2HG0A

Structure of the west nile virus envelope glycoprotein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
400
structure length
400
Chain Sequence
FNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLAEVRSYCYLATVSDLSTKAACPTMGEAHNDKRADPAFVCRQGVVDRGWGNGCGLFGKGSIDTCAKFACSTKAIGRTILKENIKYEVAIFVHGPTTVESHGNYSTQVGATQAGRFSITPAAPSYTLKLGEYGEVTVDCEPRSGIDTNAYYVMTVGTKTFLVHREWFMDLNLPWSSAGSTVWRNRETLMEFEEPHATKQSVIALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein
publication title Crystal structure of the West Nile virus envelope glycoprotein.
pubmed doi rcsb
source organism West nile virus
molecule tags Viral protein
total genus 65
structure length 400
sequence length 400
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2hg0A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 2hg0A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 2hg0A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 2hg0A03
5JHLA 2R69A 4BZ2A 3G7TA 4BZ1A 5H37A 3UZVA 1RERA 2P5PA 4UTCA 2HG0A 4ALAC 1OKEA 2JSFA 3VTTA 4X42A 5LBVA 1OK8A 3C5XA 3UZEC 5KVDE 2V33A 1PJWA 5KVFE 1S6NA 5IZ7A 5AAWC 3N41F 4L5FE 5KVEE 3N40F 5B1CA 3P54A 3MUUA 5AAMC 5LBSA 3UYPB 2JV6A 5GZOA 3N43F 2R29A 4FG0A 4AM0Q 5KVGE 3J27A 3N44F 2ALAA 2JQMA 3I50E 1Z3RA 5JHMA 4GT0A 5IREA 3WE1A 3C6EA 5GZNA 2GG1A 1ZTXE 5LCVA 3UAJA 4GSXA 1Z66A 4AL8C 3IRCA 4UTAA 1UZGA 1SVBA 1TG8A 2H0PA 4UT9A 4FFZA 3J2PA 2I69A 4UT6A 3N42F 3UZQB 1OANA 4FFYA 1URZA 3UC0A 4UTBA
chains in the Genus database with same CATH superfamily
2ZAIA 2VL5B 1G7HB 4ZZFA 4O9HL 1PKQB 3FZUD 5GSRA 1N5AB 5A2JH 2V3EA 1YYLH 3IXTA 3MAWA 1OD9A 3TFBA 4WGKA 4F5CA 2UZYA 3ZHLA 1UVQB 3QUYB 4FEMA 3APMA 3D2TA 3MZGB 4QAMB 4PRIE 4XO8A 1D6VH 1FH2A 1WEJH 2YRZA 3MRCB 4LCWD 3L9RB 3K6SA 2X41A 1NIBA 5I16B 3JTSB 1LE5B 2J88H 4JZOB 3QJXA 1ZHLA 1A1MA 1EEUA 2EDOA 4JRWA 3WUZA 3IJSA 3MRMB 2X09A 1FIGL 3C09B 1BHGA 5F8RC 1BFVL 1W80A 3NIDE 4GO6B 1AGCB 5HI3D 3LXAA 2EO1A 3BEWA 3FQTB 3MVSA 3V0GA 4CW1A 1I1AB 3MROB 4BFKA 1G7JB 3CVIH 3OMAB 2YBRB 4DGWC 5JORB 3WJJC 3UERA 5G5DB 4UTBH 2XKUA 3RWFB 5K9OB 3AS1A 4TSAH 4XE0A 2F74B 3GXIA 1YEDA 4LSUL 3BDXA 4X6CE 1TJHL 3QE5A 4DGVL 1P4IL 5ANME 5H35A 3NFPB 2X1XR 5F3BA 2X2HA 1HNGA 1DQIA 5JUEH 2OKMA 4F37K 2NY0D 1MNUL 1P1ZA 1P4BH 1R5IA 2ZOTA 1C16A 4X7TB 4N87A 2DKSA 4YHNA 3WFEL 4XNXL 2WBJD 3ZX1A 4PRPB 4WJ5A 1ZGLA 2BHYA 2FWLB 2YKLL 3A24A 3KLDA 3LD8C 1I8IA 1JAEA 1TO5A 1XSIA 1ZHBB 3S5LG 1EXHA 2NX5A 4LVHC 5FDWB 4ZPVA 4HKXA 3PWJA 3K6NA 4JPWH 3CLEH 3BSZH 3WIFB 4NDMB 1RSYA 2DWEB 3F2LA 3GSNB 1EQWA 1BXXA 1ZANL 1UXSB 1XTMA 5E4EC 4TVSa 2K8QA 4IDJH 5LNGA 1LLAA 1A47A 4MCYB 2J73A 4UYQA 4N0YL 2JCWA 4AL8C 3GJEA 1NKRA 5KBKA 1F3RB 1I8KA 4PJ5D 1OALA 1WC7B 2C9AA 4KNTA 3H9SB 1GW0A 1N0XL 2J20A 4AVJA 3RGVA 2WZ5A 4FA6A 3VO0A 1J8HA 1FRGL 5AOLA 3HZMA 3UBHA 4UQ3A 3WE6B 4TNEA 3V0DA 4GSDL 1EERB 1X5ZA 4HXBH 1JNNH 3BKML 4RAVB 5AWNL 3W9EA 1LJMA 3LV3A 4ZXBC 3QJRB 5D1XA 2QBWA 4AENA 3TURA 4Q8BA 3KPPB 1XH1A 2VXVL 2WQVA 3OZKA 3O6FA 5FV1L 2EKSB 3LN5B 4G71B 1YECH 3KEHA 4M93B 1MHEA 3UZVA 2MOGA 4F5CE 4F2FA 4UAOC 3V7AG 4EEEA 2E6PA 1RZJC 2GFBB 2VQ1B 3L3OB 1QPKA 3QXDB 4G6JH 4NI3A 1M7UA 5INDA 5TGBA 4BFGA 4LSRH 2XA8L 2CAKA 1M71B 1GIGH 3ESMA 3UZQA 3PREA 4YSOA 2XI9A 4PJHB 1ZLVH 1JGDA 1NL0L 3L3IA 2NCEA 4X83A 1QACA 3KAAA 1GKEA 2F8VA 4OI7A 1MCHA 1UT2A 3V6OC 3ZZ1A 1ETZA 2EINB 3QZPA 2UYLB 4NZRL 4I3RH 2A9DA 3F83A 1BEYH 3EH3B 3U0TB 2NXZD 2ADYA 3B43A 3M45A 3DYPA 4AOFA 1ETJA 2AXGA 3H53A 3RX8A 4BH7A 1JZ7A 3OPZL 3F7YB 3IJ7A 4HEPG 1R5VB 1XGZA 2HT4C 3S3PA 3IGKA 3GLZA 1N4XL 4NC1E 1YNKL 5CIPA 2VN3A 1OAYH 5EBLB 5F93C 4S1RH 3WDIA 4ZFOA 5D70L 1JHKH 3U7WH 2H0FA 5IJKA 2GTZA 4BFNA 2HT3D 2DWTA 1EHXA 2P5EB 1RUQL 3T4YA 1QR4A 5AKRA 3ILPA 1L0PA 3L4YA 5EORL 1B0RB 2X1WL 4AYFA 3GPEA 4Y4KB 4BZ1H 2WAQA 4AY0A 1DN2A 1U8OB 5IMMA 1T4KB 3HN8A 5F7EH 3RPIA 2XTSA 3VD7A 1P2CA 2ZX8A 4JRXB 4OCXL 4WWNA 3SYAA 1ZVHA 5BPPA 2NZIA 4MDJA 4QTIH 3SDYL 4RGND 1S7UB 1BIIA 3UABA 3OGOE 3UGUA 1G7MA 1ZHKA 2P42B 5B38A 1KTJA 1P9MC 4FNUA 1SMOA 4J3BA 4NKOA 5D7LD 4O51B 5F7WC 2NX5E 3WJMB 4FNTA 5EF2A 1RPUA 2R2EA 4N8VG 1HH6B 3MLPA 4OT1L 1FNEB 1DEDA 2PTTA 1KTDB 4G8EB 4RLDA 2C4FT 2GHZA 3Q6FA 3QUYC 2JMRA 3C5SB 3SKNB 3IN2A 3FOLB 3HNSL 4H8HA 4TOYL 4E2OA 2V9TA 3VFUB 3FONA 1DBKH 4W6YB 3QPXL 2CRMA 1HQ4A 4K8RL 2Q8BL 1BOGA 4KDWA 3CDZB 4ODVH 1Q1JH 2PNDA 1H8NA 1U41A 1CE1H 2V7HB 2XZQL 5TPWH 4YFLI 2K78A 5FOBB 4LLQB 4LLYB 5FUOL 2APVA 1M7XA 3BEVA 2O6FA 4KV5E 2PPEA 3CHSA 5E2WH 3C09C 1J8HE 1UC6A 4Z7AA 4BWTA 3MMEB 1JZHA 4F8NA 2PP8A 4Y19A 2JJSA 1H6TA 2DW5A 4LHJB 4FNLH 4R3SB 5FIEA 4BSVA 3T3PF 2N7SA 3OLGA 4NERA 5D1XE 2Z92B 1I1AC 3QUXB 4JM2D 5E03A 2H3KA 5DC2A 2Y2YA 3JBG7 4LL4A 2XLLA 2CBQA 3SKOA 5GJSH 3RVVD 4H25B 4OCWL 2HWZH 3VFWB 1SJHA 1F2QA 1OGTA 3CUPB 1J9RA 3DX2A 5AUMA 5DO2D 4K5NA 3OKEB 4QXGL 1U93B 4JHUA 2Q8AH 2YD7A 4MHHG 2XC8A 4CJ1A 3FRPB 5C0JA 5TF1H 1AFVH 5F96L 2X10A 2GSMB 5KJRH 3RY5A 3C87A 3K2IA 4JFXB 3AUVA 4LESA 3IETA 1RZGB 1NGYB 4LL1A 5FUCE 3PV6B 2XZAH 2CRIA 1MRFH 5EZOH 4GQRA 2XIDA 3Q2WA 1JZDC 2DI9A 4PB0L 1V05A 5KYUA 3TT1L 4EBQL 4WI4A 4F8OA 3REWB 3UO1L 4ZMLA 4P8QA 3JV6A 5BVJB 2O6CA 1DE4B 2IPKB 4MJ4A 1QBAA 3TTYA 1O0VA 3SDAC 5JXAH 2FRGP 2WJ7A 3H3KA 7PCYA 4MDIB 2YGPA 3HNTL 1U91A 3OB0K 4KJQD 3CN2A 1E42A 1TZAA 5C9JA 1CD9B 3EJZC 3BZ5A 3WIHL 3PPSA 4TSBH 4AV5A 3BD4A 3L6FB 2IBGA 2DKUA 3BAKA 3VGEA 4P5TB 5E6UB 4F33B 1MAKA 3LDBB 1ZPLA 4NYLA 4N6RB 1QNZL 4IU2A 1KYUA 2ALAA 1R3JA 4AXWB 3HS0A 5BO0D 3I84A 1WT5A 3PGCA 4UDTA 3GMMB 2YD0A 3C6EA 4G3YL 3LPGA 5EU3B 1YC7A 3PXHA 3EYQC 5C0AA 2OMTA 4NQCA 5FK9A 2DEWX 1AS6A 1IU1A 2VSDA 2UXFA 5C3TA 3VWKD 4YS4A 4M93C 1PX3A 1ERNA 5KAQF 2BNQA 3L3OC 2AW2A 2M26A 2XV0A 3TBBA 5IIEA 5JIPA 3QNZA 3U46A 4FN0A 4HH9B 2DQIH 4YIQB 3SDCB 1TVHB 3RKDC 3CDFA 4ANKA 4BKLB 1TZOA 5DVOA 3P77B 5JZ7D 2X4UB 5EA0H 3F6IA 1RHHB 2FT8A 2IC2A 2FEDD 3BH9B 3DV4B 5DUML 1OL0A 2APFA 2NY3B 3WS3B 4XBPB 4FFVC 3VJ6B 5IBTL 4DQOH 4ESKA 4Y19E 4ZO9A 1TNNA 4MXWL 2PABA 4HBCH 5T1KD 4EIZC 1WISA 1DJIA 3KVDD 3VI3B 5A43C 3RHWK 3MUGB 1CXLA 4K3JL 1DBML 5JIHA 1W0WA 2MQ0A 2WXIA 1MAML 4U33A 2O5YH 2AK1H 2K4AA 4KUCF 4BZ2A 4ELDA 2E46A 3ULUF 3KGTA 5AOJA 1J8RA 4HKZB 2MQCA 4I4WB 1N68A 1MLCB 5IG7B 3EYSL 4N24A 5T5FH 3MREB 1MWAB 4Y4KC 3QR1A 4KNSA 1CD0A 3QH3A 4NWUH 4WNQA 1G5GA 2OTUA 5PAZA 3U48A 3BZFB 3CFCH 3WSQH 1VACB 2ERJB 1DVSA 4U6XB 5HHOD 4PJFB 2C9RA 3PWPB 3UTZB 1D9KB 5J6GB 2ZG2A 1JZGA 4OZ4B 3C5XA 4XCEB 4MA3B 5EO9B 1R33A 1G9EA 1KYOK 1MW2A 3DECA 4H1LG 2YPLB 1EH9A 1XMEB 2BW4A 3K8LA 1JPEA 1GMIA 2BWIA 3D1MC 1IAIM 3IDMB 4NKDB 1CL7L 2I7OA 1HCZA 3UC0H 1KCUH 4OJFL 3ZTEA 4UNVA 2LLNA 2PWEA 3D87B 2PPAA 3HE6D 5MEQB 3GXTA 5E8DL 3HAEB 4U3SA 1IBHA 1NEZB 3KLQA 3WKNA 1JPGA 4MKMA 4PCKA 4QJ4B 1EO7A 2E9GA 3WFHB 1G7LB 2WIIB 4M61A 2BRRL 3VFMB 3QO0B 3F58L 3GMQA 2R23B 3HKFA 1AIZA 1QA9A 4MGXA 1LEIA 2LQRA 5J89A 3BH4A 5J6SA 4JQXA 3O6LH 4K55A 1FGNH 1G9NC 4WHCA 3TJHD 5J56B 3DO7B 1KCBA 3PABA 1O9ZA 1PBYA 2A6JA 5TTRA 5JW4M 4HT1H 4N1CA 1RMFL 4XAWL 2DWXA 3ECBA 3VXMA 3QUXC 5C0AE 1H3XA 4NQCE 4AIZA 4X9HA 5IROA 3MOBH 2WLNA 4PP1D 4M5ZL 4AMXA 3O9WA 2APWA 2CO7A 3BI9X 3AZUA 3CZFA 3RDTD 2MSPA 5L2KA 2VLRA 3HG2A 2BNQE 5EOCH 3KS0J 5IB1A 3GJFH 4HU8A 4G7QB 2BVOB 3S2AA 3L3GB 1LO2H 4P57B 3OJDB 3IS1X 5C08D 4UCFA 4EF3A 2ATAA 3SHSA 3GXDA 1A6ZA 2ZXCA 1U8KA 4R0LB 5IB4A 3VYPA 3CXDL 4Y1AD 5KSBB 2EH8H 4K7FA 4BFBD 2G3NA 1I3VA 4MWFB 2F1EA 5HYJA 2FECI 3FQUA 4XMWA 4WU7A 3B9DA 3PDDA 1CYXA 4MJ6B 3OR6A 3PYCA 1M4KA 4D7BA 2EEBA 2H3NB 4LU5H 4DGYL 4HAKA 1TXKA 2EDTA 2DLFH 5K69A 3G5YA 3UIYA 2OXHA 3KBFA 3TL5A 3B2PA 2N0KA 4LAQH 4HK3J 4WLCA 3PXJA 2QT6A 1T03H 2ZOLB 1J0IA 4YO0B 4XNZB 5E9NA 2FYYA 5JW4N 5JPNB 2B1HL 3TPKA 3FCSB 5EEWA 1FO0H 2BVQB 4KMTH 4LCUB 4DPBX 1J5IA 1XGPB 4C83B 3EGSB 3G9VA 2DQEH 2A9BA 3ARBD 1RIUH 3DETD 1CF8H 3L7FA 4G9DA 3LDBC 4KHTL 4P5TC 4V2CB 3GXPA 3Q9QA 3WUWB 1U3JA 1KBGL 4YXHL 5K33A 3FFDA 3GHPA 5FO7A 3OKOA 3DX4A 4ELKA 1R3HB 4PRBB 5C2UB 2NLJA 1NAML 4CVWA 2ITCA 4NSKA 1GYCA 4BWWA 1D5MB 2XXMB 2AEQL 2IQ9H 5C7XH 4C8XA 2Y1ZA 1IEAB 2FZ3A 2WB1A 3RA7H 1QBLH 2JELL 4IRSB 2CWRA 1QTPA 5IHUH 3SDCC 3I2CL 4LOUC 4P0DA 4YDZA 2CO4A 3B2UC 3IBEA 3QDMD 5CP3H 5TK4A 5F21B 1UA3A 1T2QH 4X98A 3MDJA 4FQ1H 4R4ND 4DKAA 1OB1A 5FO2A 4APQB 4KKPA 5HYEA 2W9EL 2NY3C 2IH1A 4DHLA 1NBYA 1WLGA 4LLAA 3H7BB 2Z1PA 3PPEA 2WQXA 4ONHB 4RZCA 3SDDA 4JNXA 1OCCB 1KEGH 4DAGH 4OAWA 4DTGH 3VXME 1TYEB 2WBKA 4OZFG 2I25N 5CGBA 4BEIA 2P52A 4A55A 2AF2A 2J57A 2XBDA 2Y2WA 4NJAH 1V7ML 2GYSA 4YPGA 1OCWL 5L2KE 2VLRE 5J1SC 2VXQA 2OX5B 2VR3A 5TDOB 3RJDA 2J21A 1WA2X 4Y4HB 2DQCH 4ATWA 3MLSH 3QFDB 5C2BL 4BXSV 2FQFA 3G3LA 3M17B 5F7KC 3MRFA 3TF4A 1GGBH 3R18A 5BOJA 5LBSH 4W9EC 3ZTNL 2ERJC 3LQZA 1QW9A 2ZOKB 3SPCA 3QNFA 1D9KC 3OWEA 2R2BB 3QUMA 3OXRA 4RDQF 4DO5A 1WBYA 3RUGA 3LKSA 3CXFA 5DJDB 2H26A 1R75A 1E4KA 1DCEA 2LU3A 4FXKA 4Q4IA 5HYJE 3SBQA 4JB9L 4LEOB 2E5EA 5F9OL 3VM5A 2VMDA 4H13C 2UY6A 4X0KA 2Q6WA 4HK3N 3WXWH 3HMXA 4JFFD 4Y5YB 1V54B 3CFDA 2WZPD 2NY2B 2N0MA 3HUJA 2JCCA 1JFHA 1P6WA 1UM4L 1X7QA 3D2UD 3QIUD 3VFGH 4UTCA 2OFQA 3FL7A 1F1DA 2CGYA 3M1OA 3EHBD 5GHWL 1T20B 1ORQA 43C9A 5BZWA 2WWMD 3EO9L 3U9WA 1WBZA 1BGXL 3RWJA 1WP6A 5L0QC 5I0WA 4NQEB 2DBJA 2J1ZA 4V1DA 2VDOB 1EJOL 4NNYA 2BZ7A 4NHCL 3HNVL 1RZ7L 2X4NB 2F5BH 3L3DA 3VFOA 4GG6A 4AC2A 4WKXA 3TZVA 3NZ8A 4ZZKA 3ALXA 4RSYA 4APXA 2WN2A 4MCZB 4AK1A 4OGQC 1RUAL 4XNUH 2HN7B 2DMBA 2EC9U 5HGAA 1ES0B 4ZTEA 4KK8D 4P23D 1GGTA 4KKQA 3EJQA 3BW9A 1ZE3H 3OKMB 3UJTH 1J1OL 1GC1C 1UD8A 4FXTA 4KKLC 3UAEA 4HGKC 1TNMA 1KN4L 3QZWB 3PDGA 4XCNA 3DGCR 1EAJA 3NCYP 1KYDA 2IWFA 4GINA 2OMNA 4L2LA 2Y0SA 1UM6H 2VXUL 1GZHA 4HD9A 3VRJB 1YG9A 1A2YA 1T7VA 2J8UB 3BESR 4FP8L 4UANA 5DSCA 3T0XA 3KDMA 5IBLD 2DDQL 4FI6A 4NWTH 3GZOA 3ZJAA 2X89D 3RRQA 3EFDL 4O5LL 1S7TB 1OARL 4LHUG 2NYYC 4BRJA 5D1ZB 1KCRL 4UM8B 4FZ8L 4L3CA 1BWMA 4XE5B 1FG9C 5TE4L 2F1AA 5MHSE 2YC1B 4EQ3A 2J4WH 3GYRA 5J13B 4XP4L 5DWPA 1NMBL 4FKKA 1SFHA 4LLVB 1OAKH 2F7OA 4NUJA 3PWLB 4XNZC 1PLBA 2W07B 1ZVYA 3DUUB 3E3QE 3M7FB 4NRYB 2BMKB 3ZL1A 3OX8B 5DMGD 4IW4C 4WO4D 5HYSB 1HOEA 1CGSH 4JPVH 1EGJH 4H26B 4WGWB 4LP5A 1KIRA 1MZZA 2JTYA 3QAZB 3LKOA 4U1LB 1SDAB 3RUGE 1WUZA 3JV5A 1CTNA 1X7SA 5FM8A 3VMNA 1ROCA 2RB8A 4JN2A 4AC4A 3O2WH 2AJSH 4A68A 1OY3B 2VUKA 1LGVA 1IBBA 3OQ3B 4H1LH 4M8VA 4Y8AA 4CC4C 1MEXH 4JRYD 1JJUA 1NM4A 2HKHL 2R69A 2EXSA 3LH2L 4IOIA 2XACC 3OZ9L 3G5VB 1YEKL 2WHVA 3UOAB 3CX5K 3HUJE 4XHJD 1Q9KA 2JCCE 5C0CD 3M1CA 3MJ8B 4WK4B 2CA4A 1LP9A 1M7DB 2BOCA 3AACA 3K6IA 1XL4A 43CAA 4U0QB 4MNQD 3WXVL 3RTQD 1RHFA 1UURA 4APQC 5IVNA 2YAFA 4PGZA 5BRZB 3M07A 4V1DE 2XVKA 3BT0A 2NDFA 3HE7A 2YPVA 1TZGL 1QVOB 1ZS8B 3AT0A 4GG6E 1D5RA 4PG9A 4P4KD 2WXNA 5IW6A 4Z7WB 2EXWD 1SJVA 4FFYH 4NN6C 4O58H 3WDHA 3FQXA 4N5EC 4RESB 1RZIA 3VWJA 2WINB 3ISYA 4UMGA 4WI2A 3S96A 4XXWA 2JKXA 2FQEA 3O6KL 2HX7A 4NZUL 4J5VA 3L9BA 2G2RA 2Z93A 4NLHA 3K1DA 4Y4HC 1L9TA 2R4RH 5DI8B 3P9MA 5IMKA 3BOVA 3T1FB 5F72S 3TASA 3PNWA 3RP1A 2NY4D 3EFOB 3SQBA 3D3VD 1W72B 5F6IC 3NPZB 3STBA 1J5CA 4QHKJ 5JPMA 2YA2A 1FL5A 1XF2A 4GXVH 1RURL 1ZOXA 4M3HA 1YA5A 5F0PB 3VRLF 3QO1A 4B7LA 1HOCB 2YA0A 2Q86B 4XNMA 4ZMOA 1KIQB 2O6DA 2EDQA 3IDJA 1NIEA 1QFWI 4PJIB 4Z1PA 3KXFB 3GS0A 5F44A 4Y5YC 3BWZA 1Z3GH 3A6CL 4M7JL 5AKSA 4WV1A 1T6VN 2NY2C 5EHFA 2IFFL 4HWBL 3D07A 4PI2A 1DUYA 4JJHA 3H42L 1DDHA 3V0JA 1OW0C 5DD5H 4PVBA 1HI6A 1ZLSH 3KLLA 1JNHA 5E6IA 3G5XB 1SYVA 2MQGA 5GIRB 1M05B 2B77A 3QHZL 3W11C 3CLFL 4FKHA 3GB7B 3EIFA 5DD1L 5DMIH 4F7CA 1ACYL 4NJ9H 4XT1C 2DRUA 2EE2A 4L8SA 4Z5RB 4HLEA 1TQTA 3IAPA 2BFVH 2ZQKA 2XWTB 4FYQA 1HFUA 2BIHA 1EEQA 1BQHA 1S9WB 4FTVD 1OOWA 4Y5VB 3ZE0F 2VLMD 4HV8B 4PW4A 5C0ND 5I8OH 2FR4B 1I82A 3KH3A 5HGBB 1EWHA 1WSST 3TNMB 4ZFOL 4QO1B 4Z77A 1A6WH 5KOMC 1NBQA 2OL3H 4NPJA 1MCPH 1E8XA 4HF5L 1CXFA 2XRAH 5IFAH 3ASNB 3FU3A 3INOA 5EBGA 1DN0A 1JN6A 2X53A 4XWGH 1HHHB 4A2DA 1LP9E 2CKBA 4JPSA 3L16A 5A2FA 1UOWA 2UWEB 4R4BA 4A6YA 5ES4B 4N5UA 3H9HB 1WIOA 1DP0A 5EWIH 4PPTA 4MQTB 4HUXB 4ZTPH 1FH5H 4OLVH 2HRPL 5F97E 1ADWA 4QKTA 1SOKA 4QXWA 2VLKB 2WTRA 3FKUS 1U42A 3BKCL 5E08L 1ACZA 3ZE1B 5D1ZC 3GMPA 2HT2C 1FL6B 3CSGA 3FUFA 4W9IC 3PIQB 4OBRA 4M7KH 1UFUA 5J13C 3UYRH 2BIIA 1DSFL 3DHUA 5KAQG 1OAXH 3Q2VA 1Z5LA 3WLWD 3SKMA 3ETSA 4PB9H 3MLWH 2CDFB 3ERXA 1ZV2A 3OAUH 4HOXA 2VDKL 1FYTD 5I1KL 5BJTA 2E56A 4FG6C 3SE3A 1JZ2A 1MLBB 2ZG3A 4FQXD 1BX2B 1JSYA 2ZSVB 5B3JE 2PWDA 1Y0LA 4HIJA 4PVLA 3LMJL 3QUZD 1T0PB 2QHRL 4HPOL 4U49A 2HJLB 5F7MC 5L4IA 3QAZC 2VJXA 2ZOOA 1OZUA 1H15B 1XGYL 5HHQA 1F4WL 3P4MB 1PU0A 5DEZA 2X1OA 1U8IA 2NY7L 4P5SA 3WY4A 2ESVB 3QORD 5FYLL 1KCVL 3CFUA 2NY6B 3NSXA 3SCMD 1FG2B 4WW1B 5E2TH 1KYAA 4FQIH 3KYAA 4Y1SA 5DUBB 1I3RB 3MXWH 2I9TB 3GMNB 1R0AL 4Z78B 3C8KA 4OV5A 2B8OT 2AERT 1E6OH 1FFOB 2XG4A 3MR9B 4DW2L 3QDGD 4ABQA 4KDTA 1TTGA 4BWUA 3BVTA 2B7DT 3FTSA 3HG1B 1DO6A 4GRWB 1XSOA 3P3RA 3GZQA 5KYYA 2HH0H 1WZ1H 5GGVH 2X4RB 4XX5A 4XNYL 3NEEA 2ADGB 2WVVB 4MNGA 3L4VA 4NN7C 1BMGA 5CLTA 1D3CA 1BWWA 3OAYH 3WTXA 5PCYA 3G6JF 1QKZL 1O7DC 3BP5B 4Z7OB 2YUXA 3ASWA 1TSHA 1KB5H 3ABLB 5D8JL 3TBYB 1MFCH 4D2NA 3U83A 1AE6H 4HUVA 1YPZF 3DRTB 5AQ0A 5ABZA 4UINH 3T65B 2IGFL 4ALAC 1J86A 3I6SA 1E9PB 3FT9A 1R3IL 1QP1A 1A4JA 1FLRL 4HCRH 2SODB 1H5BB 3LXUX 1BQLL 2CBTA 2IOOA 5EC2A 4EUPG 4OD3L 2W0FA 1T21A 2W38A 4F7EA 3Q05A 1NCNA 4OKDA 2X2UA 3VDBA 3THMH 3F12B 1ZLWH 1JZ5A 4LP4A 3V7MA 1CZ8H 3PHQA 5G2NA 4GAJH 1E9OA 4MCMA 1JUFA 4W1TA 3VXSD 2G60H 4E5XB 3WN5B 1BYPA 3X12B 3ARDA 4GRLD 4NNXB 4A2EA 1HC1A 2B20A 1UACL 2HYMA 1RULL 5FLUA 2OJEA 4AG4H 3O6MH 1QWUA 4TULH 5DC4B 3E6FA 5J8OA 5DD3L 1YJDL 5K93A 4ODHH 4M6ML 3I6LD 1VESA 1M2OA 2G3ZA 2I5YH 3V6ZA 3NRQA 1K72A 1XF1A 2P49B 1PZCA 3D50A 2A6KA 4F2EA 3P0YH 5D6CB 3GSWA 2YK1H 4TF4A 1VCBC 4CA4A 1HIMH 1C5DA 1JHTB 5BO1H 4RMTA 3J27A 2E7DA 5IQ9B 2CDGB 2DQUL 5IHBA 4EOWH 5FAAA 1CLYL 1X5HA 2QGEA 2YMTA 4H8WL 1KLUA 5IREA 1W8OA 1MXGA 3DSNB 4GBXB 4H5SA 4Z7WF 1O6TA 4Y5VC 4N86A 1TLMA 4IS6A 5C6PB 3O4OB 3PL6A 4KX8A 4Y0GA 1PX4A 4N2FA 3UH8A 1NBZB 2PW1B 5GGQH 1QRND 1Q0XH 5D9SB 1MZYA 3ABZA 2AQQA 5C0BB 1LWJA 4XPGL 3HI6L 3MLTA 2ODIA 5HHMD 4HIHB 5F88B 1HWWA 5LQBL 4KRPB 1A7PL 1LO4L 4JREB 2JB5L 4B53A 1D5XA 4WJKB 4D3CH 7CGTA 5C97A 5E1AB 5ENWA 1CT8B 4RRPA 5KW9H 3R1GH 2R2CA 1D5IH 1OP4A 3FT4A 4D0BA 3FCGA 3KLSA 1T3FB 3MRHB 4XN2A 5MEOB 3QRFM 2Q10A 5ABAA 3FT3B 4MNGE 1TOXA 4YE4L 2WKLA 1ZT7B 2IH9A 1OK8A 4C56A 1MI5D 1YEHH 4P2RA 4YGVA 3AQDA 1T22B 4A2GA 4BQBA 1KXTB 3W2DL 1AG0A 1L6ZA 2HLAB 3R7QA 2E9IA 4N1EA 1GR7A 2IXQB 2ZUYA 4DP4X 1YEFH 2ZF9A 1PQZB 3HZYA 2ICEA 5TE6H 3P4OB 3FRPG 4OFIA 2IO5A 3W81A 3KPNA 2Q0ZX 4OLZL 1P4UA 5DTFB 1FNFA 4PWKA 4HOWA 3H8NA 2IOIA 2P1YA 2VWEC 3CAFA 3FFCD 1NFKA 4DK5A 1YN6A 2SEBB 3PQYB 4N26A 3HPJA 4KY1L 3WNNA 2C9PA 4MXVF 4BK4A 2IDSA 4B0MM 3DX6B 1O6SA 2IBZX 1AD0B 5BXFA 1BIHA 3C60A 5DJYB 4J8QA 2PYED 3LKNB 3ZU8A 1AG6A 3JVGC 3HHSB 4KAQH 1RVFL 2NY6C 3BCDA 1FAKT 4NZFA 4JS7A 1ZA6A 2VIRA 3NSDA 5ISZA 4RVBA 2DV6A 3VAEA 5ID1A 3LPFA 4BXVA 4F92B 2XKNB 4FABL 4DZ8A 5LAPA 1NFIB 4OZHB 4F7PA 2N7AA 2YLKA 5MERA 1BFOA 1DJSA 4KH2A 4Y9GA 3DOSB 1QEWA 1T66C 4TNWK 3IU4H 1Z32X 1XZ0A 3UG4A 4B9ZA 1MCEA 3U9UA 3QNXB 1CE6A 4ZMYA 4S0HA 4RDQG 5FPIA 1KN2L 1S9XA 4LHUD 4L4TB 3T0VA 2F18A 3CBJB 4QRRB 4HWUA 1JHLH 1HYRC 2JCCF 3ZE1F 1XCQB 5IWLC 4Z6AT 3TIEB 1BJ8A 2EIKB 4LSTL 4Q6IB 1CXKA 3SJVB 1BLNA 4UQ2A 5F1NA 3QHTC 4F7KA 3IVKB 1VF5C 1KCSH 3STZA 1DJYA 4QT5B 5C0DB 1DQQB 4X5RA 3TWCL 3V6FA 5K9KA 5IHLB 5D55A 4JFSA 1V5JA 3R06A 4FQLL 4O00A 5DJAB 5IEKB 2Z7UA 2EADA 4X6BA 2K3TA 2VAAB 5DYOB 1H5BC 4NQQA 2D0HA 2FWUA 3L3JB 1WAEA 1VJSA 2Y3AA 1IGCH 2YZ1A 2VLJD 3BN3B 1HSAA 1EAPB 4XODA 5DK3A 5DJCB 3HRZB 2B9BA 1GKOA 3FUKA 5DFWH 4UNTA 3LKRA 4UNUA 3U4EB 3K2KA 1AZUA 4P2OA 4QNPE 1A14H 1AAJA 1L0YA 1LK3H 3CWGA 1N19A 4C56E 1KLFA 4ZUVA 3DX9B 2X5PA 3DXAB 5AAMA 5SWSD 1YYLL 2VZ3A 3WHE1 4P2RE 3GUTA 1KDIA 2BVYA 5B21A 4QGYA 3LY6A 5C6TH 1IGJA 1NPUA 1WV7T 1D6VL 1HILA 1WEJL 3QRLA 5EU7C 1QWHA 1AMXA 5J6HB 4HIQA 2J88L 4ICWA 1UT9A 4AEEA 1QR1B 3BUQA 2CM6A 4UUJB 5CSGA 4M1CD 2GY7B 4LF3A 2Z35A 1YHPA 4PJ8A 2A74B 1I8AA 5JIIA 4GRWF 1BD2B 1J05A 4GQPH 4PM1A 2EIBA 4IU3B 4KGJA 3UZEC 4KKZA 3IMUA 4GBXC 2IIJA 2WXQA 2YFNA 4YBLB 1S6NA 2D7MA 5DJ0B 3BP7A 1CU4L 1NFDA 3O4OC 3VFTB 4UTBL 4C58B 4RRPM 2P5WD 1MFUA 1KJMA 5ISZE 3HAEG 4TSAL 3U6RB 1NEZG 2J3SA 4XVOA 2CO6B 1QOKA 3QT2A 2CCVA 4LARL 4M8QB 1A1OB 1AYRA 4XN1A 3WD5L 3NQKA 4E0RA 4JREC 1V3KA 1WJ3A 2QVMA 1ZAGA 3MJ6A 3BWUC 1BAGA 1K4CB 1MJJA 5JUEL 1WZLA 4K23H 1P4BL 2QZ5A 3RFZB 2VISA 5TQ0H 3QUML 4KU1A 4RFEB 3LRSB 4ZYKB 3T71A 3HS8A 5AL0A 4NQTA 4OKVB 5AVSB 2V9UA 4Y2OA 2NW2A 4K8RC 4WEEA 5JHDA 2I9LA 3PWVA 4LIQE 3RWIB 4U3XA 5CFHA 2MIZA 3HC2A 3HMXL 4JPWL 2LT9A 2VN6A 3BSZL 3CLEL 1LP9F 1K8DB 1Q9OB 1DO5A 2ROYA 2OS7A 3HN5A 2VRAA 3CH1A 4IDJL 1YY8A 3NN8A 3T3ME 5C09D 2CLVB 1MPAH 4YXKH 4ONGH 3ZHNA 2R0ZH 2EICA 3AWEA 5D1QB 4IRZH 3UBXI 4I0PB 1TQCB 5JYMA 1RD6A 3N42B 5FKAB 4CL7A 4ETQB 1JVOA 1A8JH 2CUIA 3S36X 2ED9A 1LDPH 5FO8A 3DYOA 5ICUA 1MY7A 4IKKA 5CCGE 1HJCA 3BAJA 4OLXL 1MFBH 3ULAB 4EUPH 4G5AA 1IM9A 1DL7L 4HXBL 1JNNL 2D7OA 1XF4B 3NJXA 2HVBA 3WNOA 4X7DC 3QUYD 5HYQA 2CIKA 1ET7A 1UD5A 4FFZH 4OTXH 2DEXX 5GGRY 1NGWB 2CHDA 5E6ZA 2Z34A 3FQYA 5DU7A 5I1AA 3CFQA 1EZVX 2FBJL 4G6JL 1B2WH 4GSRA 3QDJD 4LSRL 5CEYA 3LB6D 1A7NH 1GY1A 3QCUH 2BVPB 4P59H 1GIGL 1U8HA 2J25A 3FO1A 3X3GH 4NUQA 4F3FB 4KJPD 5JIQA 4TUOB 2CIIA 3WUWG 2W1NA 2Z4QA 4HS3B 3R7RA 4I18A 4I3RL 2FX8H 3IFNH 3ATBA 3VXPB 1TMCB 4X8XA 2PXYD 4KXBA 1ZT1A 3D9AH 5KYWB 1SNRA 2VZ1A 4GRMB 2RH0A 4Q6IC 1GVIA 4YH6A 3O45B 2YEVB 3BQUB 4L37A 5D7JD 4A7VA 1OF2A 4I2XA 1LO5B 4XNQB 1NFDE 3CNKA 5CP7A 3U30B 1OAYL 1I1FB 3LZQA 4S1RL 5JLZB 1JHKL 2BVEA 1NAMB 3QJVB 2P46B 1XAUA 4JO2L 1OTTC 1KJ3H 4D9LH 3C5ZB 2YXWA 4CSTA 5I6KA 4BZ1L 3N1FC 4M1GH 2Z65C 2OR8A 1A9BB 2BOBB 2HLEB 4HJJL 5F7EL 5KZCB 4PJBB 3JUZA 4LRNL 4XO3A 3E9TA 4GLRI 3SYPA 2DI7A 5L6YL 1BP3B 4QXTB 1E30A 4QTIL 3HRZC 4S1DC 5J9PB 1V3LA 2FIRT 2FT6A 1EFXA 5FYKE 1IM3A 2A6DB 4BFOA 4GAYB 3U0WH 5JHDE 3KNBA 1SBSL 1CYGA 1HEZB 5FGRA 2WQWA 2RD0A 2VNCA 5JNYA 1J1XL 1H3UA 1N7ML 3FB6A 2WLJA 1XIWB 3SE8H 1HL4A 4OCNC 5FFGA 3EJZD 1R9FA 1TDQA 1BFSA 1XX9C 5JMRA 3SE4C 1TJGH 2PCPA 1A3LH 1DBKL 3VA6A 4OF0A 4PJCA 3KJ4B 3OAZK 4PG2C 1HXKA 4ODVL 1NUNB 3UTOA 1YSOA 5TPWL 4KO9A 1VIWA 3VW3H 1THCA 3S37X 3NABH 4L3EA 4PRIB 2YXVA 4UAHA 4MD5A 2XZCH 5F6HJ 3BVNA 4JPIA 2BXZA 3DX3A 3TV8A 4X4XA 2EKJA 4FNLL 4YBLC 1BLIA 3FB7A 5E51A 1SUJA 5FWQA 3ZQXA 1A9VA 1UGKA 2YWZA 1W16A 5KVMC 3MACH 2ATKB 3NIDB 2YSSB 2DL9A 5TFSL 5GJSL 4O2EA 4A04A 1GGYA 2HWZL 3BMWA 2AQ2A 3L3HB 1I4FA 2NY1B 5IQOA 4Z8FL 3D6GA 3MFGB 2Q8AL 1PG7H 4X7SH 3RZCB 4V2BA 2FE0A 3BSGA 1AFVL 1J0ZA 2FYVA 2WSKA 5DA4A 5KJRL 3RFZC 3MRNA 3R8BB 2M1KA 2ARJA 4J3TA 5A3IC 3N43B 1FVDA 1SXBA 4DOHB 3VGBA 4X6CB 5K1NA 2AI0H 1ASQA 4PH8A 1JZ6A 2XZAL 4R7NA 4YHKL 4YZFF 4GUCA 1EXUA 4XP1L 5SWQA 5GS1A 3S9DB 2R56H 2FIKB 1QSEA 1E4XI 3PUUA 2NR6C 5SV3A 3ILDA 4OQTA 4WDIB 4FXGA 2OLDA 3JUYA 4JJ5A 1MY5A 1Q9WB 4NUPA 3DX8B 3KYMB 4KC3B 4I2XE 4XGZB 4KVCH 1KNOB 3AM8C 1YDPA 1CICB 2GAZB 2AGJL 5JXAL 4JKKA 4FC3E 3FN3A 2H8PA 3QZWG 4PRHA 1J5HA 1L9SA 1SOSA 2BJMH 3VA2C 5IVOA 2QVTA 5D1QC 3SE9H 1TUPA 4JRXD 4WI9A 5FR3A 4I0PC 1TQCC 4NS0A 4TSBL 4AQZA 4HKBB 3LAFA 3MKGA 3VCLA 3FT2A 3AFLA 3HG0A 5FHBH 9PCYA 4P46B 4FZEH 2AV7B 2G3XA 5IV2B 1E4XH 2ZCKH 5IW3A 2CDEA 3LYRA 4AYDC 4PWFA 4ZUWA 4CU6A 4NBYB 2GC4C 2AS5M 4MCNA 3FCTB 2QPUA 1KZYA 4G9FA 5LJYH 3UTTD 2MPVA 3U2JA 2C9UA 3T6WA 1FZOA 5ETUA 3B7YA 1S9VB 3L5WB 3OKNB 4MZ2A 1YN7B 5HDOA 1TVDA 1GS6X 4JFDA 5J57B 1I8LA 1UOLA 1SYSB 1BMZA 2DQIL 4JHAH 4PJCE 1RZQA 2E9BA 4TSCH 2F61A 2UX6A 4JKNA 4MXQC 3VQLA 2IALB 4WI8A 1A3ZA 1HWHB 2KZ1B 5EA0L 2P44B 4JHWL 4L3EE 2H45A 4FL4B 5DS8B 2C9VA 3V9CA 3K6SB 4DQOL 4DKTA 3N40P 1HSBA 3II2A 32C2B 3SQOH 1M57B 5A16A 1ZHLB 4LGRB 1IFRA 4HBCL 3IDXH 4I5BB 4ONOA 1NGZB 1WWAX 1NAKH 4HS6B 4KO7A 3BQUC 2OSWA 3I50H 3MLUH 2RALA 2WYIA 2K7PA 2O5YL 1E43A 3PCYA 5KN5B 5T5FL 1EV2E 4S0TD 3HHMA 2P24A 3C5ZC 3KGUA 2OYLA 3BEWB 1ZVSA 3DX1A 4P9HH 2L7EA 4NWUL 3Q44A 2FGZA 3CHOA 4JBSA 1YLBB 3CFCL 1JXGA 3WSQL 1WVZA 5IVXB 4WAFA 3ELQA 3QJFA 3QUKA 4JL1A 4NQSB 4K5LA 4KXZH 5H35B 3UEZA 1QSEE 2D2CC 3P30H 2XTJB 3GI8H 3IXAA 4FF9A 4TL5A 1IGYA 1AACA 4RX4A 4DP9X 2HUHA 5F3BB 4XO4A 4HCFA 4WUUA 1IAMA 1P1ZB 3WJLA 1R5IB 2D3VA 4YR6A 4WJG3 3MBEA 3DBXB 3S3JA 4F9LC 5CEXA 2KC0A 1BEXA 4WJ5B 1QEXA 1ZGLB 3UC0L 1KCUL 3B9KD 4P06A 4KK5C 2AK4B 2CXKA 1I8IB 3DV6A 3W0WD 3BO8A 2NX5B 4PRHE 3PWJB 4JFEA 3KJ4C 4XNAA 2CJUH 3BVUA 4KQ4H 5I6OA 3HBGA 1Q0YH 2DBLH 2E6QA 1I1RA 4LMQI 2EIJB 1NH6A 3QI9B 1DJXA 1FL3A 2FHCA 4R7XA 3MRQA 3MV7D 4BV1A 4ZAKB 2HLFD 1MW1A 2XYBA 3O6LL 4PAZA 2WYHA 1FGNL 1I8KB 5J3HC 4G7VH 3GKWH 1PZUB 3FTGA 2CALA 2EE3A 4ZO6A 4HT1L 3X13A 4CUCA 1F45A 5KYNA 1OGAB 3MOBL 4G9FE 2OQJB 3KM1A 3HZMB 4PV1C 4UQ3B 1CFVH 1TJIH 5FW7A 3GHEH 2H1LM 3W9EB 2WCGA 4JFDE 5A2BA 3LV3B 2LFGA 4AENB 4HETA 2NY1C 2GJ6A 3EW3B 3GSUA 4IQHA 5I19L 1JE6A 4AKOA 3RZCC 2LFEA 1RFDL 1LO2L 5FYJH 4PJBF 3RNQB 2WP3O 3KGSA 3CN0A 2OPCA 4U1MA 1JWMB 3EF7A 2BSRB 4YBQC 3BVDB 3BJ91 4JHBA 4GKSA 1W91A 3QARA 3UPAA 5INDB 3MGTB 3CU7A 3U25A 3UZQB 3WKQA 1CD1A 1YNTA 3LZOA 1T1YA 3PF2A 3V9EA 3WNLA 1JGDB 1D5ZA 5EO1B 1ETZB 3DVNA 1UKSA 4LU5L 1PIGA 2G0LA 3KWVA 3SZKC 1M7IA 2DLFL 1CICC 3EOYG 1GW6A 2B59B 5KSAA 2EYTB 4M8UA 1DLHA 4RGMB 1T03L 3AADB 5I66A 2I27N 4Z18A 2H9GB 4L4VA 1SEQH 2RFXA 1FO0L 3FPXA 1AANA 2R4SH 3P3SA 2DQEL 3PDOA 5T1LB 4U6YB 1OGPA 1RIUL 2WBJA 2A1WH 4UIKH 4ZFOB 3TBTB 3UTSA 1ZT4B 2GTZB 1DVZA 1BQSA 1PJ9A 2V0AA 2DZEA 2O5XL 2P26A 4P46C 5AEAA 3K71A 3T4YB 4K2UL 1A6VH 2DAVA 4KROB 4W9HC 3F7PC 4MB1A 3FSZA 2FECL 1AZRA 4RETB 3T0EE 4EXKA 5IMMB 5KBPA 4YVUA 4WUUE 3RPIB 3T3MF 5B3SB 2PTVA 3MLRH 4N8CH 1WK0A 3LSOB 4XCFH 1E3FA 4AE1A 4POZD 4LASH 4EZJA 1AXSA 5C7XL 3IDNB 3QC5X 2FSEA 1G7MB 1G9HA 1HXYA 2YAHA 3LRHA 5B38B 3RA7L 1IT9H 1QBLL 2O26U 3RKPA 3EJYD 1PY4A 4W70A 1TFHA 4JFEE 2W60B 4D0CB 3GSQA 2Y36H 1TMQA 1T6WA 1T2QL 3Q6FB 4FQ1L 5GZOA 3BUBA 2WKGA 1Y6KR 2XG5B 3N43F 4K3EH 5FW8A 4FG0A 2AHIA 4MS8C 2JK5A 2VDKB 4FL4C 1U8MA 5EPMB 5KVGE 1GYWA 1JK9A 3P73A 1Z9OA 2WQAA 1DANT 2XQYG 4EI6A 1E4WH 2FAUA 1IGTB 1OAUH 1KEGL 4EMZA 4YDKH 1AH1A 5DZAA 1OSPL 4KKLD 3HBQA 5I5IA 3P1VA 2IGLA 2QQQA 1INQA 1WGVA 2G75A 3I6GA 3NIGE 3QJHA 4MB3A 1UD3A 3L13A 5DHYB 5E99H 4DVRH 3UAJA 2FGWH 4G43B 2J12B 4XN7A 3QEQB 2DQCL 3C6LB 1X5KA 2GJ6E 2PR9A 3MLSL 2XPGA 5EZLA 2MNJB 1SVZA 2A73B 2JIXB 2DI8A 4PJGB 4OI9A 2ZP9A 5LBSL 5IF0A 3SKOB 1G1OA 1AZVA 1RIVH 1RKRA 5E1IA 1A65A 2G5BA 2NYYD 4NQUA 2J2ZA 3N55A 2YJQA 5E5MB 5HGHB 2XTJC 3CBRA 1IVTA 4XHQA 1VGKA 1N3NA 1ODUA 1HYSD 2F53A 2E9JA 5HVFB 4ZO8A 3ZHDA 4EI5C 3WXWL 2Y5QA 1FP5A 2B4CH 2X4TA 2JI3A 4M7LT 1COBA 3EBHA 2ENSA 2EDHA 1OT4A 4AYMC 1GRWA 3H9YA 3MV9A 1W15A 5FYJD 3B34A 3UACA 4LCYB 4E9YA 4L4VE 3B6SB 3HJ0A 3K0WA 4NP4H 2YS4A 1FC2D 4HISA 3P3UA 3QI9C 3H2WA 2X40A 1X4YA 1E90A 3UTSE 4Y9BA 4ZAKC 1FNGA 1I7UA 3PP4H 1S3KH 2UUDH 3SD5A 3L5XH 5CKAA 5FF6A 5IEHA 1G6RA 1B3IA 2IWKA 4N0CC 4U6HA 4GP8B 3I85A 3HC4H 5C9JB 2DMHA 2DS4A 4ORZC 4ZMZA 2F5BL 4OM0H 2EUXA 1V3MA 4GNKB 5DLMH 4LIQL 3TN0C 1NDGA 5IW1B 3II1A 1Q72H 3PY9A 4XNUL 5DVLA 5EUKB 1J5OH 4E5XG 2V2WA 3G5ZA 2WIMA 1OT2A 3NMEA 1P4LA 3ZZLA 4KI5D 5CLWA 1BVLA 1R3JB 2ZG1A 3D33A 3HS0B 1LK2A 1AY1H 1RUPL 5IVZA 4QY8B 4IRSD 4NN5B 5CR1A 5EF1A 2K6ZA 3PGCB 3F01A 4QF1A 1TZHB 4YDLB 5C0AB 2OMTB 3GNML 4TVPH 1IC0A 5FK9B 4U1HB 1UH3A 3VXOA 5CHNA 1IJNA 3BD5A 3V4PL 3UBXA 2XV6B 5IVXF 7FABH 2JQAA 3K4AA 2J1YA 1UM6L 2WNXA 4YGAB 2X4PB 2ZNWA 3UPRB 2BNQB 4PGEA 5DZNA 2O61A 5FM5O 2FLMA 3ES6A 3VXUD 3U46B 3HR5B 2BX5A 3C8DA 4NWTL 4MAUH 1HCYA 1KEMH 4AYEC 4FNSA 3AY2A 2XSKA 4XX1G 3ARUA 3BUIA 3GTTA 5D72H 2BZCA 5E8EA 1OAZL 5CILH 1CFMA 2TRHA 3LNGA 3S3SA 2BY1A 3LVEA 3L17A 3UP6A 4RGMC 3WTTA 4P9ML 3OMZA 2IBBA 3CTTA 2GJRA 5AW1B 1WYJA 1CGSL 4QTFA 4JPVL 1EGJL 2FATL 3NCJL 1DLFH 2CA3A 4GEIA 5F70A 5T3ZH 5L4JA 3INUL 1NGXA 1CIUA 5I9QB 3B8YA 3NIFB 4AZ8A 4OCRH 5I1GL 4FNRA 4KROC 2X4OB 4HYTB 3BKJH 5TE7H 3TBSA 4PYGA 2XQBH 3I9GH 2FJFA 1V7NH 3FUNA 3PWUB 1NQBA 2P8PA 3O2WL 2AJSL 4PJ7B 5A2LH 2E8ZA 1OTSC 2F53E 4GIOA 1T0OA 5T3XE 1UWEH 4UBDC 4DUXA 4YSUA 1MEXL 4BQ8A 5KBLA 2VYRE 1VKXA 2WW8A 4Q2ZA 2OXGB 1XGTA 1ZTXH 3MV9E 4A37A 1OPGL 3DJZA 5GGRA 4HG4K 2HFEA 3RURA 1X9QA 4Q6YA 1OAQL 2A9NL 4YK4B 4G42A 3LIZA 1ZSHA 1X4XA 1W72H 4K5MA 5J4MA 3JTTB 4ZOCA 4H2CA 3IJHA 1M3JA 4N9GA 4U3SB 3VTTA 5K5YA 5FYKL 1FLTX 3WMQA 1JPGB 2H32B 5I8CB 1AQKH 2BNUA 2QL1A 2I85A 4HDIB 4M61B 3MUJA 4OBSA 3GMQB 1QA9B 1HU8A 4P3WA 4FFYL 4O58L 1JOIA 3IDUA 3MJ9A 2OJZH 1JZJA 4KZCA 4A2MA 2VL4A 4Z3GA 4ONFH 1R3LB 2YD1A 3H2PA 2ITDB 3FB5A 3PABB 4IMKC 2WLIB 1L9QA 2EIDA 5F7FA 4NRZA 3C6LC 3VXMB 5HYFA 3Q43A 3Q8CA 2B5IB 1ZEAH 4PJDF 4X6FA 2CO7B 2VUOA 4S10A 4TNVK 4QPEA 1JGVH 1F6AB 5IB1B 1GL4B 1R34A 4GXVL 5E6RB 3V10A 4HWNA 1YQVL 3MRGB 4QKXB 5KG9A 1RLBA 1JZ8A 3WKYA 1ETB1 1HEJC 1MJ7H 5D5MF 5GGSY 5HDBE 2H6UA 5AW8B 1A6ZB 1DSYA 1U8KB 1WICA 1Z3GL 2D03H 4G8GD 4PJ5B 5GRUH 5IB4B 3BPCA 1XD1A 4K7FB 1CN4A 5F7DA 4TVPD 3FB8B 3GTNA 3JWNH 3D12B 4R7DA 1CXIA 3ZE2B 4AEHH 1NCIA 2PO6B 3LKQA 4NCDA 4WU7B 3VFSA 1AI1L 4AQAA 1DJZA 3AG3B 4U1IA 4ODXB 3HLAB 1IQDA 3OR6B 5H37G 5DD5L 1ZLSL 3FF7A 1HH9B 4ZUTA 3ULVH 4PJ9A 4EDWL 4MZIA 4UOW0 4NZJA 4CNIA 4X6EA 1HTYA 2OMXB 2OSXA 2FYYB 4NJ9L 1SPDA 1UEYA 4A39A 4BCXA 2BWDA 1SDDA 5HJBA 4LDCA 1JI2A 1TZ8A 2BFVL 4MJ5A 4MRBA 1QI5A 4BK5A 5BZZA 1AJ7H 4G9DB 1QFWL 4FD0A 1RV6X 3CQQA 4UM9D 3OKLA 3KJ6H 2W94A 4K94L 3ZDXE 2OW6A 3B5TA 3D69B 3SY0A 1BFTA 5I8OL 3OKOB 1FIGH 1MJ8L 4NN5C 4X5WB 3NJVA 3P2DA 1A6WL 1BFVH 3BXNB 3DVFA 4LCCA 2OL3L 2IAMC 1MCPL 2W5PA 2J6EH 3IF1B 4YDLC 2WUCH 5IFAL 4OFVA 4XWGL 5T3ZD 1DVFA 2NXZB 2Y6SD 4WTZA 1NTDA 3F6LA 2WLLB 2WXGA 4FHBD 4LLMA 1U9KA 2Y1AA 4JEGB 2PPFA 1LNUB 2FZ3B 4O2FB 5K9JL 4X5XA 5J11B 4JVWA 1F6FB 4U05A 4L3AA 2KMWA 5I0VA 1MVYA 1YJDC 4KKCD 1B6DA 4ZTPL 1KELH 1P4IH 4JE0A 4OLVL 5EF3A 3LH9A 2VITA 1AHMA 3ARWA 1MHHB 3QQDA 4X98B 3QIWD 1MNUH 4E9TA 4D8PA 5GZND 1OB1B 3V5KA 3B2VH 4J4PD 3V5HA 4YLBA 4KY2A 3GT6A 4C4BA 4XVTH 2YGVA 3UYRL 1NBYB 3ATEA 3QPQD 2KUTA 1OAXL 1LMKA 2YKLH 4H8WC 4M48H 3ARGA 1AGBB 5DHVH 2OW7A 3VXRD 4Z7QE 5ICZB 1QATA 5DEFB 1SJEB 3SDDB 3MLWL 2EC8A 5FOJA 3OAUL 4ODWA 1IIKA 5CWSA 6PAZA 1RK0A 2BSSB 2TRYA 3FFOA 4RAUB 5C08A 5EEYA 2WO4A 1X6NA 1FIEA 5D7LB 1D2PA 1ZANH 2H0JA 4AM0A 1HHJA 5I9QC 3FZUC 4UWQB 1JVKA 3BGFB 1S46A 4N0YH 5I0XA 4OLWH 4NFBA 4NGHH 1NC2A 3U7YL 2CGRL 2QADD 5LG1A 1UTDA 4MSWB 3W57A 1BV8A 1DQTA 2G4GA 3NJLA 5I74C 2ARWA 1JWUA 5DLLA 5AVYB 3QUMB 5E1HB 3OXRB 1GZPA 5E2UH 5B7EA 4H40A 1FRGH 4W9ZA 4G6FD 5E5RB 3MFFA 5K59F 4GW1A 5E2TL 4FXKB 4PJAA 1U92B 4N0UB 2R59A 3WELA 3L2NA 3F7RA 5IJBC 5JR1H 4X0KB 2YD9A 1KFGA 3I6KA 3MUHL 2OBGA 3GIVA 4IMLA 4YK4C 2APXA 1E6OL 1Q94A 2VXVH 3DA0A 3DVGA 3HUJB 3GO1L 5FO9A 4MD4A 1X7QB 3NCWA 4JM2B 4Z7NB 3TCXA 1K2DB 4ZFFB 2HH0L 4YHOL 1WZ1L 3Q2CA 4AQOA 1NL0H 1ORQB 43C9B 4K15A 1DBAL 3K8KA 5CD5D 1LHZA 4NZRH 2KLSA 3RG1C 3RWJB 3ZUNC 3GXMA 5AB9A 1DQDL 4N2EA 1KB5L 1UJ3A 3L3DB 4XVSH 3T2LA 3VFOB 2ID5A 4XN5A 1QFOA 3TZVB 1MFCL 3T5WA 4B3EA 1AE6L 5I71B 3ULVD 1BQUA 2R83A 2FDBP 3J7HA 4WHTA 1HWGB 2B5IC 4PMFA 5HGAB 1W0VB 2J8OA 4HCRL 4NKQB 5AOMA 4NCC1 3BW9B 4P2YA 3A6OA 4U1JA 5D70H 1BM3H 3GXNA 2Q5BA 2HTLC 1T7XA 1NCGA 1B90A 1RUQH 2DQMA 2BCMA 2JF1A 3COOA 1OV8A 3EJSA 1SEBB 3PGDA 4LRIC 3THML 4UT9H 4XVUD 3ETTA 1CZ8L 5JXEA 3OSKA 1PJWA 4A7UA 2ZXAA 3DGGA 1BAWA 4GAJL 1A2YB 1VEOA 2AQRA 2H6OA 3KDMB 3A47A 5FFLA 3D85D 2JJTC 3N41B 2IFGA 5D2NC 5AW6B 5HHNB 1M9WA 2CHWA 2F68X 1J0KA 3BIKB 4RAHA 3MNWB 3O6ML 4JLRA 3VU2A 2PO6C 3MBWA 3AREA 4TULL 2ADIB 4M7ZB 3VSVA 3WLBA 4S0SD 3IFPB 1FN4B 3IMWA 3KYNA 1U3HA 4H88H 4ODHL 1EDYA 1GA2A 1HNFA 4L3CB 5C08E 4MBRA 5EU4B 3UADA 2I5YL 1UM5L 3TO2B 4PJEA 5EEZA 3P0YL 4J12A 3GMLA 2YK1L 2DIJA 1HIML 1AGEA 2ESVD 2V5MA 5BO1L 2FJGA 1GYVA 5FGBA 3VWKB 2IPTH 3QPXH 1SXCA 4ZJ9A 2LE9A 1FNSH 3GMRB 4HX1A 2Q8BH 4E9LA 2XNAA 2V4LA 4L9LB 2XZQH 4GXUM 4S1SL 4JRFA 3BUYA 2IH3B 4QOKA 4LXFA 3FSOA 4KZ0A 2JB6A 5GGQL 2Z7YA 5DHMC 1JD9A 4B9YA 1Q0XL 3RWDA 4KTDH 4PJAE 1T66D 5BS0B 3N6YA 4HAGA 5DQ9A 3W1ZA 4Z3JA 1AHKA 2KLRA 5DRZA 2NXZC 5HVWA 3FU0A 1N59A 1JF6A 2RACA 4AK2A 5AW0B 4FE9A 1FHNA 1K8IA 2KT6A 2VR9A 3BISA 4IOIB 3HG1D 3L1GA 2CK2A 2TSAA 4TNGA 4YHPB 3N06B 4D3CL 5BQ7B 3DTDA 3KPLB 5J11C 3QFJD 1A7RL 1RL1A 3L08A 4RMSA 1OEZW 2N59A 3VRIA 4YEFA 1D5IL 5KW9L 4BIKA 4P5KA 2WBXA 4KKRA 1EHLL 3DWTA 5INCB 4JDZA 2BOCB 3E1ZA 4XOAA 5I30H 1AOZA 3B7UX 4YDJA 2LVCA 4QXGH 2X0UA 3MNZA 2HT3C 1UWGH 1HN1A 4WO0A 3EG9A 4MMZA 2R1YA 5F96H 3VD3A 4OCSH 1YEHL 5CR8A 4FYSA 1AC6A 3AXLA 2WO2B 1KY7A 4GPVA 4S1QL 2CHNA 2VE6A 4PGJA 1VFMA 4PG9B 2Z31A 4P5MB 5HD8D 3MRIB 1WCQA 3X17A 3FQXB 4MKTA 4GXUN 4OD1L 3R0NA 1SMDA 5F2FA 1OKEA 4LMQE 3S96B 3VFPA 4P3DA 4ZOEA 5D2LF 1KF9B 3L2LA 2Z93B 3BGFC 4K3GA 4KH9A 1LEGA 5HPMA 5KVGL 1UD6A 3NYKA 4IRJA 5KS9A 2XN1A 4X8CA 2CH8A 1HL8A 3PNWB 4TNFA 3L81A 5T33H 4PREB 3SQBB 5AVUB 5LKNA 2DQGH 1CDYA 1T7WA 5B1BB 1JGLH 3CN4A 5KVFE 1UQSA 1QNZH 1OF0A 3DIVA 4KAQL 5JPMB 5IZ7A 4WWKD 1FL5B 1X5GA 1XF2B 1FFQA 1QRKA 2DIAA 4GMSH 4FXKC 4AJ0A 3D51A 2RA1A 2BCKA 1BZDA 2AJ3B 4LP8A 4XMVA 3IDJB 3ZVVA 2W59A 4X80H 1QSFA 3TO4D 4G59C 5EC1A 5JHLH 2YD3A 3QWRD 5K1VA 3TYFA 1MIEH 3DIFA 3IU4L 4KNUA 2X9WA 5H37H 4G8IB 3GGWA 2BIOA 2R0WH 4PJEE 1TSRA 1Y18B 4JFHE 4JM2C 3IT8D 1AP2A 4PRDA 3TCLA 3EYUH 1MUJB 4CMMB 2X38A 1HKFA 3I75A 3CZLA 1JHLL 4I48A 2V8LA 4Q56A 3QUHA 35C8L 3IYLW 1U2YA 2QDVA 2YD8A 4QYOA 2Y7QB 5DO2C 1KJ2H 2ZAHA 1U3ZA 4F7CB 3K8MA 3NSYA 1NCBL 4QOKE 4GEJA 4OIBA 1KCSL 5EOCJ 4HK0B 3ARFA 4KRPD 5IR1A 3TZVC 4YHLH 3LXBA 5L8LB 4F24A 2EE6A 5I71C 2W65A 5IMLB 3PGFH 1BQHB 4HCIA 1T80A 1NA8A 1F18A 2IPUK 5FC9A 1DBMH 3EO0A 4IOFC 3L8QA 3WKML 3RY6C 2HA1A 3A4AA 1BSIA 3O11A 4Z77B 4G1EA 2HG5A 1BZ9A 3FHAA 1YC8A 3SO5A 1IGCL 4WI7A 3SIKA 2QELA 3EYSH 1JN6B 3FUIA 4UT6A 4LBAA 2XOTA 1FUNA 1PEZA 4JANA 4WEUD 5K39B 2BS9A 1I7ZA 4KJQC 3GRGA 1A14L 1LK3L 4R4BB 1KCWA 1K3IA 4NNPL 4PWHA 3QULA 4XPAH 5C0GA 3UYPA 4I88A 3CSBA 2OJ1A 2O6EA 2EYSA 3OZLA 3ZYZA 5SWZA 2FTAA 2E4FA 2WTRB 1MHCB 1JIBA 4M7ZC 5LGJA 1U8LB 1TTRA 3VB9A 1N2RA 3QEGL 3UPCA 4JFOB 4Q14A 1HINH 2J43A 1CL7H 1E4HA 4UMSA 4MA8L 4QAWA 1VSCA 4WW2B 4JM2F 4M7LL 4DK6A 1Z5LB 3VE0A 3SKMB 1YEIH 3ZN6A 2JSFA 3ZQWA 4QRAA 2OMZA 4NQVB 3VWKC 4HWEL 1ID5I 3K4ZA 5KS9E 4GAFB 3CZUB 2ATPA 3O8XA 2K7QA 1C1EH 4M62H 2GITA 2OYMA 1Y0LB 1KT2A 2ZKYA 4HIJB 4L9LC 5DD0H 3FXIC 2B1OA 1KXVA 2IOMA 4KXCA 2GW5A 4QWWD 5IQMA 3CX2A 5HHQB 3QDMB 4JGUA 3S97C 3BWAA 4IEFA 3DRQA 3BZ4A 1B4RA 1U8IB 1VFUA 1UOVA 3KL3A 2YQBA 3MRLA 3REVA 3EJCA 1J12A 1IKNA 4L23A 1MHPH 2FEDC 4LKCB 1LDSA 1SJMA 1QSFE 1XEUA 4JGMA 3MTRA 1QMUA 2J5LB 3OR7A 3G5WA 4M5ZH 4YWGH 2FEJA 1D7BA 4K23L 2ZUUA 2R7EB 5TQ0L 4QRRD 4OCYL 3EDEA 2JI2A 1T1ZA 2B39A 5BZDA 3C8KB 4M00A 1E50A 4N2HA 1CDGA 5IFHH 1B0GA 4LDOB 2EIEA 4YSAA 3ZHKA 4ERSH 2OZ4A 2ZXWB 3G04A 1D6EA 3Q48A 4M4RA 4U7SA 3APFA 5J1AA 1UXWB 3SEPA 4CU8A 4HOZA 2Y7LA 4OSUH 2Y7OA 2FJHA 5DO8A 3KPSD 5FM5M 4YDIL 5KYYB 3U0PA 1YMMA 1HESA 5GGSB 2XWXA 3FU7A 3N1MC 5D7HA 3DX7A 5E1GA 1F97A 3MJ7A 1DYZA 4A67A 4ONGL 3BPOB 2PYFA 2R0ZL 4X4YB 2IDCA 3HEIB 4H20H 1P7BA 1X5AA 4K7PY 4YQXH 4NUGL 3RJOA 4R96A 4LOFA 1RK7A 4JFFB 1LDPL 4ZS6D 4I3SL 3WTYA 4ZMVA 4HUVB 1IBZA 2Q3AA 3GJFB 3GRWH 4Z7VF 3VXQA 5ACZB 1G0XA 3WBDA 4LFHD 3DXAD 1X7TA 4OIFA 4KHTH 1PL3A 1Q0EA 4OJAA 3WHXA 3VDCA 5F9WB 5JPMC 2DF3A 3FMGH 5EC2B 2FJSA 1JV2A 3EHBB 4YXHH 4P05A 5AFAA 1T21B 4F7EB 4M02A 2WZAA 3NZHH 1NAMH 3FTWA 4IGBA 4IOSD 5IQLA 4QHMA 5SWZE 1B2WL 3OLIA 1H3WM 3K74B 4ELMA 1A7NL 3QCUL 3PWNB 4P59L 3X3GL 1E9OB 1JUFB 5I1LB 4IBUA 4ECNA 2VQUA 3H2QA 1H0DB 1QHPA 3OHXA 4HHGA 2H47C 2ICWA 1XVSA 4ACTA 3NGBB 5I6MA 2BSCA 3LH8A 1R24B 1UB5B 3OC5A 4PP1C 1SQ2N 3WNKA 2FX8L 3IFNL 3DVIA 1S7WB 2VZSA 1JGIA 4JN1L 3V0WL 3PJSB 1KIPB 1ML0A 1FO0B 3CVHA 4X42A 5IB3A 3Q2NA 3SGJA 2LAGB 3MXVL 2IGTA 3HIZA 3D9AL 4LLDA 3VI4A 3ECQA 3QWOB 4HUKB 3GSWB 3Q8AA 4YFEA 2KBGA 1MJUH 5L4MA 1C5DB 4X6DF 3TA4D 2C7UA 2WLKA 3UXFA 5IOPA 4AUYA 2K45A 1G7QB 5B38G 3KPMB 1AGFA 5DA0B 1KJ3L 2L4OA 4LZKA 4FQ2H 1TQSA 1T0MA 3CFKA 4MJIA 3MOAH 3P54A 5DJZB 3PL6B 1PZSA 3P40A 1ZS2A 4N8VB 3CSFA 2OR9L 3HI5L 1PY9A 1OCWH 5DMJB 3ZL4L 4CKQA 4G1MB 1A5FH 4NM4H 5C2BH 4NHUA 1G1YA 4D94A 2VTFA 4RMRA 2VW4A 4EPSA 1G5AA 4C54A 3AS0A 1E4JA 4WO4B 2WQSA 2X7LB 3R19A 4YAQB 3DETC 1B9KA 3NESA 3SE8L 1XR9A 3KWXA 2Z8RA 3H1ZA 1YMME 4ADIA 4ZMNA 3K2MC 4JB9H 4KTGA 4F9PA 1A3LL 5B1KA 2Y72A 4C56B 3AAZB 4EJ1C 1WCBA 1FFNA 3SPJA 3OV6A 1J9SA 4BD4A 3VGAB 4HFWA 4WW2C 4YZWA 4YGVB 5I76B 4WHYG 1OM3L 5IJVA 4U3HA 4JRYB 2VM4A 2RR3A 3VW3L 3NABL 3HI1A 5KJ7E 4HSCX 2H6PB 2D8KA 3HZYB 3SE3C 4NZTL 1IX2A 2QJDA 1TTBA 2QVKA 5BW7A 1N6QH 2JXMA 1M6UA 5C0CB 5F1IA 1E5UI 5M95B 1MQ8A 4NIYE 3ARRA 2XFGB 3EO9H 3QXUA 4P3CL 2YGOA 1AHWB 5B22A 1YN6B 2VR7A 2YAMA 2XVLA 3MACL 3GSRA 4MNQB 3HPJB 4B9IA 3FQWB 4U31A 1FZJA 4WIQA 3RTQB 3TOPA 3S8GB 1O6SB 3HNVH 4QIRA 3NFNB 2MTPA 1RUKL 5FKPA 3U9PL 3C60B 2P48B 3F6JA 4Y2DD 4EN3A 1F4XH 3X3FL 4ELME 4MXQD 2VRQA 5C3LD 2YD5A 2J5LC 2VQTA 3DDFA 1PG7L 4HFUH 1X6LA 4X7SL 3D18A 3IBOA 2VIRB 4FQJL 2Q3XA 5ID1B 2DM3A 1OOAA 3C5JA 2PCFB 2XXCB 2AI0L 1EEYB 2EILB 3X14A 1BFOB 2R56L 1ED3B 1REIA 4OZFA 2C3XA 3AMKA 4QDGA 5EULV 4HMDA 3BQUD 2VDLH 4M56A 4UU9A 5IHZA 5E8OB 3VI4E 3E38A 1JZIA 4JDTH 1VERA 1HDMA 3U9UB 4WI5A 1CE6B 2QGBA 3DJSA 2BK8A 4XN4A 5BRPA 1U4FA 2GEQA 4BFEA 3DMMA 1U4EA 4RCAA 1I8MA 5AZUA 2LABA 4E41B 2GQHA 4O5LH 4QTHA 4KXDA 2ZWYA 5A7EA 5KZCD 2BJML 1CFSB 2XIBA 3BPOC 1FI8C 1KCRH 4MJIE 3SE9L 4FZ8H 4WK0B 3BHBA 4IKIA 4N4YB 2OMBA 5T8IA 4WW2F 4D0DB 5HBBA 4ORGA 3D09A 4MVBD 2BP0B 1CFQB 3D39A 3OAZH 3TX4A 2ADJA 4HHAB 4QRFA 1B9ZA 2NNAA 5FHBL 1TO4A 1AKJA 1AOHA 1E4XL 2ZCKL 4MMYA 2ZX6A 1RP8A 4DEUA 3QIUC 3V4PB 2V3FA 3KLKA 5HI5D 1I8UA 1XIWD 5F9WC 3S35X 5EOTA 2EDLA 4XTRD 5IQNA 3EHBC 1E27A 4KPHH 1KGCD 1A6UL 1FJ1A 2VAJA 3LKRB 2WWMC 3DROA 1KIUA 3GI9H 3DHMA 4RGOH 3CDGB 5SX4I 3TFKD 1XD0A 2NQDA 2YD4A 4H0IA 4KVNL 4JHAL 1AKPA 3GS7A 4ZUVB 4TSCL 3EYFA 4PRID 1QSVA 2C1OB 3NGBC 1XMWA 2CLZB 4FTVB 2DLHA 2QSVA 5E8NA 3K7UA 5J3HD 3FO9A 2AKRA 1YAZA 4KK8C 4P23C 4XRCA 1OSZA 1KY6A 5IJDC 1NLBL 3SQOL 3VTMA 1KB9J 1AYOA 1SM3L 4M6OH 1S8DA 4NPYA 5GGTA 3WXVH 4BQ6A 1GYAA 1ZHNB 2F19H 2Z35B 2KQNA 3I50L 3MLUL 1OAJA 1PZ3A 2WBWB 4EVNA 2X3BA 5CBEB 2DMKA 4JY6B 1UUSA 2NY1D 4HJIA 1IBDA 3VU1A 3CMOH 1BVKA 4RQQA 1SRDA 2EE9A 5IBLC 4HJ0C 5SX4H 4XOBA 1I53A 3MV8B 3US9A 2E9WA 1KG0B 4P9HL 4K07A 2MWCA 4H44C 3PL6C 3W5MA 4DFIA 4FCAA 3UG3A 3KPOA 4HH8A 3MCLH 1HT6A 1KJMB 4DKFH 2C9QA 3R8QA 3T8XA 2AAVA 1YY9C 3L45A 4OUUA 1XB6A 1CBVL 2VOTA 3UGEA 4ZFGH 3P30L 3WJJA 3GI8L 5ERWA 3BP6A 4GW5B 3QNYA 2XTLA 1J1PH 1FYTB 2AJZA 2VISB 2W81C 3KPRA 4WO4C 2A9AA 4FQXB 3TGXA 3D4ZA 1H8SA 2KERA 5CSZB 2ORBH 1RURH 4YJZL 3NCFB 4ZT1A 3QUZB 1FHGA 4Y2OB 5JHDB 1K3ZA 2ZICA 4QHUA 1K6QH 2HJFA 4P4RA 4BFIB 5CUSH 1PD1A 2XWBA 1UB6B 2D73A 3OM3B 2CJUL 2YD2A 4M7JH 4PGBA 1CGXA 5F0JB 4LEXH 4P46D 5TDPB 3VGAC 2DBLL 3QORB 1GZQB 2ZD0A 3U79A 4Z23A 3D39E 2OMWB 3IEAA 1S7RA 1YY8B 2XYCA 3FSVA 4GQ9L 1XH3A 2YWYA 3O0RH 1NKGA 4N0FB 3SCMB 4OFYA 2WUBH 4XHJC 2YHGA 5EV7A 2P8LA 1TETH 3FHQA 3EJUA 1DBJH 3GKWL 3RVXD 4HJ1A 3MX0A 3BUPA 2ZWZA 4LQFH 3QHZH 4AIOA 4QHPA 1C9SA 1AHWC 3GBNL 2G9HA 4IHOB 3RTQC 1CFVL 1TJIL 3QDGB 1IM9B 1P7QA 4BDVA 4HW6A 2VDRH 1NC4A 4KGLA 3QJSB 3ULSA 2VKXA 5IOKA 5ILTH 4R2GD 1A4BA 4I13B 1AS7A 5FYJL 4RNRA 5CIPH 4MS8D 2EXWC 2IANB 4GH7B 5KANG 4X99A 4ZXBA 4WTXA 1BBJB 2H0PA 4ENZA 2C4XA 1F4HA 1ILUA 4J3SA 4DN4H 4MAYB 1IO4C 2EVHA 2B14A 2H1XA 3EBGA 2EEDA 3TIDB 1RJLB 1OANA 2CIIB 3P11L 3SBWC 3TJEH 5FCSH 3GIZH 3D0LA 4BSWA 4ZW8A 3ZIMA 1VFBA 2WNGA 3GLAA 4AEFA 1MH5A 4GKOA 4Y7MA 1IAKA 1ZT1B 2HRPH 3IFOA 3ZDZF 2CBMA 3V6OA 1SHSA 3BKCH 5IP4A 3H54A 1GOFA 2W9DH 1SEQL 3C75A 4L37B 1OF2B 3RL2A 3TBVB 5FYKU 1F2XK 1MREL 3R4DA 4UIKL 1ZE3C 2ZUQB 3NSCA 5IMOA 3HZ3A 3TH4T 3LQMA 3E1F1 3MV01 2C1PB 4QHLA 3TONA 2WPGA 5C07A 3VXSB 1R5WA 2GUOA 4DUWA 4GRLB 1WWWX 1A6VL 5I1KH 5DVPA 1ZLUK 3MNDA 5DWUH 5MEPA 1UT1A 4K4KA 1IRAY 3PFUA 4HIEA 1D5BA 5AOKA 1CLOH 5EMYA 4L48A 4CSZA 1M1XA 4ZOBA 3KPRE 2ZSWA 4RSVA 2WV3A 4B9PA 1E3XA 1LYQA 1XGYH 2NX5D 5F0LB 4R5VA 1IM3B 4R5XA 5CZXD 4FFTA 4PGDB 1JWSA 4JCMA 1S7QB 4L5FE 3N40F 5L2JB 3KYOA 4ZAKD 1XCTA 1QZ1A 5DMKB 2V2TA 1OB0A 5AAMC 2Y36L 5HDQH 1UWXK 2Z91A 1H6FA 2HRHA 2OTWA 1A7BA 1P9MA 4NAMA 2VL5A 2IWEA 1G7HA 4MLIA 4WHYH 1GSMA 3Q06A 3MLZL 3CXHJ 3D4CA 1N5AA 3MODH 4LQ1A 3S8WA 5H8DA 4E42A 1R0AH 4PJCB 2WWKO 2YFOA 3BAEL 3FTVA 2Z1KA 3RGVD 5C7ZA 5L4FA 4YOKA 1J8HD 3QUYA 4F80A 1E4WL 4XMKH 4TVUA 3VB8A 3MCG1 1S9YB 1EANA 3FQ4A 1W8EA 3I02A 3SPIA 4MD5B 2WB7A 3S37H 3JTSA 5D1XD 3BVNB 3OF6A 2HZHA 4JPIB 4U4BA 5I16A 5HYIA 5IB2B 3VQ2C 1NSNH 2YQ3A 3AS3A 5E99L 4JPKH 4DVRL 4EZKA 2Z6FA 3O6FD 2FGWL 5AB1A 1BXUA 4BFRA 3MRMA 9CGTA 1ET8A 4CSSA 3MRRA 3T0DA 2OMVB 4IK7A 4J3WA 1MI5B 3FQTA 1GY2A 1RIVL 1MCSA 2WN3A 4O2EB 4ZO7A 5HY9B 5KYXA 3CJJA 1I1AA 3MROA 1G7JA 4WY7L 4KMLB 5JORA 1I4FB 1XV8A 4MBOA 2JFCA 4J23A 2IGFH 5G5DA 3RWFA 2HPOA 5K9OA 2N01B 1R3IH 3X1GA 1FLRH 1UHVA 2F74A 2ZNXA 4FQXC 1BQLH 4UV4H 4W81A 4YUEH 2B4CL 1MNNA 1UFGA 1KV3A 2P4AB 5SWQB 4OD3H 3NFPA 3EXLA 1XF3B 5JOPE 3QUZC 2WXMA 3US1A 3CG8A 2OK0L 3FFCB 5ID0A 5CJXA 3G7TA 3V6OE 4X7TA 1KBWA 1GCYA 2GT9A 4JJ5B 4PRPA 2L04A 2ZAGA 4PLJC 5AD0A 3EDJA 5DFAA 3QORC 4JMXA 3SDXF 3ZKMD 1ZHBA 2PYEB 5IM7A 1KB5B 2GTQA 4NAQA 5FDWA 1A3RL 1S3KL 1N8ZB 3L5XL 3T3PE 4PRHB 3SCMC 2VKWA 5C07E 5DD3H 3HC4L 1YJDH 3GSNA 4PBDA 4FLSA 1UXSA 3OKKA 1ONQA 3SDAA 3I9AA 1Q72L 4F2MB 4PR5B 2PTUA 1J5OL 4XCCL 1MCOH 3O3AA 2DQUH 5CLYA 2WQRA 2AEWA 3H9SA 3DBSA 5JHAA 1IE5A 4G8FA 4O4YL 2R27A 5D93B 4PJXB 3UTPE 3C2SA 4BZ2H 3WE6A 7FABL 1FZOB 5ETUB 1QO3B 4PD4K 4JFPA 1UYWH 2GY5A 1AC0A 3BWSA 5D1ZI 1G43A 3G08A 1I3GH 3APCA 4MAYC 4UT6L 4MAUL 1SLVA 2DLIA 1NDMA 1G1CA 1KEML 5LQBH 1BZ8A 3LN5A 1A7PH 1LO4H 1XCXA 1Y07A 3HZVA 1OP3K 1KULA 5KSVA 15C8H 3L3OA 2GFBA 2VQ1A 3QXDA 4I1PA 3DTUB 4Y19D 3WNJA 3A6BH 5CILL 4TMPA 4HUNB 4LDEB 1I9IL 3A4DA 3W38A 2PKDA 4U1GB 1H19A 2F6AA 1QLFB 1XGUB 1HSBB 1Y1DA 1ZLEA 2FT7A 2VLJB 4P99A 5AOZA 5A16B 5B3NA 4LPXA 5AVQB 2UYLA 1Q9LA 1JF5A 2JIXD 4YE4H 2BC4B 3U0TA 1H8OA 4K94C 4DKEL 5I28A 5FS5A 5FHAL 1DLFL 2ZUQC 1DVXA 5T3ZL 2XN9A 4WF7A 4W9GC 2P24B 3F7YA 4GRLC 1FGVL 1R5VA 4OCRL 4FFZA 1NWPA 3BKJL 4RBPK 5TE7L 4F15B 5L8JB 2VR5A 5CN3A 1B4JL 2XQBL 1ZA3B 4GW4B 5EBLA 3ZYOA 1R46A 1V7NL 3Q3GA 4YL4A 2P5EA 3DHPA 5I17A 4H7VA 3ZTDC 4Y4KA 5TQ2H 1EXGA 1E7UA 1U8OA 1T4KA 4CBZA 3EGXA 1IGYB 1ZTXL 4TLUA 4WUUB 4D9QE 1R3KA 4DWHA 4YR6B 4PRPE 2YAPA 4OGAC 1RVFH 2P47B 3NCEB 4JDEA 4WWOA 1A6TB 3QUGA 4O51A 4GUPB 5GRZA 1SLXA 3WJMA 4BGDA 3O2DA 4FABH 5DD6B 5KANI 1MVFA 3BO8B 3QVAA 4ZK8A 1HH6A 3ROLB 1FNEA 4U6VL 1AQKL 2ADFH 3ULUE 4NKMB 3DO4A 4YSEA 4W9KC 1P0SE 3FOLA 5JW5A 5KEZA 3GSVB 5KVDE 3TC9A 2CK0H 5KTEL 2OJZL 1KN2H 4Z3IA 3CN1A 4ONFL 4NQCD 5C0AD 3WY2A 3CDZA 5CSBA 2V7HA 4J3UA 1XGRA 3H9SE 5G4OA 5FOBA 4LLQA 3X13B 4Z3TA 4LLYA 3X1FA 3DSFL 1G94A 1ROWA 2BNQD 3MMEA 2ENPA 4JQIA 3UBFA 2BNRA 1Z9SB 2NNFA 3ORJA 1YYCA 1CDCA 1ZJBA 1RAMA 1JYVA 1T0NB 1WA0X 1P84K 1MCJA 5ADOH 3U36B 4I9XA 2Z92A 3QUXA 1L9MA 2NTSP 2YOAA 2GJ6B 1L7IH 1UASA 3QQXA 4DIXA 1E2VA 3BN9D 2AEPL 4L8BB 4GI9A 5C09B 1MJ7L 4U1MB 2Y4SA 4ADJA 4J8RB 3CUPA 4UOQA 4FMVA 4GKSB 1JGUH 2VZUA 2B3RA 2D03L 5GRUL 1F58H 4IKLA 3OKEA 3AB0B 1YNTB 4JFXA 1BQHG 1RZGA 3PV6A 1HCVA 3ILQC 4JKMA 4ZODA 2HCZX 2X9XA 4HUWB 1L9PA 3I9PA 1YAIA 3ULVL 1W6LA 1A7QH 2XN9E 3U82B 4YXLH 4DCQB 3F7VA 1GPOL 4NB7A 4JGNA 4DJMA 4UQIM 2IPKA 5EIIA 1T4WA 2WXOA 3CVHL 4MA1B 2IDQA 3KPQB 2P28B 5E0QA 1ZY9A 2JKJA 3I3BA 4R26H 2D4DA 1AJ7L 3UTSB 1N0LB 1U8PA 4MDIA 3BGMA 3QDJB 3WAJA 5IY5B 3KJ6L 2P5EE 4W4OC 3F7LA 2P80A 2X4QB 3WTVA 2DQHH 5ECGA 5GGUB 5AENA 1KTBA 4DETA 3VTAA 1JL8A 3TS8A 4P5TA 4F33A 5CO1A 4N6RA 2J6EL 2WUCL 5D93C 4AXWA 2PXYB 2H2PC 2J71A 1CGVA 1WE5A 2UVEA 1CU4H 3UTQA 3GMMA 1AXSB 4NXSA 4Y2LA 4M29A 4WKZA 3MRDA 5EU3A 3T9WA 2FSEB 4PBVC 5D7JB 2LLGA 2VXQH 4Y88A 4PTUA 1I8LC 4AYID 1OWWA 4Q9QH 3S8FB 4PBXA 4PS7A 3MLYH 1KELL 4LARH 1WA1X 4NQDA 2E6JA 5DJXA 3L54A 2A83A 5E2JA 3WD5H 4ANVA 1A9EB 3GSQB 2EEAA 2R0LL 4TL4A 2OMYB 3EJPA 3B2VL 4G2AA 3KBPA 3QUMH 4XH2A 3TA3A 4YIQA 4HH9A 4XVTL 5CJ8A 2JK5B 3SDCA 1UKQA 3VGDA 1U8MB 4U1GC 4WEBH 1NCUA 4U1NB 1TVHA 5CNHA 3VXMD 3P73B 3VFNB 3BP4B 4M48L 4BKLA 5DRXB 5IROD 2E7HA 4N3UA 1FCGA 2C9XA 1O6VA 5CCHE 2X4UA 1VPOH 3O9WD 3ZMEA 3DIDA 2QR0A 4EI6B 3MUZ1 5H94B 1RHHA 3BH9A 5BUGA 5L2KD 2VLRD 3HMXH 4XBPA 3S34L 2HJKA 1M2VA 2HTLD 3CD4A 3R0MA 3VJ6A 1GTFA 5D96B 2BNRE 4NZ8A 2G75B 4N2LA 1UD4A 3QJHB 1LQSR 2QFPA 4YX2H 4OZIB 5DS2A 2R29A 3QIBB 3UCQA 1EAOA 3HPLB 4OLWL 4F15C 2EDDA 4NGHL 2FL5B 2HAZA 5EZLB 3V79C 4E9VA 2L3BA 1E67A 2JQMA 5IF0B 5BV7H 1MLCA 4Q7DA 1MWAA 4KKBC 5HYJD 2MFNA 1KBBA 3LTVA 2DQJH 1U95B 2G5BB 1IGML 3JSSA 2PO6D 5E2UL 1NIAA 1DANU 1R4XA 3BAWA 2VMEA 2Y5EA 4M1CC 4OLXH 4U2ZA 4X5PA 3X1NA 3BZFA 2EYRB 1MOEA 1DL7H 4N25A 3LIUA 1U8CA 5JR1L 5IKCB 1ORSB 4PJFA 3PWPA 2R9HC 2CUMA 2OCFD 5ALBL 1D9KA 3UTZA 4PJXF 1ZLVK 3WGVB 1ZV9A 4OZ4A 3LNIA 4MA3A 4XCEA 2X4TB 3BDBA 3O3BA 2YPLA 3ZT6A 2K4WA 2FBJH 3MRBB 2BHFA 1WO2A 1LO3L 4JE4B 2XWJB 3FQRA 4PVNA 2F08A 1QLEL 1J0YA 1FNGB 3BLKA 3HAEA 1I7UB 4QJ3B 1AD9B 1NEZA 5FF6B 2P7TB 4U6HB 3WFHA 1G7LA 1LTXA 2WIIA 4LOEA 5GPRA 3W39B 3GKZA 5M94B 4EUPB 4XVSL 5C70A 5C9KA 3FO0H 4GG8A 3CPLA 1TCRA 2MNUA 3CK0L 4U3CA 3X11A 4AQ1B 1QI4A 3G5ZB 1QZNA 5E00B 1P4LB 5I6XC 1HKLH 1H3TA 2F15A 2X6AA 3PJNA 1LK2B 5GXBB 5IVZB 2MCAA 3FU8A 3FNKA 1BM3L 2J55A 4ZQKB 4QF1B 1T7ZA 5EU6A 4JO2H 4H8PA 2LGNA 2QPSA 2AAAA 4NQDE 2XN2A 3VXOB 4HPYH 5CHNB 3LPWA 4UT9L 1GGCL 4HJJH 4KRMB 4OVUA 3CE1A 4LRNH 4PP2B 1KB3A 2PLTA 2AEIT 2O61B 4XB7A 5L6YH 3SDDD 2AXFA 3AB0C 2WY3B 3L3GA 4P57A 1PDKB 3S0PA 2AQPA