2HG1A

N-domain of grp94 in complex with the novel ligand n-(2-hydroxyl)ethyl carboxyamido adenosine
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
236
structure length
225
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQEQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-Domain Of Grp94 In Complex With the Novel Ligand N-(2-hydroxyl)ethyl Carboxyamido Adenosine
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 68
structure length 225
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2hg1A00
3RLPA 3JZ3A 5FWKA 4CWSA 4I3HA 3R4MA 1I5CA 4LWIA 1NHIA 3CGYA 3WHAA 3O2FA 4R1FA 4O0BA 1OSFA 3Q5LA 1GJVA 4CWFA 1BXDA 4EGHA 4HXZA 5CPHA 3HYZA 4KSGA 5D6PA 2XD6A 1YETA 3Q5KA 3FV5A 4MPEA 3GIEA 2IORA 5D7RA 2XX4A 3T0ZA 3MNRP 1Y8PA 4XCLA 2CH4A 3PEJA 1YERA 1YT2A 4FMTA 2YKEA 4HYPA 5FNFA 2ZDYA 4U7NA 3D36A 2FXSA 5J6AA 4YKYA 4WUCA 4AWQA 3HEKA 4PRXA 4YKTA 2Q8GA 2YEEA 4YKXA 5L3JA 2ZKJA 3VHDA 1TH8A 2BU8A 2WEQA 4LPBA 1R62A 2ESAA 3EKRA 4AWOA 4H81A 3RLRA 4MP7A 1GKXA 4HZ0A 4B6CA 5D6QA 1KZNA 2IWXA 1UYLA 4YKQA 2YEBA 1UYMA 1UYEA 1YSZA 2QG0A 3B26A 1S16A 3HYYA 3KE6A 4KP4A 3T10A 4AS9A 1Z59A 4XE2A 4FCQA 2IWUA 3WQ9A 1KIJA 3CGZA 1Y4SA 2YGEA 4LWGA 2JJCA 1B3QA 2YJXA 1TIDA 4LWHA 5F5RA 1QYEA 4XIPA 2YI0A 4JASA 5CF0A 2XDXA 2VW5A 2Q8IA 2WI2A 2H8MA 2BU2A 4QPKA 3D0BA 4E00A 3LNUA 1Z5AA 3FT5A 1ZXNA 4AWPA 4MPCA 2GFDA 4XKOA 4E01A 3PEHA 2FWYA 2VCJA 3B27A 3ZKBA 4V25A 4QPJA 1Y4UA 3R92A 2BU7A 4LWEA 2O1UA 1UYDA 4ZVIA 4EFUA 4BIUA 4U7OA 2YGFA 2XDKA 5IDJA 4ASFA 4EMVA 5BODA 1GKZA 2CGFA 2YE6A 4HY1A 4CE1A 4BQGA 3DGEA 4GEEA 4K4OA 1JM6A 5M4PA 4XC0A 2YEIA 1ZXMA 3K99A 4EFTA 1I5BA 4R3MA 2CCUA 3GIGB 3GIFA 1TC6A 2XDLA 4X9LA 1EA6A 2JKIA 1THNA 1I58A 1AJ6A 4LWFA 5D7CA 3EHGA 3OPDA 3HZ5A 2VCIA 1PVGA 4JAUA 4CWNA 2XX5A 4FCRA 4E02A 2BSMA 4PL9A 2YKCA 4CE2A 2ZBKB 3R4PA 4XCJA 2BZ5A 2WI4A 4EGIA 4GT8A 1Y8NA 2XJGA 4URLA 4CWRA 3G7BA 3A0RA 4WUDA 4NH7A 3ZKDA 1I5DA 5IDMA 3R4NA 3ZM7A 2YEHA 4GFNA 2YGAA 3EKOA 2BYHA 4P7AA 4GCZA 4PU9A 3GIGA 3RKZA 2BRCA 5M4HA 1EI1A 4CWQA 4JQLA 4L91A 1MU5A 4KQVA 3TZ4A 1ZWHA 3RLQA 4XIQA 1UY6A 1UY8A 3D2RA 3U2KA 1YC1A 4O05A 1BYQA 2WI3A 3Q5JA 4XKKA 5M4EA 5D7DA 2YE3A 2YE2A 2XDUA 2XX2A 5BOCA 5CTWA 1S14A 4HXWA 4W7TA 1I5AA 4NH8A 4MPNA 5M4MA 1U2OA 2VWCA 5C93A 3LPSA 4L8ZA 4YKWA 1B62A 1TBWA 2BU6A 3B24A 3K97A 4EM7A 1B63A 1I59A 1UYCA 2WI5A 4HYMA 3B28A 4DZYA 3K98A 1YSRA 4HZ5A 1TILA 2XHRA 4B7PA 2CCSA 3TUHA 4L93A 4ZKIA 3BMYA 2YK9A 2XABA 4O07A 1AMWA 5M4NA 3OMUA 2BREA 1YC4A 3EHFA 2FYPA 2IWSA 3B25A 4MP2A 3BM9A 4XKAA 1ZW9A 2XHXA 4ASBA 4L90A 1QY8A 4XD8A 4YKUA 4KFGA 3INWA 2YKIA 1Z5CA 5J71A 4GQTA 1BKNA 4V26A 4GGLA 3HHUA 1BGQA 3A0XA 5CTYA 1AM1A 2K5BA 3O0IA 1AH6A 2WERA 4BQJA 3SL2A 4DUHA 1NHHA 4YKZA 3T1KA 3NMQA 1AH8A 3EHJA 3HZ1A 4URMA 1TC0A 3OWDA 4URNA 3VHCA 2H55A 2O1VA 1Y8OA 3H4LA 2YE7A 1H7SA 1H7UA 5FNCA 1UYIA 4FPPA 4ASGA 1YS3A 2HG1A 2Q2EB 1YT0A 4O09A 3EHHA 2UWDA 2YK2A 3INXA 3U2DA 2WI1A 1U0ZA 2XHTA 2YEDA 4JAVA 3TZ5A 2PNRA 3A0TA 3K60A 2WI7A 3VHAA 2WEPA 1UY9A 2FWZA 3ZXOA 4YKRA 2E0AA 2YI7A 4XITA 3TTZA 3G75A 3C0EA 2ZDXA 4ASAA 3CWVA 2YEFA 2YECA 5FNDA 2YKJA 2YI5A 1UYFA 4BIZA 2GQPA 4XDMA 3ZXQA 4EGKA 4NH9A 4EEHA 2AKPA 3U67A 1UYHA 2HCHA 4XIRA 4H85A 1YT1A 4BXIA 4CWTA 3G7EA 1ID0A 1YESA 2YI6A 3CRLA 4KTNA 5GGZA 4CE3A 2YEAA 2CG9A 2Q8FA 4FCPA 4UROA 5F3KA 1QZRA 2Q8HA 1Z5BA 1YC3A 3VADA 3H80A 2BTZA 2O1WA 2EXLA 5M4KA 3C11A 4U93A 2IOQA 2XK2A 2YKBA 2QG2A 2WI6A 2QF6A 3T0HA 3O6OA 5CTUA 1US7A 3QDDA 4MB9A 4MBCA 3T2SA 4CWPA 5IN9A 3A0YA 2YEJA 3TZ0A 4L94A 2BU5A 3CRKA 2XJJA 2YJWA 4WUBA 3R91A 3QTFA 3IEDA 4Q20A 2XCMA 2QFOA 3TZ2A 2C2AA 2YE4A 4O04A 4CWOA 2IOPA 2XJXA 4P8OA 4LP0A 1UYGA 2BT0A 4H7QA 4KSHA 3OWBA 4I5SA 4MOTA 4BAEA 2YE8A 3R4OA 2HKJA 4XTJA 2YEGA 4PRVA 1UY7A 3A0ZA 2YE9A 2XDSA 3OW6A 2YE5A 5CTXA 1MX0A 3A0WA 4HY6A 1UYKA 2BYIA 4R3AA 3FT8A 1A4HA 1L0OA 2CCTA 1NHJA
chains in the Genus database with same CATH superfamily
3RLPA 3JZ3A 5FWKA 4CWSA 4I3HA 3R4MA 1I5CA 4LWIA 1NHIA 3CGYA 3WHAA 3O2FA 4R1FA 4O0BA 1OSFA 3Q5LA 1GJVA 4CWFA 1BXDA 4EGHA 4HXZA 5CPHA 3HYZA 4KSGA 5D6PA 2XD6A 1YETA 3Q5KA 3FV5A 4MPEA 3GIEA 2IORA 5D7RA 2XX4A 3T0ZA 3MNRP 1Y8PA 4XCLA 2CH4A 3PEJA 1YERA 1YT2A 4FMTA 2YKEA 4HYPA 5FNFA 2ZDYA 4U7NA 3D36A 2FXSA 5J6AA 4YKYA 4WUCA 4AWQA 3HEKA 4PRXA 4YKTA 2Q8GA 2YEEA 4YKXA 5L3JA 2ZKJA 3VHDA 1TH8A 2BU8A 2WEQA 4LPBA 1R62A 2ESAA 3EKRA 4AWOA 4H81A 3RLRA 4MP7A 1GKXA 4HZ0A 4B6CA 5D6QA 1KZNA 2IWXA 1UYLA 4YKQA 2YEBA 1UYMA 1UYEA 1YSZA 2QG0A 3B26A 1S16A 3HYYA 3KE6A 4KP4A 3T10A 4AS9A 1Z59A 4XE2A 4FCQA 2IWUA 3WQ9A 1KIJA 3CGZA 1Y4SA 3LMMA 2YGEA 4LWGA 2JJCA 1B3QA 2YJXA 1TIDA 4LWHA 5F5RA 1QYEA 4XIPA 2YI0A 4JASA 5CF0A 2XDXA 2VW5A 2Q8IA 2WI2A 2H8MA 2BU2A 4QPKA 3D0BA 4E00A 3LNUA 1Z5AA 3FT5A 1ZXNA 4AWPA 4MPCA 2GFDA 4XKOA 4E01A 3PEHA 2FWYA 2VCJA 3B27A 3ZKBA 4V25A 4QPJA 1F51A 1Y4UA 3R92A 2BU7A 4LWEA 2O1UA 1UYDA 4ZVIA 4EFUA 4BIUA 4U7OA 2YGFA 2XDKA 5IDJA 4ASFA 4EMVA 5BODA 1GKZA 2CGFA 2YE6A 4HY1A 4CE1A 4BQGA 3DGEA 4GEEA 4K4OA 1JM6A 5M4PA 4XC0A 2YEIA 1ZXMA 3K99A 4EFTA 1I5BA 4R3MA 4E72A 2CCUA 3GIGB 3GIFA 1TC6A 2XDLA 4X9LA 1EA6A 2JKIA 1THNA 1I58A 1AJ6A 4LWFA 5D7CA 3EHGA 3OPDA 3HZ5A 2VCIA 1PVGA 4JAUA 4CWNA 2XX5A 4FCRA 4E02A 2BSMA 4PL9A 2YKCA 4CE2A 2ZBKB 3R4PA 4XCJA 2BZ5A 2WI4A 4EGIA 4GT8A 1Y8NA 3S5TA 2XJGA 4URLA 4CWRA 3G7BA 3A0RA 4WUDA 4NH7A 3ZKDA 1I5DA 5IDMA 3R4NA 3ZM7A 2YEHA 4GFNA 2YGAA 3EKOA 2BYHA 4P7AA 4GCZA 4PU9A 3GIGA 3RKZA 2BRCA 5M4HA 1EI1A 4CWQA 4JQLA 4L91A 1MU5A 4KQVA 5JENA 3TZ4A 1ZWHA 3RLQA 4XIQA 1UY6A 1UY8A 3D2RA 3U2KA 1YC1A 4O05A 1BYQA 2WI3A 3Q5JA 4XKKA 5M4EA 5D7DA 2YE3A 2YE2A 2XDUA 2XX2A 5BOCA 5CTWA 1S14A 4HXWA 4W7TA 1I5AA 4NH8A 4MPNA 5M4MA 1U2OA 2VWCA 5C93A 3LPSA 4L8ZA 4YKWA 1B62A 1TBWA 2BU6A 3B24A 3K97A 4EM7A 1B63A 1I59A 1UYCA 2WI5A 4HYMA 3B28A 4DZYA 3K98A 1YSRA 4HZ5A 1TILA 2XHRA 4B7PA 2CCSA 3TUHA 4L93A 4ZKIA 3BMYA 2YK9A 2XABA 4O07A 1AMWA 5M4NA 3OMUA 2BREA 2C1GA 1YC4A 3EHFA 2FYPA 1IXMA 2IWSA 3B25A 3BM9A 4MP2A 4XKAA 1ZW9A 2XHXA 4ASBA 4L90A 1QY8A 4XD8A 4YKUA 4KFGA 3INWA 2YKIA 1Z5CA 5J71A 4GQTA 1BKNA 4V26A 4GGLA 3HHUA 1BGQA 3A0XA 5CTYA 1AM1A 2K5BA 3O0IA 1AH6A 2WERA 4BQJA 2FTKA 3SL2A 4DUHA 1NHHA 4YKZA 3T1KA 3NMQA 1AH8A 3EHJA 3HZ1A 4URMA 1TC0A 3OWDA 4URNA 3VHCA 2H55A 2O1VA 1Y8OA 3H4LA 2YE7A 1H7SA 1H7UA 5FNCA 1UYIA 4FPPA 4ASGA 1YS3A 2HG1A 2Q2EB 1YT0A 4O09A 3EHHA 2UWDA 2YK2A 3INXA 3U2DA 2WI1A 1U0ZA 2XHTA 2YEDA 4JAVA 3TZ5A 2PNRA 3A0TA 3K60A 2WI7A 3VHAA 2WEPA 1UY9A 2FWZA 3ZXOA 4YKRA 2E0AA 2YI7A 4XITA 3TTZA 3G75A 3C0EA 2ZDXA 4ASAA 3CWVA 2YEFA 2YECA 5FNDA 2YKJA 2YI5A 1UYFA 4BIZA 2GQPA 4XDMA 3ZXQA 4EGKA 4NH9A 4EEHA 2AKPA 3U67A 1UYHA 2HCHA 4XIRA 4H85A 1YT1A 4BXIA 4CWTA 3G7EA 1ID0A 1YESA 2YI6A 3CRLA 4KTNA 5GGZA 4CE3A 2YEAA 2CG9A 2Q8FA 4FCPA 4UROA 2C1IA 5F3KA 1QZRA 2Q8HA 1Z5BA 1YC3A 3VADA 3H80A 2BTZA 2O1WA 2EXLA 5M4KA 3C11A 4U93A 2IOQA 2XK2A 3CYGA 2YKBA 2QG2A 2WI6A 2QF6A 3T0HA 3O6OA 5CTUA 1US7A 3QDDA 4MB9A 4MBCA 3T2SA 4CWPA 5IN9A 3A0YA 2YEJA 3TZ0A 4L94A 2BU5A 3CRKA 2XJJA 2YJWA 4WUBA 3R91A 3QTFA 3IEDA 4Q20A 2XCMA 2QFOA 3TZ2A 2C2AA 2YE4A 4O04A 4CWOA 2IOPA 2XJXA 4P8OA 4LP0A 1UYGA 2BT0A 4H7QA 4KSHA 3OWBA 4I5SA 4MOTA 4BAEA 2YE8A 2HHIA 3R4OA 2HKJA 4XTJA 2YEGA 4PRVA 1UY7A 3A0ZA 2YE9A 2XDSA 3OW6A 2YE5A 5CTXA 1MX0A 3A0WA 4HY6A 1UYKA 2BYIA 4R3AA 3FT8A 1A4HA 1L0OA 2CCTA 1NHJA
chains in the Genus database with same CATH topology
3RLPA 3JZ3A 5FWKA 4CWSA 4I3HA 3R4MA 1I5CA 4LWIA 1NHIA 3CGYA 3WHAA 3O2FA 4R1FA 4O0BA 1OSFA 3Q5LA 1GJVA 4CWFA 1BXDA 4EGHA 4HXZA 5CPHA 3HYZA 4KSGA 5D6PA 2XD6A 1YETA 3Q5KA 3FV5A 4MPEA 3GIEA 2IORA 5D7RA 2XX4A 3T0ZA 3MNRP 1Y8PA 4XCLA 2CH4A 3PEJA 1YERA 1YT2A 4FMTA 2YKEA 4HYPA 5FNFA 2ZDYA 4U7NA 3D36A 2FXSA 5J6AA 4YKYA 4WUCA 4AWQA 3HEKA 4PRXA 4YKTA 2Q8GA 2YEEA 4YKXA 5L3JA 2ZKJA 3VHDA 1TH8A 2BU8A 2WEQA 4LPBA 1R62A 2ESAA 3EKRA 4AWOA 4H81A 3RLRA 4MP7A 1GKXA 4HZ0A 4B6CA 5D6QA 1KZNA 2IWXA 1UYLA 4YKQA 2YEBA 1UYMA 1UYEA 1YSZA 2QG0A 3B26A 1S16A 3HYYA 3KE6A 4KP4A 3T10A 4AS9A 1Z59A 4XE2A 4FCQA 2IWUA 3WQ9A 1KIJA 3CGZA 1Y4SA 2YGEA 4LWGA 2JJCA 1B3QA 2YJXA 1TIDA 4LWHA 5F5RA 1QYEA 4XIPA 2YI0A 4JASA 5CF0A 2XDXA 2VW5A 2Q8IA 2WI2A 2H8MA 2BU2A 4QPKA 3D0BA 4E00A 3LNUA 1Z5AA 3FT5A 1ZXNA 4AWPA 4MPCA 2GFDA 4XKOA 4E01A 3PEHA 2FWYA 2VCJA 3B27A 3ZKBA 4V25A 4QPJA 1Y4UA 3R92A 2BU7A 4LWEA 2O1UA 1UYDA 4ZVIA 4EFUA 4BIUA 4U7OA 2YGFA 2XDKA 5IDJA 4ASFA 4EMVA 5BODA 1GKZA 2CGFA 2YE6A 4HY1A 4CE1A 4BQGA 3DGEA 4GEEA 4K4OA 1JM6A 5M4PA 4XC0A 2YEIA 1ZXMA 3K99A 4EFTA 1I5BA 4R3MA 2CCUA 3GIGB 3GIFA 1TC6A 2XDLA 4X9LA 1EA6A 2JKIA 1THNA 1I58A 1AJ6A 4LWFA 5D7CA 3EHGA 3OPDA 3HZ5A 2VCIA 1PVGA 4JAUA 4CWNA 2XX5A 4FCRA 4E02A 2BSMA 4PL9A 2YKCA 4CE2A 2ZBKB 3R4PA 4XCJA 2BZ5A 2WI4A 4EGIA 4GT8A 1Y8NA 2XJGA 4URLA 4CWRA 3G7BA 3A0RA 4WUDA 4NH7A 3ZKDA 1I5DA 5IDMA 3R4NA 3ZM7A 2YEHA 4GFNA 2YGAA 3EKOA 2BYHA 4P7AA 4GCZA 4PU9A 3GIGA 3RKZA 2BRCA 5M4HA 1EI1A 4CWQA 4JQLA 4L91A 1MU5A 4KQVA 3TZ4A 1ZWHA 3RLQA 4XIQA 1UY6A 1UY8A 3D2RA 3U2KA 1YC1A 4O05A 1BYQA 2WI3A 3Q5JA 4XKKA 5M4EA 5D7DA 2YE3A 2YE2A 2XDUA 2XX2A 5BOCA 5CTWA 1S14A 4HXWA 4W7TA 1I5AA 4NH8A 4MPNA 5M4MA 1U2OA 2VWCA 5C93A 3LPSA 4L8ZA 4YKWA 1B62A 1TBWA 2BU6A 3B24A 3K97A 4EM7A 1B63A 1I59A 1UYCA 2WI5A 4HYMA 3B28A 4DZYA 3K98A 1YSRA 4HZ5A 1TILA 2XHRA 4B7PA 2CCSA 3TUHA 4L93A 4ZKIA 3BMYA 2YK9A 2XABA 4O07A 1AMWA 5M4NA 3OMUA 2BREA 1YC4A 3EHFA 2FYPA 2IWSA 3B25A 4MP2A 3BM9A 4XKAA 1ZW9A 2XHXA 4ASBA 4L90A 1QY8A 4XD8A 4YKUA 4KFGA 3INWA 2YKIA 1Z5CA 5J71A 4GQTA 1BKNA 4V26A 4GGLA 3HHUA 1BGQA 3A0XA 5CTYA 1AM1A 2K5BA 3O0IA 1AH6A 2WERA 4BQJA 3SL2A 4DUHA 1NHHA 4YKZA 3T1KA 3NMQA 1AH8A 3EHJA 3HZ1A 4URMA 1TC0A 3OWDA 4URNA 3VHCA 2H55A 2O1VA 1Y8OA 3H4LA 2YE7A 1H7SA 1H7UA 5FNCA 1UYIA 4FPPA 4ASGA 1YS3A 2HG1A 2Q2EB 1YT0A 4O09A 3EHHA 2UWDA 2YK2A 3INXA 3U2DA 2WI1A 1U0ZA 2XHTA 2YEDA 4JAVA 3TZ5A 2PNRA 3A0TA 3K60A 2WI7A 3VHAA 2WEPA 1UY9A 2FWZA 3ZXOA 4YKRA 2E0AA 2YI7A 4XITA 3TTZA 3G75A 3C0EA 2ZDXA 4ASAA 3CWVA 2YEFA 2YECA 5FNDA 2YKJA 2YI5A 1UYFA 4BIZA 2GQPA 4XDMA 3ZXQA 4EGKA 4NH9A 4EEHA 2AKPA 3U67A 1UYHA 2HCHA 4XIRA 4H85A 1YT1A 4BXIA 4CWTA 3G7EA 1ID0A 1YESA 2YI6A 3CRLA 4KTNA 5GGZA 4CE3A 2YEAA 2CG9A 2Q8FA 4FCPA 4UROA 5F3KA 1QZRA 2Q8HA 1Z5BA 1YC3A 3VADA 3H80A 2BTZA 2O1WA 2EXLA 5M4KA 3C11A 4U93A 2IOQA 2XK2A 2YKBA 2QG2A 2WI6A 2QF6A 3T0HA 3O6OA 5CTUA 1US7A 3QDDA 4MB9A 4MBCA 3T2SA 4CWPA 5IN9A 3A0YA 2YEJA 3TZ0A 4L94A 2BU5A 3CRKA 2XJJA 2YJWA 4WUBA 3R91A 3QTFA 3IEDA 4Q20A 2XCMA 2QFOA 3TZ2A 2C2AA 2YE4A 4O04A 4CWOA 2IOPA 2XJXA 4P8OA 4LP0A 1UYGA 2BT0A 4H7QA 4KSHA 3OWBA 4I5SA 4MOTA 4BAEA 2YE8A 3R4OA 2HKJA 4XTJA 2YEGA 4PRVA 1UY7A 3A0ZA 2YE9A 2XDSA 3OW6A 2YE5A 5CTXA 1MX0A 3A0WA 4HY6A 1UYKA 2BYIA 4R3AA 3FT8A 1A4HA 1L0OA 2CCTA 1NHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLP A;  3JZ3 A;  5FWK A;  4CWS A;  4I3H A;  3R4M A;  1I5C A;  4LWI A;  1NHI A;  3CGY A;  3WHA A;  3O2F A;  4R1F A;  4O0B A;  1OSF A;  3Q5L A;  1GJV A;  4CWF A;  1BXD A;  4EGH A;  4HXZ A;  5CPH A;  3HYZ A;  4KSG A;  5D6P A;  2XD6 A;  1YET A;  3Q5K A;  3FV5 A;  4MPE A;  3GIE A;  2IOR A;  5D7R A;  2XX4 A;  3T0Z A;  3MNR P;  1Y8P A;  4XCL A;  2CH4 A;  3PEJ A;  1YER A;  1YT2 A;  4FMT A;  2YKE A;  4HYP A;  5FNF A;  2ZDY A;  4U7N A;  3D36 A;  2FXS A;  5J6A A;  4YKY A;  4WUC A;  4AWQ A;  3HEK A;  4PRX A;  4YKT A;  2Q8G A;  2YEE A;  4YKX A;  5L3J A;  2ZKJ A;  3VHD A;  1TH8 A;  2BU8 A;  2WEQ A;  4LPB A;  1R62 A;  2ESA A;  3EKR A;  4AWO A;  4H81 A;  3RLR A;  4MP7 A;  1GKX A;  4HZ0 A;  4B6C A;  5D6Q A;  1KZN A;  2IWX A;  1UYL A;  4YKQ A;  2YEB A;  1UYM A;  1UYE A;  1YSZ A;  2QG0 A;  3B26 A;  1S16 A;  3HYY A;  3KE6 A;  4KP4 A;  3T10 A;  4AS9 A;  1Z59 A;  4XE2 A;  4FCQ A;  2IWU A;  3WQ9 A;  1KIJ A;  3CGZ A;  1Y4S A;  2YGE A;  4LWG A;  2JJC A;  1B3Q A;  2YJX A;  1TID A;  4LWH A;  5F5R A;  1QYE A;  4XIP A;  2YI0 A;  4JAS A;  5CF0 A;  2XDX A;  2VW5 A;  2Q8I A;  2WI2 A;  2H8M A;  2BU2 A;  4QPK A;  3D0B A;  4E00 A;  3LNU A;  1Z5A A;  3FT5 A;  1ZXN A;  4AWP A;  4MPC A;  2GFD A;  4XKO A;  4E01 A;  3PEH A;  2FWY A;  2VCJ A;  3B27 A;  3ZKB A;  4V25 A;  4QPJ A;  1Y4U A;  3R92 A;  2BU7 A;  4LWE A;  2O1U A;  1UYD A;  4ZVI A;  4EFU A;  4BIU A;  4U7O A;  2YGF A;  2XDK A;  5IDJ A;  4ASF A;  4EMV A;  5BOD A;  1GKZ A;  2CGF A;  2YE6 A;  4HY1 A;  4CE1 A;  4BQG A;  3DGE A;  4GEE A;  4K4O A;  1JM6 A;  5M4P A;  4XC0 A;  2YEI A;  1ZXM A;  3K99 A;  4EFT A;  1I5B A;  4R3M A;  2CCU A;  3GIG B;  3GIF A;  1TC6 A;  2XDL A;  4X9L A;  1EA6 A;  2JKI A;  1THN A;  1I58 A;  1AJ6 A;  4LWF A;  5D7C A;  3EHG A;  3OPD A;  3HZ5 A;  2VCI A;  1PVG A;  4JAU A;  4CWN A;  2XX5 A;  4FCR A;  4E02 A;  2BSM A;  4PL9 A;  2YKC A;  4CE2 A;  2ZBK B;  3R4P A;  4XCJ A;  2BZ5 A;  2WI4 A;  4EGI A;  4GT8 A;  1Y8N A;  2XJG A;  4URL A;  4CWR A;  3G7B A;  3A0R A;  4WUD A;  4NH7 A;  3ZKD A;  1I5D A;  5IDM A;  3R4N A;  3ZM7 A;  2YEH A;  4GFN A;  2YGA A;  3EKO A;  2BYH A;  4P7A A;  4GCZ A;  4PU9 A;  3GIG A;  3RKZ A;  2BRC A;  5M4H A;  1EI1 A;  4CWQ A;  4JQL A;  4L91 A;  1MU5 A;  4KQV A;  3TZ4 A;  1ZWH A;  3RLQ A;  4XIQ A;  1UY6 A;  1UY8 A;  3D2R A;  3U2K A;  1YC1 A;  4O05 A;  1BYQ A;  2WI3 A;  3Q5J A;  4XKK A;  5M4E A;  5D7D A;  2YE3 A;  2YE2 A;  2XDU A;  2XX2 A;  5BOC A;  5CTW A;  1S14 A;  4HXW A;  4W7T A;  1I5A A;  4NH8 A;  4MPN A;  5M4M A;  1U2O A;  2VWC A;  5C93 A;  3LPS A;  4L8Z A;  4YKW A;  1B62 A;  1TBW A;  2BU6 A;  3B24 A;  3K97 A;  4EM7 A;  1B63 A;  1I59 A;  1UYC A;  2WI5 A;  4HYM A;  3B28 A;  4DZY A;  3K98 A;  1YSR A;  4HZ5 A;  1TIL A;  2XHR A;  4B7P A;  2CCS A;  3TUH A;  4L93 A;  4ZKI A;  3BMY A;  2YK9 A;  2XAB A;  4O07 A;  1AMW A;  5M4N A;  3OMU A;  2BRE A;  1YC4 A;  3EHF A;  2FYP A;  2IWS A;  3B25 A;  4MP2 A;  3BM9 A;  4XKA A;  1ZW9 A;  2XHX A;  4ASB A;  4L90 A;  1QY8 A;  4XD8 A;  4YKU A;  4KFG A;  3INW A;  2YKI A;  1Z5C A;  5J71 A;  4GQT A;  1BKN A;  4V26 A;  4GGL A;  3HHU A;  1BGQ A;  3A0X A;  5CTY A;  1AM1 A;  2K5B A;  3O0I A;  1AH6 A;  2WER A;  4BQJ A;  3SL2 A;  4DUH A;  1NHH A;  4YKZ A;  3T1K A;  3NMQ A;  1AH8 A;  3EHJ A;  3HZ1 A;  4URM A;  1TC0 A;  3OWD A;  4URN A;  3VHC A;  2H55 A;  2O1V A;  1Y8O A;  3H4L A;  2YE7 A;  1H7S A;  1H7U A;  5FNC A;  1UYI A;  4FPP A;  4ASG A;  1YS3 A;  2HG1 A;  2Q2E B;  1YT0 A;  4O09 A;  3EHH A;  2UWD A;  2YK2 A;  3INX A;  3U2D A;  2WI1 A;  1U0Z A;  2XHT A;  2YED A;  4JAV A;  3TZ5 A;  2PNR A;  3A0T A;  3K60 A;  2WI7 A;  3VHA A;  2WEP A;  1UY9 A;  2FWZ A;  3ZXO A;  4YKR A;  2E0A A;  2YI7 A;  4XIT A;  3TTZ A;  3G75 A;  3C0E A;  2ZDX A;  4ASA A;  3CWV A;  2YEF A;  2YEC A;  5FND A;  2YKJ A;  2YI5 A;  1UYF A;  4BIZ A;  2GQP A;  4XDM A;  3ZXQ A;  4EGK A;  4NH9 A;  4EEH A;  2AKP A;  3U67 A;  1UYH A;  2HCH A;  4XIR A;  4H85 A;  1YT1 A;  4BXI A;  4CWT A;  3G7E A;  1ID0 A;  1YES A;  2YI6 A;  3CRL A;  4KTN A;  5GGZ A;  4CE3 A;  2YEA A;  2CG9 A;  2Q8F A;  4FCP A;  4URO A;  5F3K A;  1QZR A;  2Q8H A;  1Z5B A;  1YC3 A;  3VAD A;  3H80 A;  2BTZ A;  2O1W A;  2EXL A;  5M4K A;  3C11 A;  4U93 A;  2IOQ A;  2XK2 A;  2YKB A;  2QG2 A;  2WI6 A;  2QF6 A;  3T0H A;  3O6O A;  5CTU A;  1US7 A;  3QDD A;  4MB9 A;  4MBC A;  3T2S A;  4CWP A;  5IN9 A;  3A0Y A;  2YEJ A;  3TZ0 A;  4L94 A;  2BU5 A;  3CRK A;  2XJJ A;  2YJW A;  4WUB A;  3R91 A;  3QTF A;  3IED A;  4Q20 A;  2XCM A;  2QFO A;  3TZ2 A;  2C2A A;  2YE4 A;  4O04 A;  4CWO A;  2IOP A;  2XJX A;  4P8O A;  4LP0 A;  1UYG A;  2BT0 A;  4H7Q A;  4KSH A;  3OWB A;  4I5S A;  4MOT A;  4BAE A;  2YE8 A;  3R4O A;  2HKJ A;  4XTJ A;  2YEG A;  4PRV A;  1UY7 A;  3A0Z A;  2YE9 A;  2XDS A;  3OW6 A;  2YE5 A;  5CTX A;  1MX0 A;  3A0W A;  4HY6 A;  1UYK A;  2BYI A;  4R3A A;  3FT8 A;  1A4H A;  1L0O A;  2CCT A;  1NHJ A; 
#chains in the Genus database with same CATH topology
 3RLP A;  3JZ3 A;  5FWK A;  4CWS A;  4I3H A;  3R4M A;  1I5C A;  4LWI A;  1NHI A;  3CGY A;  3WHA A;  3O2F A;  4R1F A;  4O0B A;  1OSF A;  3Q5L A;  1GJV A;  4CWF A;  1BXD A;  4EGH A;  4HXZ A;  5CPH A;  3HYZ A;  4KSG A;  5D6P A;  2XD6 A;  1YET A;  3Q5K A;  3FV5 A;  4MPE A;  3GIE A;  2IOR A;  5D7R A;  2XX4 A;  3T0Z A;  3MNR P;  1Y8P A;  4XCL A;  2CH4 A;  3PEJ A;  1YER A;  1YT2 A;  4FMT A;  2YKE A;  4HYP A;  5FNF A;  2ZDY A;  4U7N A;  3D36 A;  2FXS A;  5J6A A;  4YKY A;  4WUC A;  4AWQ A;  3HEK A;  4PRX A;  4YKT A;  2Q8G A;  2YEE A;  4YKX A;  5L3J A;  2ZKJ A;  3VHD A;  1TH8 A;  2BU8 A;  2WEQ A;  4LPB A;  1R62 A;  2ESA A;  3EKR A;  4AWO A;  4H81 A;  3RLR A;  4MP7 A;  1GKX A;  4HZ0 A;  4B6C A;  5D6Q A;  1KZN A;  2IWX A;  1UYL A;  4YKQ A;  2YEB A;  1UYM A;  1UYE A;  1YSZ A;  2QG0 A;  3B26 A;  1S16 A;  3HYY A;  3KE6 A;  4KP4 A;  3T10 A;  4AS9 A;  1Z59 A;  4XE2 A;  4FCQ A;  2IWU A;  3WQ9 A;  1KIJ A;  3CGZ A;  1Y4S A;  3LMM A;  2YGE A;  4LWG A;  2JJC A;  1B3Q A;  2YJX A;  1TID A;  4LWH A;  5F5R A;  1QYE A;  4XIP A;  2YI0 A;  4JAS A;  5CF0 A;  2XDX A;  2VW5 A;  2Q8I A;  2WI2 A;  2H8M A;  2BU2 A;  4QPK A;  3D0B A;  4E00 A;  3LNU A;  1Z5A A;  3FT5 A;  1ZXN A;  4AWP A;  4MPC A;  2GFD A;  4XKO A;  4E01 A;  3PEH A;  2FWY A;  2VCJ A;  3B27 A;  3ZKB A;  4V25 A;  4QPJ A;  1F51 A;  1Y4U A;  3R92 A;  2BU7 A;  4LWE A;  2O1U A;  1UYD A;  4ZVI A;  4EFU A;  4BIU A;  4U7O A;  2YGF A;  2XDK A;  5IDJ A;  4ASF A;  4EMV A;  5BOD A;  1GKZ A;  2CGF A;  2YE6 A;  4HY1 A;  4CE1 A;  4BQG A;  3DGE A;  4GEE A;  4K4O A;  1JM6 A;  5M4P A;  4XC0 A;  2YEI A;  1ZXM A;  3K99 A;  4EFT A;  1I5B A;  4R3M A;  4E72 A;  2CCU A;  3GIG B;  3GIF A;  1TC6 A;  2XDL A;  4X9L A;  1EA6 A;  2JKI A;  1THN A;  1I58 A;  1AJ6 A;  4LWF A;  5D7C A;  3EHG A;  3OPD A;  3HZ5 A;  2VCI A;  1PVG A;  4JAU A;  4CWN A;  2XX5 A;  4FCR A;  4E02 A;  2BSM A;  4PL9 A;  2YKC A;  4CE2 A;  2ZBK B;  3R4P A;  4XCJ A;  2BZ5 A;  2WI4 A;  4EGI A;  4GT8 A;  1Y8N A;  3S5T A;  2XJG A;  4URL A;  4CWR A;  3G7B A;  3A0R A;  4WUD A;  4NH7 A;  3ZKD A;  1I5D A;  5IDM A;  3R4N A;  3ZM7 A;  2YEH A;  4GFN A;  2YGA A;  3EKO A;  2BYH A;  4P7A A;  4GCZ A;  4PU9 A;  3GIG A;  3RKZ A;  2BRC A;  5M4H A;  1EI1 A;  4CWQ A;  4JQL A;  4L91 A;  1MU5 A;  4KQV A;  5JEN A;  3TZ4 A;  1ZWH A;  3RLQ A;  4XIQ A;  1UY6 A;  1UY8 A;  3D2R A;  3U2K A;  1YC1 A;  4O05 A;  1BYQ A;  2WI3 A;  3Q5J A;  4XKK A;  5M4E A;  5D7D A;  2YE3 A;  2YE2 A;  2XDU A;  2XX2 A;  5BOC A;  5CTW A;  1S14 A;  4HXW A;  4W7T A;  1I5A A;  4NH8 A;  4MPN A;  5M4M A;  1U2O A;  2VWC A;  5C93 A;  3LPS A;  4L8Z A;  4YKW A;  1B62 A;  1TBW A;  2BU6 A;  3B24 A;  3K97 A;  4EM7 A;  1B63 A;  1I59 A;  1UYC A;  2WI5 A;  4HYM A;  3B28 A;  4DZY A;  3K98 A;  1YSR A;  4HZ5 A;  1TIL A;  2XHR A;  4B7P A;  2CCS A;  3TUH A;  4L93 A;  4ZKI A;  3BMY A;  2YK9 A;  2XAB A;  4O07 A;  1AMW A;  5M4N A;  3OMU A;  2BRE A;  2C1G A;  1YC4 A;  3EHF A;  2FYP A;  1IXM A;  2IWS A;  3B25 A;  3BM9 A;  4MP2 A;  4XKA A;  1ZW9 A;  2XHX A;  4ASB A;  4L90 A;  1QY8 A;  4XD8 A;  4YKU A;  4KFG A;  3INW A;  2YKI A;  1Z5C A;  5J71 A;  4GQT A;  1BKN A;  4V26 A;  4GGL A;  3HHU A;  1BGQ A;  3A0X A;  5CTY A;  1AM1 A;  2K5B A;  3O0I A;  1AH6 A;  2WER A;  4BQJ A;  2FTK A;  3SL2 A;  4DUH A;  1NHH A;  4YKZ A;  3T1K A;  3NMQ A;  1AH8 A;  3EHJ A;  3HZ1 A;  4URM A;  1TC0 A;  3OWD A;  4URN A;  3VHC A;  2H55 A;  2O1V A;  1Y8O A;  3H4L A;  2YE7 A;  1H7S A;  1H7U A;  5FNC A;  1UYI A;  4FPP A;  4ASG A;  1YS3 A;  2HG1 A;  2Q2E B;  1YT0 A;  4O09 A;  3EHH A;  2UWD A;  2YK2 A;  3INX A;  3U2D A;  2WI1 A;  1U0Z A;  2XHT A;  2YED A;  4JAV A;  3TZ5 A;  2PNR A;  3A0T A;  3K60 A;  2WI7 A;  3VHA A;  2WEP A;  1UY9 A;  2FWZ A;  3ZXO A;  4YKR A;  2E0A A;  2YI7 A;  4XIT A;  3TTZ A;  3G75 A;  3C0E A;  2ZDX A;  4ASA A;  3CWV A;  2YEF A;  2YEC A;  5FND A;  2YKJ A;  2YI5 A;  1UYF A;  4BIZ A;  2GQP A;  4XDM A;  3ZXQ A;  4EGK A;  4NH9 A;  4EEH A;  2AKP A;  3U67 A;  1UYH A;  2HCH A;  4XIR A;  4H85 A;  1YT1 A;  4BXI A;  4CWT A;  3G7E A;  1ID0 A;  1YES A;  2YI6 A;  3CRL A;  4KTN A;  5GGZ A;  4CE3 A;  2YEA A;  2CG9 A;  2Q8F A;  4FCP A;  4URO A;  2C1I A;  5F3K A;  1QZR A;  2Q8H A;  1Z5B A;  1YC3 A;  3VAD A;  3H80 A;  2BTZ A;  2O1W A;  2EXL A;  5M4K A;  3C11 A;  4U93 A;  2IOQ A;  2XK2 A;  3CYG A;  2YKB A;  2QG2 A;  2WI6 A;  2QF6 A;  3T0H A;  3O6O A;  5CTU A;  1US7 A;  3QDD A;  4MB9 A;  4MBC A;  3T2S A;  4CWP A;  5IN9 A;  3A0Y A;  2YEJ A;  3TZ0 A;  4L94 A;  2BU5 A;  3CRK A;  2XJJ A;  2YJW A;  4WUB A;  3R91 A;  3QTF A;  3IED A;  4Q20 A;  2XCM A;  2QFO A;  3TZ2 A;  2C2A A;  2YE4 A;  4O04 A;  4CWO A;  2IOP A;  2XJX A;  4P8O A;  4LP0 A;  1UYG A;  2BT0 A;  4H7Q A;  4KSH A;  3OWB A;  4I5S A;  4MOT A;  4BAE A;  2YE8 A;  2HHI A;  3R4O A;  2HKJ A;  4XTJ A;  2YEG A;  4PRV A;  1UY7 A;  3A0Z A;  2YE9 A;  2XDS A;  3OW6 A;  2YE5 A;  5CTX A;  1MX0 A;  3A0W A;  4HY6 A;  1UYK A;  2BYI A;  4R3A A;  3FT8 A;  1A4H A;  1L0O A;  2CCT A;  1NHJ A; 
#chains in the Genus database with same CATH homology
 3RLP A;  3JZ3 A;  5FWK A;  4CWS A;  4I3H A;  3R4M A;  1I5C A;  4LWI A;  1NHI A;  3CGY A;  3WHA A;  3O2F A;  4R1F A;  4O0B A;  1OSF A;  3Q5L A;  1GJV A;  4CWF A;  1BXD A;  4EGH A;  4HXZ A;  5CPH A;  3HYZ A;  4KSG A;  5D6P A;  2XD6 A;  1YET A;  3Q5K A;  3FV5 A;  4MPE A;  3GIE A;  2IOR A;  5D7R A;  2XX4 A;  3T0Z A;  3MNR P;  1Y8P A;  4XCL A;  2CH4 A;  3PEJ A;  1YER A;  1YT2 A;  4FMT A;  2YKE A;  4HYP A;  5FNF A;  2ZDY A;  4U7N A;  3D36 A;  2FXS A;  5J6A A;  4YKY A;  4WUC A;  4AWQ A;  3HEK A;  4PRX A;  4YKT A;  2Q8G A;  2YEE A;  4YKX A;  5L3J A;  2ZKJ A;  3VHD A;  1TH8 A;  2BU8 A;  2WEQ A;  4LPB A;  1R62 A;  2ESA A;  3EKR A;  4AWO A;  4H81 A;  3RLR A;  4MP7 A;  1GKX A;  4HZ0 A;  4B6C A;  5D6Q A;  1KZN A;  2IWX A;  1UYL A;  4YKQ A;  2YEB A;  1UYM A;  1UYE A;  1YSZ A;  2QG0 A;  3B26 A;  1S16 A;  3HYY A;  3KE6 A;  4KP4 A;  3T10 A;  4AS9 A;  1Z59 A;  4XE2 A;  4FCQ A;  2IWU A;  3WQ9 A;  1KIJ A;  3CGZ A;  1Y4S A;  2YGE A;  4LWG A;  2JJC A;  1B3Q A;  2YJX A;  1TID A;  4LWH A;  5F5R A;  1QYE A;  4XIP A;  2YI0 A;  4JAS A;  5CF0 A;  2XDX A;  2VW5 A;  2Q8I A;  2WI2 A;  2H8M A;  2BU2 A;  4QPK A;  3D0B A;  4E00 A;  3LNU A;  1Z5A A;  3FT5 A;  1ZXN A;  4AWP A;  4MPC A;  2GFD A;  4XKO A;  4E01 A;  3PEH A;  2FWY A;  2VCJ A;  3B27 A;  3ZKB A;  4V25 A;  4QPJ A;  1Y4U A;  3R92 A;  2BU7 A;  4LWE A;  2O1U A;  1UYD A;  4ZVI A;  4EFU A;  4BIU A;  4U7O A;  2YGF A;  2XDK A;  5IDJ A;  4ASF A;  4EMV A;  5BOD A;  1GKZ A;  2CGF A;  2YE6 A;  4HY1 A;  4CE1 A;  4BQG A;  3DGE A;  4GEE A;  4K4O A;  1JM6 A;  5M4P A;  4XC0 A;  2YEI A;  1ZXM A;  3K99 A;  4EFT A;  1I5B A;  4R3M A;  2CCU A;  3GIG B;  3GIF A;  1TC6 A;  2XDL A;  4X9L A;  1EA6 A;  2JKI A;  1THN A;  1I58 A;  1AJ6 A;  4LWF A;  5D7C A;  3EHG A;  3OPD A;  3HZ5 A;  2VCI A;  1PVG A;  4JAU A;  4CWN A;  2XX5 A;  4FCR A;  4E02 A;  2BSM A;  4PL9 A;  2YKC A;  4CE2 A;  2ZBK B;  3R4P A;  4XCJ A;  2BZ5 A;  2WI4 A;  4EGI A;  4GT8 A;  1Y8N A;  2XJG A;  4URL A;  4CWR A;  3G7B A;  3A0R A;  4WUD A;  4NH7 A;  3ZKD A;  1I5D A;  5IDM A;  3R4N A;  3ZM7 A;  2YEH A;  4GFN A;  2YGA A;  3EKO A;  2BYH A;  4P7A A;  4GCZ A;  4PU9 A;  3GIG A;  3RKZ A;  2BRC A;  5M4H A;  1EI1 A;  4CWQ A;  4JQL A;  4L91 A;  1MU5 A;  4KQV A;  3TZ4 A;  1ZWH A;  3RLQ A;  4XIQ A;  1UY6 A;  1UY8 A;  3D2R A;  3U2K A;  1YC1 A;  4O05 A;  1BYQ A;  2WI3 A;  3Q5J A;  4XKK A;  5M4E A;  5D7D A;  2YE3 A;  2YE2 A;  2XDU A;  2XX2 A;  5BOC A;  5CTW A;  1S14 A;  4HXW A;  4W7T A;  1I5A A;  4NH8 A;  4MPN A;  5M4M A;  1U2O A;  2VWC A;  5C93 A;  3LPS A;  4L8Z A;  4YKW A;  1B62 A;  1TBW A;  2BU6 A;  3B24 A;  3K97 A;  4EM7 A;  1B63 A;  1I59 A;  1UYC A;  2WI5 A;  4HYM A;  3B28 A;  4DZY A;  3K98 A;  1YSR A;  4HZ5 A;  1TIL A;  2XHR A;  4B7P A;  2CCS A;  3TUH A;  4L93 A;  4ZKI A;  3BMY A;  2YK9 A;  2XAB A;  4O07 A;  1AMW A;  5M4N A;  3OMU A;  2BRE A;  1YC4 A;  3EHF A;  2FYP A;  2IWS A;  3B25 A;  4MP2 A;  3BM9 A;  4XKA A;  1ZW9 A;  2XHX A;  4ASB A;  4L90 A;  1QY8 A;  4XD8 A;  4YKU A;  4KFG A;  3INW A;  2YKI A;  1Z5C A;  5J71 A;  4GQT A;  1BKN A;  4V26 A;  4GGL A;  3HHU A;  1BGQ A;  3A0X A;  5CTY A;  1AM1 A;  2K5B A;  3O0I A;  1AH6 A;  2WER A;  4BQJ A;  3SL2 A;  4DUH A;  1NHH A;  4YKZ A;  3T1K A;  3NMQ A;  1AH8 A;  3EHJ A;  3HZ1 A;  4URM A;  1TC0 A;  3OWD A;  4URN A;  3VHC A;  2H55 A;  2O1V A;  1Y8O A;  3H4L A;  2YE7 A;  1H7S A;  1H7U A;  5FNC A;  1UYI A;  4FPP A;  4ASG A;  1YS3 A;  2HG1 A;  2Q2E B;  1YT0 A;  4O09 A;  3EHH A;  2UWD A;  2YK2 A;  3INX A;  3U2D A;  2WI1 A;  1U0Z A;  2XHT A;  2YED A;  4JAV A;  3TZ5 A;  2PNR A;  3A0T A;  3K60 A;  2WI7 A;  3VHA A;  2WEP A;  1UY9 A;  2FWZ A;  3ZXO A;  4YKR A;  2E0A A;  2YI7 A;  4XIT A;  3TTZ A;  3G75 A;  3C0E A;  2ZDX A;  4ASA A;  3CWV A;  2YEF A;  2YEC A;  5FND A;  2YKJ A;  2YI5 A;  1UYF A;  4BIZ A;  2GQP A;  4XDM A;  3ZXQ A;  4EGK A;  4NH9 A;  4EEH A;  2AKP A;  3U67 A;  1UYH A;  2HCH A;  4XIR A;  4H85 A;  1YT1 A;  4BXI A;  4CWT A;  3G7E A;  1ID0 A;  1YES A;  2YI6 A;  3CRL A;  4KTN A;  5GGZ A;  4CE3 A;  2YEA A;  2CG9 A;  2Q8F A;  4FCP A;  4URO A;  5F3K A;  1QZR A;  2Q8H A;  1Z5B A;  1YC3 A;  3VAD A;  3H80 A;  2BTZ A;  2O1W A;  2EXL A;  5M4K A;  3C11 A;  4U93 A;  2IOQ A;  2XK2 A;  2YKB A;  2QG2 A;  2WI6 A;  2QF6 A;  3T0H A;  3O6O A;  5CTU A;  1US7 A;  3QDD A;  4MB9 A;  4MBC A;  3T2S A;  4CWP A;  5IN9 A;  3A0Y A;  2YEJ A;  3TZ0 A;  4L94 A;  2BU5 A;  3CRK A;  2XJJ A;  2YJW A;  4WUB A;  3R91 A;  3QTF A;  3IED A;  4Q20 A;  2XCM A;  2QFO A;  3TZ2 A;  2C2A A;  2YE4 A;  4O04 A;  4CWO A;  2IOP A;  2XJX A;  4P8O A;  4LP0 A;  1UYG A;  2BT0 A;  4H7Q A;  4KSH A;  3OWB A;  4I5S A;  4MOT A;  4BAE A;  2YE8 A;  3R4O A;  2HKJ A;  4XTJ A;  2YEG A;  4PRV A;  1UY7 A;  3A0Z A;  2YE9 A;  2XDS A;  3OW6 A;  2YE5 A;  5CTX A;  1MX0 A;  3A0W A;  4HY6 A;  1UYK A;  2BYI A;  4R3A A;  3FT8 A;  1A4H A;  1L0O A;  2CCT A;  1NHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...