2HG1A

N-domain of grp94 in complex with the novel ligand n-(2-hydroxyl)ethyl carboxyamido adenosine
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
236
structure length
225
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQEQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-Domain Of Grp94 In Complex With the Novel Ligand N-(2-hydroxyl)ethyl Carboxyamido Adenosine
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 68
structure length 225
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2hg1A00
4O05A 4MPEA 1BYQA 4E02A 2QFOA 2YE9A 2YJXA 4CWPA 3BM9A 1UYEA 4URMA 3VHCA 2H55A 2AKPA 2XX5A 3B25A 3ZKBA 1TILA 4LPBA 4HY1A 3BMYA 3O0IA 2YE7A 3G7EA 2HCHA 4MBCA 2XDUA 4XTJA 4LWEA 3Q5LA 1YT0A 2QG2A 2CH4A 2YEFA 5M4PA 1U2OA 3TUHA 3LNUA 4ASAA 1ZW9A 3RLPA 1B3QA 2ZBKB 3VHDA 5F5RA 3VHAA 2XX2A 4WUCA 5D7RA 1BGQA 4U7OA 3GIFA 2YKJA 3NMQA 4Q20A 3FT8A 1AJ6A 1BKNA 4URLA 2YI5A 3HEKA 4BAEA 2UWDA 3D2RA 2YEHA 2BZ5A 2HKJA 1Z59A 3HYZA 4YKQA 1QZRA 4LP0A 4JAUA 4UROA 1GKXA 4MPNA 3A0XA 2YI7A 4KP4A 3INWA 3C0EA 4H81A 2BU8A 4HYMA 2YEBA 2QF6A 2YEDA 2XDLA 2BYIA 2Q2EB 4XDMA 5D7DA 3HHUA 4PL9A 2IWXA 4JQLA 1Y8NA 4L91A 2Q8GA 4KQVA 2Q8HA 4CWRA 3A0ZA 2K5BA 4XKAA 4EGKA 2CCUA 4GCZA 1NHIA 3MNRP 1UYHA 4K4OA 2PNRA 3EHGA 4MP2A 4FCQA 4PRXA 4MP7A 4V25A 2FWYA 3R4OA 4L90A 1AMWA 3U2DA 1YSZA 2CG9A 2YEAA 5BODA 3H80A 4LWGA 4YKRA 3EKRA 5CTWA 3K97A 1GKZA 3QDDA 4ZVIA 3R4MA 2WI5A 4KSHA 4U93A 4EFTA 4DUHA 1PVGA 4MOTA 3FT5A 4H7QA 1YT2A 5CTYA 4XKKA 5M4HA 3CRLA 5FNDA 4EEHA 4GFNA 2YE4A 3T10A 3U2KA 2YEIA 1Z5BA 1AM1A 2BU7A 2XDKA 4YKYA 3TZ0A 3KE6A 3T0ZA 2JKIA 4AWOA 1ZWHA 4NH9A 2WEQA 3B27A 3ZM7A 5IN9A 4MPCA 5L3JA 5F3KA 2YK9A 2YKCA 1YC1A 5M4KA 1UYMA 3OW6A 5CTUA 2IWSA 2WEPA 2VW5A 1L0OA 2BU6A 2YK2A 4CWFA 2FYPA 2YE5A 3RKZA 5M4NA 4YKWA 1UYFA 4KSGA 1S14A 2YE2A 4EGIA 4B6CA 4URNA 3R91A 2WERA 4HZ5A 3VADA 3K99A 4GQTA 3RLRA 1YETA 2XX4A 4XIRA 1S16A 3GIGA 1UYGA 4XCLA 3WQ9A 1I59A 3HZ5A 2O1WA 4XD8A 4HY6A 4BQGA 4ZKIA 3CGYA 3K98A 1MU5A 4XKOA 1UY6A 3OWBA 1Z5AA 2XJGA 3A0YA 2XHTA 5BOCA 4L94A 3TZ4A 4CWSA 4R1FA 4HZ0A 4ASBA 4WUBA 4LWFA 3T1KA 2CCTA 4FCRA 4P7AA 4PU9A 1B62A 1B63A 3EHJA 3OPDA 1KZNA 3GIEA 2YKBA 1TIDA 2VCIA 5IDMA 4R3MA 2ZDYA 5D6QA 4PRVA 1YT1A 2CGFA 3PEHA 3D0BA 4E01A 2YGFA 4W7TA 2WI1A 3CWVA 2Q8FA 2YE3A 5D7CA 4HXZA 3K60A 2FWZA 2XABA 3HZ1A 3CRKA 2YE6A 5M4EA 2GQPA 2YI0A 4CE3A 1OSFA 4V26A 3O6OA 2BTZA 1Y8OA 3ZXOA 4O04A 2IOPA 2VWCA 4YKZA 2BU5A 1TH8A 1US7A 1YC3A 4YKTA 3ZKDA 5J6AA 2E0AA 4YKUA 4HXWA 2XDSA 2YEJA 2CCSA 4CWNA 1Y4SA 1R62A 2XK2A 4XE2A 1AH6A 4O09A 1YSRA 2JJCA 1ZXNA 2XHXA 3GIGB 1QYEA 1TC6A 1U0ZA 2YJWA 4O07A 3INXA 5FNFA 2Q8IA 3JZ3A 2WI2A 3R4PA 3OWDA 4AWPA 1A4HA 3PEJA 4BQJA 4CWQA 1H7UA 4GGLA 3O2FA 3B26A 4JASA 3IEDA 2H8MA 1YC4A 3WHAA 1YESA 3Q5KA 4KTNA 5IDJA 1YERA 4I5SA 3A0RA 1UY7A 4EGHA 2WI6A 3H4LA 4FPPA 1Y8PA 4QPJA 1I58A 2BSMA 1I5DA 4I3HA 4CWTA 1THNA 4R3AA 2EXLA 1UYLA 2XJXA 4L8ZA 3CGZA 1YS3A 3LPSA 4LWIA 1MX0A 1KIJA 3TTZA 2YKEA 4XIQA 4LWHA 4B7PA 4JAVA 5FNCA 1TBWA 2BREA 1UY8A 2GFDA 2BU2A 4BIUA 5GGZA 1NHJA 1QY8A 4BXIA 3OMUA 5J71A 5CPHA 3B28A 4AWQA 2YEEA 4QPKA 3B24A 2HG1A 3QTFA 2XJJA 3RLQA 2ZDXA 5CTXA 4ASGA 3DGEA 4L93A 4CWOA 2WI3A 4EFUA 2YI6A 3A0TA 4AS9A 1ID0A 2BRCA 2O1VA 1TC0A 2YGAA 4XIPA 3T2SA 4XCJA 3ZXQA 5C93A 5M4MA 4WUDA 4MB9A 1BXDA 4BIZA 4HYPA 4CE1A 3TZ2A 1UYKA 4DZYA 4FCPA 2YKIA 4EM7A 5FWKA 3G75A 3EHFA 4O0BA 3D36A 1UYIA 3SL2A 2ESAA 3U67A 1Y4UA 3T0HA 2XCMA 1JM6A 1ZXMA 4H85A 1AH8A 3Q5JA 3HYYA 4GEEA 2QG0A 4E00A 2ZKJA 1Z5CA 4XC0A 3R4NA 2IOQA 4FMTA 2IWUA 4U7NA 1UYDA 1UYCA 4YKXA 4CE2A 2C2AA 1I5AA 1H7SA 3R92A 2YE8A 3EKOA 2YGEA 5D6PA 4XITA 3TZ5A 4GT8A 4NH7A 1NHHA 2FXSA 3G7BA 1EA6A 2BT0A 4ASFA 1GJVA 2XDXA 2IORA 2WI4A 2VCJA 4NH8A 4X9LA 3EHHA 4KFGA 2XHRA 1I5CA 3FV5A 4EMVA 2XD6A 1UY9A 2YECA 1EI1A 2WI7A 4P8OA 1I5BA 3A0WA 5CF0A 2YEGA 3C11A 2O1UA 2BYHA
chains in the Genus database with same CATH superfamily
4O05A 4MPEA 1BYQA 4E02A 2QFOA 2YE9A 2YJXA 4CWPA 3BM9A 1UYEA 4URMA 3VHCA 2H55A 2AKPA 2XX5A 3B25A 3ZKBA 1TILA 2C1IA 4LPBA 4HY1A 3BMYA 3O0IA 2YE7A 3G7EA 2HCHA 4MBCA 2XDUA 4XTJA 4LWEA 3Q5LA 1YT0A 2QG2A 2CH4A 2YEFA 5M4PA 1U2OA 3TUHA 3LNUA 4ASAA 1ZW9A 3RLPA 1B3QA 2ZBKB 3VHDA 5F5RA 3VHAA 2XX2A 4WUCA 5D7RA 1BGQA 4U7OA 3GIFA 2YKJA 3NMQA 4Q20A 3FT8A 1AJ6A 1BKNA 4URLA 2YI5A 3HEKA 4BAEA 2UWDA 3D2RA 2YEHA 2BZ5A 2HKJA 1Z59A 3HYZA 4YKQA 1QZRA 4LP0A 4JAUA 4UROA 1GKXA 4MPNA 3A0XA 2YI7A 4KP4A 3INWA 3C0EA 4H81A 2BU8A 4HYMA 2YEBA 2QF6A 2YEDA 2XDLA 2BYIA 2Q2EB 4XDMA 5D7DA 3HHUA 4PL9A 2IWXA 4JQLA 1Y8NA 4L91A 2Q8GA 4KQVA 2Q8HA 4CWRA 3A0ZA 2K5BA 4XKAA 4EGKA 2CCUA 4GCZA 3S5TA 1NHIA 3MNRP 1UYHA 4K4OA 2PNRA 3EHGA 4MP2A 4FCQA 4PRXA 4MP7A 4V25A 2FWYA 3R4OA 4L90A 1AMWA 3U2DA 1YSZA 2CG9A 2YEAA 5BODA 3H80A 2HHIA 4LWGA 4YKRA 3EKRA 5CTWA 3K97A 1GKZA 3QDDA 4ZVIA 3R4MA 2WI5A 4KSHA 4U93A 4EFTA 4DUHA 1PVGA 4MOTA 3FT5A 4H7QA 1YT2A 5CTYA 4XKKA 5M4HA 3CRLA 5FNDA 4EEHA 4GFNA 2YE4A 3T10A 3U2KA 2YEIA 1Z5BA 1AM1A 2BU7A 2XDKA 4YKYA 3TZ0A 3KE6A 1F51A 3T0ZA 2JKIA 4AWOA 1ZWHA 4NH9A 2WEQA 3B27A 3ZM7A 5IN9A 4MPCA 5L3JA 5F3KA 2YK9A 2YKCA 1YC1A 5M4KA 1UYMA 3OW6A 3LMMA 5CTUA 2IWSA 2WEPA 2VW5A 1L0OA 2BU6A 2YK2A 4CWFA 2FYPA 2YE5A 3RKZA 5M4NA 4YKWA 1UYFA 4KSGA 1S14A 2YE2A 4EGIA 4B6CA 4URNA 3R91A 2WERA 4HZ5A 3VADA 3K99A 4GQTA 3RLRA 1YETA 2XX4A 4XIRA 1S16A 3GIGA 1UYGA 4XCLA 3WQ9A 1I59A 3HZ5A 2O1WA 4XD8A 4HY6A 4BQGA 4ZKIA 3CGYA 3K98A 1MU5A 4XKOA 1UY6A 3OWBA 1Z5AA 2XJGA 3A0YA 2XHTA 5BOCA 4L94A 3TZ4A 4CWSA 4R1FA 4HZ0A 4ASBA 4WUBA 4LWFA 3T1KA 2CCTA 4FCRA 4P7AA 4PU9A 1B62A 1B63A 3EHJA 3OPDA 1KZNA 3GIEA 2YKBA 1TIDA 2VCIA 5IDMA 4R3MA 2ZDYA 5D6QA 4PRVA 1YT1A 2CGFA 3PEHA 3D0BA 4E01A 2YGFA 4W7TA 2WI1A 4E72A 3CWVA 2Q8FA 2YE3A 5D7CA 4HXZA 3K60A 2FWZA 2XABA 3HZ1A 2FTKA 3CRKA 2YE6A 5M4EA 2GQPA 2YI0A 4CE3A 1OSFA 4V26A 3O6OA 2BTZA 1Y8OA 3ZXOA 4O04A 2IOPA 2VWCA 4YKZA 1IXMA 2BU5A 1TH8A 1US7A 1YC3A 4YKTA 3ZKDA 5J6AA 2E0AA 4YKUA 4HXWA 2XDSA 2YEJA 2CCSA 4CWNA 1Y4SA 1R62A 2XK2A 4XE2A 1AH6A 4O09A 1YSRA 2C1GA 2JJCA 1ZXNA 2XHXA 3GIGB 1QYEA 1TC6A 1U0ZA 2YJWA 4O07A 3INXA 5FNFA 2Q8IA 3JZ3A 2WI2A 3R4PA 3OWDA 4AWPA 1A4HA 3PEJA 4BQJA 4CWQA 1H7UA 4GGLA 3O2FA 3B26A 4JASA 3IEDA 2H8MA 1YC4A 5JENA 3WHAA 1YESA 3Q5KA 4KTNA 5IDJA 1YERA 4I5SA 3A0RA 1UY7A 4EGHA 2WI6A 3H4LA 4FPPA 1Y8PA 4QPJA 1I58A 2BSMA 1I5DA 4I3HA 4CWTA 1THNA 4R3AA 2EXLA 1UYLA 2XJXA 4L8ZA 3CGZA 1YS3A 3LPSA 4LWIA 1MX0A 1KIJA 3TTZA 2YKEA 4XIQA 4LWHA 4B7PA 4JAVA 5FNCA 1TBWA 2BREA 1UY8A 2GFDA 2BU2A 4BIUA 5GGZA 1NHJA 1QY8A 4BXIA 3OMUA 5J71A 5CPHA 3B28A 4AWQA 2YEEA 4QPKA 3B24A 2HG1A 3QTFA 2XJJA 3RLQA 2ZDXA 5CTXA 4ASGA 3DGEA 4L93A 4CWOA 2WI3A 4EFUA 2YI6A 3A0TA 4AS9A 1ID0A 2BRCA 2O1VA 1TC0A 2YGAA 4XIPA 3T2SA 4XCJA 3ZXQA 5C93A 5M4MA 4WUDA 4MB9A 1BXDA 4BIZA 4HYPA 4CE1A 3TZ2A 1UYKA 3CYGA 4DZYA 4FCPA 2YKIA 4EM7A 5FWKA 3G75A 3EHFA 4O0BA 3D36A 1UYIA 3SL2A 2ESAA 3U67A 1Y4UA 3T0HA 2XCMA 1JM6A 1ZXMA 4H85A 1AH8A 3Q5JA 3HYYA 4GEEA 2QG0A 4E00A 2ZKJA 1Z5CA 4XC0A 3R4NA 2IOQA 4FMTA 2IWUA 4U7NA 1UYDA 1UYCA 4YKXA 4CE2A 2C2AA 1I5AA 1H7SA 3R92A 2YE8A 3EKOA 2YGEA 5D6PA 4XITA 3TZ5A 4GT8A 4NH7A 1NHHA 2FXSA 3G7BA 1EA6A 2BT0A 4ASFA 1GJVA 2XDXA 2IORA 2WI4A 2VCJA 4NH8A 4X9LA 3EHHA 4KFGA 2XHRA 1I5CA 3FV5A 4EMVA 2XD6A 1UY9A 2YECA 1EI1A 2WI7A 4P8OA 1I5BA 3A0WA 5CF0A 2YEGA 3C11A 2O1UA 2BYHA
chains in the Genus database with same CATH topology
4O05A 4MPEA 1BYQA 4E02A 2QFOA 2YE9A 2YJXA 4CWPA 3BM9A 1UYEA 4URMA 3VHCA 2H55A 2AKPA 2XX5A 3B25A 3ZKBA 1TILA 4LPBA 4HY1A 3BMYA 3O0IA 2YE7A 3G7EA 2HCHA 4MBCA 2XDUA 4XTJA 4LWEA 3Q5LA 1YT0A 2QG2A 2CH4A 2YEFA 5M4PA 1U2OA 3TUHA 3LNUA 4ASAA 1ZW9A 3RLPA 1B3QA 2ZBKB 3VHDA 5F5RA 3VHAA 2XX2A 4WUCA 5D7RA 1BGQA 4U7OA 3GIFA 2YKJA 3NMQA 4Q20A 3FT8A 1AJ6A 1BKNA 4URLA 2YI5A 3HEKA 4BAEA 2UWDA 3D2RA 2YEHA 2BZ5A 2HKJA 1Z59A 3HYZA 4YKQA 1QZRA 4LP0A 4JAUA 4UROA 1GKXA 4MPNA 3A0XA 2YI7A 4KP4A 3INWA 3C0EA 4H81A 2BU8A 4HYMA 2YEBA 2QF6A 2YEDA 2XDLA 2BYIA 2Q2EB 4XDMA 5D7DA 3HHUA 4PL9A 2IWXA 4JQLA 1Y8NA 4L91A 2Q8GA 4KQVA 2Q8HA 4CWRA 3A0ZA 2K5BA 4XKAA 4EGKA 2CCUA 4GCZA 1NHIA 3MNRP 1UYHA 4K4OA 2PNRA 3EHGA 4MP2A 4FCQA 4PRXA 4MP7A 4V25A 2FWYA 3R4OA 4L90A 1AMWA 3U2DA 1YSZA 2CG9A 2YEAA 5BODA 3H80A 4LWGA 4YKRA 3EKRA 5CTWA 3K97A 1GKZA 3QDDA 4ZVIA 3R4MA 2WI5A 4KSHA 4U93A 4EFTA 4DUHA 1PVGA 4MOTA 3FT5A 4H7QA 1YT2A 5CTYA 4XKKA 5M4HA 3CRLA 5FNDA 4EEHA 4GFNA 2YE4A 3T10A 3U2KA 2YEIA 1Z5BA 1AM1A 2BU7A 2XDKA 4YKYA 3TZ0A 3KE6A 3T0ZA 2JKIA 4AWOA 1ZWHA 4NH9A 2WEQA 3B27A 3ZM7A 5IN9A 4MPCA 5L3JA 5F3KA 2YK9A 2YKCA 1YC1A 5M4KA 1UYMA 3OW6A 5CTUA 2IWSA 2WEPA 2VW5A 1L0OA 2BU6A 2YK2A 4CWFA 2FYPA 2YE5A 3RKZA 5M4NA 4YKWA 1UYFA 4KSGA 1S14A 2YE2A 4EGIA 4B6CA 4URNA 3R91A 2WERA 4HZ5A 3VADA 3K99A 4GQTA 3RLRA 1YETA 2XX4A 4XIRA 1S16A 3GIGA 1UYGA 4XCLA 3WQ9A 1I59A 3HZ5A 2O1WA 4XD8A 4HY6A 4BQGA 4ZKIA 3CGYA 3K98A 1MU5A 4XKOA 1UY6A 3OWBA 1Z5AA 2XJGA 3A0YA 2XHTA 5BOCA 4L94A 3TZ4A 4CWSA 4R1FA 4HZ0A 4ASBA 4WUBA 4LWFA 3T1KA 2CCTA 4FCRA 4P7AA 4PU9A 1B62A 1B63A 3EHJA 3OPDA 1KZNA 3GIEA 2YKBA 1TIDA 2VCIA 5IDMA 4R3MA 2ZDYA 5D6QA 4PRVA 1YT1A 2CGFA 3PEHA 3D0BA 4E01A 2YGFA 4W7TA 2WI1A 3CWVA 2Q8FA 2YE3A 5D7CA 4HXZA 3K60A 2FWZA 2XABA 3HZ1A 3CRKA 2YE6A 5M4EA 2GQPA 2YI0A 4CE3A 1OSFA 4V26A 3O6OA 2BTZA 1Y8OA 3ZXOA 4O04A 2IOPA 2VWCA 4YKZA 2BU5A 1TH8A 1US7A 1YC3A 4YKTA 3ZKDA 5J6AA 2E0AA 4YKUA 4HXWA 2XDSA 2YEJA 2CCSA 4CWNA 1Y4SA 1R62A 2XK2A 4XE2A 1AH6A 4O09A 1YSRA 2JJCA 1ZXNA 2XHXA 3GIGB 1QYEA 1TC6A 1U0ZA 2YJWA 4O07A 3INXA 5FNFA 2Q8IA 3JZ3A 2WI2A 3R4PA 3OWDA 4AWPA 1A4HA 3PEJA 4BQJA 4CWQA 1H7UA 4GGLA 3O2FA 3B26A 4JASA 3IEDA 2H8MA 1YC4A 3WHAA 1YESA 3Q5KA 4KTNA 5IDJA 1YERA 4I5SA 3A0RA 1UY7A 4EGHA 2WI6A 3H4LA 4FPPA 1Y8PA 4QPJA 1I58A 2BSMA 1I5DA 4I3HA 4CWTA 1THNA 4R3AA 2EXLA 1UYLA 2XJXA 4L8ZA 3CGZA 1YS3A 3LPSA 4LWIA 1MX0A 1KIJA 3TTZA 2YKEA 4XIQA 4LWHA 4B7PA 4JAVA 5FNCA 1TBWA 2BREA 1UY8A 2GFDA 2BU2A 4BIUA 5GGZA 1NHJA 1QY8A 4BXIA 3OMUA 5J71A 5CPHA 3B28A 4AWQA 2YEEA 4QPKA 3B24A 2HG1A 3QTFA 2XJJA 3RLQA 2ZDXA 5CTXA 4ASGA 3DGEA 4L93A 4CWOA 2WI3A 4EFUA 2YI6A 3A0TA 4AS9A 1ID0A 2BRCA 2O1VA 1TC0A 2YGAA 4XIPA 3T2SA 4XCJA 3ZXQA 5C93A 5M4MA 4WUDA 4MB9A 1BXDA 4BIZA 4HYPA 4CE1A 3TZ2A 1UYKA 4DZYA 4FCPA 2YKIA 4EM7A 5FWKA 3G75A 3EHFA 4O0BA 3D36A 1UYIA 3SL2A 2ESAA 3U67A 1Y4UA 3T0HA 2XCMA 1JM6A 1ZXMA 4H85A 1AH8A 3Q5JA 3HYYA 4GEEA 2QG0A 4E00A 2ZKJA 1Z5CA 4XC0A 3R4NA 2IOQA 4FMTA 2IWUA 4U7NA 1UYDA 1UYCA 4YKXA 4CE2A 2C2AA 1I5AA 1H7SA 3R92A 2YE8A 3EKOA 2YGEA 5D6PA 4XITA 3TZ5A 4GT8A 4NH7A 1NHHA 2FXSA 3G7BA 1EA6A 2BT0A 4ASFA 1GJVA 2XDXA 2IORA 2WI4A 2VCJA 4NH8A 4X9LA 3EHHA 4KFGA 2XHRA 1I5CA 3FV5A 4EMVA 2XD6A 1UY9A 2YECA 1EI1A 2WI7A 4P8OA 1I5BA 3A0WA 5CF0A 2YEGA 3C11A 2O1UA 2BYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O05 A;  4MPE A;  1BYQ A;  4E02 A;  2QFO A;  2YE9 A;  2YJX A;  4CWP A;  3BM9 A;  1UYE A;  4URM A;  3VHC A;  2H55 A;  2AKP A;  2XX5 A;  3B25 A;  3ZKB A;  1TIL A;  4LPB A;  4HY1 A;  3BMY A;  3O0I A;  2YE7 A;  3G7E A;  2HCH A;  4MBC A;  2XDU A;  4XTJ A;  4LWE A;  3Q5L A;  1YT0 A;  2QG2 A;  2CH4 A;  2YEF A;  5M4P A;  1U2O A;  3TUH A;  3LNU A;  4ASA A;  1ZW9 A;  3RLP A;  1B3Q A;  2ZBK B;  3VHD A;  5F5R A;  3VHA A;  2XX2 A;  4WUC A;  5D7R A;  1BGQ A;  4U7O A;  3GIF A;  2YKJ A;  3NMQ A;  4Q20 A;  3FT8 A;  1AJ6 A;  1BKN A;  4URL A;  2YI5 A;  3HEK A;  4BAE A;  2UWD A;  3D2R A;  2YEH A;  2BZ5 A;  2HKJ A;  1Z59 A;  3HYZ A;  4YKQ A;  1QZR A;  4LP0 A;  4JAU A;  4URO A;  1GKX A;  4MPN A;  3A0X A;  2YI7 A;  4KP4 A;  3INW A;  3C0E A;  4H81 A;  2BU8 A;  4HYM A;  2YEB A;  2QF6 A;  2YED A;  2XDL A;  2BYI A;  2Q2E B;  4XDM A;  5D7D A;  3HHU A;  4PL9 A;  2IWX A;  4JQL A;  1Y8N A;  4L91 A;  2Q8G A;  4KQV A;  2Q8H A;  4CWR A;  3A0Z A;  2K5B A;  4XKA A;  4EGK A;  2CCU A;  4GCZ A;  1NHI A;  3MNR P;  1UYH A;  4K4O A;  2PNR A;  3EHG A;  4MP2 A;  4FCQ A;  4PRX A;  4MP7 A;  4V25 A;  2FWY A;  3R4O A;  4L90 A;  1AMW A;  3U2D A;  1YSZ A;  2CG9 A;  2YEA A;  5BOD A;  3H80 A;  4LWG A;  4YKR A;  3EKR A;  5CTW A;  3K97 A;  1GKZ A;  3QDD A;  4ZVI A;  3R4M A;  2WI5 A;  4KSH A;  4U93 A;  4EFT A;  4DUH A;  1PVG A;  4MOT A;  3FT5 A;  4H7Q A;  1YT2 A;  5CTY A;  4XKK A;  5M4H A;  3CRL A;  5FND A;  4EEH A;  4GFN A;  2YE4 A;  3T10 A;  3U2K A;  2YEI A;  1Z5B A;  1AM1 A;  2BU7 A;  2XDK A;  4YKY A;  3TZ0 A;  3KE6 A;  3T0Z A;  2JKI A;  4AWO A;  1ZWH A;  4NH9 A;  2WEQ A;  3B27 A;  3ZM7 A;  5IN9 A;  4MPC A;  5L3J A;  5F3K A;  2YK9 A;  2YKC A;  1YC1 A;  5M4K A;  1UYM A;  3OW6 A;  5CTU A;  2IWS A;  2WEP A;  2VW5 A;  1L0O A;  2BU6 A;  2YK2 A;  4CWF A;  2FYP A;  2YE5 A;  3RKZ A;  5M4N A;  4YKW A;  1UYF A;  4KSG A;  1S14 A;  2YE2 A;  4EGI A;  4B6C A;  4URN A;  3R91 A;  2WER A;  4HZ5 A;  3VAD A;  3K99 A;  4GQT A;  3RLR A;  1YET A;  2XX4 A;  4XIR A;  1S16 A;  3GIG A;  1UYG A;  4XCL A;  3WQ9 A;  1I59 A;  3HZ5 A;  2O1W A;  4XD8 A;  4HY6 A;  4BQG A;  4ZKI A;  3CGY A;  3K98 A;  1MU5 A;  4XKO A;  1UY6 A;  3OWB A;  1Z5A A;  2XJG A;  3A0Y A;  2XHT A;  5BOC A;  4L94 A;  3TZ4 A;  4CWS A;  4R1F A;  4HZ0 A;  4ASB A;  4WUB A;  4LWF A;  3T1K A;  2CCT A;  4FCR A;  4P7A A;  4PU9 A;  1B62 A;  1B63 A;  3EHJ A;  3OPD A;  1KZN A;  3GIE A;  2YKB A;  1TID A;  2VCI A;  5IDM A;  4R3M A;  2ZDY A;  5D6Q A;  4PRV A;  1YT1 A;  2CGF A;  3PEH A;  3D0B A;  4E01 A;  2YGF A;  4W7T A;  2WI1 A;  3CWV A;  2Q8F A;  2YE3 A;  5D7C A;  4HXZ A;  3K60 A;  2FWZ A;  2XAB A;  3HZ1 A;  3CRK A;  2YE6 A;  5M4E A;  2GQP A;  2YI0 A;  4CE3 A;  1OSF A;  4V26 A;  3O6O A;  2BTZ A;  1Y8O A;  3ZXO A;  4O04 A;  2IOP A;  2VWC A;  4YKZ A;  2BU5 A;  1TH8 A;  1US7 A;  1YC3 A;  4YKT A;  3ZKD A;  5J6A A;  2E0A A;  4YKU A;  4HXW A;  2XDS A;  2YEJ A;  2CCS A;  4CWN A;  1Y4S A;  1R62 A;  2XK2 A;  4XE2 A;  1AH6 A;  4O09 A;  1YSR A;  2JJC A;  1ZXN A;  2XHX A;  3GIG B;  1QYE A;  1TC6 A;  1U0Z A;  2YJW A;  4O07 A;  3INX A;  5FNF A;  2Q8I A;  3JZ3 A;  2WI2 A;  3R4P A;  3OWD A;  4AWP A;  1A4H A;  3PEJ A;  4BQJ A;  4CWQ A;  1H7U A;  4GGL A;  3O2F A;  3B26 A;  4JAS A;  3IED A;  2H8M A;  1YC4 A;  3WHA A;  1YES A;  3Q5K A;  4KTN A;  5IDJ A;  1YER A;  4I5S A;  3A0R A;  1UY7 A;  4EGH A;  2WI6 A;  3H4L A;  4FPP A;  1Y8P A;  4QPJ A;  1I58 A;  2BSM A;  1I5D A;  4I3H A;  4CWT A;  1THN A;  4R3A A;  2EXL A;  1UYL A;  2XJX A;  4L8Z A;  3CGZ A;  1YS3 A;  3LPS A;  4LWI A;  1MX0 A;  1KIJ A;  3TTZ A;  2YKE A;  4XIQ A;  4LWH A;  4B7P A;  4JAV A;  5FNC A;  1TBW A;  2BRE A;  1UY8 A;  2GFD A;  2BU2 A;  4BIU A;  5GGZ A;  1NHJ A;  1QY8 A;  4BXI A;  3OMU A;  5J71 A;  5CPH A;  3B28 A;  4AWQ A;  2YEE A;  4QPK A;  3B24 A;  2HG1 A;  3QTF A;  2XJJ A;  3RLQ A;  2ZDX A;  5CTX A;  4ASG A;  3DGE A;  4L93 A;  4CWO A;  2WI3 A;  4EFU A;  2YI6 A;  3A0T A;  4AS9 A;  1ID0 A;  2BRC A;  2O1V A;  1TC0 A;  2YGA A;  4XIP A;  3T2S A;  4XCJ A;  3ZXQ A;  5C93 A;  5M4M A;  4WUD A;  4MB9 A;  1BXD A;  4BIZ A;  4HYP A;  4CE1 A;  3TZ2 A;  1UYK A;  4DZY A;  4FCP A;  2YKI A;  4EM7 A;  5FWK A;  3G75 A;  3EHF A;  4O0B A;  3D36 A;  1UYI A;  3SL2 A;  2ESA A;  3U67 A;  1Y4U A;  3T0H A;  2XCM A;  1JM6 A;  1ZXM A;  4H85 A;  1AH8 A;  3Q5J A;  3HYY A;  4GEE A;  2QG0 A;  4E00 A;  2ZKJ A;  1Z5C A;  4XC0 A;  3R4N A;  2IOQ A;  4FMT A;  2IWU A;  4U7N A;  1UYD A;  1UYC A;  4YKX A;  4CE2 A;  2C2A A;  1I5A A;  1H7S A;  3R92 A;  2YE8 A;  3EKO A;  2YGE A;  5D6P A;  4XIT A;  3TZ5 A;  4GT8 A;  4NH7 A;  1NHH A;  2FXS A;  3G7B A;  1EA6 A;  2BT0 A;  4ASF A;  1GJV A;  2XDX A;  2IOR A;  2WI4 A;  2VCJ A;  4NH8 A;  4X9L A;  3EHH A;  4KFG A;  2XHR A;  1I5C A;  3FV5 A;  4EMV A;  2XD6 A;  1UY9 A;  2YEC A;  1EI1 A;  2WI7 A;  4P8O A;  1I5B A;  3A0W A;  5CF0 A;  2YEG A;  3C11 A;  2O1U A;  2BYH A; 
#chains in the Genus database with same CATH topology
 4O05 A;  4MPE A;  1BYQ A;  4E02 A;  2QFO A;  2YE9 A;  2YJX A;  4CWP A;  3BM9 A;  1UYE A;  4URM A;  3VHC A;  2H55 A;  2AKP A;  2XX5 A;  3B25 A;  3ZKB A;  1TIL A;  2C1I A;  4LPB A;  4HY1 A;  3BMY A;  3O0I A;  2YE7 A;  3G7E A;  2HCH A;  4MBC A;  2XDU A;  4XTJ A;  4LWE A;  3Q5L A;  1YT0 A;  2QG2 A;  2CH4 A;  2YEF A;  5M4P A;  1U2O A;  3TUH A;  3LNU A;  4ASA A;  1ZW9 A;  3RLP A;  1B3Q A;  2ZBK B;  3VHD A;  5F5R A;  3VHA A;  2XX2 A;  4WUC A;  5D7R A;  1BGQ A;  4U7O A;  3GIF A;  2YKJ A;  3NMQ A;  4Q20 A;  3FT8 A;  1AJ6 A;  1BKN A;  4URL A;  2YI5 A;  3HEK A;  4BAE A;  2UWD A;  3D2R A;  2YEH A;  2BZ5 A;  2HKJ A;  1Z59 A;  3HYZ A;  4YKQ A;  1QZR A;  4LP0 A;  4JAU A;  4URO A;  1GKX A;  4MPN A;  3A0X A;  2YI7 A;  4KP4 A;  3INW A;  3C0E A;  4H81 A;  2BU8 A;  4HYM A;  2YEB A;  2QF6 A;  2YED A;  2XDL A;  2BYI A;  2Q2E B;  4XDM A;  5D7D A;  3HHU A;  4PL9 A;  2IWX A;  4JQL A;  1Y8N A;  4L91 A;  2Q8G A;  4KQV A;  2Q8H A;  4CWR A;  3A0Z A;  2K5B A;  4XKA A;  4EGK A;  2CCU A;  4GCZ A;  3S5T A;  1NHI A;  3MNR P;  1UYH A;  4K4O A;  2PNR A;  3EHG A;  4MP2 A;  4FCQ A;  4PRX A;  4MP7 A;  4V25 A;  2FWY A;  3R4O A;  4L90 A;  1AMW A;  3U2D A;  1YSZ A;  2CG9 A;  2YEA A;  5BOD A;  3H80 A;  2HHI A;  4LWG A;  4YKR A;  3EKR A;  5CTW A;  3K97 A;  1GKZ A;  3QDD A;  4ZVI A;  3R4M A;  2WI5 A;  4KSH A;  4U93 A;  4EFT A;  4DUH A;  1PVG A;  4MOT A;  3FT5 A;  4H7Q A;  1YT2 A;  5CTY A;  4XKK A;  5M4H A;  3CRL A;  5FND A;  4EEH A;  4GFN A;  2YE4 A;  3T10 A;  3U2K A;  2YEI A;  1Z5B A;  1AM1 A;  2BU7 A;  2XDK A;  4YKY A;  3TZ0 A;  3KE6 A;  1F51 A;  3T0Z A;  2JKI A;  4AWO A;  1ZWH A;  4NH9 A;  2WEQ A;  3B27 A;  3ZM7 A;  5IN9 A;  4MPC A;  5L3J A;  5F3K A;  2YK9 A;  2YKC A;  1YC1 A;  5M4K A;  1UYM A;  3OW6 A;  3LMM A;  5CTU A;  2IWS A;  2WEP A;  2VW5 A;  1L0O A;  2BU6 A;  2YK2 A;  4CWF A;  2FYP A;  2YE5 A;  3RKZ A;  5M4N A;  4YKW A;  1UYF A;  4KSG A;  1S14 A;  2YE2 A;  4EGI A;  4B6C A;  4URN A;  3R91 A;  2WER A;  4HZ5 A;  3VAD A;  3K99 A;  4GQT A;  3RLR A;  1YET A;  2XX4 A;  4XIR A;  1S16 A;  3GIG A;  1UYG A;  4XCL A;  3WQ9 A;  1I59 A;  3HZ5 A;  2O1W A;  4XD8 A;  4HY6 A;  4BQG A;  4ZKI A;  3CGY A;  3K98 A;  1MU5 A;  4XKO A;  1UY6 A;  3OWB A;  1Z5A A;  2XJG A;  3A0Y A;  2XHT A;  5BOC A;  4L94 A;  3TZ4 A;  4CWS A;  4R1F A;  4HZ0 A;  4ASB A;  4WUB A;  4LWF A;  3T1K A;  2CCT A;  4FCR A;  4P7A A;  4PU9 A;  1B62 A;  1B63 A;  3EHJ A;  3OPD A;  1KZN A;  3GIE A;  2YKB A;  1TID A;  2VCI A;  5IDM A;  4R3M A;  2ZDY A;  5D6Q A;  4PRV A;  1YT1 A;  2CGF A;  3PEH A;  3D0B A;  4E01 A;  2YGF A;  4W7T A;  2WI1 A;  4E72 A;  3CWV A;  2Q8F A;  2YE3 A;  5D7C A;  4HXZ A;  3K60 A;  2FWZ A;  2XAB A;  3HZ1 A;  2FTK A;  3CRK A;  2YE6 A;  5M4E A;  2GQP A;  2YI0 A;  4CE3 A;  1OSF A;  4V26 A;  3O6O A;  2BTZ A;  1Y8O A;  3ZXO A;  4O04 A;  2IOP A;  2VWC A;  4YKZ A;  1IXM A;  2BU5 A;  1TH8 A;  1US7 A;  1YC3 A;  4YKT A;  3ZKD A;  5J6A A;  2E0A A;  4YKU A;  4HXW A;  2XDS A;  2YEJ A;  2CCS A;  4CWN A;  1Y4S A;  1R62 A;  2XK2 A;  4XE2 A;  1AH6 A;  4O09 A;  1YSR A;  2C1G A;  2JJC A;  1ZXN A;  2XHX A;  3GIG B;  1QYE A;  1TC6 A;  1U0Z A;  2YJW A;  4O07 A;  3INX A;  5FNF A;  2Q8I A;  3JZ3 A;  2WI2 A;  3R4P A;  3OWD A;  4AWP A;  1A4H A;  3PEJ A;  4BQJ A;  4CWQ A;  1H7U A;  4GGL A;  3O2F A;  3B26 A;  4JAS A;  3IED A;  2H8M A;  1YC4 A;  5JEN A;  3WHA A;  1YES A;  3Q5K A;  4KTN A;  5IDJ A;  1YER A;  4I5S A;  3A0R A;  1UY7 A;  4EGH A;  2WI6 A;  3H4L A;  4FPP A;  1Y8P A;  4QPJ A;  1I58 A;  2BSM A;  1I5D A;  4I3H A;  4CWT A;  1THN A;  4R3A A;  2EXL A;  1UYL A;  2XJX A;  4L8Z A;  3CGZ A;  1YS3 A;  3LPS A;  4LWI A;  1MX0 A;  1KIJ A;  3TTZ A;  2YKE A;  4XIQ A;  4LWH A;  4B7P A;  4JAV A;  5FNC A;  1TBW A;  2BRE A;  1UY8 A;  2GFD A;  2BU2 A;  4BIU A;  5GGZ A;  1NHJ A;  1QY8 A;  4BXI A;  3OMU A;  5J71 A;  5CPH A;  3B28 A;  4AWQ A;  2YEE A;  4QPK A;  3B24 A;  2HG1 A;  3QTF A;  2XJJ A;  3RLQ A;  2ZDX A;  5CTX A;  4ASG A;  3DGE A;  4L93 A;  4CWO A;  2WI3 A;  4EFU A;  2YI6 A;  3A0T A;  4AS9 A;  1ID0 A;  2BRC A;  2O1V A;  1TC0 A;  2YGA A;  4XIP A;  3T2S A;  4XCJ A;  3ZXQ A;  5C93 A;  5M4M A;  4WUD A;  4MB9 A;  1BXD A;  4BIZ A;  4HYP A;  4CE1 A;  3TZ2 A;  1UYK A;  3CYG A;  4DZY A;  4FCP A;  2YKI A;  4EM7 A;  5FWK A;  3G75 A;  3EHF A;  4O0B A;  3D36 A;  1UYI A;  3SL2 A;  2ESA A;  3U67 A;  1Y4U A;  3T0H A;  2XCM A;  1JM6 A;  1ZXM A;  4H85 A;  1AH8 A;  3Q5J A;  3HYY A;  4GEE A;  2QG0 A;  4E00 A;  2ZKJ A;  1Z5C A;  4XC0 A;  3R4N A;  2IOQ A;  4FMT A;  2IWU A;  4U7N A;  1UYD A;  1UYC A;  4YKX A;  4CE2 A;  2C2A A;  1I5A A;  1H7S A;  3R92 A;  2YE8 A;  3EKO A;  2YGE A;  5D6P A;  4XIT A;  3TZ5 A;  4GT8 A;  4NH7 A;  1NHH A;  2FXS A;  3G7B A;  1EA6 A;  2BT0 A;  4ASF A;  1GJV A;  2XDX A;  2IOR A;  2WI4 A;  2VCJ A;  4NH8 A;  4X9L A;  3EHH A;  4KFG A;  2XHR A;  1I5C A;  3FV5 A;  4EMV A;  2XD6 A;  1UY9 A;  2YEC A;  1EI1 A;  2WI7 A;  4P8O A;  1I5B A;  3A0W A;  5CF0 A;  2YEG A;  3C11 A;  2O1U A;  2BYH A; 
#chains in the Genus database with same CATH homology
 4O05 A;  4MPE A;  1BYQ A;  4E02 A;  2QFO A;  2YE9 A;  2YJX A;  4CWP A;  3BM9 A;  1UYE A;  4URM A;  3VHC A;  2H55 A;  2AKP A;  2XX5 A;  3B25 A;  3ZKB A;  1TIL A;  4LPB A;  4HY1 A;  3BMY A;  3O0I A;  2YE7 A;  3G7E A;  2HCH A;  4MBC A;  2XDU A;  4XTJ A;  4LWE A;  3Q5L A;  1YT0 A;  2QG2 A;  2CH4 A;  2YEF A;  5M4P A;  1U2O A;  3TUH A;  3LNU A;  4ASA A;  1ZW9 A;  3RLP A;  1B3Q A;  2ZBK B;  3VHD A;  5F5R A;  3VHA A;  2XX2 A;  4WUC A;  5D7R A;  1BGQ A;  4U7O A;  3GIF A;  2YKJ A;  3NMQ A;  4Q20 A;  3FT8 A;  1AJ6 A;  1BKN A;  4URL A;  2YI5 A;  3HEK A;  4BAE A;  2UWD A;  3D2R A;  2YEH A;  2BZ5 A;  2HKJ A;  1Z59 A;  3HYZ A;  4YKQ A;  1QZR A;  4LP0 A;  4JAU A;  4URO A;  1GKX A;  4MPN A;  3A0X A;  2YI7 A;  4KP4 A;  3INW A;  3C0E A;  4H81 A;  2BU8 A;  4HYM A;  2YEB A;  2QF6 A;  2YED A;  2XDL A;  2BYI A;  2Q2E B;  4XDM A;  5D7D A;  3HHU A;  4PL9 A;  2IWX A;  4JQL A;  1Y8N A;  4L91 A;  2Q8G A;  4KQV A;  2Q8H A;  4CWR A;  3A0Z A;  2K5B A;  4XKA A;  4EGK A;  2CCU A;  4GCZ A;  1NHI A;  3MNR P;  1UYH A;  4K4O A;  2PNR A;  3EHG A;  4MP2 A;  4FCQ A;  4PRX A;  4MP7 A;  4V25 A;  2FWY A;  3R4O A;  4L90 A;  1AMW A;  3U2D A;  1YSZ A;  2CG9 A;  2YEA A;  5BOD A;  3H80 A;  4LWG A;  4YKR A;  3EKR A;  5CTW A;  3K97 A;  1GKZ A;  3QDD A;  4ZVI A;  3R4M A;  2WI5 A;  4KSH A;  4U93 A;  4EFT A;  4DUH A;  1PVG A;  4MOT A;  3FT5 A;  4H7Q A;  1YT2 A;  5CTY A;  4XKK A;  5M4H A;  3CRL A;  5FND A;  4EEH A;  4GFN A;  2YE4 A;  3T10 A;  3U2K A;  2YEI A;  1Z5B A;  1AM1 A;  2BU7 A;  2XDK A;  4YKY A;  3TZ0 A;  3KE6 A;  3T0Z A;  2JKI A;  4AWO A;  1ZWH A;  4NH9 A;  2WEQ A;  3B27 A;  3ZM7 A;  5IN9 A;  4MPC A;  5L3J A;  5F3K A;  2YK9 A;  2YKC A;  1YC1 A;  5M4K A;  1UYM A;  3OW6 A;  5CTU A;  2IWS A;  2WEP A;  2VW5 A;  1L0O A;  2BU6 A;  2YK2 A;  4CWF A;  2FYP A;  2YE5 A;  3RKZ A;  5M4N A;  4YKW A;  1UYF A;  4KSG A;  1S14 A;  2YE2 A;  4EGI A;  4B6C A;  4URN A;  3R91 A;  2WER A;  4HZ5 A;  3VAD A;  3K99 A;  4GQT A;  3RLR A;  1YET A;  2XX4 A;  4XIR A;  1S16 A;  3GIG A;  1UYG A;  4XCL A;  3WQ9 A;  1I59 A;  3HZ5 A;  2O1W A;  4XD8 A;  4HY6 A;  4BQG A;  4ZKI A;  3CGY A;  3K98 A;  1MU5 A;  4XKO A;  1UY6 A;  3OWB A;  1Z5A A;  2XJG A;  3A0Y A;  2XHT A;  5BOC A;  4L94 A;  3TZ4 A;  4CWS A;  4R1F A;  4HZ0 A;  4ASB A;  4WUB A;  4LWF A;  3T1K A;  2CCT A;  4FCR A;  4P7A A;  4PU9 A;  1B62 A;  1B63 A;  3EHJ A;  3OPD A;  1KZN A;  3GIE A;  2YKB A;  1TID A;  2VCI A;  5IDM A;  4R3M A;  2ZDY A;  5D6Q A;  4PRV A;  1YT1 A;  2CGF A;  3PEH A;  3D0B A;  4E01 A;  2YGF A;  4W7T A;  2WI1 A;  3CWV A;  2Q8F A;  2YE3 A;  5D7C A;  4HXZ A;  3K60 A;  2FWZ A;  2XAB A;  3HZ1 A;  3CRK A;  2YE6 A;  5M4E A;  2GQP A;  2YI0 A;  4CE3 A;  1OSF A;  4V26 A;  3O6O A;  2BTZ A;  1Y8O A;  3ZXO A;  4O04 A;  2IOP A;  2VWC A;  4YKZ A;  2BU5 A;  1TH8 A;  1US7 A;  1YC3 A;  4YKT A;  3ZKD A;  5J6A A;  2E0A A;  4YKU A;  4HXW A;  2XDS A;  2YEJ A;  2CCS A;  4CWN A;  1Y4S A;  1R62 A;  2XK2 A;  4XE2 A;  1AH6 A;  4O09 A;  1YSR A;  2JJC A;  1ZXN A;  2XHX A;  3GIG B;  1QYE A;  1TC6 A;  1U0Z A;  2YJW A;  4O07 A;  3INX A;  5FNF A;  2Q8I A;  3JZ3 A;  2WI2 A;  3R4P A;  3OWD A;  4AWP A;  1A4H A;  3PEJ A;  4BQJ A;  4CWQ A;  1H7U A;  4GGL A;  3O2F A;  3B26 A;  4JAS A;  3IED A;  2H8M A;  1YC4 A;  3WHA A;  1YES A;  3Q5K A;  4KTN A;  5IDJ A;  1YER A;  4I5S A;  3A0R A;  1UY7 A;  4EGH A;  2WI6 A;  3H4L A;  4FPP A;  1Y8P A;  4QPJ A;  1I58 A;  2BSM A;  1I5D A;  4I3H A;  4CWT A;  1THN A;  4R3A A;  2EXL A;  1UYL A;  2XJX A;  4L8Z A;  3CGZ A;  1YS3 A;  3LPS A;  4LWI A;  1MX0 A;  1KIJ A;  3TTZ A;  2YKE A;  4XIQ A;  4LWH A;  4B7P A;  4JAV A;  5FNC A;  1TBW A;  2BRE A;  1UY8 A;  2GFD A;  2BU2 A;  4BIU A;  5GGZ A;  1NHJ A;  1QY8 A;  4BXI A;  3OMU A;  5J71 A;  5CPH A;  3B28 A;  4AWQ A;  2YEE A;  4QPK A;  3B24 A;  2HG1 A;  3QTF A;  2XJJ A;  3RLQ A;  2ZDX A;  5CTX A;  4ASG A;  3DGE A;  4L93 A;  4CWO A;  2WI3 A;  4EFU A;  2YI6 A;  3A0T A;  4AS9 A;  1ID0 A;  2BRC A;  2O1V A;  1TC0 A;  2YGA A;  4XIP A;  3T2S A;  4XCJ A;  3ZXQ A;  5C93 A;  5M4M A;  4WUD A;  4MB9 A;  1BXD A;  4BIZ A;  4HYP A;  4CE1 A;  3TZ2 A;  1UYK A;  4DZY A;  4FCP A;  2YKI A;  4EM7 A;  5FWK A;  3G75 A;  3EHF A;  4O0B A;  3D36 A;  1UYI A;  3SL2 A;  2ESA A;  3U67 A;  1Y4U A;  3T0H A;  2XCM A;  1JM6 A;  1ZXM A;  4H85 A;  1AH8 A;  3Q5J A;  3HYY A;  4GEE A;  2QG0 A;  4E00 A;  2ZKJ A;  1Z5C A;  4XC0 A;  3R4N A;  2IOQ A;  4FMT A;  2IWU A;  4U7N A;  1UYD A;  1UYC A;  4YKX A;  4CE2 A;  2C2A A;  1I5A A;  1H7S A;  3R92 A;  2YE8 A;  3EKO A;  2YGE A;  5D6P A;  4XIT A;  3TZ5 A;  4GT8 A;  4NH7 A;  1NHH A;  2FXS A;  3G7B A;  1EA6 A;  2BT0 A;  4ASF A;  1GJV A;  2XDX A;  2IOR A;  2WI4 A;  2VCJ A;  4NH8 A;  4X9L A;  3EHH A;  4KFG A;  2XHR A;  1I5C A;  3FV5 A;  4EMV A;  2XD6 A;  1UY9 A;  2YEC A;  1EI1 A;  2WI7 A;  4P8O A;  1I5B A;  3A0W A;  5CF0 A;  2YEG A;  3C11 A;  2O1U A;  2BYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...