2HG5C

Cs+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB HEAVY CHAIN
molecule tags Membrane protein
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
total genus 21
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hg5C00
4XDJA 3K0DA 1J95A 2Q69A 4GX1A 4HZ3A 4MSWC 5EK0A 3SYOA 2ZXWC 2EILC 3F7VC 4P9PA 4BW5A 2A0LA 2QKSA 3ABKC 4R8CA 3UM7A 4J9ZB 3LNMB 3TETA 2IH3C 4MVMA 4PA3A 3IGAC 4QNHB 3LDCA 3RW0A 3LDEA 4RUEA 1R3LC 3ZJZA 4CBCA 4JTAB 3FB5C 3FB6C 1ZWIC 2Q68A 3F7YC 3T4DA 2Y69C 3K03A 4MVQA 4RO2A 4WFFA 2X6CA 3LUTB 3ZRSA 3SYPA 4MTGA 2WLKA 3FB8C 2HFEC 4MS2A 4MTFA 2EIKC 3OR6C 4JTDB 4KFMA 1QLEC 4P30A 1V54C 1KKDA 2WLHA 3AG4C 1BL8A 1OCCC 3BEHA 3OR7C 3OUFA 2WLIA 3SPGA 4MW3A 3SYCA 3E8GA 5CBGA 3OUSA 2R9RB 2WLLB 4DXWA 3WG7C 3T1CA 2ITDC 4G28B 4WFEA 3IFXA 3X2QC 2A79B 3AG1C 3T4ZA 3EFFK 2QTOA 1OCZC 2WLNA 4XDLA 4G27B 4PDVA 5KUKA 3E83A 4MVZA 5EBLC 3SYAA 3TCUA 3SJQC 2EINC 2DYSC 2K1EA 3JYCA 4MVOA 4UUJC 5B1BC 1R3JC 2WLMA 2KB1A 2X6AA 3STLC 2ZD9A 4J9YB 4EKWA 1XL4A 4MVUA 2Q67A 4X89A 1G4YB 2AHYA 2DYRC 1XL6A 2H8PC 1M57C 3ABMC 2OCCC 4LCUC 3E89A 3ABLC 5IY5C 4RUFA 2W0FC 4GX5A 2HJFC 2HVJC 2BOCC 2HG5C 3AG3C 3LDDA 5KUMA 3VOUA 2EIMC 2Q6AA 4F4LA 4MVRA 5EC1C 2ATKC 2X6BA 5B3SC 3T2MA 4HYOA 3E8HA 3RVZA 2A9HA 3K08A 1P7BA 2NLJC 3SYQA 5J9PC 5B1AC 2WLIB 4PDMA 5CBHA 1OCOC 2HVKC 3K04A 3STZC 4PDLA 2WLLA 4JTCB 3SPCA 1JVMA 4PA4A 3AG2C 4MTOA 4R6ZA 2BOBC 4PA6A 3K0GA 4PA7A 4R50A 4QE7A 2DWDC 4GX0A 3SPIA 2DWEC 1M56C 3SPJA 3GB7C 4MVSA 1ORQC 4WFGA 3ASOC 4XDKA 5BZBA 1K4DC 4QE9A 2P7TC 4P2ZA 2YEVA 2EIJC 3OGCC 1K4CC 4RAIA 5EBMC 3SPHA 4R7CA 2AHZA 3KG2A 1LNQA 5E1AC 4ZBMA 4P9OA 3E86A 3ASNC 3F5WC 2JK5C 4X88A 4LP8A 3HPLC 3PJSK 3K06A 5CBFA 1R3KC 3FB7C 4WFHA 5EC2C 2IH1C 2WLJA 4I9WA 4X8AA 4LBEC 1OCRC 4MW8A 3E8FA 3E8BA 4GX2A 4OXSA 5EBWC 3RBZA 3UKMA 2ITCC 3R65A 4PA9A 3RVYA 4H37A 1R3IC 4PDRA 4H33A 1V55C 4TWKA 1S5HC
chains in the Genus database with same CATH superfamily
5GTHZ 1H2GA 4J41A 2Q69A 1GMGA 3QNEA 5KHGA 1U96A 1KP2A 2GDSA 2ZT9B 1S3JA 4JI3O 4LFAO 3RW0A 3HKBB 2F43G 1H2KA 1PL0A 2XUMA 2N74A 1IX9A 3EVKA 1MMMA 3FB8C 2GBOA 5FNVB 2WLHA 1CEZA 2HLDG 3CRMA 4FLYA 1VP7A 5KAIZ 3ETEA 3CCSV 4NXMO 2GHYA 2BTQB 1YIJV 2DQ0A 2ZM6B 2Q73A 4DR5O 3KCXA 1YHQV 4LF5O 2GV9A 5BY1A 3JAMN 2UU9B 1F23A 4DV1O 5EYPA 2O57A 2EBOA 4MTXA 2LW7A 3A0RA 3A0BZ 4B3MB 2ODMA 3RYHB 2DYRC 2PUSA 3RYFB 2ZQMA 1GTOA 1GK9A 2YI9A 4X1KA 3THOA 5HFMA 2JRIA 1FS0G 5D5PA 2LW1A 2PYJA 5KAFZ 2WA4A 1YSCA 4K8XA 2LFRA 4YIPA 2VS0A 4ZI7A 1TUBB 2Y4TA 4B3TO 4GUNA 3CRAA 1YJ9V 1AJNA 4UB8Z 1XBLA 5HFLA 5IYDO 1BCCH 1KUQA 1DF4A 1VF6C 2YIBD 3G6EV 4B3RO 1OV9A 3TK1A 2H3OA 2YXLA 3D36C 2W0XA 4W4LA 3JARB 1O9GA 5LGUA 1S5LZ 3E22B 3RBZA 1TVKB 4H37A 1HNWB 1RM1B 4JI4O 1SF9A 4LFBB 4R8CA 4FLXA 4FFKA 5LP6C 1KECA 3N27A 2Q7EA 3ABKB 3ETGA 4DUZO 4J80A 1SZXA 4JTAB 2P90A 3W7WA 2P5OA 3NR7A 3ABTA 1HW7A 3LUTB 3SYPA 3AG4B 1MNGA 1TUBA 1AROP 4JTDB 1U97A 5DEDA 4DK0A 5CBGA 4OX9O 2QKAA 4DXWA 3ZMUA 1AR4A 1OCZC 5B66Z 4PDVA 5LL6Y 2PTMA 4LNUA 4FLZA 2PI4A 3DXRB 1HNZO 1HNWO 1G6UA 5CA3A 3K59A 4YXWG 2VQFO 1MZEA 4X89A 5LHHA 4FVMA 1K8AW 4DO2A 3ZN1A 1MZFA 3OGIB 2RN9A 2QJ1A 3L71H 3D3QA 5KUMA 3VOUA 3ZBHA 3A8TA 2YUAA 2IU3A 3G71V 5ITZA 3P32A 2XNDG 1L0NH 1T5EA 1FYJA 1K73W 1BMFG 2QR4A 4LWSA 3L74H 4ZKIA 1XMOO 1XILA 3EHBB 1PNKA 1GN3A 4R6ZA 3JALA 4X65B 4QE7A 1XI1A 1JPXA 3VQVA 3SPJA 5FNVA 2EULA 2YXYA 1B06A 1O9HA 1ZL8A 4WFAV 3APOA 1K5QA 3RWRD 1BZKA 5JWPA 3E86A 3AK3A 4DRXA 4YY3B 1TVKA 4B7KA 3OTFA 4X66B 1S5JA 4O2AA 2ZR3A 3RYCB 4LFCO 5LHGA 1B3QA 1S5HC 4X1IA 4MSWC 1YTFB 1SC5B 1XHXA 4UCRA 2YS8A 2D2CB 2LGWA 3C90A 3CX5F 5FL7G 1PP9H 2UUBO 1EM1A 1D2DA 4PI0A 3CEIA 4P30A 1KKDA 1WN7A 5LA6A 3BEHA 2IJIA 2ZE6A 3K57A 2UXBO 4TUYB 1NZ6A 4K0KB 2LQTA 3CRRA 4G27B 1ZX3A 2EINC 2QGNA 5L3EA 5LGTA 2ZD9A 4TV8A 4O4HB 3UO2A 1M57B 3CJHB 2V7QG 1E79G 1NBMG 3JARA 2F95B 2ZKOA 4J7ZA 3E22A 1IURA 3K5NA 2QKCA 2WSSG 2OTLV 1NS1A 3AG3C 2WAMA 4F6RB 3PN1A 3BCCH 1UJWB 5B3SC 2E5LB 4U3JA 2ZE8A 2UXNA 3FYEB 3SYQA 2A9HA 1QCEA 5B1AC 1HWYA 2Q4PA 1SERA 4IHJB 3JCUZ 5GTIZ 1NR7A 5KX5A 5J2UA 2FYUH 4UCUA 1WB7A 3W7TA 2YEVA 1Q8IA 5EBMC 1F4NA 1ENVA 3MDSA 4DV0B 1HNXO 4DR3B 4QIWF 3S3XA 1N34O 1AVMA 3RYFA 1V55B 4O4JB 1BSMA 4X1IB 5EYPB 1K5SA 2F23A 3U10A 4E4EA 1VF7A 2QE7G 3QF7A 1Y67A 5FLXN 4PA3A 2Y0PA 1EN6A 1LUVA 3MD0A 1JJOA 3B09A 5IJ9A 3CCMV 2Q68A 5AG2A 1N4CA 4FLUA 5JCOA 2YC0A 4JI0B 1W0JG 2CH7B 4DUYO 1AI5A 1AP6A 4MW3A 1QLEB 4ABMA 4U3JB 3UCSC 4LF8O 2F4VO 4K0KO 4C7UA 4J7KA 3ABUA 4I4TB 4PD4F 3GVMA 3Q4HA 4GYCB 2ZR2A 4W4KA 2N05A 2X6AA 3ZRVA 1Y74B 4CC6A 5JJJB 4O4LB 2OT5A 1P84F 1Y6XA 2YIDA 1XL6A 2H8PC 5L3GA 1QR8A 2FB5A 4RUFA 1A32A 2W0FC 4GKKB 1PNMA 2HG5C 4ZIBA 5KA6A 2Q6AA 5IY5B 2ATKC 4OPAA 4LFCB 5K1PA 3LNNA 4D7SA 4NTYA 2HVKC 5IJ0B 3K04A 3H01A 4DR1B 1I7FA 4EEQA 1VQ7V 4PA7A 3CCLV 4DV0O 3GWOA 1YDXA 1MA1A 3BAAA 4QE9A 3VQYA 2XT9A 2Q0OC 3OGCC 4RAIA 1S72V 1GN6A 4JPRA 4N23A 2JK5C 4LP8A 4FM1A 4B3SO 4JI6O 4O2AB 1NKDA 1AR1B 4JI1O 3E8FA 5C8YB 3JCZA 3HKCA 2MW2B 3OEHG 4NTWA 2OYQA 4DRXB 4NB5A 4A5UB 2E74B 2OIEA 4O4HA 4AILC 4HZ3A 4ZOLA 1BS3A 2LJ2A 5KHKA 5LMUB 4RWUA 4XBFA 4WBNA 1L8DA 3IGAC 4QNHB 4U7OA 2BSKB 2VWJA 4DR1O 4FPPA 4TV9B 1ZWIC 2EZOA 2QM4A 4WFFA 4HNAB 4O4IA 3FKSG 4BIUA 5E79Z 4MTGA 4JI7O 1XMQB 3CCEV 1QR9A 3SPGA 5DECA 1M93A 2HJDA 1OJHA 3RYIA 4JI7B 1B6QA 3T4ZA 1R1BA 3EFFK 3DC6A 4NKGB 5LHIA 2XAHA 4FLVA 4JYYA 1KC8W 4JI2B 1K34A 5EZYA 2PY5A 3E35A 1D5NA 4DV1B 2OIGA 4PELA 4X1YB 1N34B 4JF3A 2YIBA 5IWAB 4DR3O 4AHCA 1M57C 3QG5A 2DMXA 1VQ9V 1YXBA 4JI8O 1HR0O 4O4IB 4UVBA 1OCOB 4JI5B 1MG1A 3RGBA 4JASA 5IYCO 4YJ2A 3H1HH 3HKEB 5C8YA 3AK2A 2ZDIC 5FPOA 3QO8A 1K4DC 3CHXA 2EJ7A 4UCVA 1K4CC 4LF4O 1SQVH 1YTFD 4R7CA 4B08A 4WFHA 1I5XA 1AJPA 3HR0A 5CA0A 2VRZA 3APQA 1WJZA 4MW8A 3R65A 4PA9A 1SKVA 3B8NA 2ZXWB 4ZI7B 1AI4A 3G4SV 3VQXA 4XDJA 1J95A 3SYOA 1VQ6V 3K5MA 4WFBV 2RNBA 3TETA 3LNMB 3DXRA 2AZ2A 2KG7B 3OFNG 3K03A 2Y48A 3ZRSA 1IZ3A 5JCOC 2K9PA 4MS2A 2L35A 2EIKC 2XASA 2Y69B 1URFA 3OR6C 4H0LB 1S0VA 2PZSA 2KKWA 5B5EZ 4OPHA 5GONB 1PV0A 2PF4E 3FAVA 4EB6B 3WG7C 1KD1W 4LF8B 4LF9O 2ILMA 1RSOB 2UUCB 1MSDA 3BPZA 4QPKA 2K1EA 4K3AA 1NVPB 1BQ0A 4J9YB 3OM3B 3CRQA 2CDYA 5IE9A 4O2BA 2CH7A 3I5DA 3D8CA 4ASUG 2ETNA 1VQMV 4LR3A 2BTQA 2HR3A 1US6A 1IDSA 2DN9A 3JAKA 1HNXB 3B4SA 1HDJA 4JTCB 2X0LA 3AG2C 4LFBO 4NXMB 3BA9A 2DWDC 4GX0A 1VQ4V 4JGSA 1M56C 1XNQB 3HKBA 3BHPA 3WFVA 2B9ZA 2KQXA 4WFGA 3ZHQA 3DC5A 4LF9B 2EIJC 2YEVB 2W6IG 2BCCH 4L87A 1R3KC 1N33B 1XEQA 3ZHSA 5EC2C 2AW9A 1NH2B 1QU7A 1JCHA 2AXTZ 3CWBH 4GX2A 1I0HA 2Q9LA 3RVYA 1NTZH 4PI2A 5KMGB 1V55C 3J80N 1RFYA 3UM7A 2Q7GA 4J9ZB 4CBCA 5LBQA 2IM9A 1M4UA 2ZDIA 3DSQA 3H9VA 1OCCC 1ZAUA 2GSMB 3SYCA 3ZHRA 2LFSA 2RDCA 2ZCEA 4TQDA 3AK1A 4WFEA 2CTWA 2Z0AA 1VQOV 3SJCC 2WLNA 2JDIG 1JFFB 3RFRA 1YEWA 1F4MA 1ZLZA 3L72H 2DYSB 4J10A 4EKWA 4YHHO 4MVUA 3ZX6A 3TXSA 2QWNB 4DV6B 1XNRO 5LA6B 2KSDA 2DYRB 4LCUC 4JAVA 4QPJA 4KHPO 5C93A 4F4LA 1FAFA 3TXQA 2DOSA 4K35A 4DR4B 3JAWA 5D5QA 1FD9A 1Y76A 3D36A 2XAFA 4Z2WA 1Z5VA 2HKOA 1WPXA 1DK1A 5BXZA 4QJFB 4R50A 2P6JA 2ARHA 4XDKA 3KCYA 3ZHTA 5E1AC 2P06A 4P9OA 2A3QA 1N0NA 4I4TA 1KU9A 1Q3EA 3E8BA 3W7SA 4X20A 1BGYH 2NNUA 4D7TA 4LWSB 4IGGA 5EK0A 5KHIA 2ZXWC 2M7WA 4I0XB 4FZ0A 3JD4A 4FK5C 3O65A 2CTRA 5JH7A 4RQFA 4JI0O 2IH3C 4MVMA 2CE4A 4I50B 1YF2A 2JS3A 3CCJV 4RO2A 1AP5A 4O2BB 3OAAG 1QLEC 4DV7O 4LF7B 1XREA 5L3CA 5L3FA 4TQFA 3AG1B 2WLLB 1VARA 4YY3O 3AG7A 1Y4MA 4DUZB 3N2KA 4U3FH 1RSOA 3DTUB 2EINB 4DV7B 2RMKB 4DW1A 1S77D 2EJRA 1QVGU 1ZUQA 1DTOA 4CC5A 5K1XA 1M1KW 1TAEA 3T1HO 2OCCB 4DR7B 2VQEO 1FXKB 2KG7A 1RPOA 3ZIAG 3ABMB 3LDDA 1Q5OA 1AB3A 4KP4A 4MVRA 3OTOB 3VQWA 1IBMO 2IJJA 2P4KA 1E1QG 1N36B 5BMVA 1IXMA 1I5YA 1OCOC 2Q8VA 4GT1A 2IW5A 4MT8A 1QBZA 1UFIA 1PL4A 4ZHQB 4JI3B 4D6TH 4LFAB 4X62O 4IIJB 1YVWA 3K0GA 4CH4A 3HKDA 1SETA 2GTAA 3ASNB 2JIZG 3K9SA 4JYAO 3SPHA 3OE7G 4BWAA 2F93B 5CBFA 1R73A 2VQEB 1NTKH 1W0KG 4X8AA 3HKEA 4OXSA 4TUYA 2ITCC 1H2LA 2AGAA 4UCTA 2UXBB 2YI8A 2HHHO 4TWKA 3TGUH 3H1JH 4L8JA 4GX1A 3B40A 4P9PA 5B1NA 1SQXH 5KHHA 4JV5B 4NTXA 3SDLA 4RUEA 1R3LC 1WP7A 5LMNO 1LR1A 3J81N 3SR2C 4PJ0Z 4EFEA 1NI8A 2Y0IA 1V54C 4JI4B 1PNLA 3FD9A 3OTOO 2ZM6O 1IBMB 4FMTA 3I55V 1VF6A 2Q0AA 3OUSA 1OCCB 2R9RB 2WA3A 3DGEA 3ZRXA 1XQ8A 3X2QC 1W2BU 3N2KB 5CA0B 5KUKA 2B1GA 3E83A 1AJQA 3JYCA 1R3JC 4CH5A 1S76D 3IJ4A 2YXHA 3OMAB 1BHBA 1K3EA 4JV5O 3ABLB 1JA8A 3ZMSA 3P3PA 1N32B 1CXZB 2B1IA 1TGOA 4TV9A 2QWPB 2ZE5A 2EZPA 3F5TA 2V1DA 2DQ3A 5EC1C 3ZRWB 4BAYA 4GLXA 1Q7YW 4PHZA 2EIMB 4F6RA 2WLIB 3QTCA 1FPOA 5LYJA 3FX7A 1HP8A 1TA8A 1L1FA 2H94A 1Q6UA 3UT5B 4GCZA 4TSFG 2BOBC 4TV8B 2DWEC 4BW9A 3ASOC 5H6QA 2P7TC 1K9MW 3H1LH 1JQ0A 2A06H 1FFXB 1NQTA 1Q90D 3CRCA 3JSNA 4Q6GA 1SA0A 2UXCO 2CTPA 1J5EB 2B5UA 2QWRB 2NR5A 4CS2A 4BW5A 1WA8A 5LP6B 1VMGA 1OHHG 4UCOA 4DR7O 4DR2B 4UV8A 2F1MA 1MOFA 2WPDG 3CE2A 3FB6C 2X6CA 2C2AA 3RYCA 2HFEC 3AG4C 3OR7C 3A0HZ 4WF9V 1FXHA 1R6TA 5LYJB 3L70H 2X7RB 1ZSPA 3CJHA 1SQGA 2UUAB 3CXCU 2A79B 2UUCO 1JX9A 1JFFA 4XDLA 1GAXA 5BMVB 4MVZA 4ICGA 1OCZB 1FFTB 2F66C 4MVOA 5B1BC 4J7JA 3JALB 3BA8A 3IC7A 1XL4A 2Q67A 4NXNO 3CP1A 1N33O 3H1KH 3E89A 2PGGA 1QQCA 2E5LO 1K33A 1Y66A 2Q7HA 4HYOA 4H44B 4UXNA 2OTJV 3LSUA 5CB4A 2F4VB 1IBLO 2A7WA 4FLTA 1IVSA 3JATA 1YI2V 2ADPA 2XOKG 1Z5WA 3UO3A 1D5AA 3GB7C 3D3IA 3L75H 2QM7A 1AI6A 4P2ZA 4ZBMA 3SJAC 4OX9B 3K06A 2QEXV 1OCRB 1YJWV 2FMLA 3CMAV 1SA0B 3CSXA 1Z2GA 3ZCCA 1R3IC 4PDRA 4FZ1A 2IJHA 4LF5B 2JVDA 4YJ3B 3B8MA 2Z3YA 2UUBB 3F7VC 3ZHUA 1RM1C 2A0LA 1HR0B 5F2VO 3ZJZA 4WBNB 1XHZA 5LMNB 4AQYB 1KYOF 4MVQA 3R66A 4JI8B 5IWAO 4DV4B 4X64B 1NJIW 4B3RB 3B77A 3KZIZ 3ETQA 3WB2A 4O4JA 5IT9N 2LO1A 3JATB 4JAAA 3W7UA 2QTOA 3AEIA 1IXBA 3SJBC 2ZE7A 1H2SB 2YICA 2P4VA 3G80A 3LSSA 5BR8B 3FYIB 4DV2O 2D3OW 2AHYA 4KXRA 1Q6HA 1V9PA 1DGSA 4NR1A 2JGDB 4CH3A 2HJFC 4LF4B 4B3MO 1GO3F 4DV5B 4YIOA 4B7EA 1VEWA 1DF5A 3EXAA 4JYCA 1AILA 3T2MA 4GZRB 3E8HA 1I94B 2NLJC 4FM2A 1SQQH 5CBHA 3LSQA 4AI8A 5IDJA 1VQ5V 4PDLA 5JVDB 2WLLA 5CN0A 4BIOA 4CH6A 3CCQV 1GN4A 3K79A 4UV9A 1JVMA 1G8MA 5H2FZ 4DR5B 5JJNB 1XNQO 3N2GA 2CGNA 1M56B 1X4TA 4TOIA 4CS4A 1WPBA 3ZS8C 4LH7A 1ZL8B 3F5WC 4FJCC 4X88A 3HPLC 2EIJB 4I7ZB 3ZMZA 1KKCA 1K7DA 1CP9A 4QGPA 4HBNA 4X20B 2YSUB 2JS5A 3CPWU 1L0LH 1IBKO 4UVCA 3TJTA 5JVDA 1KQSU 3CCUV 2OCHA 4I55B 1JJ2U 2CK3G 3LDEA 1GRJA 3O9OA 3CS5A 3JD0A 1K92A 1PPJH 2FKXA 4JI5O 2YIAA 3L9DA 5LOVB 4RQEA 4JAUA 2Z5UA 1NVPD 3OUFA 5JQGA 1XUQA 1M90W 3JASA 1Q81W 1V54B 5LOVA 3M7MX 4DYLA 1IBLB 2CUGA 2ITDC 3BY6A 2QA4V 5JJEB 3UT5A 4LNUB 3IFXA 4CZZA 1PM9A 3WB1A 3JAWB 2E3CA 1K97A 2JGDA 2AZ0A 1Q6IA 2QWQB 1WP8A 4UUJC 2WLMA 1EN4A 3CC4V 5EIBD 4DV3O 4LH6A 1THZA 3K3WA 4I0XA 1FFXA 3MAQA 3RN4A 1AI7A 4BR6A 5J2TA 3ABLC 1X59A 1FXVA 1SQBH 1NR1A 3MHSC 2VWKA 1P7BA 1M5IA 3CCVV 4FIPC 3S3WA 4CS3A 1EBOA 4YJ3A 3HKDB 5GW7A 1NH2D 4MTOA 1Q82W 5IYZA 3OD4A 1WNSA 1VQ8V 3ZRWA 5IJ9B 3C3SA 3K5OA 1FJGB 1WLEA 2CGOA 4GKKO 4Z1MG 2BE3A 1LNQA 1Y76B 3VBBA 1MSWD 4DV6O 3BRCA 4JI6B 4B3SB 4EFBA 1YJNV 2JEUA 5KMGA 1OCRC 1QLNA 5LXTB 1LUWA 5DM6V 2CAZC 1H8HG 1GKFA 2HP8A 2EILC 2W6JG 3ABKC 5KHJA 4DV5O 1VF5B 4NXNB 2P22C 3OMNB 1NTMH 2XAJA 2GTSA 4IT5A 4JZGA 2N04A 4TT3G 4O4LA 1YITV 3JAKB 2IJKA 1GM7A 2ZINA 2FTKA 4F6EA 3P3NA 1RP3B 3AG1C 2GUZB 3B2EE 4JYAB 3JD1A 4NYKA 1EZJA 1R6KA 3CB2A 4FFBA 5JH7B 3ZEDA 1FXKA 4Q20A 3CXHF 1XNRB 3AG3B 2UU9O 5TISZ 2QTSA 3IC9A 2UXXA 3G6BA 2BOCC 5L3DA 4YHHB 2EIMC 4DUYB 1MABG 3QO5A 1J5EO 3K08A 2V4DA 4I5SA 3A2FA 3ZHVA 4FLWA 4J11A 3G67A 1P7GA 2XHBA 4DW0A 3K9AA 5EIBC 1EZVH 3ASOB 3RYHA 1ORQC 1N8RW 4WCEV 3BVOA 3ICXA 4HAMA 3ASNC 3NXSA 4LC1A 3GWKC 1JOYA 2Y4UA 5BR8O 5EBWC 3OEEG 4H33A 1H8EG 2IBZH 2L6LA 4PV1B 5CMUA 4N21A 4I55A 2RJZA 3RT3C 4LF6B 1JMKC 3F7YC 1UPGA 2E75B 2WLKA 3JD3A 4KFMA 4NVPA 3E2EA 5J2TB 4X62B 1BT8A 1BL8A 2UXDO 2PYLA 2WLIA 2LGQA 4LF6O 1H2MA 3FFQA 3CMEV 2R70A 3CD6V 1KP3A 1SRYA 2MK3A 2ZIOA 4H13B 1F7YA 2ADQB 4KUMA 5EBLC 3SYAA 2G38A 1CPYA 3ZMVA 2JGUA 5CA1A 1G1XB 1G4YB 1DLBA 1YCIA 3U11A 1P49A 4UVAA 5B3SB 2HVJC 3CCRV 5EZYB 5B1AB 3FAVB 4EB6A 1SQPH 1PKXA 2RQ6A 5J9PC 3QVNA 4X65O 2JEXA 4PDMA 4UFZA 3I56V 2XTAA 1ZTEA 1BE3H 4PA4A 2IU0A 3KKYA 5CA1B 1WAZA 4MVSA 4YJ2B 1N0JA 3WB0A 1SZTA 1JR9A 1ROPA 4FFBB 5L3BA 3KG2A 2QSAA 1R6NA 2RCVA 5ITZB 2GUZA 2WLJA 3CC7V 1GH6A 1FKAO 4IL6Z 3BFRA 3M8AA 3J7AU 1VQNV 4DV2B 2DE0X 2HHHB 1HNZB 3HKCB 3Q4HB 2XAQA 1E1RG 3OT7A 2ZIMA 1EN5A 2QKSA 1OZ0A 4UB6Z 2EILB 3T1YO 1XMOB 3T1HB 3WU2Z 1BQZA 4K8ZA 4IIJA 3JD2A 5DN6G 2PI5A 2R72A 4MTFA 1KB9F 5GONA 3W7XA 2QM8A 4X64O 2LP7A 1P4RA 1QNMA 3E8GA 5KLVH 4KHPB 3T1CA 4G28B 3K5LA 1AR5A 4DR4O 5LMUO 4DV4O 3X2QB 4U7NA 1YZBA 2VQFB 1F51A 4GKJB 3TCUA 2DYSC 2KB1A 1SESA 2BSKA 3STLC 4AQYO 5JQGB 5B1BB 1XDCA 1I08A 1SS3A 3SGIA 4BIZA 3QO7A 4GKJO 3HB3B 2HEPA 3L73H 1GM9A 2JJ2G 3OMIB 5IY5C 2P67A 2M6YA 3C3TA 4GX5A 1FJGO 5KA5A 2X6BA 3RYIB 1B04A 3CYOA 1VQLV 4B3TB 1SQFA 4JI2O 2BTOA 4IHJA 3UQ8A 4UCSA 3BABA 3ZN0A 1KMIZ 4OGQB 4PA6A 2CTQA 4ZHQA 4LF7O 3U0ZA 3ML0A 4I50A 4JZ2A 1PD3A 5BZBA 1TUEB 1XMQO 4DV3B 2AHZA 3N2GB 5IJ0A 4FM0A 2R9IA 4JYBA 2IH1C 2R9AA 4J42A 2EX3A 4LBEC 2QDOA 2OWOA 3P30A 3UKMA 3M99B 5H9CA 4KL1A 3K58A 1WB8A 3K0DA 1N36O 4X1YA 1GN2A 1COWG 5CB4B 4JI1B 1GM8A 3LDCA 2FL4A 1Q43A 2NN4A 3FB5C 4X9QA 3T4DA 2EIKB 2Y69C 5A2QN 5LGNA 2YDEA 5LXTA 5J2UB 5KX5B 2QWOB 4DR6B 1M9NA 3WG7B 4X66O 2JJ1G 5A9GA 3H1IH 5IYBO 3ZMTA 4E2LA 1VQPV 2ZNJA 1EFRG 2ZNIA 3IAYA 3SJQC 1IBKB 3OW2U 1NU1H 1VIBA 5IYZB 4DR2O 1FXKC 2UXCB 3T1YB 4DK1A 3ABMC 2OCCC 5B1OA 2Q5ZA 4DR6O 1QVFU 1NT2B 1W59A 1QHTA 1VQKV 3RVZA 1H38A 3ETDA 5H6RA 1I94O 3STZC 3AG2B 1KBHA 1H2NA 4Z1VA 1WA8B 5LP6A 2XAGA 3SPCA 1RPRA 1XOUA 1Q86W 2UXDB 3SPIA 2DJVA 3MHHC 4IYHA 4IYIA 4G2KA 4HNAA 5H5NA 2WWWA 3PJSK 4X1KB 3FB7C 3CC2V 3JASB 2DW4A 2UUAO 2E76B 5FPRA 1N32O 4I9WA 4I9QA 4ZOLB 1BHAA 3JSLA 1Y74A
chains in the Genus database with same CATH topology
1H2GA 2Q69A 1H8HG 1GMGA 4GX1A 4HZ3A 1GKFA 3QNEA 2EILC 4P9PA 2W6JG 5B1NA 3ABKC 4XBFA 1KP2A 3IGAC 4QNHB 4U7OA 1S3JA 3RW0A 4RUEA 1R3LC 2F43G 4FPPA 3OMNB 1PL0A 1ZWIC 2EZOA 2XAJA 4WFFA 3FKSG 4BIUA 4MTGA 3FB8C 1V54C 3CCEV 1PNLA 1QR9A 2WLHA 1CEZA 2HLDG 3SPGA 4TT3G 4FMTA 3I55V 1YITV 3CCSV 3ETEA 3OUSA 2GHYA 1GM7A 1OCCB 2IJKA 2R9RB 3DGEA 3ZRXA 1YIJV 2FTKA 1B6QA 3X2QC 2DQ0A 3AG1C 3T4ZA 1W2BU 3EFFK 5LHIA 2XAHA 5KUKA 2B1GA 3E83A 1KC8W 3JD1A 1K34A 1YHQV 1AJQA 1EZJA 1R6KA 3JYCA 3E35A 1R3JC 1S76D 1F23A 2EBOA 4PELA 4MTXA 3A0RA 4JF3A 3OMAB 1BHBA 1K3EA 2DYRC 1FXKA 3ABLB 4Q20A 1M57C 3AG3B 3ZMSA 2ZQMA 1VQ9V 1GTOA 1GK9A 5HFMA 2B1IA 2UXXA 2BOCC 5L3DA 1FS0G 2EIMC 2EZPA 2V1DA 2DQ3A 4UVBA 5EC1C 3ZRWB 1MABG 3QO5A 4BAYA 1OCOB 1Q7YW 2EIMB 3K08A 4I5SA 1YSCA 2WLIB 1MG1A 2LFRA 1L1FA 2H94A 3K9AA 4JASA 5IYCO 4GCZA 4TSFG 2BOBC 3ASOB 2DWEC 2ZDIC 1YJ9V 1AJNA 1ORQC 3ASOC 1N8RW 3QO8A 1K4DC 5H6QA 4WCEV 2P7TC 1K4CC 1K9MW 1YTFD 4R7CA 5HFLA 5IYDO 4HAMA 1JQ0A 3ASNC 1DF4A 3G6EV 3NXSA 4LC1A 3TK1A 1JOYA 4WFHA 1I5XA 1NQTA 1AJPA 5LGUA 4MW8A 3RBZA 5EBWC 3OEEG 3R65A 4PA9A 4H37A 2B5UA 3B8NA 4H33A 1H8EG 2ZXWB 1RM1B 1AI4A 3G4SV 4XDJA 1J95A 3SYOA 4BW5A 1VQ6V 1OHHG 4R8CA 4WFBV 3TETA 3LNMB 5CMUA 1KECA 4N21A 4UV8A 3ABKB 1MOFA 2WPDG 3ETGA 3OFNG 4JTAB 3FB6C 2P90A 3F7YC 3K03A 3W7WA 3ABTA 2Y48A 2X6CA 3LUTB 3ZRSA 3SYPA 2C2AA 3AG4B 2WLKA 1AROP 2HFEC 3JD3A 2XASA 2EIKC 2Y69B 3OR6C 4JTDB 4KFMA 4MS2A 1S0VA 3E2EA 3AG4C 1BL8A 3OR7C 2WLIA 4WF9V 1FXHA 5CBGA 3CMEV 3CD6V 2X7RB 1KP3A 1SRYA 2MK3A 4DXWA 3WG7C 1KD1W 3CXCU 3ZMUA 2A79B 1JX9A 4XDLA 1OCZC 4PDVA 4KUMA 4QPKA 4MVZA 5EBLC 3SYAA 2PI4A 1OCZB 2K1EA 1FFTB 4MVOA 5B1BC 1NVPB 5CA3A 1CPYA 3IC7A 4J9YB 3OM3B 1XL4A 3ZMVA 4YXWG 4X89A 2Q67A 5LHHA 1G4YB 1K8AW 4DO2A 3ZN1A 3CP1A 1DLBA 3E89A 4UVAA 5B3SB 2HVJC 4ASUG 5KUMA 3VOUA 3CCRV 5B1AB 1K33A 2IU3A 1VQMV 1Y66A 3G71V 1PKXA 2HR3A 2XNDG 3P32A 4HYOA 5J9PC 4UXNA 2OTJV 1K73W 1BMFG 2JEXA 4PDMA 3I56V 4JTCB 2X0LA 4ZKIA 1YI2V 4PA4A 3AG2C 2IU0A 3EHBB 1PNKA 4R6ZA 2XOKG 4QE7A 2DWDC 4GX0A 1VQ4V 1JPXA 4JGSA 3SPJA 1M56C 3GB7C 4MVSA 1SZTA 3D3IA 3WFVA 2QM7A 4WFGA 1ROPA 4WFAV 1AI6A 1K5QA 4P2ZA 2EIJC 5L3BA 3KG2A 4ZBMA 3E86A 1R6NA 2YEVB 2W6IG 3K06A 4L87A 2QEXV 1R3KC 1OCRB 1YJWV 5EC2C 3CMAV 1NH2B 2WLJA 3CC7V 1JCHA 4GX2A 3ZCCA 3RVYA 2ZR3A 1R3IC 1VQNV 4PDRA 5LHGA 2IJHA 1V55C 1S5HC 4MSWC 1YTFB 3B8MA 2Z3YA 2XAQA 3F7VC 1E1RG 1RM1C 2A0LA 2QKSA 1OZ0A 3UM7A 4J9ZB 2EILB 3ZJZA 5FL7G 4CBCA 5LBQA 4MVQA 3JD2A 5DN6G 2PI5A 2ZDIA 4MTFA 4P30A 3W7XA 1KKDA 2QM8A 1OCCC 3BEHA 2LP7A 2IJIA 2GSMB 3SYCA 1NJIW 1P4RA 3B77A 3E8GA 2LFSA 3T1CA 4G28B 4WFEA 1VQOV 3W7UA 2QTOA 2WLNA 2JDIG 4G27B 3AEIA 3X2QB 4U7NA 1F51A 3TCUA 2EINC 2DYSC 5L3EA 1F4MA 5LGTA 2KB1A 1SESA 2ZD9A 3STLC 3LSSA 2DYSB 5B1BB 4EKWA 3FYIB 1M57B 4BIZA 3QO7A 3HB3B 2V7QG 4MVUA 2D3OW 1E79G 2AHYA 1NBMG 1GM9A 2JJ2G 2DYRB 4LCUC 3OMIB 5IY5C 2P67A 2WSSG 4GX5A 4JAVA 2OTLV 2HJFC 4QPJA 1GO3F 3AG3C 2WAMA 5C93A 4F4LA 5KA5A 2X6BA 1UJWB 5B3SC 1DF5A 4JYCA 3T2MA 2UXNA 3CYOA 3FYEB 1VQLV 3E8HA 3SYQA 2A9HA 2NLJC 1QCEA 5B1AC 1HWYA 5CBHA 3D36A 2XAFA 3LSQA 5IDJA 1VQ5V 4PDLA 2HKOA 2WLLA 5CN0A 3ZN0A 3CCQV 1SERA 3K79A 1WPXA 4UV9A 1JVMA 1G8MA 1NR7A 4QJFB 4PA6A 4R50A 2P6JA 3ML0A 1PD3A 4XDKA 5BZBA 1TUEB 1M56B 3W7TA 2YEVA 5EBMC 2AHZA 5E1AC 4P9OA 3F5WC 1F4NA 4FJCC 4X88A 3HPLC 2EIJB 2R9IA 1ENVA 4JYBA 3ZMZA 4QIWF 2IH1C 1K7DA 1CP9A 4LBEC 3P30A 1V55B 3E8BA 3UKMA 2YSUB 3W7SA 3CPWU 3M99B 5H9CA 4UVCA 2NNUA 1KQSU 1K5SA 3K0DA 5EK0A 2ZXWC 2M7WA 2QE7G 3CCUV 3JD4A 1JJ2U 1COWG 4FK5C 4RQFA 1GM8A 2IH3C 4MVMA 4PA3A 3LDCA 2CK3G 3LDEA 3MD0A 3FB5C 3CCMV 2Q68A 3T4DA 3CCJV 2EIKB 2Y69C 4RO2A 3JD0A 1K92A 5LGNA 1M9NA 3OAAG 1QLEC 1W0JG 4RQEA 4JAUA 2Z5UA 1NVPD 1AI5A 3OUFA 3WG7B 4MW3A 1M90W 1QLEB 2JJ1G 1V54B 5L3CA 5L3FA 1Q81W 3AG1B 2WLLB 2ITDC 3BY6A 2QA4V 3IFXA 4CZZA 3ABUA 5IYBO 1Y4MA 3ZMTA 1K97A 4E2LA 1VQPV 1EFRG 3SJQC 2ZR2A 3DTUB 4UUJC 2WLMA 2X6AA 3OW2U 3ZRVA 3CC4V 2EINB 1S77D 2EJRA 1QVGU 1THZA 1DTOA 3K3WA 1M1KW 2OT5A 1FXKC 2OCCB 1XL6A 1AI7A 2H8PC 5L3GA 1QR8A 3ABMC 1FXKB 2OCCC 3ABLC 5B1OA 4RUFA 2W0FC 1RPOA 3ZIAG 1PNMA 2HG5C 3ABMB 3LDDA 5KA6A 2Q6AA 4KP4A 4MVRA 5IY5B 2ATKC 1QVFU 1FXVA 1NR1A 2IJJA 3MHSC 1VQKV 1E1QG 3RVZA 1H38A 1P7BA 3ETDA 5H6RA 3CCVV 4FIPC 1IXMA 1I5YA 1EBOA 1OCOC 2HVKC 3H01A 3K04A 4GT1A 3STZC 3AG2B 2IW5A 4MT8A 1QBZA 2XAGA 3SPCA 1RPRA 1Q86W 5GW7A 1NH2D 4MTOA 1VQ7V 1Q82W 3K0GA 4PA7A 3CCLV 3GWOA 3SPIA 1VQ8V 3MHHC 3ZRWA 4QE9A 1SETA 3ASNB 2JIZG 3OGCC 1WLEA 4RAIA 1S72V 3SPHA 4Z1MG 4JPRA 1LNQA 4G2KA 3OE7G 4N23A 3VBBA 1MSWD 2JK5C 4LP8A 2WWWA 3PJSK 5CBFA 3FB7C 1R73A 3CC2V 2DW4A 1NKDA 1YJNV 2JEUA 1W0KG 4I9WA 4X8AA 1OCRC 1AR1B 1QLNA 3E8FA 3JCZA 4OXSA 3OEHG 2ITCC 1BHAA 4TWKA 5DM6V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDJ A;  3K0D A;  1J95 A;  2Q69 A;  4GX1 A;  4HZ3 A;  4MSW C;  5EK0 A;  3SYO A;  2ZXW C;  2EIL C;  3F7V C;  4P9P A;  4BW5 A;  2A0L A;  2QKS A;  3ABK C;  4R8C A;  3UM7 A;  4J9Z B;  3LNM B;  3TET A;  2IH3 C;  4MVM A;  4PA3 A;  3IGA C;  4QNH B;  3LDC A;  3RW0 A;  3LDE A;  4RUE A;  1R3L C;  3ZJZ A;  4CBC A;  4JTA B;  3FB5 C;  3FB6 C;  1ZWI C;  2Q68 A;  3F7Y C;  3T4D A;  2Y69 C;  3K03 A;  4MVQ A;  4RO2 A;  4WFF A;  2X6C A;  3LUT B;  3ZRS A;  3SYP A;  4MTG A;  2WLK A;  3FB8 C;  2HFE C;  4MS2 A;  4MTF A;  2EIK C;  3OR6 C;  4JTD B;  4KFM A;  1QLE C;  4P30 A;  1V54 C;  1KKD A;  2WLH A;  3AG4 C;  1BL8 A;  1OCC C;  3BEH A;  3OR7 C;  3OUF A;  2WLI A;  3SPG A;  4MW3 A;  3SYC A;  3E8G A;  5CBG A;  3OUS A;  2R9R B;  2WLL B;  4DXW A;  3WG7 C;  3T1C A;  2ITD C;  4G28 B;  4WFE A;  3IFX A;  3X2Q C;  2A79 B;  3AG1 C;  3T4Z A;  3EFF K;  2QTO A;  1OCZ C;  2WLN A;  4XDL A;  4G27 B;  4PDV A;  5KUK A;  3E83 A;  4MVZ A;  5EBL C;  3SYA A;  3TCU A;  3SJQ C;  2EIN C;  2DYS C;  2K1E A;  3JYC A;  4MVO A;  4UUJ C;  5B1B C;  1R3J C;  2WLM A;  2KB1 A;  2X6A A;  3STL C;  2ZD9 A;  4J9Y B;  4EKW A;  1XL4 A;  4MVU A;  2Q67 A;  4X89 A;  1G4Y B;  2AHY A;  2DYR C;  1XL6 A;  2H8P C;  1M57 C;  3ABM C;  2OCC C;  4LCU C;  3E89 A;  3ABL C;  5IY5 C;  4RUF A;  2W0F C;  4GX5 A;  2HJF C;  2HVJ C;  2BOC C;  2HG5 C;  3AG3 C;  3LDD A;  5KUM A;  3VOU A;  2EIM C;  2Q6A A;  4F4L A;  4MVR A;  5EC1 C;  2ATK C;  2X6B A;  5B3S C;  3T2M A;  4HYO A;  3E8H A;  3RVZ A;  2A9H A;  3K08 A;  1P7B A;  2NLJ C;  3SYQ A;  5J9P C;  5B1A C;  2WLI B;  4PDM A;  5CBH A;  1OCO C;  2HVK C;  3K04 A;  3STZ C;  4PDL A;  2WLL A;  4JTC B;  3SPC A;  1JVM A;  4PA4 A;  3AG2 C;  4MTO A;  4R6Z A;  2BOB C;  4PA6 A;  3K0G A;  4PA7 A;  4R50 A;  4QE7 A;  2DWD C;  4GX0 A;  3SPI A;  2DWE C;  1M56 C;  3SPJ A;  3GB7 C;  4MVS A;  1ORQ C;  4WFG A;  3ASO C;  4XDK A;  5BZB A;  1K4D C;  4QE9 A;  2P7T C;  4P2Z A;  2YEV A;  2EIJ C;  3OGC C;  1K4C C;  4RAI A;  5EBM C;  3SPH A;  4R7C A;  2AHZ A;  3KG2 A;  1LNQ A;  5E1A C;  4ZBM A;  4P9O A;  3E86 A;  3ASN C;  3F5W C;  2JK5 C;  4X88 A;  4LP8 A;  3HPL C;  3PJS K;  3K06 A;  5CBF A;  1R3K C;  3FB7 C;  4WFH A;  5EC2 C;  2IH1 C;  2WLJ A;  4I9W A;  4X8A A;  4LBE C;  1OCR C;  4MW8 A;  3E8F A;  3E8B A;  4GX2 A;  4OXS A;  5EBW C;  3RBZ A;  3UKM A;  2ITC C;  3R65 A;  4PA9 A;  3RVY A;  4H37 A;  1R3I C;  4PDR A;  4H33 A;  1V55 C;  4TWK A;  1S5H C; 
#chains in the Genus database with same CATH topology
 5GTH Z;  1H2G A;  4J41 A;  2Q69 A;  1GMG A;  3QNE A;  5KHG A;  1U96 A;  1KP2 A;  2GDS A;  2ZT9 B;  1S3J A;  4JI3 O;  4LFA O;  3RW0 A;  3HKB B;  2F43 G;  1H2K A;  1PL0 A;  2XUM A;  2N74 A;  1IX9 A;  3EVK A;  1MMM A;  3FB8 C;  2GBO A;  5FNV B;  2WLH A;  1CEZ A;  2HLD G;  3CRM A;  4FLY A;  1VP7 A;  5KAI Z;  3ETE A;  3CCS V;  4NXM O;  2GHY A;  2BTQ B;  1YIJ V;  2DQ0 A;  2ZM6 B;  2Q73 A;  4DR5 O;  3KCX A;  1YHQ V;  4LF5 O;  2GV9 A;  5BY1 A;  3JAM N;  2UU9 B;  1F23 A;  4DV1 O;  5EYP A;  2O57 A;  2EBO A;  4MTX A;  2LW7 A;  3A0R A;  3A0B Z;  4B3M B;  2ODM A;  3RYH B;  2DYR C;  2PUS A;  3RYF B;  2ZQM A;  1GTO A;  1GK9 A;  2YI9 A;  4X1K A;  3THO A;  5HFM A;  2JRI A;  1FS0 G;  5D5P A;  2LW1 A;  2PYJ A;  5KAF Z;  2WA4 A;  1YSC A;  4K8X A;  2LFR A;  4YIP A;  2VS0 A;  4ZI7 A;  1TUB B;  2Y4T A;  4B3T O;  4GUN A;  3CRA A;  1YJ9 V;  1AJN A;  4UB8 Z;  1XBL A;  5HFL A;  5IYD O;  1BCC H;  1KUQ A;  1DF4 A;  1VF6 C;  2YIB D;  3G6E V;  4B3R O;  1OV9 A;  3TK1 A;  2H3O A;  2YXL A;  3D36 C;  2W0X A;  4W4L A;  3JAR B;  1O9G A;  5LGU A;  1S5L Z;  3E22 B;  3RBZ A;  1TVK B;  4H37 A;  1HNW B;  1RM1 B;  4JI4 O;  1SF9 A;  4LFB B;  4R8C A;  4FLX A;  4FFK A;  5LP6 C;  1KEC A;  3N27 A;  2Q7E A;  3ABK B;  3ETG A;  4DUZ O;  4J80 A;  1SZX A;  4JTA B;  2P90 A;  3W7W A;  2P5O A;  3NR7 A;  3ABT A;  1HW7 A;  3LUT B;  3SYP A;  3AG4 B;  1MNG A;  1TUB A;  1ARO P;  4JTD B;  1U97 A;  5DED A;  4DK0 A;  5CBG A;  4OX9 O;  2QKA A;  4DXW A;  3ZMU A;  1AR4 A;  1OCZ C;  5B66 Z;  4PDV A;  5LL6 Y;  2PTM A;  4LNU A;  4FLZ A;  2PI4 A;  3DXR B;  1HNZ O;  1HNW O;  1G6U A;  5CA3 A;  3K59 A;  4YXW G;  2VQF O;  1MZE A;  4X89 A;  5LHH A;  4FVM A;  1K8A W;  4DO2 A;  3ZN1 A;  1MZF A;  3OGI B;  2RN9 A;  2QJ1 A;  3L71 H;  3D3Q A;  5KUM A;  3VOU A;  3ZBH A;  3A8T A;  2YUA A;  2IU3 A;  3G71 V;  5ITZ A;  3P32 A;  2XND G;  1L0N H;  1T5E A;  1FYJ A;  1K73 W;  1BMF G;  2QR4 A;  4LWS A;  3L74 H;  4ZKI A;  1XMO O;  1XIL A;  3EHB B;  1PNK A;  1GN3 A;  4R6Z A;  3JAL A;  4X65 B;  4QE7 A;  1XI1 A;  1JPX A;  3VQV A;  3SPJ A;  5FNV A;  2EUL A;  2YXY A;  1B06 A;  1O9H A;  1ZL8 A;  4WFA V;  3APO A;  1K5Q A;  3RWR D;  1BZK A;  5JWP A;  3E86 A;  3AK3 A;  4DRX A;  4YY3 B;  1TVK A;  4B7K A;  3OTF A;  4X66 B;  1S5J A;  4O2A A;  2ZR3 A;  3RYC B;  4LFC O;  5LHG A;  1B3Q A;  1S5H C;  4X1I A;  4MSW C;  1YTF B;  1SC5 B;  1XHX A;  4UCR A;  2YS8 A;  2D2C B;  2LGW A;  3C90 A;  3CX5 F;  5FL7 G;  1PP9 H;  2UUB O;  1EM1 A;  1D2D A;  4PI0 A;  3CEI A;  4P30 A;  1KKD A;  1WN7 A;  5LA6 A;  3BEH A;  2IJI A;  2ZE6 A;  3K57 A;  2UXB O;  4TUY B;  1NZ6 A;  4K0K B;  2LQT A;  3CRR A;  4G27 B;  1ZX3 A;  2EIN C;  2QGN A;  5L3E A;  5LGT A;  2ZD9 A;  4TV8 A;  4O4H B;  3UO2 A;  1M57 B;  3CJH B;  2V7Q G;  1E79 G;  1NBM G;  3JAR A;  2F95 B;  2ZKO A;  4J7Z A;  3E22 A;  1IUR A;  3K5N A;  2QKC A;  2WSS G;  2OTL V;  1NS1 A;  3AG3 C;  2WAM A;  4F6R B;  3PN1 A;  3BCC H;  1UJW B;  5B3S C;  2E5L B;  4U3J A;  2ZE8 A;  2UXN A;  3FYE B;  3SYQ A;  2A9H A;  1QCE A;  5B1A C;  1HWY A;  2Q4P A;  1SER A;  4IHJ B;  3JCU Z;  5GTI Z;  1NR7 A;  5KX5 A;  5J2U A;  2FYU H;  4UCU A;  1WB7 A;  3W7T A;  2YEV A;  1Q8I A;  5EBM C;  1F4N A;  1ENV A;  3MDS A;  4DV0 B;  1HNX O;  4DR3 B;  4QIW F;  3S3X A;  1N34 O;  1AVM A;  3RYF A;  1V55 B;  4O4J B;  1BSM A;  4X1I B;  5EYP B;  1K5S A;  2F23 A;  3U10 A;  4E4E A;  1VF7 A;  2QE7 G;  3QF7 A;  1Y67 A;  5FLX N;  4PA3 A;  2Y0P A;  1EN6 A;  1LUV A;  3MD0 A;  1JJO A;  3B09 A;  5IJ9 A;  3CCM V;  2Q68 A;  5AG2 A;  1N4C A;  4FLU A;  5JCO A;  2YC0 A;  4JI0 B;  1W0J G;  2CH7 B;  4DUY O;  1AI5 A;  1AP6 A;  4MW3 A;  1QLE B;  4ABM A;  4U3J B;  3UCS C;  4LF8 O;  2F4V O;  4K0K O;  4C7U A;  4J7K A;  3ABU A;  4I4T B;  4PD4 F;  3GVM A;  3Q4H A;  4GYC B;  2ZR2 A;  4W4K A;  2N05 A;  2X6A A;  3ZRV A;  1Y74 B;  4CC6 A;  5JJJ B;  4O4L B;  2OT5 A;  1P84 F;  1Y6X A;  2YID A;  1XL6 A;  2H8P C;  5L3G A;  1QR8 A;  2FB5 A;  4RUF A;  1A32 A;  2W0F C;  4GKK B;  1PNM A;  2HG5 C;  4ZIB A;  5KA6 A;  2Q6A A;  5IY5 B;  2ATK C;  4OPA A;  4LFC B;  5K1P A;  3LNN A;  4D7S A;  4NTY A;  2HVK C;  5IJ0 B;  3K04 A;  3H01 A;  4DR1 B;  1I7F A;  4EEQ A;  1VQ7 V;  4PA7 A;  3CCL V;  4DV0 O;  3GWO A;  1YDX A;  1MA1 A;  3BAA A;  4QE9 A;  3VQY A;  2XT9 A;  2Q0O C;  3OGC C;  4RAI A;  1S72 V;  1GN6 A;  4JPR A;  4N23 A;  2JK5 C;  4LP8 A;  4FM1 A;  4B3S O;  4JI6 O;  4O2A B;  1NKD A;  1AR1 B;  4JI1 O;  3E8F A;  5C8Y B;  3JCZ A;  3HKC A;  2MW2 B;  3OEH G;  4NTW A;  2OYQ A;  4DRX B;  4NB5 A;  4A5U B;  2E74 B;  2OIE A;  4O4H A;  4AIL C;  4HZ3 A;  4ZOL A;  1BS3 A;  2LJ2 A;  5KHK A;  5LMU B;  4RWU A;  4XBF A;  4WBN A;  1L8D A;  3IGA C;  4QNH B;  4U7O A;  2BSK B;  2VWJ A;  4DR1 O;  4FPP A;  4TV9 B;  1ZWI C;  2EZO A;  2QM4 A;  4WFF A;  4HNA B;  4O4I A;  3FKS G;  4BIU A;  5E79 Z;  4MTG A;  4JI7 O;  1XMQ B;  3CCE V;  1QR9 A;  3SPG A;  5DEC A;  1M93 A;  2HJD A;  1OJH A;  3RYI A;  4JI7 B;  1B6Q A;  3T4Z A;  1R1B A;  3EFF K;  3DC6 A;  4NKG B;  5LHI A;  2XAH A;  4FLV A;  4JYY A;  1KC8 W;  4JI2 B;  1K34 A;  5EZY A;  2PY5 A;  3E35 A;  1D5N A;  4DV1 B;  2OIG A;  4PEL A;  4X1Y B;  1N34 B;  4JF3 A;  2YIB A;  5IWA B;  4DR3 O;  4AHC A;  1M57 C;  3QG5 A;  2DMX A;  1VQ9 V;  1YXB A;  4JI8 O;  1HR0 O;  4O4I B;  4UVB A;  1OCO B;  4JI5 B;  1MG1 A;  3RGB A;  4JAS A;  5IYC O;  4YJ2 A;  3H1H H;  3HKE B;  5C8Y A;  3AK2 A;  2ZDI C;  5FPO A;  3QO8 A;  1K4D C;  3CHX A;  2EJ7 A;  4UCV A;  1K4C C;  4LF4 O;  1SQV H;  1YTF D;  4R7C A;  4B08 A;  4WFH A;  1I5X A;  1AJP A;  3HR0 A;  5CA0 A;  2VRZ A;  3APQ A;  1WJZ A;  4MW8 A;  3R65 A;  4PA9 A;  1SKV A;  3B8N A;  2ZXW B;  4ZI7 B;  1AI4 A;  3G4S V;  3VQX A;  4XDJ A;  1J95 A;  3SYO A;  1VQ6 V;  3K5M A;  4WFB V;  2RNB A;  3TET A;  3LNM B;  3DXR A;  2AZ2 A;  2KG7 B;  3OFN G;  3K03 A;  2Y48 A;  3ZRS A;  1IZ3 A;  5JCO C;  2K9P A;  4MS2 A;  2L35 A;  2EIK C;  2XAS A;  2Y69 B;  1URF A;  3OR6 C;  4H0L B;  1S0V A;  2PZS A;  2KKW A;  5B5E Z;  4OPH A;  5GON B;  1PV0 A;  2PF4 E;  3FAV A;  4EB6 B;  3WG7 C;  1KD1 W;  4LF8 B;  4LF9 O;  2ILM A;  1RSO B;  2UUC B;  1MSD A;  3BPZ A;  4QPK A;  2K1E A;  4K3A A;  1NVP B;  1BQ0 A;  4J9Y B;  3OM3 B;  3CRQ A;  2CDY A;  5IE9 A;  4O2B A;  2CH7 A;  3I5D A;  3D8C A;  4ASU G;  2ETN A;  1VQM V;  4LR3 A;  2BTQ A;  2HR3 A;  1US6 A;  1IDS A;  2DN9 A;  3JAK A;  1HNX B;  3B4S A;  1HDJ A;  4JTC B;  2X0L A;  3AG2 C;  4LFB O;  4NXM B;  3BA9 A;  2DWD C;  4GX0 A;  1VQ4 V;  4JGS A;  1M56 C;  1XNQ B;  3HKB A;  3BHP A;  3WFV A;  2B9Z A;  2KQX A;  4WFG A;  3ZHQ A;  3DC5 A;  4LF9 B;  2EIJ C;  2YEV B;  2W6I G;  2BCC H;  4L87 A;  1R3K C;  1N33 B;  1XEQ A;  3ZHS A;  5EC2 C;  2AW9 A;  1NH2 B;  1QU7 A;  1JCH A;  2AXT Z;  3CWB H;  4GX2 A;  1I0H A;  2Q9L A;  3RVY A;  1NTZ H;  4PI2 A;  5KMG B;  1V55 C;  3J80 N;  1RFY A;  3UM7 A;  2Q7G A;  4J9Z B;  4CBC A;  5LBQ A;  2IM9 A;  1M4U A;  2ZDI A;  3DSQ A;  3H9V A;  1OCC C;  1ZAU A;  2GSM B;  3SYC A;  3ZHR A;  2LFS A;  2RDC A;  2ZCE A;  4TQD A;  3AK1 A;  4WFE A;  2CTW A;  2Z0A A;  1VQO V;  3SJC C;  2WLN A;  2JDI G;  1JFF B;  3RFR A;  1YEW A;  1F4M A;  1ZLZ A;  3L72 H;  2DYS B;  4J10 A;  4EKW A;  4YHH O;  4MVU A;  3ZX6 A;  3TXS A;  2QWN B;  4DV6 B;  1XNR O;  5LA6 B;  2KSD A;  2DYR B;  4LCU C;  4JAV A;  4QPJ A;  4KHP O;  5C93 A;  4F4L A;  1FAF A;  3TXQ A;  2DOS A;  4K35 A;  4DR4 B;  3JAW A;  5D5Q A;  1FD9 A;  1Y76 A;  3D36 A;  2XAF A;  4Z2W A;  1Z5V A;  2HKO A;  1WPX A;  1DK1 A;  5BXZ A;  4QJF B;  4R50 A;  2P6J A;  2ARH A;  4XDK A;  3KCY A;  3ZHT A;  5E1A C;  2P06 A;  4P9O A;  2A3Q A;  1N0N A;  4I4T A;  1KU9 A;  1Q3E A;  3E8B A;  3W7S A;  4X20 A;  1BGY H;  2NNU A;  4D7T A;  4LWS B;  4IGG A;  5EK0 A;  5KHI A;  2ZXW C;  2M7W A;  4I0X B;  4FZ0 A;  3JD4 A;  4FK5 C;  3O65 A;  2CTR A;  5JH7 A;  4RQF A;  4JI0 O;  2IH3 C;  4MVM A;  2CE4 A;  4I50 B;  1YF2 A;  2JS3 A;  3CCJ V;  4RO2 A;  1AP5 A;  4O2B B;  3OAA G;  1QLE C;  4DV7 O;  4LF7 B;  1XRE A;  5L3C A;  5L3F A;  4TQF A;  3AG1 B;  2WLL B;  1VAR A;  4YY3 O;  3AG7 A;  1Y4M A;  4DUZ B;  3N2K A;  4U3F H;  1RSO A;  3DTU B;  2EIN B;  4DV7 B;  2RMK B;  4DW1 A;  1S77 D;  2EJR A;  1QVG U;  1ZUQ A;  1DTO A;  4CC5 A;  5K1X A;  1M1K W;  1TAE A;  3T1H O;  2OCC B;  4DR7 B;  2VQE O;  1FXK B;  2KG7 A;  1RPO A;  3ZIA G;  3ABM B;  3LDD A;  1Q5O A;  1AB3 A;  4KP4 A;  4MVR A;  3OTO B;  3VQW A;  1IBM O;  2IJJ A;  2P4K A;  1E1Q G;  1N36 B;  5BMV A;  1IXM A;  1I5Y A;  1OCO C;  2Q8V A;  4GT1 A;  2IW5 A;  4MT8 A;  1QBZ A;  1UFI A;  1PL4 A;  4ZHQ B;  4JI3 B;  4D6T H;  4LFA B;  4X62 O;  4IIJ B;  1YVW A;  3K0G A;  4CH4 A;  3HKD A;  1SET A;  2GTA A;  3ASN B;  2JIZ G;  3K9S A;  4JYA O;  3SPH A;  3OE7 G;  4BWA A;  2F93 B;  5CBF A;  1R73 A;  2VQE B;  1NTK H;  1W0K G;  4X8A A;  3HKE A;  4OXS A;  4TUY A;  2ITC C;  1H2L A;  2AGA A;  4UCT A;  2UXB B;  2YI8 A;  2HHH O;  4TWK A;  3TGU H;  3H1J H;  4L8J A;  4GX1 A;  3B40 A;  4P9P A;  5B1N A;  1SQX H;  5KHH A;  4JV5 B;  4NTX A;  3SDL A;  4RUE A;  1R3L C;  1WP7 A;  5LMN O;  1LR1 A;  3J81 N;  3SR2 C;  4PJ0 Z;  4EFE A;  1NI8 A;  2Y0I A;  1V54 C;  4JI4 B;  1PNL A;  3FD9 A;  3OTO O;  2ZM6 O;  1IBM B;  4FMT A;  3I55 V;  1VF6 A;  2Q0A A;  3OUS A;  1OCC B;  2R9R B;  2WA3 A;  3DGE A;  3ZRX A;  1XQ8 A;  3X2Q C;  1W2B U;  3N2K B;  5CA0 B;  5KUK A;  2B1G A;  3E83 A;  1AJQ A;  3JYC A;  1R3J C;  4CH5 A;  1S76 D;  3IJ4 A;  2YXH A;  3OMA B;  1BHB A;  1K3E A;  4JV5 O;  3ABL B;  1JA8 A;  3ZMS A;  3P3P A;  1N32 B;  1CXZ B;  2B1I A;  1TGO A;  4TV9 A;  2QWP B;  2ZE5 A;  2EZP A;  3F5T A;  2V1D A;  2DQ3 A;  5EC1 C;  3ZRW B;  4BAY A;  4GLX A;  1Q7Y W;  4PHZ A;  2EIM B;  4F6R A;  2WLI B;  3QTC A;  1FPO A;  5LYJ A;  3FX7 A;  1HP8 A;  1TA8 A;  1L1F A;  2H94 A;  1Q6U A;  3UT5 B;  4GCZ A;  4TSF G;  2BOB C;  4TV8 B;  2DWE C;  4BW9 A;  3ASO C;  5H6Q A;  2P7T C;  1K9M W;  3H1L H;  1JQ0 A;  2A06 H;  1FFX B;  1NQT A;  1Q90 D;  3CRC A;  3JSN A;  4Q6G A;  1SA0 A;  2UXC O;  2CTP A;  1J5E B;  2B5U A;  2QWR B;  2NR5 A;  4CS2 A;  4BW5 A;  1WA8 A;  5LP6 B;  1VMG A;  1OHH G;  4UCO A;  4DR7 O;  4DR2 B;  4UV8 A;  2F1M A;  1MOF A;  2WPD G;  3CE2 A;  3FB6 C;  2X6C A;  2C2A A;  3RYC A;  2HFE C;  3AG4 C;  3OR7 C;  3A0H Z;  4WF9 V;  1FXH A;  1R6T A;  5LYJ B;  3L70 H;  2X7R B;  1ZSP A;  3CJH A;  1SQG A;  2UUA B;  3CXC U;  2A79 B;  2UUC O;  1JX9 A;  1JFF A;  4XDL A;  1GAX A;  5BMV B;  4MVZ A;  4ICG A;  1OCZ B;  1FFT B;  2F66 C;  4MVO A;  5B1B C;  4J7J A;  3JAL B;  3BA8 A;  3IC7 A;  1XL4 A;  2Q67 A;  4NXN O;  3CP1 A;  1N33 O;  3H1K H;  3E89 A;  2PGG A;  1QQC A;  2E5L O;  1K33 A;  1Y66 A;  2Q7H A;  4HYO A;  4H44 B;  4UXN A;  2OTJ V;  3LSU A;  5CB4 A;  2F4V B;  1IBL O;  2A7W A;  4FLT A;  1IVS A;  3JAT A;  1YI2 V;  2ADP A;  2XOK G;  1Z5W A;  3UO3 A;  1D5A A;  3GB7 C;  3D3I A;  3L75 H;  2QM7 A;  1AI6 A;  4P2Z A;  4ZBM A;  3SJA C;  4OX9 B;  3K06 A;  2QEX V;  1OCR B;  1YJW V;  2FML A;  3CMA V;  1SA0 B;  3CSX A;  1Z2G A;  3ZCC A;  1R3I C;  4PDR A;  4FZ1 A;  2IJH A;  4LF5 B;  2JVD A;  4YJ3 B;  3B8M A;  2Z3Y A;  2UUB B;  3F7V C;  3ZHU A;  1RM1 C;  2A0L A;  1HR0 B;  5F2V O;  3ZJZ A;  4WBN B;  1XHZ A;  5LMN B;  4AQY B;  1KYO F;  4MVQ A;  3R66 A;  4JI8 B;  5IWA O;  4DV4 B;  4X64 B;  1NJI W;  4B3R B;  3B77 A;  3KZI Z;  3ETQ A;  3WB2 A;  4O4J A;  5IT9 N;  2LO1 A;  3JAT B;  4JAA A;  3W7U A;  2QTO A;  3AEI A;  1IXB A;  3SJB C;  2ZE7 A;  1H2S B;  2YIC A;  2P4V A;  3G80 A;  3LSS A;  5BR8 B;  3FYI B;  4DV2 O;  2D3O W;  2AHY A;  4KXR A;  1Q6H A;  1V9P A;  1DGS A;  4NR1 A;  2JGD B;  4CH3 A;  2HJF C;  4LF4 B;  4B3M O;  1GO3 F;  4DV5 B;  4YIO A;  4B7E A;  1VEW A;  1DF5 A;  3EXA A;  4JYC A;  1AIL A;  3T2M A;  4GZR B;  3E8H A;  1I94 B;  2NLJ C;  4FM2 A;  1SQQ H;  5CBH A;  3LSQ A;  4AI8 A;  5IDJ A;  1VQ5 V;  4PDL A;  5JVD B;  2WLL A;  5CN0 A;  4BIO A;  4CH6 A;  3CCQ V;  1GN4 A;  3K79 A;  4UV9 A;  1JVM A;  1G8M A;  5H2F Z;  4DR5 B;  5JJN B;  1XNQ O;  3N2G A;  2CGN A;  1M56 B;  1X4T A;  4TOI A;  4CS4 A;  1WPB A;  3ZS8 C;  4LH7 A;  1ZL8 B;  3F5W C;  4FJC C;  4X88 A;  3HPL C;  2EIJ B;  4I7Z B;  3ZMZ A;  1KKC A;  1K7D A;  1CP9 A;  4QGP A;  4HBN A;  4X20 B;  2YSU B;  2JS5 A;  3CPW U;  1L0L H;  1IBK O;  4UVC A;  3TJT A;  5JVD A;  1KQS U;  3CCU V;  2OCH A;  4I55 B;  1JJ2 U;  2CK3 G;  3LDE A;  1GRJ A;  3O9O A;  3CS5 A;  3JD0 A;  1K92 A;  1PPJ H;  2FKX A;  4JI5 O;  2YIA A;  3L9D A;  5LOV B;  4RQE A;  4JAU A;  2Z5U A;  1NVP D;  3OUF A;  5JQG A;  1XUQ A;  1M90 W;  3JAS A;  1Q81 W;  1V54 B;  5LOV A;  3M7M X;  4DYL A;  1IBL B;  2CUG A;  2ITD C;  3BY6 A;  2QA4 V;  5JJE B;  3UT5 A;  4LNU B;  3IFX A;  4CZZ A;  1PM9 A;  3WB1 A;  3JAW B;  2E3C A;  1K97 A;  2JGD A;  2AZ0 A;  1Q6I A;  2QWQ B;  1WP8 A;  4UUJ C;  2WLM A;  1EN4 A;  3CC4 V;  5EIB D;  4DV3 O;  4LH6 A;  1THZ A;  3K3W A;  4I0X A;  1FFX A;  3MAQ A;  3RN4 A;  1AI7 A;  4BR6 A;  5J2T A;  3ABL C;  1X59 A;  1FXV A;  1SQB H;  1NR1 A;  3MHS C;  2VWK A;  1P7B A;  1M5I A;  3CCV V;  4FIP C;  3S3W A;  4CS3 A;  1EBO A;  4YJ3 A;  3HKD B;  5GW7 A;  1NH2 D;  4MTO A;  1Q82 W;  5IYZ A;  3OD4 A;  1WNS A;  1VQ8 V;  3ZRW A;  5IJ9 B;  3C3S A;  3K5O A;  1FJG B;  1WLE A;  2CGO A;  4GKK O;  4Z1M G;  2BE3 A;  1LNQ A;  1Y76 B;  3VBB A;  1MSW D;  4DV6 O;  3BRC A;  4JI6 B;  4B3S B;  4EFB A;  1YJN V;  2JEU A;  5KMG A;  1OCR C;  1QLN A;  5LXT B;  1LUW A;  5DM6 V;  2CAZ C;  1H8H G;  1GKF A;  2HP8 A;  2EIL C;  2W6J G;  3ABK C;  5KHJ A;  4DV5 O;  1VF5 B;  4NXN B;  2P22 C;  3OMN B;  1NTM H;  2XAJ A;  2GTS A;  4IT5 A;  4JZG A;  2N04 A;  4TT3 G;  4O4L A;  1YIT V;  3JAK B;  2IJK A;  1GM7 A;  2ZIN A;  2FTK A;  4F6E A;  3P3N A;  1RP3 B;  3AG1 C;  2GUZ B;  3B2E E;  4JYA B;  3JD1 A;  4NYK A;  1EZJ A;  1R6K A;  3CB2 A;  4FFB A;  5JH7 B;  3ZED A;  1FXK A;  4Q20 A;  3CXH F;  1XNR B;  3AG3 B;  2UU9 O;  5TIS Z;  2QTS A;  3IC9 A;  2UXX A;  3G6B A;  2BOC C;  5L3D A;  4YHH B;  2EIM C;  4DUY B;  1MAB G;  3QO5 A;  1J5E O;  3K08 A;  2V4D A;  4I5S A;  3A2F A;  3ZHV A;  4FLW A;  4J11 A;  3G67 A;  1P7G A;  2XHB A;  4DW0 A;  3K9A A;  5EIB C;  1EZV H;  3ASO B;  3RYH A;  1ORQ C;  1N8R W;  4WCE V;  3BVO A;  3ICX A;  4HAM A;  3ASN C;  3NXS A;  4LC1 A;  3GWK C;  1JOY A;  2Y4U A;  5BR8 O;  5EBW C;  3OEE G;  4H33 A;  1H8E G;  2IBZ H;  2L6L A;  4PV1 B;  5CMU A;  4N21 A;  4I55 A;  2RJZ A;  3RT3 C;  4LF6 B;  1JMK C;  3F7Y C;  1UPG A;  2E75 B;  2WLK A;  3JD3 A;  4KFM A;  4NVP A;  3E2E A;  5J2T B;  4X62 B;  1BT8 A;  1BL8 A;  2UXD O;  2PYL A;  2WLI A;  2LGQ A;  4LF6 O;  1H2M A;  3FFQ A;  3CME V;  2R70 A;  3CD6 V;  1KP3 A;  1SRY A;  2MK3 A;  2ZIO A;  4H13 B;  1F7Y A;  2ADQ B;  4KUM A;  5EBL C;  3SYA A;  2G38 A;  1CPY A;  3ZMV A;  2JGU A;  5CA1 A;  1G1X B;  1G4Y B;  1DLB A;  1YCI A;  3U11 A;  1P49 A;  4UVA A;  5B3S B;  2HVJ C;  3CCR V;  5EZY B;  5B1A B;  3FAV B;  4EB6 A;  1SQP H;  1PKX A;  2RQ6 A;  5J9P C;  3QVN A;  4X65 O;  2JEX A;  4PDM A;  4UFZ A;  3I56 V;  2XTA A;  1ZTE A;  1BE3 H;  4PA4 A;  2IU0 A;  3KKY A;  5CA1 B;  1WAZ A;  4MVS A;  4YJ2 B;  1N0J A;  3WB0 A;  1SZT A;  1JR9 A;  1ROP A;  4FFB B;  5L3B A;  3KG2 A;  2QSA A;  1R6N A;  2RCV A;  5ITZ B;  2GUZ A;  2WLJ A;  3CC7 V;  1GH6 A;  1FKA O;  4IL6 Z;  3BFR A;  3M8A A;  3J7A U;  1VQN V;  4DV2 B;  2DE0 X;  2HHH B;  1HNZ B;  3HKC B;  3Q4H B;  2XAQ A;  1E1R G;  3OT7 A;  2ZIM A;  1EN5 A;  2QKS A;  1OZ0 A;  4UB6 Z;  2EIL B;  3T1Y O;  1XMO B;  3T1H B;  3WU2 Z;  1BQZ A;  4K8Z A;  4IIJ A;  3JD2 A;  5DN6 G;  2PI5 A;  2R72 A;  4MTF A;  1KB9 F;  5GON A;  3W7X A;  2QM8 A;  4X64 O;  2LP7 A;  1P4R A;  1QNM A;  3E8G A;  5KLV H;  4KHP B;  3T1C A;  4G28 B;  3K5L A;  1AR5 A;  4DR4 O;  5LMU O;  4DV4 O;  3X2Q B;  4U7N A;  1YZB A;  2VQF B;  1F51 A;  4GKJ B;  3TCU A;  2DYS C;  2KB1 A;  1SES A;  2BSK A;  3STL C;  4AQY O;  5JQG B;  5B1B B;  1XDC A;  1I08 A;  1SS3 A;  3SGI A;  4BIZ A;  3QO7 A;  4GKJ O;  3HB3 B;  2HEP A;  3L73 H;  1GM9 A;  2JJ2 G;  3OMI B;  5IY5 C;  2P67 A;  2M6Y A;  3C3T A;  4GX5 A;  1FJG O;  5KA5 A;  2X6B A;  3RYI B;  1B04 A;  3CYO A;  1VQL V;  4B3T B;  1SQF A;  4JI2 O;  2BTO A;  4IHJ A;  3UQ8 A;  4UCS A;  3BAB A;  3ZN0 A;  1KMI Z;  4OGQ B;  4PA6 A;  2CTQ A;  4ZHQ A;  4LF7 O;  3U0Z A;  3ML0 A;  4I50 A;  4JZ2 A;  1PD3 A;  5BZB A;  1TUE B;  1XMQ O;  4DV3 B;  2AHZ A;  3N2G B;  5IJ0 A;  4FM0 A;  2R9I A;  4JYB A;  2IH1 C;  2R9A A;  4J42 A;  2EX3 A;  4LBE C;  2QDO A;  2OWO A;  3P30 A;  3UKM A;  3M99 B;  5H9C A;  4KL1 A;  3K58 A;  1WB8 A;  3K0D A;  1N36 O;  4X1Y A;  1GN2 A;  1COW G;  5CB4 B;  4JI1 B;  1GM8 A;  3LDC A;  2FL4 A;  1Q43 A;  2NN4 A;  3FB5 C;  4X9Q A;  3T4D A;  2EIK B;  2Y69 C;  5A2Q N;  5LGN A;  2YDE A;  5LXT A;  5J2U B;  5KX5 B;  2QWO B;  4DR6 B;  1M9N A;  3WG7 B;  4X66 O;  2JJ1 G;  5A9G A;  3H1I H;  5IYB O;  3ZMT A;  4E2L A;  1VQP V;  2ZNJ A;  1EFR G;  2ZNI A;  3IAY A;  3SJQ C;  1IBK B;  3OW2 U;  1NU1 H;  1VIB A;  5IYZ B;  4DR2 O;  1FXK C;  2UXC B;  3T1Y B;  4DK1 A;  3ABM C;  2OCC C;  5B1O A;  2Q5Z A;  4DR6 O;  1QVF U;  1NT2 B;  1W59 A;  1QHT A;  1VQK V;  3RVZ A;  1H38 A;  3ETD A;  5H6R A;  1I94 O;  3STZ C;  3AG2 B;  1KBH A;  1H2N A;  4Z1V A;  1WA8 B;  5LP6 A;  2XAG A;  3SPC A;  1RPR A;  1XOU A;  1Q86 W;  2UXD B;  3SPI A;  2DJV A;  3MHH C;  4IYH A;  4IYI A;  4G2K A;  4HNA A;  5H5N A;  2WWW A;  3PJS K;  4X1K B;  3FB7 C;  3CC2 V;  3JAS B;  2DW4 A;  2UUA O;  2E76 B;  5FPR A;  1N32 O;  4I9W A;  4I9Q A;  4ZOL B;  1BHA A;  3JSL A;  1Y74 A; 
#chains in the Genus database with same CATH homology
 1H2G A;  2Q69 A;  1H8H G;  1GMG A;  4GX1 A;  4HZ3 A;  1GKF A;  3QNE A;  2EIL C;  4P9P A;  2W6J G;  5B1N A;  3ABK C;  4XBF A;  1KP2 A;  3IGA C;  4QNH B;  4U7O A;  1S3J A;  3RW0 A;  4RUE A;  1R3L C;  2F43 G;  4FPP A;  3OMN B;  1PL0 A;  1ZWI C;  2EZO A;  2XAJ A;  4WFF A;  3FKS G;  4BIU A;  4MTG A;  3FB8 C;  1V54 C;  3CCE V;  1PNL A;  1QR9 A;  2WLH A;  1CEZ A;  2HLD G;  3SPG A;  4TT3 G;  4FMT A;  3I55 V;  1YIT V;  3CCS V;  3ETE A;  3OUS A;  2GHY A;  1GM7 A;  1OCC B;  2IJK A;  2R9R B;  3DGE A;  3ZRX A;  1YIJ V;  2FTK A;  1B6Q A;  3X2Q C;  2DQ0 A;  3AG1 C;  3T4Z A;  1W2B U;  3EFF K;  5LHI A;  2XAH A;  5KUK A;  2B1G A;  3E83 A;  1KC8 W;  3JD1 A;  1K34 A;  1YHQ V;  1AJQ A;  1EZJ A;  1R6K A;  3JYC A;  3E35 A;  1R3J C;  1S76 D;  1F23 A;  2EBO A;  4PEL A;  4MTX A;  3A0R A;  4JF3 A;  3OMA B;  1BHB A;  1K3E A;  2DYR C;  1FXK A;  3ABL B;  4Q20 A;  1M57 C;  3AG3 B;  3ZMS A;  2ZQM A;  1VQ9 V;  1GTO A;  1GK9 A;  5HFM A;  2B1I A;  2UXX A;  2BOC C;  5L3D A;  1FS0 G;  2EIM C;  2EZP A;  2V1D A;  2DQ3 A;  4UVB A;  5EC1 C;  3ZRW B;  1MAB G;  3QO5 A;  4BAY A;  1OCO B;  1Q7Y W;  2EIM B;  3K08 A;  4I5S A;  1YSC A;  2WLI B;  1MG1 A;  2LFR A;  1L1F A;  2H94 A;  3K9A A;  4JAS A;  5IYC O;  4GCZ A;  4TSF G;  2BOB C;  3ASO B;  2DWE C;  2ZDI C;  1YJ9 V;  1AJN A;  1ORQ C;  3ASO C;  1N8R W;  3QO8 A;  1K4D C;  5H6Q A;  4WCE V;  2P7T C;  1K4C C;  1K9M W;  1YTF D;  4R7C A;  5HFL A;  5IYD O;  4HAM A;  1JQ0 A;  3ASN C;  1DF4 A;  3G6E V;  3NXS A;  4LC1 A;  3TK1 A;  1JOY A;  4WFH A;  1I5X A;  1NQT A;  1AJP A;  5LGU A;  4MW8 A;  3RBZ A;  5EBW C;  3OEE G;  3R65 A;  4PA9 A;  4H37 A;  2B5U A;  3B8N A;  4H33 A;  1H8E G;  2ZXW B;  1RM1 B;  1AI4 A;  3G4S V;  4XDJ A;  1J95 A;  3SYO A;  4BW5 A;  1VQ6 V;  1OHH G;  4R8C A;  4WFB V;  3TET A;  3LNM B;  5CMU A;  1KEC A;  4N21 A;  4UV8 A;  3ABK B;  1MOF A;  2WPD G;  3ETG A;  3OFN G;  4JTA B;  3FB6 C;  2P90 A;  3F7Y C;  3K03 A;  3W7W A;  3ABT A;  2Y48 A;  2X6C A;  3LUT B;  3ZRS A;  3SYP A;  2C2A A;  3AG4 B;  2WLK A;  1ARO P;  2HFE C;  3JD3 A;  2XAS A;  2EIK C;  2Y69 B;  3OR6 C;  4JTD B;  4KFM A;  4MS2 A;  1S0V A;  3E2E A;  3AG4 C;  1BL8 A;  3OR7 C;  2WLI A;  4WF9 V;  1FXH A;  5CBG A;  3CME V;  3CD6 V;  2X7R B;  1KP3 A;  1SRY A;  2MK3 A;  4DXW A;  3WG7 C;  1KD1 W;  3CXC U;  3ZMU A;  2A79 B;  1JX9 A;  4XDL A;  1OCZ C;  4PDV A;  4KUM A;  4QPK A;  4MVZ A;  5EBL C;  3SYA A;  2PI4 A;  1OCZ B;  2K1E A;  1FFT B;  4MVO A;  5B1B C;  1NVP B;  5CA3 A;  1CPY A;  3IC7 A;  4J9Y B;  3OM3 B;  1XL4 A;  3ZMV A;  4YXW G;  4X89 A;  2Q67 A;  5LHH A;  1G4Y B;  1K8A W;  4DO2 A;  3ZN1 A;  3CP1 A;  1DLB A;  3E89 A;  4UVA A;  5B3S B;  2HVJ C;  4ASU G;  5KUM A;  3VOU A;  3CCR V;  5B1A B;  1K33 A;  2IU3 A;  1VQM V;  1Y66 A;  3G71 V;  1PKX A;  2HR3 A;  2XND G;  3P32 A;  4HYO A;  5J9P C;  4UXN A;  2OTJ V;  1K73 W;  1BMF G;  2JEX A;  4PDM A;  3I56 V;  4JTC B;  2X0L A;  4ZKI A;  1YI2 V;  4PA4 A;  3AG2 C;  2IU0 A;  3EHB B;  1PNK A;  4R6Z A;  2XOK G;  4QE7 A;  2DWD C;  4GX0 A;  1VQ4 V;  1JPX A;  4JGS A;  3SPJ A;  1M56 C;  3GB7 C;  4MVS A;  1SZT A;  3D3I A;  3WFV A;  2QM7 A;  4WFG A;  1ROP A;  4WFA V;  1AI6 A;  1K5Q A;  4P2Z A;  2EIJ C;  5L3B A;  3KG2 A;  4ZBM A;  3E86 A;  1R6N A;  2YEV B;  2W6I G;  3K06 A;  4L87 A;  2QEX V;  1R3K C;  1OCR B;  1YJW V;  5EC2 C;  3CMA V;  1NH2 B;  2WLJ A;  3CC7 V;  1JCH A;  4GX2 A;  3ZCC A;  3RVY A;  2ZR3 A;  1R3I C;  1VQN V;  4PDR A;  5LHG A;  2IJH A;  1V55 C;  1S5H C;  4MSW C;  1YTF B;  3B8M A;  2Z3Y A;  2XAQ A;  3F7V C;  1E1R G;  1RM1 C;  2A0L A;  2QKS A;  1OZ0 A;  3UM7 A;  4J9Z B;  2EIL B;  3ZJZ A;  5FL7 G;  4CBC A;  5LBQ A;  4MVQ A;  3JD2 A;  5DN6 G;  2PI5 A;  2ZDI A;  4MTF A;  4P30 A;  3W7X A;  1KKD A;  2QM8 A;  1OCC C;  3BEH A;  2LP7 A;  2IJI A;  2GSM B;  3SYC A;  1NJI W;  1P4R A;  3B77 A;  3E8G A;  2LFS A;  3T1C A;  4G28 B;  4WFE A;  1VQO V;  3W7U A;  2QTO A;  2WLN A;  2JDI G;  4G27 B;  3AEI A;  3X2Q B;  4U7N A;  1F51 A;  3TCU A;  2EIN C;  2DYS C;  5L3E A;  1F4M A;  5LGT A;  2KB1 A;  1SES A;  2ZD9 A;  3STL C;  3LSS A;  2DYS B;  5B1B B;  4EKW A;  3FYI B;  1M57 B;  4BIZ A;  3QO7 A;  3HB3 B;  2V7Q G;  4MVU A;  2D3O W;  1E79 G;  2AHY A;  1NBM G;  1GM9 A;  2JJ2 G;  2DYR B;  4LCU C;  3OMI B;  5IY5 C;  2P67 A;  2WSS G;  4GX5 A;  4JAV A;  2OTL V;  2HJF C;  4QPJ A;  1GO3 F;  3AG3 C;  2WAM A;  5C93 A;  4F4L A;  5KA5 A;  2X6B A;  1UJW B;  5B3S C;  1DF5 A;  4JYC A;  3T2M A;  2UXN A;  3CYO A;  3FYE B;  1VQL V;  3E8H A;  3SYQ A;  2A9H A;  2NLJ C;  1QCE A;  5B1A C;  1HWY A;  5CBH A;  3D36 A;  2XAF A;  3LSQ A;  5IDJ A;  1VQ5 V;  4PDL A;  2HKO A;  2WLL A;  5CN0 A;  3ZN0 A;  3CCQ V;  1SER A;  3K79 A;  1WPX A;  4UV9 A;  1JVM A;  1G8M A;  1NR7 A;  4QJF B;  4PA6 A;  4R50 A;  2P6J A;  3ML0 A;  1PD3 A;  4XDK A;  5BZB A;  1TUE B;  1M56 B;  3W7T A;  2YEV A;  5EBM C;  2AHZ A;  5E1A C;  4P9O A;  3F5W C;  1F4N A;  4FJC C;  4X88 A;  3HPL C;  2EIJ B;  2R9I A;  1ENV A;  4JYB A;  3ZMZ A;  4QIW F;  2IH1 C;  1K7D A;  1CP9 A;  4LBE C;  3P30 A;  1V55 B;  3E8B A;  3UKM A;  2YSU B;  3W7S A;  3CPW U;  3M99 B;  5H9C A;  4UVC A;  2NNU A;  1KQS U;  1K5S A;  3K0D A;  5EK0 A;  2ZXW C;  2M7W A;  2QE7 G;  3CCU V;  3JD4 A;  1JJ2 U;  1COW G;  4FK5 C;  4RQF A;  1GM8 A;  2IH3 C;  4MVM A;  4PA3 A;  3LDC A;  2CK3 G;  3LDE A;  3MD0 A;  3FB5 C;  3CCM V;  2Q68 A;  3T4D A;  3CCJ V;  2EIK B;  2Y69 C;  4RO2 A;  3JD0 A;  1K92 A;  5LGN A;  1M9N A;  3OAA G;  1QLE C;  1W0J G;  4RQE A;  4JAU A;  2Z5U A;  1NVP D;  1AI5 A;  3OUF A;  3WG7 B;  4MW3 A;  1M90 W;  1QLE B;  2JJ1 G;  1V54 B;  5L3C A;  5L3F A;  1Q81 W;  3AG1 B;  2WLL B;  2ITD C;  3BY6 A;  2QA4 V;  3IFX A;  4CZZ A;  3ABU A;  5IYB O;  1Y4M A;  3ZMT A;  1K97 A;  4E2L A;  1VQP V;  1EFR G;  3SJQ C;  2ZR2 A;  3DTU B;  4UUJ C;  2WLM A;  2X6A A;  3OW2 U;  3ZRV A;  3CC4 V;  2EIN B;  1S77 D;  2EJR A;  1QVG U;  1THZ A;  1DTO A;  3K3W A;  1M1K W;  2OT5 A;  1FXK C;  2OCC B;  1XL6 A;  1AI7 A;  2H8P C;  5L3G A;  1QR8 A;  3ABM C;  1FXK B;  2OCC C;  3ABL C;  5B1O A;  4RUF A;  2W0F C;  1RPO A;  3ZIA G;  1PNM A;  2HG5 C;  3ABM B;  3LDD A;  5KA6 A;  2Q6A A;  4KP4 A;  4MVR A;  5IY5 B;  2ATK C;  1QVF U;  1FXV A;  1NR1 A;  2IJJ A;  3MHS C;  1VQK V;  1E1Q G;  3RVZ A;  1H38 A;  1P7B A;  3ETD A;  5H6R A;  3CCV V;  4FIP C;  1IXM A;  1I5Y A;  1EBO A;  1OCO C;  2HVK C;  3H01 A;  3K04 A;  4GT1 A;  3STZ C;  3AG2 B;  2IW5 A;  4MT8 A;  1QBZ A;  2XAG A;  3SPC A;  1RPR A;  1Q86 W;  5GW7 A;  1NH2 D;  4MTO A;  1VQ7 V;  1Q82 W;  3K0G A;  4PA7 A;  3CCL V;  3GWO A;  3SPI A;  1VQ8 V;  3MHH C;  3ZRW A;  4QE9 A;  1SET A;  3ASN B;  2JIZ G;  3OGC C;  1WLE A;  4RAI A;  1S72 V;  3SPH A;  4Z1M G;  4JPR A;  1LNQ A;  4G2K A;  3OE7 G;  4N23 A;  3VBB A;  1MSW D;  2JK5 C;  4LP8 A;  2WWW A;  3PJS K;  5CBF A;  3FB7 C;  1R73 A;  3CC2 V;  2DW4 A;  1NKD A;  1YJN V;  2JEU A;  1W0K G;  4I9W A;  4X8A A;  1OCR C;  1AR1 B;  1QLN A;  3E8F A;  3JCZ A;  4OXS A;  3OEH G;  2ITC C;  1BHA A;  4TWK A;  5DM6 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...