI8A 4GI8A 1NANH 2VDLL 2NY5L 2NZ1A 3DRTA 2P9RA 1JS4A 2YR3A 5CEZD 1F3JB 1MWAB 3V5KB 3HC4L 1IRAY 4A6YB 3VH8A 2OR9H 4P4KC 1KY6A 2H0PA 3P9MA 1JYWA 4IKIA 2YKLL 5T1KD 2NY6C 4K3GA 4HKBB 3OZ9L 1S5HA 1E9QB 4R90L 3NSFA 5GGTA 5E8PA 3BSHA 1KXTB 5GZND 5ACLA 2I5YH 1UADC 4JEGB 3BE1H 4GRWE 4R4BB 1IFHH 1A6UH 5B7FA 3T08A 1MF2H 1ORQB 2XA8L 5DJAA 5EU6A 3SEPA 2YD2A 2X7LB 3A23A 4WJ5A 4LSSH 4NC0B 5H8DA 3F8UB 3CFDA 1KJMA 4EF3A 3O3DB 2J1KA 1HXMB 2R1YB 2NNRA 4OM1L 1VKXA 1D5ZA 1AXSA 2C9PA 3Q9QA 1F1GA 4JZNB 4E9TA 4R5XA 3GO1H 3UAJC 3TCXA 3MRPA 5GJTH 1FH2A 1BYNA 5DJXA 4Z3TA 3IDIB 2V7NB 1G84A 4DVRH 2OYMA 3A4FA 2Q86B 2J88H 2VITA 4J5VA 3X14B 4HOZA 1Z9MA 2VSCA 3DDGA 1T3FB 1WUNT 3QUXA 3LVTA 2ADGB 4ZZFA 1C08A 4N6RB 3QCVH 4N2GA 3TJPA 4N0UE 4OI9A 1E27A 5DUPL 3WGVB 3ARXA 4FFYH 4PRBB 1QPKA 3NG5A 2HA1A 1HE7A 3LXAA 2ERJC 4CC1A 1L0XA 2AV1B 4PEEA 5CUSL 1HZKA 4U0RC 2QV4A 4JMXA 1MN4A 2FQGA 2YQGA 4ZSOB 4J3OC 4RMQA 4MAUH 3MREA 4XWGH 2QGEA 1ROWA 2VXSH 3BKJL 1T66D 3PIQA 3CUPB 3QO0B 1A8JH 1IFRA 5D2NA 1XGYH 3THML 3QR2A 2GTWA 3RZCD 4K2UL 5KVGL 4MDJA 3DIFA 3S36H 2IWEA 1YNTF 5K33A 2JQZA 4YDJB 3D3VB 2NY4C 1JK8B 1J5OH 1D5BA 1XL4A 3MHZA 4OVUA 5HGDB 4TSBH 1AKJA 2OMUA 3VFVA 4YGVA 5AG9A 5F8QC 2HRPL 4NO0A 4TUOB 1QATA 4E9WA 1GGBH 1SBSL 5CKGA 3OKDB 5E2UL 5CCKH 3LIUA 1UD5A 1A6AB 3RPIA 5HYJA 1SN2A 2QGDA 2Z4QB 4WV1B 1IGTA 1DBKL 1DL7H 3E9UA 2FUQA 3FO9A 4TLTA 4U1MA 2XC8A 3FT4B 1F58L 2CRZA 3P0YH 2G5RA 1W0VA 2PF6A 5DF0A 4HIIA 4F37K 5C71A 3WLWC 4PS4L 1JYVA 1MCFA 3O0LA 3RA7L 5I6KA 4Y4KA 4BFFA 4GY4A 1HEZA 1ZEAL 4IKNA 1QG3A 3LRMA 4H26A 1H6FA 1TJGL 2JIXD 4PJ9A 3Q1EA 4U1NB 4KUZL 4GKZA 4Z3GA 3A0OA 3MNWA 1FO0B 3THMH 4LRNL 1FV1B 2JXMA 3NOIA 5KN5A 4P2QA 4Q52A 5I8EB 2OW7A 5MENE 1S8DB 2BP0B 3ETSA 1Q0EA 1DBBH 3S96A 3ZHKA 3SQOH 4K5LA 5JDSA 5F9DC 5T3XD 1U8LA 4K3EL 4LLUB 2DI9A 1FZJA 2IH3B 3QEQE 4HSAC 5D2NE 4ZXBA 1YRKA 2GEQA 2B1AH 4I77H 1HCVA 4LSPL 1AQKL 4AQ1C 1I8KB 4WW2F 3TV8A 2A74A 3GDBA 2XN2A 5DYOA 3J07A 2BNQA 2IJ0C 3SY0A 4JDVA 1NZRA 1YUHA 2ODHA 3H53A 4LRIC 4A7GF 1AR2A 3DO7B 1FNEA 1ZWIB 3HE7D 4LKXB 5EIIG 1UD6A 3ZUCA 1KJVA 3LKOB 2EADA 4BGDA 2ADJB 2WKLA 4FQ2H 2NPLX 2YLHA 1AXIB 3IMSA 3SGEI 3T8XB 4KPHH 1SQ2N 4JZOB 4GXFA 8FABA 1BOGA 2XG4A 4UM8B 3GINA 4XE0A 4OAWB 5AQ0A 3CZEA 3NDZE 2X4SA 3MX0B 4KRPC 2Y7MA 1D5RA 4FFZA 4MMZC 1T22B 4UIMB 4CAGA 5JR1H 2VLRE 4JVUA 1LO3L 2IH3A 1ED3A 3LVEA 4KX8A 4I0PB 1OAZL 3IJYB 4DP8X 1NCWL 1KIQA 1KACB 1JI2A 1IFGA 4G3YL 2DYRB 9PCYA 5AVXB 4H2CA 1WAEA 2ATPB 1PTZA 3DV4A 2VN3A 5IBLD 4KK8C 1X5MA 3QEGL 4F3FB 4JFZH 1ROCA 3IFLL 3G5WA 4D8OA 4PVMA 2CO6B 2ZKHH 3QYCA 2BP8B 2CAKA 4FFWC 5EOQH 4AYEC 1FCCA 2EDEA 1PZ2A 2X89D 3PP3H 4KVCL 1FHNA 4J8RA 4U6XB 4GB9A 4KMQA 4PGDB 5I5MA 3FT1A 3L81A 4P3CH 4E36A 4RMSA 1C1EH 5JW5A 4Z95H 1MZZA 4PS7A 4UU9A 3BKYH 3VXMB 4P59H 3GI9L 4HDIB 4WLCA 1MUJB 1UTDA 3APCA 4ZUUA 2HCZX 4PVLA 4LP8A 3RJDA 1PJ9A 2HVJA 3IMWA 3QDGE 2OR8A 7CGTA 5T5NF 4HK3J 2CO7A 3TT1H 5KZCB 5CD3A 4K7PX 3BESR 3E2HB 3A4DA 4PWJA 5LCVA 2ZAIA 4E0RA 4YPGA 4D9QD 3T0XA 2FD6H 5IQOA 4XMXA 4XX5A 4FJ6A 5IROC 1I1YB 3CU1A 3D39A 4MXVE 5AD0B 1EX0A 4O4YH 4ATTA 1H3TA 3RGVC 4U3XA 3KPOB 4OF3A 3GMRB 1XR9A 1N67A 2XBTA 3U9UA 3WJMB 5E2VL 2CCWA 1IGFH 3VD2A 1TU2A 4Q9QL 1SMDA 2HVJB 4PP2B 5A7BA 3ZOAA 1T6WA 2EDOA 3RL2B 2GTWB 4PJ8B 1XEUA 5I8KL 2UVFA 3SDAC 1LHZA 4G9FD 4Z6AT 4IBYA 5LXGL 3MLWH 1LL1A 2BLFA 2PW1B 5INDA 3DJSA 3NPSB 3B2DC 5L6YH 5K93A 5ESAB 4MJ6B 1BIIB 1QACA 3PGCB 4PV8B 3RX5A 2W0LA 3ME0A 4IGBA 4NUQA 5DWUL 3BGMA 3QJSB 1FRGL 2WBKA 3RFZC 2X53A 5ETUA 1WSST 4QRPD 4Q9RL 3C9NA 1UEYA 4HH8A 1HEHC 1E27B 5C1MB 3LZOA 4NO2A 3FJTA 3MRMB 1YPZE 2CBPA 1T1YB 3W9DB 2ATPA 2PTUA 1L7TH 2W59A 1L9QA 3ECQA 1G6RH 3NAAH 3N40P 1H5BC 4A7TA 4Z7AA 2FO4A 3KWVA 4D3CH 3AGVA 1T3FA 3QUXB 2P52A 1K2DB 2GPZA 3PWNA 2X28A 3EJZD 1HH9A 1IGFL 2D7MA 1U8JB 5GZOA 2FSDA 4N5ED 2AGJH 3V4PL 1U8CB 4BIKA 5E95B 3NPZB 2GVYA 4DF9A 1N8OE 5HDRA 1I9RH 2AEWA 3IDGB 4K8RL 2J3SA 4R26H 2EYTB 1OGTA 2MEJB 3W2DL 1X4YA 3V9EA 3B2XA 1NEUA 4C4BA 3WKNA 1LMKA 3B7SA 4KVCH 2YPLE 2EKJA 1DQDL 3ESUF 1CD8A 1P0SE 4M43H 2XXFA 5D70L 5T5FH 1YUHB 1S6NA 2UY6A 1L7TL 1MRDH 4ERSL 2JQMA 1NCTA 3BAKA 4R7VA 1T6BX 4I13B 5FA3B 2XRAH 4NAQA 1RK1B 1JF6A 1QPXA 5DJCA 1NUFA 1Y7VA 1E3XA 4ODHL 3TT3H 1OF0A 5E1AA 4L3ED 3U7WL 5ELIA 1SLVA 2P5WA 4AM0Q 4W68A 5EF1A 4NP9A 4C56D 1A6ZB 5D93B 3U7YL 2BHYA 3GHBL 4WGVB 4FL4C 2VN6A 1FO0A 2WKOF 3MNWB 4YHIA 2Z7ZA 3F5WB 3UJJL 5KVMC 4ELME 1AGCA 4FI8A 2GJJA 4QHLB 4RZKA 4UT6A 2ZD0A 5IB1B 4RLDA 3POHA 2UZIL 3BUQA 1F3RB 1UXWB 3ZE2B 5DGQA 4XN5A 3UIYA 1ZS8B 4YSSA 2UZYA 3NA4A 4NERA 5JPNB 2HFEA 1U6AH 2PNDA 4P4KB 5DHYA 1ZVHA 4G8FB 4GQPH 1GC1C 3WEOA 3MGTB 1SDDB 4M5YL 2DLFH 2OSYA 5TE4H 4ZYKA 5IB5B 5IHHA 1F02I 2OKMA 4F8TA 4Z0XA 3AACA 2J2ZA 2E59A 4I4WA 5IG7A 5EWIL 3QRBA 4V2CB 1EFXD 4S2SB 1JHKH 2CO4A 1QSZA 3HHSA 4TPRH 1SJMA 4IU3A 5DQJB 1QSEA 1AHWB 3QI9B 2BO0A 1ETA1 1ZDQA 2ROYA 3D18B 5L2KA 3RUGA 3O6LH 1DDTA 4KXDA 4WW2C 2XFGB 4CC0A 3KYAA 4PJDF 2OTWB 2DICA 3N06B 3KPPA 4L2YA 4N2KA 4XNYL 3WEBA 1MPAL 3O8XA 5E6UB 1LWHA 2EP6A 3CTTA 4UQ2A 3HS0A 1KLFB 1A3ZA 1HWWA 3CMGA 4HX1B 3HJEA 2ZUSA 1JPSH 2VZ1A 1JE6A 1P6WA 1X5GA 2RMNA 1ZLDA 4LQFH 5F89B 4CKQA 3U48A 5BQ7B 2B15A 3DXAB 1JGUH 2XZAH 3SDCB 4OLYL 4A7SA 1LO5B 2X2IA 1AE6L 4B9JA 2JKJA 1VPOL 1UOLA 4KRMB 2A6DB 3ZKND 5GZNC 2AXFA 1UACH 4Z7OE 2ESVD 4MX7B 3DUSA 1AO7E 3SOBH 4PGEA 3D4YA 1D9KB 1GYVA 2AEOA 5L4FA 4Y2DA 4XVOA 4KUCF 2PR4H 1Z9SB 3F7YB 3F04A 1FGNH 4Z3IA 1R3HA 1YQ2A 3QQDB 1G7QA 4MAZA 1GCFA 2K8QA 4R3SB 4K9EH 1OGAB 4Z77A 2I85A 4GQZA 4FQJL 2DTML 4TVPD 1LO3H 1E2VA 4OD3L 4DZ8B 2FWOA 4ZUTB 3UBGA 2Q7NA 1RQ5A 3ARWA 4P99A 1IC5L 2WKGA 5JOFA 3ZL4H 3RWEB 4PJCB 4HG4J 5HI4D 3ZO9A 4ENEC 1WC7A 5KSAD 2QQKL 1AR1B 3CZFA 2BRQA 4U1IB 3ATEA 4XBGA 2P26A 2RQEA 3R1GL 2J4WL 5AALA 1LLAA 1H8NA 1EAQA 1TYEB 2V7NA 5EZLB 2ZXBA 4U6HB 5B8CC 1TTRA 3DX4A 3MRPB 4KV5E 3T0EC 3X12A 3FMGH 5HHNA 1NC4A 4KO7A 2ITFA 4DKTA 2F8IA 4LLWA 2Y1ZA 4F7PA 4NZDA 1TEYA 1CI3M 4AVKA 4UINH 2R1YA 1TLMA 3BT2H 4XWGL 3UTQA 4MKMA 3TONA 5B38G 4MZ2A 4QRRD 4LIQE 4GKSA 1F4YH 4K9EL 1M56B 1OZUA 3VAEA 5ACZB 3VI3B 3IJ8A 3O6ML 3S36X 3TIDA 2D3NA 3H9HB 1MELA 4P3CL 3QJQB 1OARH 1VLXA 2PR4L 5IVXA 4F24A 1AO7D 1CG9B 1L9TA 1YPZB 3SGJC 4ZW6A 3QYNA 2FYYB 3S8FB 4NZRH 2B3RA 2CKBH 1P2CB 4ZXBD 5CCHE 2AEQL 5KVEH 1KYFA 2XFXB 3MV9B 3DRTB 1SXNA 3NA9L 5DD5H 5LQBL 1NGWB 1P6FA 3H2WA 3QIUA 5EOCJ 4PWEA 1GXEA 1HNYA 3QORA 2BS8A 2NX5A 2OMYA 4U1JB 1JTOA 5FB8A 1RK0B 4G8AC 2WVTA 4JVWA 3H55A 2HPOA 4QUOA 3RILA 3NABH 4PY8I 1QBLL 3JVGC 4N2DA 3DVNA 3RI5K 1JPEA 3F7VB 4NBYB 3PV7A 5BQDA 2HTLC 1G5GA 3CFCL 43C9A 1S7XA 4BQBA 2Q7YA 3EJCA 4LCVA 5FM5O 4LEXL 4OGAD 3BGAA 4RBPK 3GMMB 1LNUA 2QADD 4Q7DA 2PO6D 2CUIA 1WQVT 3UTQB 1DN0A 1OCOB 4OBSA 3VRJB 3VWKD 3EYUL 4ZBJA 4RRPG 2V5TA 4NC1E 1WH0A 2H45A 2YZ1A 1BHGA 3TH4T 1ECZA 4Z7QF 5TE7L 5HHNB 5KBDA 1AGDB 2OV0A 4JPSA 1I85A 1JRHH 4YDKL 1A9BA 3BJ91 1KCBA 4YSRA 3BOVA 3RKPA 4IQHA 1P7HL 5GS0L 4U6VL 2MJWA 1SXCA 3A3YB 2DM2A 5F0PB 4IRJC 1INDL 1N4XL 2ITEA 5CKAA 2A4CA 3L3DA 4PB9H 4HJTA 2UXFA 3BUYB 1J8HB 1LQSR 5GZOC 4FFVD 2Q2LA 3KR3H 3I6GB 4LSTL 5C6PB 4U1LB 1EZVY 4Y9FA 3QCTL 4DZ8A 4TV3A 2JKNA 4EZLA 5FM5M 5F6IB 4ALAH 2ILLA 3EYOB 3VWKB 1G1KA 3LNDA 3P02A 1RL1A 3M6DA 2L7QA 2XJKA 2BCKB 3B9AA 3BGFC 1QWHA 5IF0A 4L8CB 1OL0A 2OL3A 4RA3A 2WLNA 4U6YA 4EN3A 1QFWM 1X3DA 3KD4A 4CSZA 3HPJA 3MNZB 4KK6D 5F7AA 5AW2B 1TTAA 2XIDA 2CK0H 4PJ9C 5JQIB 1SHWA 4KFZC 4JM2A 1NCBH 2VYRE 3HE6D 5C0FB 2WXNA 2MH4A 2IIJA 3MYJA 5F0LB 2W60B 4DHLA 2ZIDA 4AOFA 1S7SA 3SYAA 5J6GB 1GHFL 4P2OC 4X8JA 1CLZL 4ADIA 4X6DA 1U8MB 4IRJD 3C6LA 5I0DA 1GPOH 2BIPA 2X4NA 3VFPA 1N8ZA 1UXSA 1RJYB 4XHJC 1ESOA 3GT6A 1NQBA 1ZXKA 3Q5YA 4GW5A 1Z66A 1ZHBA 3AB0B 3U7WH 3IRZA 4XPFH 3RUGB 4KTDH 1P7QB 2H0JA 3ZGIA 4P9ML 1ZLSL 3EUDA 1RI8A 4FFZH 4F92B 3EO1A 1FC1A 5DK0B 2FJGA 5HGAB 1DN0B 2J2ZB 3R19A 1ITCA 5FV2A 3U2IA 2UUDK 2Z4TA 5EFIA 4L9LA 4OCXL 4F7CA 1SMAA 4E9SA 4R0LC 3LN4A 2CNZA 4PJ8C 3DXAD 4L3FA 3L3OA 4XCNB 5GGRA 1RZFL 1HCFX 4MAUL 4B3VA 1OSZA 4GBXB 4JDEA 1KIUA 2I9TB 1DBJH 3TEZA 3B6SB 2B8OT 1XF5A 2VDNH 2WBJC 4IRSD 3NEXA 4R9HA 3LKRB 3WY1A 4IDLA 1OP3H 5LN4A 2BW4A 3E6HB 4PJBF 5KBPA 2E6JA 4NQEE 3ECVA 4WFGE 1XF1A 5DZPA 3HFFA 4UDUA 1S2EA 1PKOA 3CN1A 4AMKH 3KW8A 5AVVB 1N70A 5B3JE 2WZ5A 3L6FA 1EGJH 1XT5A 3HNVL 4S1QL 4PJBA 4NM4L 3ZZ1A 1BQHG 5HPMA 3OAYH 3OM3B 4M62L 2H6PB 1KYOK 2E7HA 4HWEL 4LL4A 5HYSB 5EBWB 2OXHB 2GAZA 2QQLH 4LQFL 1MG2C 3V5DB 2JJTC 1WAAE 1VA9A 2HH0L 1LGVA 2VLJB 4WJKB 3LNGA 4A6YH 1R5VA 2EDMA 4OZGA 5LB1A 3RUGE 3TBTB 3AQXA 3QA3A 1U93A 2E4FA 3RPBA 1T1WB 4AUYA 2WCSA 2X40A 5TE7H 2FEDD 4NRYB 3UG3A 1PLGH 2GEEA 5LDUA 5EORL 1B0GA 1G94A 4M7ZB 2EYTA 5E1HB 3QP3A 4LLWB 4FQQB 4WGWB 1A21A 2EIKB 1NGPL 1KPVA 1DJIA 3I2CH 2EE0A 3K6SA 3GMNA 4BQ9A 3IS1X 4NYLB 1E67A 3VXUB 2I9LB 1INQB 4JFDA 4HPHA 4N8VA 1DJZA 2FEDC 3FYEB 2DIEA 1I7TA 1HZHH 3K4ZA 1R3JB 5DJDB 3RX9A 1EFXB 1MEXL 1KNOB 3DOHA 1VESA 3O6FC 4G7YL 4P5SA 4NIYE 3B34A 1TSHA 1O6VA 4UTAH 4X6FA 4F1SA 4PJDA 3LIZL 3TF4A 4PGCB 3G6AA 4JPVL 1BX2A 3LJ3A 5L8LB 2NY3C 3AC0A 3EJPA 4XAKE 4FJZA 1AQDA 4UT9H 2E9WA 1BVLA 3WAKA 4FMKA 1RZ7H 1A7BA 4Y4HC 5AFAA 3C6LD 3ULVC 2EIBA 4P4KD 1ZVNA 4Y2DB 3RJOA 5DT1H 4N2CA 4FQXD 1RIUH 4UQBA 4E2OA 2QBWA 3H7BB 3WAJA 3BZEA 3WIFA 1U8NA 4MD4B 5GS1C 1MCOH 2JCCF 2WO4A 2H6UA 4FQ2L 2WBJD 1WFTA 2EYRA 2O4EA 5F3BB 3RL1B 4JHVA 3D4ZA 1MJJB 3WJMA 1H3VA 2NDGA 1UM6H 3OKEA 2H9GB 3QQ3B 2F1EA 1QFWH 5A2AA 3U6XS 1JGEA 1T5XB 2COQA 4G80B 3HI1A 4S0TD 4P23C 1G7LB 3E8UH 3KG5A 3VACA 2FZ3B 3T0EA 3ZLQC 3MRDB 3MGOA 2VQ4A 4JUTA 4R26L 3QZBA 1NCWH 4Q9CA 2J8UE 3RG1C 3BFOA 3JVFC 1EFQA 1OTTD 1CBJA 4L8SA 1BD2A 4JLRB 4I5BA 3P69A 1HIML 3FUJA 5CJOH 1JZHA 4QI3A 4FQ1L 1AR1D 4P5MA 3C5SB 4OZHA 4MJ5B 4A39A 2JI1A 3X1BA 3R06B 4LDCA 2XN1A 2J56A 1C8PA 1AGBB 3K74B 2GYSA 4NGHL 4DKEL 1JL8A 4NN5C 4KVNH 2PCXA 4KH2A 2EUVA 1R24B 2ZOTA 2K6WA 4NI6A 4ZS6C 5FKAA 3R8QA 2FCBA 1B4TA 4P3DA 5C09A 4EN3C 1AS7A 3ZMNA 2DTSA 2VMDA 4N0YL 1NEPA 4MJIE 1GH7A 5F7BA 1BQLL 2YJQA 3FSVA 1E42A 1ICTA 5C09D 3V4PB 2N7SA 2VGLM 4HXAH 1OE3A 4G6MH 4HK3N 1LEIA 2WINA 4PJFB 1CDYA 4G6AC 2JLPA 3BVNB 4FTVB 5FF6A 1IC1A 2YS4A 3GZQA 2PPAA 4UIMA 4KQ4H 1U2CA 1IQDB 4BZYA 1ETB1 2JKRM 3G04A 4HBQA 3NSCA 1AR1C 4JFVA 2Y2WA 1MHEA 1WHOA 2G30A 3CU7A 4LZKA 5EMYA 4UV4L 3ZL1A 5IUSA 4LSTH 2R2HB 4MAYC 4XBPA 5H35B 3HZ3A 1E40A 2HN7A 1EV2E 4AIZA 4MJ4A 4X5WB 3LIZA 3Q01A 5EO0A 2CMRL 3INOA 1KJVB 3FUMA 2E8YA 2FNBA 4N0RA 2R2HA 4JFFD 4XBPB 1BF2A 4DKEH 3RWDA 4JS7A 4ONGL 4QPEA 1EAJA 4JMNA 5AVWB 4EIBA 3L4YA 3T2OA 3MLUL 5HYSG 2VL5A 2O5NA 3BPLC 3ZL4L 5DURD 4NN5B 3T65A 4NNPH 1Y6NR 1I8KA 3NVQA 3OXRB 3G7TA 3SD2A 3BVNA 2BFVL 4RISL 4M6AA 1KDJA 2ZP9A 2H0EA 5FYJL 4M6OH 1VGEH 1KGWA 3RIFF 3FHAA 2B77A 2EC8A 5IBTL 1WLHA 3D6GA 1BZDA 4WJG3 1J88A 5FYKL 2X44D 3V4PA 4BSVB 3W5MA 5F1IB 2HUHA 2QHRL 3CVIL 5EOQL 3PP3K 2H1PL 4NO2B 2DQMA 3KYKL 5BVPH 1RULL 3FN0L 1YEJH 4PH8A 1PIFA 3BCFA 3QORC 1TZ8A 1UHVA 3MACL 5JMOC 3ZYOA 2DQDL 4U1NA 3HVNA 4JR9H 3PL6D 4CKVX 1FL5A 3C6SA 4ZMXA 1VB9A 2A1WL 3MUZ1 3P0GB 1PZUB 1I7RA 1IM3D 3TN0A 1GTNA 3IFOA 3PPEA 3V0WH 2F5AL 1WEJH 5IBLC 1MJ7H 3PGFL 3CBRA 4PJXE 2R0ZL 4NFDA 5HDWA 1NPJA 3E3QE 1AGBA 1DQJA 4RWHA 2H5UA 1RIHH 3K6IA 5ADOL 3G5XB 2I07A 4DKDC 1FYTA 1NLBL 1NDTA 15C8L 5I26A 3B9KC 2BP3A 2DH3A 3LS4H 3TBYA 1PVHA 4WI2A 1AFVH 5CEZE 4ZFOA 2FHBA 1KELL 1L0QA 3CVHA 4A38A 4RDQF 3CFQA 1JV5B 5JNYA 5EG6C 1Z6JT 3AG1B 4QIRA 2OR9L 2EIDA 2AI0H 4ZFOL 1JGVL 3SDAB 5CD3B 1J8HD 2LR4A 4LGSB 1I3GH 4GLRI 4ZMVA 3BT2L 3QWOA 1EBAA 5CILH 3D50A 3PL6C 5BS0B 4FF9A 4WHYH 1AQKH 1PEZA 1OP4A 4EDXA 3IU4H 3ALWA 3GZKA 3WIFB 2CIIA 3VXMA 3CUPA 1EZVX 3KLLA 3ZK0A 5JW5B 1RIVL 3V6FB 3WJLA 4JR9L 3GPSA 2VAJA 3DETD 4TRPH 4X5LA 3ECBB 4HLZH 4U7SA 3IFOB 3TN0B 2VQUA 2OPCA 5G4NA 4AWJC 1F6AB 1ODUA 4U7MA 4FFWD 5C70A 2IGLA 1DVYA 4P46B 4A66A 1OF2A 4OZIA 4ZJ9A 3SDAD 1KDIA 3T4YB 2VW4A 3H9SD 3BUIA 1BD2E 1V3LA 1X7QA 2ZXGA 5CZKA 3OMIB 3EOYG 5JMRA 4KMTH 1M7XA 1CIUA 1NMCC 4H20H 4OLZL 4AL8C 3B43A 3SDXF 3X1NA 4F8NA 4PRDB 5KWYC 5AAMC 2GSGB 1A3RH 2F68X 3LPOA 3T6QC 5T5NG 4OZFG 1ZA3B 2G9HA 3VD5A 5LHDA 5AAWC 4ACPA 2PPDA 2A0LC 5FYLH 1CQKA 4N2AA 1QR1A 2VC2H 3M1CA 1K72A 4YAQA 1N6UA 2C26A 5C2UB 3RNQB 2VL5B 2R83A 1RZKH 4MLSA 1E9OA 1DP0A 5ECJE 1S9YB 3CAFA 4QHKI 5JHDE 4LAQL 5C6WH 1B0GB 4FN0A 5FOBB 1FGNL 4NRYA 3QUMH 3EJZC 1JXDA 4LEBA 5AW4B 2Z64C 3IETB 5FDYA 1E4KC 3TNMB 3Q05A 4AIZB 3B2UC 4O5LL 3EYFA 1FNEB 1ZWIA 4GXVL 3MLRL 3KNBA 1P53A 2XQBL 1CGTA 1CZ8L 4O2FB 2ZXWB 1MHEB 1IGIH 4K3DL 3OAZK 1U4EA 5I18H 3G04B 4HUXB 3LKNA 4I3GA 3EDFA 1UFUA 4FKKA 5LNDA 3QIWC 4K9EC 4B97A 2HX8A 4IBZA 1ITBB 1LWRA 1YMMD 3TL5A 1EMTL 4YC2B 3VFWA 3KYMB 4PHXA 3PXJA 4P46C 4QTHA 4QOKB 1NUNB 2E3VA 4ZNEA 3ZTCC 2WN3A 5AOIA 5DLLA 7PCYA 2EVHA 1IQWH 1BD2D 1QNZL 5FHBH 3H9SE 5HHXL 1JF5A 5JQ6H 4UQCA 1KENH 4KKBC 4J12A 1IM3A 3TN0D 2GBVA 4DP9X 3Q9PA 4V1DD 2W88A 5IFJA 5FYLL 4LVOC 4XCNA 5GGRB 1W0WB 4C8XA 3GNML 2IOIA 1BGXL 5HHOA 3FT0A 3VMNA 3DETC 1ZIAA 1KEGH 2ZXAA 4QDGA 3FN9A 4OKVA 1NCBL 3VDBA 3D08A 5I15L 4HJ0C 1MHHB 3WCYA 3WN6A 3QG7H 1SOKA 5LXGH 2BX5A 3NP3A 4H88H 5AAPA 4OF7A 3WU1A 3E6FB 1Z3RA 2Z4QA 5L88H 2J6EA 3BZ4B 5B21A 5ICZB 3DSFH 1KTBA 4G7VL 4BQ6A 1XIWC 4NJAL 1HTYA 4OBRA 5JIQA 3L17A 5FW8A 1FWXA 4UTBA 4NO0B 4TUOA 3F83A 3IDUA 1ZVSB 4LRIA 1UXSB 5F7EL 1N8ZB 5F7DB 3HRZA 1X5IA 1WWBX 3C6LB 4G80A 1NEZG 2DMCA 1AKJB 1FPTL 2OMUB 4PU2A 3VFGH 1A1NA 4YXLH 1DFBL 4HFUH 3PV6A 1D9KC 3OKEB 1EXUA 2GITA 2R0LH 5I6OA 4P2RB 5C0CA 4P07A 1FGVL 1KN2L 4K0OA 4IJ3B 2VM4A 2Y06L 3BVVA 3TOPA 5E6IA 3BZEB 1X6LA 3NACL 3UXFA 1BLNA 1AI1H 1MNUL 3D69B 2ZX6A 3FT3A 1YECH 1P5VB 2IDFA 1MLBA 3LH2H 4XCEA 2WB1A 1EH9A 2FIRT 1IBGH 1NIBA 1U8KB 3R0MA 4X9FA 4CJ1A 5TGBB 1NDGA 1AY1L 1YEIH 4JRFA 2DV6A 2B59B 1EA9C 1ETZB 4XNZC 4D0CB 4YDKH 1N18A 2XT1B 4UQEA 3WHE1 3CIAA 5I6MA 1K5NA 4U1LA 4UMSA 3OKOB 2HVBA 1CGSL 2QDWA 3GUTA 3OR6A 1GC1L 1JF1A 3CDZA 1C08B 3E1F1 3VXNB 3CVIH 1A22B 3FQRA 4DW2L 3BIAX 2KQMA 3KCWA 3WNLA 1HFUA 4OQTH 4XVTL 4BK8A 3L4XA 3L4WA 2H41A 3X14A 5DZ9A 3UJJH 1TQBC 3KJ6H 1QX1A 4FNLL 5SX4H 4LLYA 1R5IA 1A9BB 3OHMB 3VSQA 4H8UA 4HZAA 1NSNH 3BPCB 3MBXL 3EH4B 4MS8C 3K6SB 2YAQA 5HHXH 4KX7A 5I28A 2IG2H 3UAEA 5J06A 2A2QT 2VN7A 4L3EB 1CF8H 1HWGB 1NM4A 4XMPH 1VKXB 3L3JB 3MC0A 4ZPTB 4FXTA 3O3DA 3MLZH 4FXGC 2PR9A 2GI0A 3CFDB 4NZTL 3Q8CA 4UT6L 3UG4A 3CH8A 1L9OA 1NC4D 3EJYD 1T1WA 3QDJA 2ENSA 3L1OH 5FIEA 1PCSA 3UJTL 4IRSA 4M7LT 3X11A 2K4WA 4FLOA 1A47A 1YO4A 4Y5VB 4IOSA 2YD9A 1YUKB 1SJEA 3QWRA 4MXWH 4ODTL 3T6VA 1OQXA 2N59A 4DO5A 4AGMA 2V5SA 4MCYA 3MUGA 5DUJA 3L5XH 3SKMB 1KXVC 2AJVH 3DVNB 1I75A 3CC5B 4RRPA 5C0RH 3PHQB 2E8ZA 4FLRA 1FFPA 3RWFA 3VH8B 1CWVA 1WITA 4J39A 5E6SB 2KZ1B 1ZANH 4JG0H 2OMYB 4IEFA 4P2OD 4X9GA 2HT2D 4ABWA 2LV4A 4MFHA 1KELH 4PTTA 3EG9B 2XWCA 4L1BA 4OCWH 5C9KA 4NZFA 1P7KB 3CGTA 2IBZY 2A77L 2AV7B 2IDTA 3MUGB 1CG9A 4UQ9A 4B9KC 2FSEB 4ES8A 2ZX9A 2Z8VC 4PHZA 2KZBA 2V5YA 2AJSH 2P45B 4WWKC 3BKYL 4G8GB 5FECA 5E23A 2CLZA 5A16B 1FO0L 4Y5VA 3MO1A 2IWGA 2CQVA 3O3UN 5BRPA 2DLHA 3UBXG 3ULUL 4M4RA 3TYGL 4YWGL 3WNJA 5E51A 2MMXA 4UT6H 5IQ9A 5FO2A 5HGAA 4Z3HA 1JNNH 4I88A 3PCYA 4IOIA 3PWPD 3U82B 3QEQA 4Q6KA 3T3PF 4GKLA 1N12A 1E5YA 4PJEA 1WBXA 4TL4A 3FN3A 3BPNB 3CFUA 4IBTA 2NNAA 3IXTA 1ID5I 4M61A 3PAYA 4N8CH 5CGMA 5I1KH 5G5DA 3ZSSA 1A4CA 2VO8A 2X1PA 5FHAL 2QSCL 1C9SA 3VSVA 1AYOA 4F27A 4YLCA 5CJOL 3KPLA 1AC0A 2X3CA 2VLKD 1K4CB 4Y1AB 5HGGS 3OKKB 4FI7A 2R39A 1U3HA 3ROOA 5IMLA 3B2VH 4N2NA 4YIQA 1IAII 4OZGF 3VGFA 3FTXA 4UQAA 3I6LD 4YSUA 3D39E 4BZ2H 5C0FA 1BIHA 2WJ7A 4MDIA 4YDMA 3FRPG 4AQ8A 1Q0XL 4PWFA 5CEXB 4F9PC 3WELA 2R0WH 4UILH 2QTVA 5IQ7L 4U6YB 3LEVH 4HOMA 1XAUA 1ORSA 2WLLB 5D9SA 3LZFH 4YOKA 2OMXB 2WVUA 3CFEB 2A9ML 4WY7H 1KIPA 2DJ4A 5FPIA 3QC5X 1EHKB 2N0KA 3KWWA 3DO3A 3ZHFA 4JPKH 3OKLB 1AHMA 4XCYB 1EXUB 1J8HA 4POZD 2YAHA 5DRXB 2LW3A 4LARH 4UTCA 2EILB 2WSKA 4HX1A 4KY1H 3GLAA 3LY6A 5DZLA 4GG8A 2AQ2A 4TL5A 1G7HB 4I48B 2GJPA 2Q2EB 5JR1L 1TZGL 4DK5A 1Q0YL 2UX7A 1S3RA 4QRPB 1IAOB 3OZKA 4ZX6A 5DJZB 1F58H 1A0QH 1IEAB 1Q94B 2WCPA 3GNMH 3LEYL 5D7HA 1X5XA 3RIAF 3S6CA 4P5TA 1AHWA 4HCGA 2ADFL 4R0LB 4M02A 1UQSA 3MKKA 1H3PH 1CTOA 1TR7A 1KEML 3EF4A 4HW6A 4YL4A 5IG7B 1OAQL 4QXTA 4OUOA 2Z8WC 5J3HC 3ZE0B 1MZYA 4A2MA 3EJSA 5A2IH 2BVEA 4KK9C 1X44A 2LLLA 1YAZA 3V6OC 1ZHLB 3QJHB 1I53A 3NH7L 3D9AH 3MLUH 4LPUA 4UIKL 1HNFA 5MEQB 1UXWA 5ICYB 1F13A 2Q7YB 2I5YL 2XTJB 4QRAA 1LXMA 1Z3GH 3ARZA 5HYEA 3NZHL 4OFKA 5T3ZH 3S4SA 4LOUC 2XQYG 3O6KH 5FYJH 2DQTL 2BH0A 2RALA 3TVMA 4AIXA 1CLYL 3T3MF 3MRJA 5FB8B 3H3KA 5DQDL 1P9MA 3G6JE 4AGPA 4Y16D 5JUEL 3BCDA 5IJVA 2P24B 4NRXB 5DVPA 4WVRA 1UH4A 4MLIA 3VI4E 2B3IA 2JCCA 5CGTA 3DSNA 3KYMA 3V2AR 3POCA 1N10A 4GRLD 5T1KA 3GXIA 5JORB 2F58L 3EHBB 1I3VA 1P2CA 2WD0A 2XV6B 3UAAA 1KLGB 3JUZA 3MRIB 4IRSC 4N2MA 5E8NA 2AMUA 3ULUE 3BP6A 3OWEA 2B4CL 2C3HA 2FWSA 3FO2B 4BD4A 4QTIL 5GHWL 5ERWA 1PSKL 2P5WE 5BMFH 3ESNA 4O2FA 3N0PB 1F90L 5L2JA 3QZWA 1U8OB 2JTDA 1Q72H 1KYAA 3IJHA 4U2ZA 3ETBF 1BPLB 3KGTA 1NIDA 4U3SB 3UAJA 4KC3B 1NPUA 2V2XA 4R4FH 1S5IL 4GT7A 3H3PH 4P2QE 1E4JA 4MHHG 5I1LA 3U0WL 5DHDA 2I26N 2DB8A 1FZKB 2GKIA 1UZ6F 4B7IA 1S9YA 3N1PC 5AUMB 2CJTA 1RJCA 2NOYA 2RBLA 3ILPB 3N85L 1DQLL 3NPSC 1UUNA 4YAQB 1IAKA 2X9WA 5I76B 4MMYA 2KLSA 5C0BA 1QR1B 2X09A 3DGCR 3NZ8B 2XICA 5D8JL 2Z8SA 1UD2A 3QAZC 3L95B 3RHWK 1HH9B 3C8HA 2JK5B 2CKNA 1UZ8A 4AL8L 3ASWA 4XNQA 2GSGA 1J1PL 3T2NH 3UBXB 1A6PA 2WBXA 5LUMA 3RWEA 1XF3A 2DBLL 3IU3A 5F7LB 3BRDA 1X7QB 4XNMB 1MFAH 2AQRA 4F20A 4GI6A 3NCYS 1WZLA 1TDQA 4X6CE 2FWOB 4LPYA 4LLDA 3GEFA 4RESB 5I66B 1A0QL 1BJMA 5CSZA 4P46A 1IL1A 2CLVA 3AY4C 5E2TL 4AYFA 6CGTA 2ZUTA 3K8MA 5BRZD 3VFUA 1G7QB 2J5LC 2OJZL 3ZRFC 2B1OA 2D4DA 2DQFA 3HUJE 2ITDA 2WIIB 3ECBA 1DZ0A 4GAYB 3O2DA 4OZHE 3ULUC 1BG1A 3X3FL 3B8SA 2DM7A 1D9KA 4CL7A 2Q1EA 4PGEB 3N6YA 5C3TA 2NX5D 3ZYZA 1TVBA 2ZUUA 1NC2D 5J4MA 1I8IB 2VIRB 3L2NA 2VW6A 2JE8A 2QPEB 3QZMA 3NJFA 3GSVB 4JY5H 4BRJA 2X12A 2AEQH 2AJZB 2DS4A 5D70H 2BNRE 3V0AC 1BAWA 2DM4A 4ZK8A 1TTGA 1F0LA 2HYMA 3ARSA 3WO3B 2NY0C 2WQWA 4FQPA 5I1EH 3CSTA 3G5YB 5CBEA 2DKMA 1MHPH 4GP8B 3RVUD 1WAPA 2VLJE 1NDMB 2V9QA 4XBEL 4M8QB 2GW5A 4GSQA 3IDMB 3F7RA 3JWOH 3UL4A 3VJ6A 1U3NA 5I0WA 2Y6TE 2P46B 3BH8B 4UWQB 2L04A 2F54B 2Z34A 3ARPA 2F54E 1NANI 2YN3A 5D1XE 3IPFA 1BXXA 2FX8H 3KH4A 1KFAL 3ARGA 1MUJA 2YGOA 5MP6H 1MHCB 4UNIA 3GJFK 4NC2B 3FN0H 4I4WB 1TJHL 4BFKA 1URLA 4C56E 1S9XA 4FP8L 4Z23A 4ENZA 4U1KA 4DK3A 4MAYD 4RGOL 1SHMA 1SDDA 1FL3A 4OGAC 1FJ1B 2J8UB 4BFEA 4PGDA 4KHTH 1HWHB 1SNRA 3TJEL 1YY8B 3PWJB 4MA8L 1YJDC 4BA0A 2VDRL 5DJ2A 1E9PA 4A67A 4HJGB 3S3BB 3TS8A 4N5EC 1XH2A 3SBPA 3LKPB 1VEPA 3LX9A 5BRQA 2ZOOA 3SE6A 2WTRB 4DK6A 1JNNL 3KCPA 3PUCA 1TFHA 3CLFL 5EHFA 1N0LB 3BQUD 3VO0A 1A6ZA 2OTPA 32C2A 4IHOA 4XN7A 3GBNL 3VMOA 3CN3A 3MXVL 3V7AG 1LP9A 3K5SA 1EJ6A 3ML8A 4K23H 2YEQA 1XZ0A 3EGDB 4APQC 3IJYA 4YE0A