2HG1A

N-domain of grp94 in complex with the novel ligand n-(2-hydroxyl)ethyl carboxyamido adenosine
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
236
structure length
225
Chain Sequence
b'GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQEQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title N-Domain Of Grp94 In Complex With the Novel Ligand N-(2-hydroxyl)ethyl Carboxyamido Adenosine
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 68
structure length 225
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2hg1A00
2YKEA 3VADA 4AWQA 3CRKA 2YK9A 4E00A 2YE4A 2XHXA 2CG9A 3FT5A 5FNCA 3VHDA 4ASGA 3U67A 3CGYA 3T0HA 1Z5BA 4GGLA 4L8ZA 5D7RA 1UYGA 2YEGA 2YGFA 2FXSA 3Q5LA 4KFGA 2IOQA 1U0ZA 2YJXA 3D2RA 1ID0A 3R92A 1ZXMA 2XX2A 4FCPA 4PRXA 1YC1A 4MPEA 2ZDXA 5D6QA 1UYMA 1UYHA 2YECA 2XJGA 4CE2A 2CCTA 3R4OA 4AWPA 2Q2EB 1NHJA 1BXDA 3ZXQA 3A0XA 1S14A 3OW6A 4DUHA 3RKZA 2O1UA 4YKXA 2ZDYA 1Y4SA 1UYDA 2XDKA 4JQLA 2YI0A 1QYEA 1EI1A 2VW5A 4KTNA 1UYIA 2YI7A 3EKRA 4O07A 2Q8FA 4R1FA 2WI5A 2WEPA 5C93A 4YKRA 5FNDA 2JJCA 1Z5CA 3Q5KA 1TIDA 2YEDA 3INWA 3RLRA 3TZ2A 4XKAA 2BTZA 5M4HA 4L91A 4CE3A 1I5DA 1UY9A 3RLQA 1BYQA 5CTWA 4R3AA 1GJVA 4O04A 5F3KA 2YEIA 4JASA 2VCJA 2FYPA 4HXZA 3R91A 2QF6A 4W7TA 2BU7A 2H55A 3HEKA 3A0ZA 2YKCA 3CRLA 4L90A 1THNA 4U7NA 3EHHA 2YEFA 2XDXA 2WI7A 3G7EA 2VWCA 3A0RA 1A4HA 4CWQA 2YEBA 2YK2A 1H7UA 4XTJA 5D7CA 4BAEA 1YS3A 2BU8A 3HYZA 2WI3A 4V26A 4YKYA 4HYMA 3R4MA 1YC3A 3FV5A 1PVGA 1B63A 4LWGA 3T1KA 3TZ5A 2WI6A 1I58A 1YSRA 4URLA 4H81A 4XCJA 4B6CA 1NHIA 1AH8A 4FCRA 4P8OA 3R4NA 1YT2A 3HYYA 3ZXOA 4ASAA 4O0BA 1YETA 3INXA 4YKUA 1I5AA 2WERA 1B3QA 4PRVA 2QG0A 3TUHA 4V25A 4XC0A 1UYFA 5IN9A 5CTXA 4ASBA 2WEQA 4KSHA 2YGEA 2XHRA 2YE2A 2PNRA 3C0EA 2CH4A 4I3HA 2YEEA 3JZ3A 3TZ0A 3LNUA 1QY8A 5FNFA 1Y8NA 4HZ5A 4E02A 1TC6A 4EM7A 2UWDA 2HCHA 2EXLA 1NHHA 4AS9A 4KP4A 2XABA 2CGFA 3K97A 1ZW9A 3U2DA 1S16A 3BMYA 2Q8IA 4EFUA 4XKOA 5J71A 3O6OA 1MU5A 2JKIA 2YE7A 5M4NA 1AM1A 1GKXA 3GIGB 4QPJA 2XDLA 2XDSA 4BIZA 3K98A 3KE6A 4LWEA 3B26A 2YE9A 4URMA 1TH8A 2H8MA 4I5SA 4BQJA 3DGEA 3EHGA 3CGZA 5BODA 2WI2A 4GT8A 4E01A 2YKJA 1AH6A 4JAUA 4XITA 4BIUA 2IWUA 1Z59A 2YE6A 1GKZA 1R62A 4AWOA 2ESAA 5IDJA 2FWYA 4YKWA 2XCMA 1Y8PA 3R4PA 4XCLA 2CCUA 1I59A 2IORA 3TTZA 1B62A 2BT0A 3D36A 3B28A 5FWKA 4B7PA 5F5RA 4CWOA 2ZKJA 4U7OA 1I5BA 1BGQA 2VCIA 2YI6A 1U2OA 2WI1A 4PL9A 5BOCA 4EGHA 1TILA 4LPBA 3LPSA 5CPHA 2XX4A 4CE1A 3OMUA 4R3MA 5CTUA 4KSGA 1QZRA 4CWSA 1UYKA 1TBWA 4BQGA 3O0IA 1YC4A 2BZ5A 4URNA 1MX0A 4GEEA 3B27A 4MPCA 4YKTA 3OWDA 1Z5AA 2WI4A 3B24A 2YE8A 4H7QA 2XJXA 2Q8HA 2CCSA 3FT8A 1OSFA 2O1WA 3WHAA 3T10A 3MNRP 4PU9A 2XJJA 3ZM7A 5M4PA 4CWNA 1H7SA 4MBCA 4XIPA 1UYLA 4HZ0A 2IWSA 2QG2A 3ZKBA 2YKBA 1KZNA 4CWTA 4ZKIA 2BU2A 2XD6A 3VHCA 4XE2A 4EFTA 5CTYA 2K5BA 2C2AA 5M4KA 1AJ6A 4XIRA 4NH7A 4CWFA 1US7A 4XD8A 4DZYA 1Y4UA 3EKOA 1AMWA 1YT1A 2Q8GA 2YGAA 4O05A 2HKJA 4FCQA 4HXWA 2BYIA 4Q20A 3EHFA 4MB9A 2ZBKB 4ZVIA 4WUBA 4HYPA 5IDMA 3HZ1A 4EGIA 4L93A 3D0BA 4QPKA 3GIGA 4H85A 3Q5JA 3K60A 2BU6A 3GIEA 4XDMA 1I5CA 3T0ZA 3ZKDA 4FPPA 4X9LA 3QDDA 2YE3A 4BXIA 3IEDA 2AKPA 3H80A 4EGKA 1YSZA 3HZ5A 3QTFA 5D7DA 4EEHA 4O09A 5M4MA 4LWHA 2IOPA 4GQTA 2HG1A 4XIQA 1UYCA 3NMQA 1JM6A 2IWXA 2YE5A 2XX5A 2XHTA 4GCZA 5GGZA 4L94A 2YEAA 3OWBA 1TC0A 3HHUA 1YT0A 3VHAA 4LWIA 3B25A 4NH8A 3U2KA 2O1VA 4LWFA 3G7BA 3EHJA 3BM9A 1ZWHA 3O2FA 2GFDA 4WUCA 4LP0A 3C11A 4MP2A 4CWRA 4UROA 1BKNA 2YEJA 4JAVA 4U93A 3CWVA 4XKKA 1L0OA 1UYEA 2YEHA 4WUDA 2YI5A 4HY1A 1KIJA 4K4OA 5L3JA 4NH9A 2XK2A 1UY6A 2BYHA 4HY6A 3PEHA 4GFNA 3A0TA 4FMTA 3G75A 1YERA 2BU5A 5M4EA 2QFOA 3OPDA 1UY8A 1EA6A 3T2SA 3H4LA 3PEJA 2FWZA 3K99A 3WQ9A 1YESA 4KQVA 2E0AA 4YKZA 1ZXNA 4P7AA 2XDUA 3A0WA 5D6PA 3A0YA 2BREA 2BSMA 3TZ4A 2YKIA 3RLPA 2BRCA 5J6AA 4MOTA 5CF0A 4YKQA 4CWPA 2GQPA 4MPNA 4EMVA 4ASFA 3GIFA 1Y8OA 2YJWA 3SL2A 1UY7A 4MP7A
chains in the Genus database with same CATH superfamily
2YKEA 3VADA 4AWQA 3CRKA 2YK9A 4E00A 2YE4A 2XHXA 4MP7A 2CG9A 3FT5A 5FNCA 3VHDA 4ASGA 3U67A 3CGYA 3T0HA 1Z5BA 4GGLA 4L8ZA 5D7RA 1UYGA 2YEGA 2YGFA 2FXSA 3Q5LA 4KFGA 2IOQA 1U0ZA 2YJXA 3D2RA 1ID0A 3R92A 1ZXMA 2XX2A 4FCPA 4PRXA 1YC1A 4MPEA 2ZDXA 3LMMA 5D6QA 1UYMA 1UYHA 2YECA 2XJGA 4CE2A 2CCTA 3R4OA 4AWPA 2Q2EB 1NHJA 1BXDA 3ZXQA 3A0XA 1S14A 3OW6A 4DUHA 3RKZA 2O1UA 4YKXA 2ZDYA 1Y4SA 1UYDA 2XDKA 4JQLA 2YI0A 1QYEA 1EI1A 2VW5A 4KTNA 1UYIA 2YI7A 3EKRA 4O07A 2Q8FA 4R1FA 2WI5A 2WEPA 5C93A 4YKRA 5FNDA 2JJCA 1Z5CA 3Q5KA 1TIDA 2YEDA 3INWA 3RLRA 3TZ2A 4XKAA 2BTZA 5M4HA 4L91A 4CE3A 1I5DA 1UY9A 3RLQA 1BYQA 5CTWA 4R3AA 1GJVA 4O04A 5F3KA 2YEIA 4JASA 2VCJA 2FYPA 4HXZA 3R91A 2QF6A 4W7TA 2BU7A 2H55A 3HEKA 3A0ZA 2YKCA 3CRLA 4L90A 1THNA 4U7NA 3EHHA 2YEFA 2XDXA 2C1GA 2WI7A 3G7EA 2VWCA 3A0RA 1A4HA 4CWQA 2YEBA 2YK2A 1H7UA 4XTJA 5D7CA 4BAEA 1YS3A 2BU8A 3HYZA 2WI3A 4V26A 4YKYA 4HYMA 3R4MA 1YC3A 3FV5A 1PVGA 1B63A 4LWGA 3T1KA 3TZ5A 2WI6A 1I58A 1YSRA 4URLA 4H81A 4XCJA 2C1IA 4B6CA 1NHIA 1AH8A 4FCRA 4P8OA 3R4NA 1YT2A 3HYYA 3ZXOA 4ASAA 4O0BA 1YETA 3INXA 4YKUA 1I5AA 2WERA 1B3QA 4PRVA 2QG0A 3TUHA 4V25A 4XC0A 1UYFA 5IN9A 5CTXA 4ASBA 2WEQA 4KSHA 2YGEA 2XHRA 2YE2A 2PNRA 3C0EA 2CH4A 4I3HA 2YEEA 3JZ3A 3TZ0A 3LNUA 1QY8A 5FNFA 1Y8NA 4HZ5A 4E02A 1TC6A 4EM7A 2UWDA 2HCHA 2EXLA 1NHHA 4AS9A 4KP4A 2XABA 2CGFA 3K97A 1ZW9A 3U2DA 1S16A 3BMYA 2Q8IA 4EFUA 4XKOA 5J71A 3O6OA 1MU5A 2JKIA 2YE7A 5M4NA 1AM1A 1GKXA 3GIGB 4QPJA 2XDLA 2XDSA 4BIZA 3K98A 3KE6A 4LWEA 3B26A 2YE9A 4URMA 1TH8A 2H8MA 4I5SA 4BQJA 3DGEA 3EHGA 3CGZA 5BODA 2WI2A 4GT8A 4E01A 2YKJA 1AH6A 4JAUA 4XITA 4BIUA 2IWUA 1Z59A 2YE6A 1GKZA 1R62A 4AWOA 2ESAA 5IDJA 2FWYA 4YKWA 2XCMA 1Y8PA 3R4PA 4XCLA 2CCUA 1I59A 2IORA 3TTZA 1B62A 2BT0A 2HHIA 3D36A 3B28A 5FWKA 4B7PA 5F5RA 4CWOA 2ZKJA 4U7OA 1I5BA 1BGQA 2VCIA 2YI6A 1U2OA 2WI1A 4PL9A 5BOCA 3CYGA 4EGHA 1TILA 4LPBA 3LPSA 5CPHA 2XX4A 4CE1A 3OMUA 4R3MA 5CTUA 4KSGA 1QZRA 5JENA 4CWSA 1UYKA 1TBWA 4BQGA 3O0IA 1YC4A 2BZ5A 3S5TA 4URNA 1MX0A 4GEEA 3B27A 4MPCA 4YKTA 3OWDA 1Z5AA 2WI4A 3B24A 2YE8A 4H7QA 2XJXA 2Q8HA 2CCSA 3FT8A 1OSFA 2O1WA 3WHAA 3T10A 3MNRP 4PU9A 2XJJA 3ZM7A 5M4PA 4CWNA 1H7SA 4MBCA 4XIPA 1UYLA 4HZ0A 2IWSA 2QG2A 3ZKBA 2YKBA 1KZNA 4CWTA 4ZKIA 2BU2A 2XD6A 3VHCA 4XE2A 4EFTA 5CTYA 2K5BA 2C2AA 5M4KA 1AJ6A 4XIRA 4NH7A 4CWFA 1US7A 4XD8A 4DZYA 1Y4UA 3EKOA 1AMWA 1YT1A 2Q8GA 2YGAA 4O05A 2HKJA 4FCQA 4HXWA 2BYIA 4Q20A 3EHFA 4MB9A 2ZBKB 4ZVIA 4WUBA 4HYPA 5IDMA 3HZ1A 4EGIA 4L93A 3D0BA 4QPKA 3GIGA 4H85A 3Q5JA 3K60A 2BU6A 3GIEA 4XDMA 1I5CA 3T0ZA 3ZKDA 4FPPA 4X9LA 3QDDA 2YE3A 4BXIA 3IEDA 2AKPA 3H80A 4EGKA 1YSZA 3HZ5A 3QTFA 5D7DA 4EEHA 4O09A 5M4MA 4LWHA 2IOPA 4GQTA 2HG1A 4XIQA 1UYCA 3NMQA 1JM6A 2IWXA 2YE5A 2XX5A 2XHTA 4GCZA 5GGZA 4L94A 2YEAA 3OWBA 1TC0A 3HHUA 1YT0A 3VHAA 4LWIA 3B25A 4NH8A 3U2KA 2O1VA 4LWFA 3G7BA 3EHJA 3BM9A 1ZWHA 3O2FA 2GFDA 4WUCA 4LP0A 3C11A 4MP2A 4CWRA 4UROA 1BKNA 2YEJA 4JAVA 4U93A 3CWVA 4XKKA 1L0OA 1UYEA 2FTKA 2YEHA 4WUDA 4E72A 2YI5A 4HY1A 1KIJA 4K4OA 5L3JA 4NH9A 2XK2A 1UY6A 2BYHA 4HY6A 3PEHA 4GFNA 3A0TA 4FMTA 3G75A 1YERA 2BU5A 5M4EA 2QFOA 3OPDA 1UY8A 1EA6A 3T2SA 3H4LA 3PEJA 2FWZA 3K99A 3WQ9A 1YESA 4KQVA 1F51A 2E0AA 4YKZA 1ZXNA 4P7AA 2XDUA 3A0WA 5D6PA 3A0YA 2BREA 2BSMA 3TZ4A 2YKIA 3RLPA 2BRCA 5J6AA 4MOTA 5CF0A 4YKQA 4CWPA 2GQPA 4MPNA 4EMVA 4ASFA 3GIFA 1Y8OA 2YJWA 3SL2A 1UY7A 1IXMA
chains in the Genus database with same CATH topology
2YKEA 3VADA 4AWQA 3CRKA 2YK9A 4E00A 2YE4A 2XHXA 2CG9A 3FT5A 5FNCA 3VHDA 4ASGA 3U67A 3CGYA 3T0HA 1Z5BA 4GGLA 4L8ZA 5D7RA 1UYGA 2YEGA 2YGFA 2FXSA 3Q5LA 4KFGA 2IOQA 1U0ZA 2YJXA 3D2RA 1ID0A 3R92A 1ZXMA 2XX2A 4FCPA 4PRXA 1YC1A 4MPEA 2ZDXA 5D6QA 1UYMA 1UYHA 2YECA 2XJGA 4CE2A 2CCTA 3R4OA 4AWPA 2Q2EB 1NHJA 1BXDA 3ZXQA 3A0XA 1S14A 3OW6A 4DUHA 3RKZA 2O1UA 4YKXA 2ZDYA 1Y4SA 1UYDA 2XDKA 4JQLA 2YI0A 1QYEA 1EI1A 2VW5A 4KTNA 1UYIA 2YI7A 3EKRA 4O07A 2Q8FA 4R1FA 2WI5A 2WEPA 5C93A 4YKRA 5FNDA 2JJCA 1Z5CA 3Q5KA 1TIDA 2YEDA 3INWA 3RLRA 3TZ2A 4XKAA 2BTZA 5M4HA 4L91A 4CE3A 1I5DA 1UY9A 3RLQA 1BYQA 5CTWA 4R3AA 1GJVA 4O04A 5F3KA 2YEIA 4JASA 2VCJA 2FYPA 4HXZA 3R91A 2QF6A 4W7TA 2BU7A 2H55A 3HEKA 3A0ZA 2YKCA 3CRLA 4L90A 1THNA 4U7NA 3EHHA 2YEFA 2XDXA 2WI7A 3G7EA 2VWCA 3A0RA 1A4HA 4CWQA 2YEBA 2YK2A 1H7UA 4XTJA 5D7CA 4BAEA 1YS3A 2BU8A 3HYZA 2WI3A 4V26A 4YKYA 4HYMA 3R4MA 1YC3A 3FV5A 1PVGA 1B63A 4LWGA 3T1KA 3TZ5A 2WI6A 1I58A 1YSRA 4URLA 4H81A 4XCJA 4B6CA 1NHIA 1AH8A 4FCRA 4P8OA 3R4NA 1YT2A 3HYYA 3ZXOA 4ASAA 4O0BA 1YETA 3INXA 4YKUA 1I5AA 2WERA 1B3QA 4PRVA 2QG0A 3TUHA 4V25A 4XC0A 1UYFA 5IN9A 5CTXA 4ASBA 2WEQA 4KSHA 2YGEA 2XHRA 2YE2A 2PNRA 3C0EA 2CH4A 4I3HA 2YEEA 3JZ3A 3TZ0A 3LNUA 1QY8A 5FNFA 1Y8NA 4HZ5A 4E02A 1TC6A 4EM7A 2UWDA 2HCHA 2EXLA 1NHHA 4AS9A 4KP4A 2XABA 2CGFA 3K97A 1ZW9A 3U2DA 1S16A 3BMYA 2Q8IA 4EFUA 4XKOA 5J71A 3O6OA 1MU5A 2JKIA 2YE7A 5M4NA 1AM1A 1GKXA 3GIGB 4QPJA 2XDLA 2XDSA 4BIZA 3K98A 3KE6A 4LWEA 3B26A 2YE9A 4URMA 1TH8A 2H8MA 4I5SA 4BQJA 3DGEA 3EHGA 3CGZA 5BODA 2WI2A 4GT8A 4E01A 2YKJA 1AH6A 4JAUA 4XITA 4BIUA 2IWUA 1Z59A 2YE6A 1GKZA 1R62A 4AWOA 2ESAA 5IDJA 2FWYA 4YKWA 2XCMA 1Y8PA 3R4PA 4XCLA 2CCUA 1I59A 2IORA 3TTZA 1B62A 2BT0A 3D36A 3B28A 5FWKA 4B7PA 5F5RA 4CWOA 2ZKJA 4U7OA 1I5BA 1BGQA 2VCIA 2YI6A 1U2OA 2WI1A 4PL9A 5BOCA 4EGHA 1TILA 4LPBA 3LPSA 5CPHA 2XX4A 4CE1A 3OMUA 4R3MA 5CTUA 4KSGA 1QZRA 4CWSA 1UYKA 1TBWA 4BQGA 3O0IA 1YC4A 2BZ5A 4URNA 1MX0A 4GEEA 3B27A 4MPCA 4YKTA 3OWDA 1Z5AA 2WI4A 3B24A 2YE8A 4H7QA 2XJXA 2Q8HA 2CCSA 3FT8A 1OSFA 2O1WA 3WHAA 3T10A 3MNRP 4PU9A 2XJJA 3ZM7A 5M4PA 4CWNA 1H7SA 4MBCA 4XIPA 1UYLA 4HZ0A 2IWSA 2QG2A 3ZKBA 2YKBA 1KZNA 4CWTA 4ZKIA 2BU2A 2XD6A 3VHCA 4XE2A 4EFTA 5CTYA 2K5BA 2C2AA 5M4KA 1AJ6A 4XIRA 4NH7A 4CWFA 1US7A 4XD8A 4DZYA 1Y4UA 3EKOA 1AMWA 1YT1A 2Q8GA 2YGAA 4O05A 2HKJA 4FCQA 4HXWA 2BYIA 4Q20A 3EHFA 4MB9A 2ZBKB 4ZVIA 4WUBA 4HYPA 5IDMA 3HZ1A 4EGIA 4L93A 3D0BA 4QPKA 3GIGA 4H85A 3Q5JA 3K60A 2BU6A 3GIEA 4XDMA 1I5CA 3T0ZA 3ZKDA 4FPPA 4X9LA 3QDDA 2YE3A 4BXIA 3IEDA 2AKPA 3H80A 4EGKA 1YSZA 3HZ5A 3QTFA 5D7DA 4EEHA 4O09A 5M4MA 4LWHA 2IOPA 4GQTA 2HG1A 4XIQA 1UYCA 3NMQA 1JM6A 2IWXA 2YE5A 2XX5A 2XHTA 4GCZA 5GGZA 4L94A 2YEAA 3OWBA 1TC0A 3HHUA 1YT0A 3VHAA 4LWIA 3B25A 4NH8A 3U2KA 2O1VA 4LWFA 3G7BA 3EHJA 3BM9A 1ZWHA 3O2FA 2GFDA 4WUCA 4LP0A 3C11A 4MP2A 4CWRA 4UROA 1BKNA 2YEJA 4JAVA 4U93A 3CWVA 4XKKA 1L0OA 1UYEA 2YEHA 4WUDA 2YI5A 4HY1A 1KIJA 4K4OA 5L3JA 4NH9A 2XK2A 1UY6A 2BYHA 4HY6A 3PEHA 4GFNA 3A0TA 4FMTA 3G75A 1YERA 2BU5A 5M4EA 2QFOA 3OPDA 1UY8A 1EA6A 3T2SA 3H4LA 3PEJA 2FWZA 3K99A 3WQ9A 1YESA 4KQVA 2E0AA 4YKZA 1ZXNA 4P7AA 2XDUA 3A0WA 5D6PA 3A0YA 2BREA 2BSMA 3TZ4A 2YKIA 3RLPA 2BRCA 5J6AA 4MOTA 5CF0A 4YKQA 4CWPA 2GQPA 4MPNA 4EMVA 4ASFA 3GIFA 1Y8OA 2YJWA 3SL2A 1UY7A 4MP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKE A;  3VAD A;  4AWQ A;  3CRK A;  2YK9 A;  4E00 A;  2YE4 A;  2XHX A;  2CG9 A;  3FT5 A;  5FNC A;  3VHD A;  4ASG A;  3U67 A;  3CGY A;  3T0H A;  1Z5B A;  4GGL A;  4L8Z A;  5D7R A;  1UYG A;  2YEG A;  2YGF A;  2FXS A;  3Q5L A;  4KFG A;  2IOQ A;  1U0Z A;  2YJX A;  3D2R A;  1ID0 A;  3R92 A;  1ZXM A;  2XX2 A;  4FCP A;  4PRX A;  1YC1 A;  4MPE A;  2ZDX A;  5D6Q A;  1UYM A;  1UYH A;  2YEC A;  2XJG A;  4CE2 A;  2CCT A;  3R4O A;  4AWP A;  2Q2E B;  1NHJ A;  1BXD A;  3ZXQ A;  3A0X A;  1S14 A;  3OW6 A;  4DUH A;  3RKZ A;  2O1U A;  4YKX A;  2ZDY A;  1Y4S A;  1UYD A;  2XDK A;  4JQL A;  2YI0 A;  1QYE A;  1EI1 A;  2VW5 A;  4KTN A;  1UYI A;  2YI7 A;  3EKR A;  4O07 A;  2Q8F A;  4R1F A;  2WI5 A;  2WEP A;  5C93 A;  4YKR A;  5FND A;  2JJC A;  1Z5C A;  3Q5K A;  1TID A;  2YED A;  3INW A;  3RLR A;  3TZ2 A;  4XKA A;  2BTZ A;  5M4H A;  4L91 A;  4CE3 A;  1I5D A;  1UY9 A;  3RLQ A;  1BYQ A;  5CTW A;  4R3A A;  1GJV A;  4O04 A;  5F3K A;  2YEI A;  4JAS A;  2VCJ A;  2FYP A;  4HXZ A;  3R91 A;  2QF6 A;  4W7T A;  2BU7 A;  2H55 A;  3HEK A;  3A0Z A;  2YKC A;  3CRL A;  4L90 A;  1THN A;  4U7N A;  3EHH A;  2YEF A;  2XDX A;  2WI7 A;  3G7E A;  2VWC A;  3A0R A;  1A4H A;  4CWQ A;  2YEB A;  2YK2 A;  1H7U A;  4XTJ A;  5D7C A;  4BAE A;  1YS3 A;  2BU8 A;  3HYZ A;  2WI3 A;  4V26 A;  4YKY A;  4HYM A;  3R4M A;  1YC3 A;  3FV5 A;  1PVG A;  1B63 A;  4LWG A;  3T1K A;  3TZ5 A;  2WI6 A;  1I58 A;  1YSR A;  4URL A;  4H81 A;  4XCJ A;  4B6C A;  1NHI A;  1AH8 A;  4FCR A;  4P8O A;  3R4N A;  1YT2 A;  3HYY A;  3ZXO A;  4ASA A;  4O0B A;  1YET A;  3INX A;  4YKU A;  1I5A A;  2WER A;  1B3Q A;  4PRV A;  2QG0 A;  3TUH A;  4V25 A;  4XC0 A;  1UYF A;  5IN9 A;  5CTX A;  4ASB A;  2WEQ A;  4KSH A;  2YGE A;  2XHR A;  2YE2 A;  2PNR A;  3C0E A;  2CH4 A;  4I3H A;  2YEE A;  3JZ3 A;  3TZ0 A;  3LNU A;  1QY8 A;  5FNF A;  1Y8N A;  4HZ5 A;  4E02 A;  1TC6 A;  4EM7 A;  2UWD A;  2HCH A;  2EXL A;  1NHH A;  4AS9 A;  4KP4 A;  2XAB A;  2CGF A;  3K97 A;  1ZW9 A;  3U2D A;  1S16 A;  3BMY A;  2Q8I A;  4EFU A;  4XKO A;  5J71 A;  3O6O A;  1MU5 A;  2JKI A;  2YE7 A;  5M4N A;  1AM1 A;  1GKX A;  3GIG B;  4QPJ A;  2XDL A;  2XDS A;  4BIZ A;  3K98 A;  3KE6 A;  4LWE A;  3B26 A;  2YE9 A;  4URM A;  1TH8 A;  2H8M A;  4I5S A;  4BQJ A;  3DGE A;  3EHG A;  3CGZ A;  5BOD A;  2WI2 A;  4GT8 A;  4E01 A;  2YKJ A;  1AH6 A;  4JAU A;  4XIT A;  4BIU A;  2IWU A;  1Z59 A;  2YE6 A;  1GKZ A;  1R62 A;  4AWO A;  2ESA A;  5IDJ A;  2FWY A;  4YKW A;  2XCM A;  1Y8P A;  3R4P A;  4XCL A;  2CCU A;  1I59 A;  2IOR A;  3TTZ A;  1B62 A;  2BT0 A;  3D36 A;  3B28 A;  5FWK A;  4B7P A;  5F5R A;  4CWO A;  2ZKJ A;  4U7O A;  1I5B A;  1BGQ A;  2VCI A;  2YI6 A;  1U2O A;  2WI1 A;  4PL9 A;  5BOC A;  4EGH A;  1TIL A;  4LPB A;  3LPS A;  5CPH A;  2XX4 A;  4CE1 A;  3OMU A;  4R3M A;  5CTU A;  4KSG A;  1QZR A;  4CWS A;  1UYK A;  1TBW A;  4BQG A;  3O0I A;  1YC4 A;  2BZ5 A;  4URN A;  1MX0 A;  4GEE A;  3B27 A;  4MPC A;  4YKT A;  3OWD A;  1Z5A A;  2WI4 A;  3B24 A;  2YE8 A;  4H7Q A;  2XJX A;  2Q8H A;  2CCS A;  3FT8 A;  1OSF A;  2O1W A;  3WHA A;  3T10 A;  3MNR P;  4PU9 A;  2XJJ A;  3ZM7 A;  5M4P A;  4CWN A;  1H7S A;  4MBC A;  4XIP A;  1UYL A;  4HZ0 A;  2IWS A;  2QG2 A;  3ZKB A;  2YKB A;  1KZN A;  4CWT A;  4ZKI A;  2BU2 A;  2XD6 A;  3VHC A;  4XE2 A;  4EFT A;  5CTY A;  2K5B A;  2C2A A;  5M4K A;  1AJ6 A;  4XIR A;  4NH7 A;  4CWF A;  1US7 A;  4XD8 A;  4DZY A;  1Y4U A;  3EKO A;  1AMW A;  1YT1 A;  2Q8G A;  2YGA A;  4O05 A;  2HKJ A;  4FCQ A;  4HXW A;  2BYI A;  4Q20 A;  3EHF A;  4MB9 A;  2ZBK B;  4ZVI A;  4WUB A;  4HYP A;  5IDM A;  3HZ1 A;  4EGI A;  4L93 A;  3D0B A;  4QPK A;  3GIG A;  4H85 A;  3Q5J A;  3K60 A;  2BU6 A;  3GIE A;  4XDM A;  1I5C A;  3T0Z A;  3ZKD A;  4FPP A;  4X9L A;  3QDD A;  2YE3 A;  4BXI A;  3IED A;  2AKP A;  3H80 A;  4EGK A;  1YSZ A;  3HZ5 A;  3QTF A;  5D7D A;  4EEH A;  4O09 A;  5M4M A;  4LWH A;  2IOP A;  4GQT A;  2HG1 A;  4XIQ A;  1UYC A;  3NMQ A;  1JM6 A;  2IWX A;  2YE5 A;  2XX5 A;  2XHT A;  4GCZ A;  5GGZ A;  4L94 A;  2YEA A;  3OWB A;  1TC0 A;  3HHU A;  1YT0 A;  3VHA A;  4LWI A;  3B25 A;  4NH8 A;  3U2K A;  2O1V A;  4LWF A;  3G7B A;  3EHJ A;  3BM9 A;  1ZWH A;  3O2F A;  2GFD A;  4WUC A;  4LP0 A;  3C11 A;  4MP2 A;  4CWR A;  4URO A;  1BKN A;  2YEJ A;  4JAV A;  4U93 A;  3CWV A;  4XKK A;  1L0O A;  1UYE A;  2YEH A;  4WUD A;  2YI5 A;  4HY1 A;  1KIJ A;  4K4O A;  5L3J A;  4NH9 A;  2XK2 A;  1UY6 A;  2BYH A;  4HY6 A;  3PEH A;  4GFN A;  3A0T A;  4FMT A;  3G75 A;  1YER A;  2BU5 A;  5M4E A;  2QFO A;  3OPD A;  1UY8 A;  1EA6 A;  3T2S A;  3H4L A;  3PEJ A;  2FWZ A;  3K99 A;  3WQ9 A;  1YES A;  4KQV A;  2E0A A;  4YKZ A;  1ZXN A;  4P7A A;  2XDU A;  3A0W A;  5D6P A;  3A0Y A;  2BRE A;  2BSM A;  3TZ4 A;  2YKI A;  3RLP A;  2BRC A;  5J6A A;  4MOT A;  5CF0 A;  4YKQ A;  4CWP A;  2GQP A;  4MPN A;  4EMV A;  4ASF A;  3GIF A;  1Y8O A;  2YJW A;  3SL2 A;  1UY7 A;  4MP7 A; 
#chains in the Genus database with same CATH topology
 2YKE A;  3VAD A;  4AWQ A;  3CRK A;  2YK9 A;  4E00 A;  2YE4 A;  2XHX A;  4MP7 A;  2CG9 A;  3FT5 A;  5FNC A;  3VHD A;  4ASG A;  3U67 A;  3CGY A;  3T0H A;  1Z5B A;  4GGL A;  4L8Z A;  5D7R A;  1UYG A;  2YEG A;  2YGF A;  2FXS A;  3Q5L A;  4KFG A;  2IOQ A;  1U0Z A;  2YJX A;  3D2R A;  1ID0 A;  3R92 A;  1ZXM A;  2XX2 A;  4FCP A;  4PRX A;  1YC1 A;  4MPE A;  2ZDX A;  3LMM A;  5D6Q A;  1UYM A;  1UYH A;  2YEC A;  2XJG A;  4CE2 A;  2CCT A;  3R4O A;  4AWP A;  2Q2E B;  1NHJ A;  1BXD A;  3ZXQ A;  3A0X A;  1S14 A;  3OW6 A;  4DUH A;  3RKZ A;  2O1U A;  4YKX A;  2ZDY A;  1Y4S A;  1UYD A;  2XDK A;  4JQL A;  2YI0 A;  1QYE A;  1EI1 A;  2VW5 A;  4KTN A;  1UYI A;  2YI7 A;  3EKR A;  4O07 A;  2Q8F A;  4R1F A;  2WI5 A;  2WEP A;  5C93 A;  4YKR A;  5FND A;  2JJC A;  1Z5C A;  3Q5K A;  1TID A;  2YED A;  3INW A;  3RLR A;  3TZ2 A;  4XKA A;  2BTZ A;  5M4H A;  4L91 A;  4CE3 A;  1I5D A;  1UY9 A;  3RLQ A;  1BYQ A;  5CTW A;  4R3A A;  1GJV A;  4O04 A;  5F3K A;  2YEI A;  4JAS A;  2VCJ A;  2FYP A;  4HXZ A;  3R91 A;  2QF6 A;  4W7T A;  2BU7 A;  2H55 A;  3HEK A;  3A0Z A;  2YKC A;  3CRL A;  4L90 A;  1THN A;  4U7N A;  3EHH A;  2YEF A;  2XDX A;  2C1G A;  2WI7 A;  3G7E A;  2VWC A;  3A0R A;  1A4H A;  4CWQ A;  2YEB A;  2YK2 A;  1H7U A;  4XTJ A;  5D7C A;  4BAE A;  1YS3 A;  2BU8 A;  3HYZ A;  2WI3 A;  4V26 A;  4YKY A;  4HYM A;  3R4M A;  1YC3 A;  3FV5 A;  1PVG A;  1B63 A;  4LWG A;  3T1K A;  3TZ5 A;  2WI6 A;  1I58 A;  1YSR A;  4URL A;  4H81 A;  4XCJ A;  2C1I A;  4B6C A;  1NHI A;  1AH8 A;  4FCR A;  4P8O A;  3R4N A;  1YT2 A;  3HYY A;  3ZXO A;  4ASA A;  4O0B A;  1YET A;  3INX A;  4YKU A;  1I5A A;  2WER A;  1B3Q A;  4PRV A;  2QG0 A;  3TUH A;  4V25 A;  4XC0 A;  1UYF A;  5IN9 A;  5CTX A;  4ASB A;  2WEQ A;  4KSH A;  2YGE A;  2XHR A;  2YE2 A;  2PNR A;  3C0E A;  2CH4 A;  4I3H A;  2YEE A;  3JZ3 A;  3TZ0 A;  3LNU A;  1QY8 A;  5FNF A;  1Y8N A;  4HZ5 A;  4E02 A;  1TC6 A;  4EM7 A;  2UWD A;  2HCH A;  2EXL A;  1NHH A;  4AS9 A;  4KP4 A;  2XAB A;  2CGF A;  3K97 A;  1ZW9 A;  3U2D A;  1S16 A;  3BMY A;  2Q8I A;  4EFU A;  4XKO A;  5J71 A;  3O6O A;  1MU5 A;  2JKI A;  2YE7 A;  5M4N A;  1AM1 A;  1GKX A;  3GIG B;  4QPJ A;  2XDL A;  2XDS A;  4BIZ A;  3K98 A;  3KE6 A;  4LWE A;  3B26 A;  2YE9 A;  4URM A;  1TH8 A;  2H8M A;  4I5S A;  4BQJ A;  3DGE A;  3EHG A;  3CGZ A;  5BOD A;  2WI2 A;  4GT8 A;  4E01 A;  2YKJ A;  1AH6 A;  4JAU A;  4XIT A;  4BIU A;  2IWU A;  1Z59 A;  2YE6 A;  1GKZ A;  1R62 A;  4AWO A;  2ESA A;  5IDJ A;  2FWY A;  4YKW A;  2XCM A;  1Y8P A;  3R4P A;  4XCL A;  2CCU A;  1I59 A;  2IOR A;  3TTZ A;  1B62 A;  2BT0 A;  2HHI A;  3D36 A;  3B28 A;  5FWK A;  4B7P A;  5F5R A;  4CWO A;  2ZKJ A;  4U7O A;  1I5B A;  1BGQ A;  2VCI A;  2YI6 A;  1U2O A;  2WI1 A;  4PL9 A;  5BOC A;  3CYG A;  4EGH A;  1TIL A;  4LPB A;  3LPS A;  5CPH A;  2XX4 A;  4CE1 A;  3OMU A;  4R3M A;  5CTU A;  4KSG A;  1QZR A;  5JEN A;  4CWS A;  1UYK A;  1TBW A;  4BQG A;  3O0I A;  1YC4 A;  2BZ5 A;  3S5T A;  4URN A;  1MX0 A;  4GEE A;  3B27 A;  4MPC A;  4YKT A;  3OWD A;  1Z5A A;  2WI4 A;  3B24 A;  2YE8 A;  4H7Q A;  2XJX A;  2Q8H A;  2CCS A;  3FT8 A;  1OSF A;  2O1W A;  3WHA A;  3T10 A;  3MNR P;  4PU9 A;  2XJJ A;  3ZM7 A;  5M4P A;  4CWN A;  1H7S A;  4MBC A;  4XIP A;  1UYL A;  4HZ0 A;  2IWS A;  2QG2 A;  3ZKB A;  2YKB A;  1KZN A;  4CWT A;  4ZKI A;  2BU2 A;  2XD6 A;  3VHC A;  4XE2 A;  4EFT A;  5CTY A;  2K5B A;  2C2A A;  5M4K A;  1AJ6 A;  4XIR A;  4NH7 A;  4CWF A;  1US7 A;  4XD8 A;  4DZY A;  1Y4U A;  3EKO A;  1AMW A;  1YT1 A;  2Q8G A;  2YGA A;  4O05 A;  2HKJ A;  4FCQ A;  4HXW A;  2BYI A;  4Q20 A;  3EHF A;  4MB9 A;  2ZBK B;  4ZVI A;  4WUB A;  4HYP A;  5IDM A;  3HZ1 A;  4EGI A;  4L93 A;  3D0B A;  4QPK A;  3GIG A;  4H85 A;  3Q5J A;  3K60 A;  2BU6 A;  3GIE A;  4XDM A;  1I5C A;  3T0Z A;  3ZKD A;  4FPP A;  4X9L A;  3QDD A;  2YE3 A;  4BXI A;  3IED A;  2AKP A;  3H80 A;  4EGK A;  1YSZ A;  3HZ5 A;  3QTF A;  5D7D A;  4EEH A;  4O09 A;  5M4M A;  4LWH A;  2IOP A;  4GQT A;  2HG1 A;  4XIQ A;  1UYC A;  3NMQ A;  1JM6 A;  2IWX A;  2YE5 A;  2XX5 A;  2XHT A;  4GCZ A;  5GGZ A;  4L94 A;  2YEA A;  3OWB A;  1TC0 A;  3HHU A;  1YT0 A;  3VHA A;  4LWI A;  3B25 A;  4NH8 A;  3U2K A;  2O1V A;  4LWF A;  3G7B A;  3EHJ A;  3BM9 A;  1ZWH A;  3O2F A;  2GFD A;  4WUC A;  4LP0 A;  3C11 A;  4MP2 A;  4CWR A;  4URO A;  1BKN A;  2YEJ A;  4JAV A;  4U93 A;  3CWV A;  4XKK A;  1L0O A;  1UYE A;  2FTK A;  2YEH A;  4WUD A;  4E72 A;  2YI5 A;  4HY1 A;  1KIJ A;  4K4O A;  5L3J A;  4NH9 A;  2XK2 A;  1UY6 A;  2BYH A;  4HY6 A;  3PEH A;  4GFN A;  3A0T A;  4FMT A;  3G75 A;  1YER A;  2BU5 A;  5M4E A;  2QFO A;  3OPD A;  1UY8 A;  1EA6 A;  3T2S A;  3H4L A;  3PEJ A;  2FWZ A;  3K99 A;  3WQ9 A;  1YES A;  4KQV A;  1F51 A;  2E0A A;  4YKZ A;  1ZXN A;  4P7A A;  2XDU A;  3A0W A;  5D6P A;  3A0Y A;  2BRE A;  2BSM A;  3TZ4 A;  2YKI A;  3RLP A;  2BRC A;  5J6A A;  4MOT A;  5CF0 A;  4YKQ A;  4CWP A;  2GQP A;  4MPN A;  4EMV A;  4ASF A;  3GIF A;  1Y8O A;  2YJW A;  3SL2 A;  1UY7 A;  1IXM A; 
#chains in the Genus database with same CATH homology
 2YKE A;  3VAD A;  4AWQ A;  3CRK A;  2YK9 A;  4E00 A;  2YE4 A;  2XHX A;  2CG9 A;  3FT5 A;  5FNC A;  3VHD A;  4ASG A;  3U67 A;  3CGY A;  3T0H A;  1Z5B A;  4GGL A;  4L8Z A;  5D7R A;  1UYG A;  2YEG A;  2YGF A;  2FXS A;  3Q5L A;  4KFG A;  2IOQ A;  1U0Z A;  2YJX A;  3D2R A;  1ID0 A;  3R92 A;  1ZXM A;  2XX2 A;  4FCP A;  4PRX A;  1YC1 A;  4MPE A;  2ZDX A;  5D6Q A;  1UYM A;  1UYH A;  2YEC A;  2XJG A;  4CE2 A;  2CCT A;  3R4O A;  4AWP A;  2Q2E B;  1NHJ A;  1BXD A;  3ZXQ A;  3A0X A;  1S14 A;  3OW6 A;  4DUH A;  3RKZ A;  2O1U A;  4YKX A;  2ZDY A;  1Y4S A;  1UYD A;  2XDK A;  4JQL A;  2YI0 A;  1QYE A;  1EI1 A;  2VW5 A;  4KTN A;  1UYI A;  2YI7 A;  3EKR A;  4O07 A;  2Q8F A;  4R1F A;  2WI5 A;  2WEP A;  5C93 A;  4YKR A;  5FND A;  2JJC A;  1Z5C A;  3Q5K A;  1TID A;  2YED A;  3INW A;  3RLR A;  3TZ2 A;  4XKA A;  2BTZ A;  5M4H A;  4L91 A;  4CE3 A;  1I5D A;  1UY9 A;  3RLQ A;  1BYQ A;  5CTW A;  4R3A A;  1GJV A;  4O04 A;  5F3K A;  2YEI A;  4JAS A;  2VCJ A;  2FYP A;  4HXZ A;  3R91 A;  2QF6 A;  4W7T A;  2BU7 A;  2H55 A;  3HEK A;  3A0Z A;  2YKC A;  3CRL A;  4L90 A;  1THN A;  4U7N A;  3EHH A;  2YEF A;  2XDX A;  2WI7 A;  3G7E A;  2VWC A;  3A0R A;  1A4H A;  4CWQ A;  2YEB A;  2YK2 A;  1H7U A;  4XTJ A;  5D7C A;  4BAE A;  1YS3 A;  2BU8 A;  3HYZ A;  2WI3 A;  4V26 A;  4YKY A;  4HYM A;  3R4M A;  1YC3 A;  3FV5 A;  1PVG A;  1B63 A;  4LWG A;  3T1K A;  3TZ5 A;  2WI6 A;  1I58 A;  1YSR A;  4URL A;  4H81 A;  4XCJ A;  4B6C A;  1NHI A;  1AH8 A;  4FCR A;  4P8O A;  3R4N A;  1YT2 A;  3HYY A;  3ZXO A;  4ASA A;  4O0B A;  1YET A;  3INX A;  4YKU A;  1I5A A;  2WER A;  1B3Q A;  4PRV A;  2QG0 A;  3TUH A;  4V25 A;  4XC0 A;  1UYF A;  5IN9 A;  5CTX A;  4ASB A;  2WEQ A;  4KSH A;  2YGE A;  2XHR A;  2YE2 A;  2PNR A;  3C0E A;  2CH4 A;  4I3H A;  2YEE A;  3JZ3 A;  3TZ0 A;  3LNU A;  1QY8 A;  5FNF A;  1Y8N A;  4HZ5 A;  4E02 A;  1TC6 A;  4EM7 A;  2UWD A;  2HCH A;  2EXL A;  1NHH A;  4AS9 A;  4KP4 A;  2XAB A;  2CGF A;  3K97 A;  1ZW9 A;  3U2D A;  1S16 A;  3BMY A;  2Q8I A;  4EFU A;  4XKO A;  5J71 A;  3O6O A;  1MU5 A;  2JKI A;  2YE7 A;  5M4N A;  1AM1 A;  1GKX A;  3GIG B;  4QPJ A;  2XDL A;  2XDS A;  4BIZ A;  3K98 A;  3KE6 A;  4LWE A;  3B26 A;  2YE9 A;  4URM A;  1TH8 A;  2H8M A;  4I5S A;  4BQJ A;  3DGE A;  3EHG A;  3CGZ A;  5BOD A;  2WI2 A;  4GT8 A;  4E01 A;  2YKJ A;  1AH6 A;  4JAU A;  4XIT A;  4BIU A;  2IWU A;  1Z59 A;  2YE6 A;  1GKZ A;  1R62 A;  4AWO A;  2ESA A;  5IDJ A;  2FWY A;  4YKW A;  2XCM A;  1Y8P A;  3R4P A;  4XCL A;  2CCU A;  1I59 A;  2IOR A;  3TTZ A;  1B62 A;  2BT0 A;  3D36 A;  3B28 A;  5FWK A;  4B7P A;  5F5R A;  4CWO A;  2ZKJ A;  4U7O A;  1I5B A;  1BGQ A;  2VCI A;  2YI6 A;  1U2O A;  2WI1 A;  4PL9 A;  5BOC A;  4EGH A;  1TIL A;  4LPB A;  3LPS A;  5CPH A;  2XX4 A;  4CE1 A;  3OMU A;  4R3M A;  5CTU A;  4KSG A;  1QZR A;  4CWS A;  1UYK A;  1TBW A;  4BQG A;  3O0I A;  1YC4 A;  2BZ5 A;  4URN A;  1MX0 A;  4GEE A;  3B27 A;  4MPC A;  4YKT A;  3OWD A;  1Z5A A;  2WI4 A;  3B24 A;  2YE8 A;  4H7Q A;  2XJX A;  2Q8H A;  2CCS A;  3FT8 A;  1OSF A;  2O1W A;  3WHA A;  3T10 A;  3MNR P;  4PU9 A;  2XJJ A;  3ZM7 A;  5M4P A;  4CWN A;  1H7S A;  4MBC A;  4XIP A;  1UYL A;  4HZ0 A;  2IWS A;  2QG2 A;  3ZKB A;  2YKB A;  1KZN A;  4CWT A;  4ZKI A;  2BU2 A;  2XD6 A;  3VHC A;  4XE2 A;  4EFT A;  5CTY A;  2K5B A;  2C2A A;  5M4K A;  1AJ6 A;  4XIR A;  4NH7 A;  4CWF A;  1US7 A;  4XD8 A;  4DZY A;  1Y4U A;  3EKO A;  1AMW A;  1YT1 A;  2Q8G A;  2YGA A;  4O05 A;  2HKJ A;  4FCQ A;  4HXW A;  2BYI A;  4Q20 A;  3EHF A;  4MB9 A;  2ZBK B;  4ZVI A;  4WUB A;  4HYP A;  5IDM A;  3HZ1 A;  4EGI A;  4L93 A;  3D0B A;  4QPK A;  3GIG A;  4H85 A;  3Q5J A;  3K60 A;  2BU6 A;  3GIE A;  4XDM A;  1I5C A;  3T0Z A;  3ZKD A;  4FPP A;  4X9L A;  3QDD A;  2YE3 A;  4BXI A;  3IED A;  2AKP A;  3H80 A;  4EGK A;  1YSZ A;  3HZ5 A;  3QTF A;  5D7D A;  4EEH A;  4O09 A;  5M4M A;  4LWH A;  2IOP A;  4GQT A;  2HG1 A;  4XIQ A;  1UYC A;  3NMQ A;  1JM6 A;  2IWX A;  2YE5 A;  2XX5 A;  2XHT A;  4GCZ A;  5GGZ A;  4L94 A;  2YEA A;  3OWB A;  1TC0 A;  3HHU A;  1YT0 A;  3VHA A;  4LWI A;  3B25 A;  4NH8 A;  3U2K A;  2O1V A;  4LWF A;  3G7B A;  3EHJ A;  3BM9 A;  1ZWH A;  3O2F A;  2GFD A;  4WUC A;  4LP0 A;  3C11 A;  4MP2 A;  4CWR A;  4URO A;  1BKN A;  2YEJ A;  4JAV A;  4U93 A;  3CWV A;  4XKK A;  1L0O A;  1UYE A;  2YEH A;  4WUD A;  2YI5 A;  4HY1 A;  1KIJ A;  4K4O A;  5L3J A;  4NH9 A;  2XK2 A;  1UY6 A;  2BYH A;  4HY6 A;  3PEH A;  4GFN A;  3A0T A;  4FMT A;  3G75 A;  1YER A;  2BU5 A;  5M4E A;  2QFO A;  3OPD A;  1UY8 A;  1EA6 A;  3T2S A;  3H4L A;  3PEJ A;  2FWZ A;  3K99 A;  3WQ9 A;  1YES A;  4KQV A;  2E0A A;  4YKZ A;  1ZXN A;  4P7A A;  2XDU A;  3A0W A;  5D6P A;  3A0Y A;  2BRE A;  2BSM A;  3TZ4 A;  2YKI A;  3RLP A;  2BRC A;  5J6A A;  4MOT A;  5CF0 A;  4YKQ A;  4CWP A;  2GQP A;  4MPN A;  4EMV A;  4ASF A;  3GIF A;  1Y8O A;  2YJW A;  3SL2 A;  1UY7 A;  4MP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...