2HG5C

Cs+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB HEAVY CHAIN
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
molecule tags Membrane protein
total genus 21
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hg5C00
3ABMC 4PA7A 1P7BA 4HYOA 3X2QC 3FB8C 5EBLC 2EILC 1K4DC 3JYCA 4X88A 2WLMA 4KFMA 2WLLB 2A79B 4WFGA 3RBZA 4GX2A 4LBEC 3K03A 3SJQC 2HFEC 4LP8A 3E8GA 3UM7A 3T2MA 3E86A 2EIMC 2A9HA 3K0GA 4MVRA 1M56C 3ABLC 2A0LA 4OXSA 4WFFA 2EINC 3F7VC 5EBMC 4R6ZA 4PA4A 1ZWIC 1BL8A 1J95A 3EFFK 4PDLA 4PDVA 1V54C 4RUFA 4P30A 1XL4A 2Q68A 2H8PC 3LNMB 3PJSK 4JTDB 4QE9A 1K4CC 2EIKC 2IH1C 3LDCA 2DWDC 4PDRA 1OCZC 4QNHB 4RO2A 4XDKA 2DWEC 2R9RB 5E1AC 3E83A 4HZ3A 3SPIA 1OCRC 3E89A 2WLNA 4GX0A 4MTGA 4G27B 3SYOA 2IH3C 4WFEA 4QE7A 2BOBC 4H37A 3SPGA 3T4DA 5B3SC 3ZRSA 2Q6AA 3AG2C 1OCOC 5CBHA 2X6CA 3HPLC 2Q67A 2HVKC 4X8AA 5KUKA 2KB1A 1R3KC 2YEVA 4MW8A 3STZC 4MSWC 4EKWA 5B1AC 3LUTB 3WG7C 4DXWA 3VOUA 4GX1A 4MVOA 3ABKC 5EBWC 2WLHA 2Q69A 5B1BC 1M57C 3E8FA 3FB7C 4P9PA 1S5HC 5J9PC 3GB7C 3K0DA 3ASNC 2K1EA 4MVZA 4RAIA 5EC1C 4BW5A 4X89A 4CBCA 4MVMA 4PA9A 4MTOA 3OR7C 3E8BA 3SYQA 2DYRC 3SYAA 3SPCA 3ZJZA 2BOCC 3R65A 2HJFC 3ASOC 1XL6A 3SPJA 2ATKC 5CBGA 4WFHA 4G28B 4RUEA 4ZBMA 2WLKA 5CBFA 4JTCB 3T1CA 2DYSC 3FB5C 3SYCA 2OCCC 3T4ZA 4R50A 2WLIB 1QLEC 3BEHA 4XDLA 1KKDA 4R7CA 4PDMA 4I9WA 3OUSA 3LDEA 4MVSA 2W0FC 3IFXA 3RW0A 3K04A 2QKSA 3IGAC 1R3LC 2HG5C 1R3IC 3KG2A 2AHZA 1G4YB 4GX5A 2HVJC 4LCUC 4MTFA 3SYPA 3AG4C 4PA3A 1JVMA 2JK5C 2NLJC 4PA6A 3TETA 4P2ZA 3E8HA 4J9YB 4MVUA 3TCUA 5IY5C 2X6BA 5BZBA 3K08A 3K06A 1R3JC 4UUJC 2ZD9A 1LNQA 2WLIA 4H33A 3SPHA 4J9ZB 2ZXWC 4TWKA 3STLC 4MVQA 3LDDA 2WLJA 2QTOA 2X6AA 3UKMA 3OGCC 4JTAB 5EC2C 3OUFA 1ORQC 3AG3C 3FB6C 3AG1C 2ITDC 4MW3A 2Y69C 4MS2A 2AHYA 4F4LA 3OR6C 2ITCC 3F7YC 4P9OA 2P7TC 4R8CA 2WLLA 1OCCC 1V55C 3RVYA 4XDJA 3F5WC 5KUMA 2EIJC 3RVZA 5EK0A
chains in the Genus database with same CATH superfamily
1VQNV 1AJNA 1U97A 3K03A 2UUCO 4KHPO 4JI3O 3E8GA 1VEWA 3ABLC 3OMAB 2DW4A 3FD9A 2VRZA 4B7KA 4G2KA 2Y4TA 3ETGA 5IDJA 2JRIA 2ZE6A 1S5LZ 5KLVH 5LYJA 1H8HG 1PNKA 5JJNB 1KC8W 4Z2WA 2WWWA 5JJJB 2QKAA 4L8JA 2V7QG 1NU1H 3ABKB 5B3SC 2ZDIC 4B7EA 2YIBA 4J42A 2BCCH 2ZR2A 4JYBA 5KUKA 4O2AA 4KXRA 1K73W 2Q9LA 4WFBV 1HNXO 1E1QG 1K9MW 3IC9A 2UU9B 1IBKO 3U0ZA 5TISZ 1IVSA 1BHBA 4J10A 4X66B 4PJ0Z 3CCEV 1VQ8V 2Q7HA 5KAFZ 3ZRWB 5L3DA 4I55A 1THZA 1I5XA 1D5AA 3ZRVA 1TUEB 5JQGA 1W2BU 1TAEA 2G38A 2WLIB 3LSSA 1RM1B 4YY3O 3QVNA 3OTOB 3P30A 4GX5A 2LW7A 4QPKA 3N2KA 2HR3A 2RNBA 4LCUC 4YJ2A 4BR6A 1AVMA 3ZN1A 3D36C 2KG7B 1F4NA 2GUZA 1IDSA 3SPHA 3CCVV 1QVGU 3ZS8C 3J7AU 1QVFU 3OE7G 4MW3A 1J5EB 4LR3A 2AXTZ 2Y69C 2WLLA 1N33O 5L3CA 2JEXA 3JYCA 3OEEG 1YF2A 3RYHB 3HKEB 2IJHA 1KB9F 2E75B 1ENVA 1ZUQA 1XEQA 3ZHRA 1N32B 4UCOA 4DK1A 3OTFA 5LOVB 1TVKA 1VP7A 3WB0A 4NR1A 3ZX6A 3AG7A 4GT1A 2OYQA 1H2KA 4BIOA 4QNHB 2O57A 4E4EA 1SC5B 4MTGA 2LP7A 3CE2A 2IH3C 3SPGA 3AG2C 2PGGA 1NTZH 3HPLC 2Q67A 4CC6A 1JFFB 3JAWB 1XUQA 1WPXA 3K79A 3T1YB 1XNRO 3ABKC 1RFYA 2F66C 5JVDB 1TGOA 3JALB 2Y48A 3CRRA 5LGTA 1P7GA 3ASNC 5EC1C 4DRXA 1EBOA 5C8YA 3VQYA 4DUZB 3R65A 3WG7B 2V1DA 5B1NA 3K59A 4JI6O 2ZKOA 1B6QA 4ZOLA 2ZE5A 4U3FH 3RN4A 2LFRA 4MT8A 3BVOA 1QLEC 1XI1A 5LL6Y 2UXXA 3K04A 2LFSA 1YJNV 4J7ZA 1PD3A 2UUAB 2RDCA 3UO2A 2DE0X 3E8HA 2PYJA 1E1RG 4B08A 4O4IA 3JD3A 2MW2B 3HB3B 5FPOA 1AROP 3FB6C 5KX5B 1GN6A 5H6RA 2Y0IA 4YHHB 3B8MA 4DUZO 1CXZB 4ZHQA 5KUMA 3OAAG 1NZ6A 3RYIA 4IHJB 3RYCB 4BIUA 2FB5A 1MNGA 2ILMA 1WP7A 3H1LH 4OXSA 4CS4A 4I7ZB 3QF7A 4LWSB 1SQBH 1XMQB 3X2QB 2EILB 4DR2O 4WFAV 1HNWB 4JYYA 2EIKC 5CA1B 4DR1B 1OCZC 1PPJH 4DR5B 2EINB 4PD4F 3HKBB 4AILC 2UXDO 3SYOA 2RCVA 2IJJA 2BOBC 3ZRSA 4WF9V 1R6NA 2GTSA 1YVWA 3JSNA 3STZC 2H94A 2V4DA 1SERA 3JARA 3HR0A 1H2MA 2WA4A 2B1IA 4I50A 3ZBHA 3GB7C 1YJWV 3L9DA 3ZMVA 4PA9A 3SYQA 3SPCA 4X1KB 1FXKA 4DV5O 4DR3B 3ZMUA 4N21A 4X20B 5IJ9B 3ABTA 4O4JB 4RUEA 1M90W 1QR8A 1WN7A 2DYSC 4DV6O 4I0XB 2W0XA 1HNWO 1BMFG 2PI5A 1BZKA 4MVSA 5KA6A 4JI2B 1BT8A 3KCXA 5D5PA 1K92A 2N74A 2FYUH 1EZVH 4PA6A 1YJ9V 1JX9A 2BSKA 5BZBA 2FTKA 5EZYB 2PI4A 1NS1A 1M5IA 1YSCA 1G8MA 1OV9A 2FKXA 4MVQA 2WA3A 4J7JA 3OUFA 1UFIA 1H2LA 3RYFA 3CC4V 2PUSA 2YIBD 2YI8A 2LJ2A 1PL4A 1H8EG 1JQ0A 4XDJA 3SGIA 4RQEA 1VQOV 2A06H 4FPPA 1KMIZ 2K9PA 4YIPA 3CS5A 4WFGA 1DTOA 4CC5A 4H0LB 2GDSA 3QG5A 5JWPA 1VQ5V 1FKAO 4X1YB 5LHIA 4R6ZA 4UCRA 4FVMA 4D7TA 4JI2O 4JAUA 1Y4MA 4ICGA 2Q68A 3PJSK 2D3OW 4OX9B 5BR8O 2IH1C 1M56B 3FAVB 4UCUA 1YI2V 3N2GB 3CRAA 4B3MO 2OIEA 2P4VA 3E2EA 4YJ3B 4LF8B 2JGUA 4J80A 5LHHA 1HWYA 4K8ZA 1VF6A 1IURA 1COWG 4LF6B 4RAIA 4BW5A 1WJZA 2DJVA 4WBNB 1CEZA 3ZJZA 2HP8A 2HJFC 1NBMG 3OW2U 3A0HZ 2Q7GA 4O4LA 1L0NH 3CP1A 2DOSA 4BWAA 3A2FA 3I5DA 3BFRA 5JCOC 3JAKB 1YCIA 1R6TA 4UCTA 1K3EA 3T1CA 1SA0B 2YS8A 3L70H 2OCCC 1FS0G 3IAYA 1W59A 4DV0B 3B8NA 3OUSA 1WB7A 1KUQA 3JASA 2W0FC 5JH7A 2Z0AA 4JI7B 1Y74A 3HKCA 1G4YB 1AI4A 3J81N 2W6JG 4P2ZA 4J9YB 5D5QA 3AG1B 2HHHB 2F95B 5BY1A 4H33A 5DECA 2UXBB 5HFLA 4CS3A 1XREA 5CN0A 1EN4A 3R66A 3OGCC 4B3RO 3QTCA 3LNNA 4LF6O 4F6RA 3QO7A 4P9OA 4LF5O 2YXHA 1Y66A 1XMOB 5ITZA 3PN1A 4JPRA 3CCLV 1Z5VA 2WLMA 3BAAA 1H2SB 1MMMA 4I9QA 1KP3A 3E22B 3K0GA 2IU0A 2Q0OC 5FNVB 1OCCB 1ROPA 1TA8A 4I4TB 4PA4A 3MAQA 5BMVB 2CDYA 4WCEV 4PDVA 2LGQA 1XL4A 3EHBB 1VQ4V 2QWNB 1MOFA 3CJHB 3T1HB 4AI8A 2XAGA 1M93A 4XDKA 1OZ0A 1N0JA 3E89A 1MSDA 4I5SA 4H37A 5J2TB 1FD9A 1YITV 1FYJA 2C2AA 2R70A 1S5JA 3NXSA 1M4UA 1EZJA 4LF4O 2YEVB 4NB5A 1XQ8A 4JASA 3M7MX 3ZRWA 2QTSA 1GN2A 1JA8A 1F4MA 2WLKA 4PV1B 3UCSC 5KHJA 1IXBA 4DV4B 3SYCA 3SJBC 5B66Z 1V9PA 2XHBA 4PDMA 1N34O 3A8TA 2KG7A 3IFXA 1R3LC 1R3IC 4JYAO 4JI0O 2LGWA 3ZMSA 2IU3A 4LF9B 1BSMA 1SETA 1RPOA 1KECA 3K06A 3ETQA 3UQ8A 4ASUG 1JMKC 4X64B 2P6JA 4CH5A 1VQ7V 2AGAA 3G4SV 3AG1C 4JGSA 2R9IA 3RFRA 1BQ0A 2A7WA 2EIJC 4ZBMA 2W6IG 3HKEA 4JYCA 3RYHA 3ABMC 4AQYO 4O2BB 4LBEC 3SJQC 3JCZA 2Y69B 4DV4O 1QU7A 2GHYA 1GO3F 2ZE8A 3F7VC 4FLUA 3JATA 3JSLA 1FXHA 1S76D 5L3BA 2DQ3A 4FLTA 1N0NA 4FFKA 4KUMA 3LDCA 4PDRA 2YUAA 2QEXV 5B1AB 2DWEC 5E1AC 3RT3C 2EBOA 2WLNA 3JAWA 3K58A 2E5LO 3C3TA 2ZIOA 5FL7G 4GZRB 5JVDA 4UVBA 3JALA 2Y4UA 1XDCA 5EBWC 3DXRA 3CCSV 4P9PA 1H2NA 3AG2B 3HKDA 4X89A 1Q6UA 4TT3G 4MTOA 3BA8A 2QKCA 2BOCC 4LFAB 1FFXB 4PELA 4JTCB 1DF4A 1ZL8B 3ASNB 1K5QA 4IIJB 2CH7B 4NXMO 3CRCA 3FYIB 1XNQO 5CB4B 1H38A 1NH2B 1AILA 2CTPA 4JI8B 3L73H 3JAMN 3OEHG 1QLEB 4DR7B 3J80N 2N05A 3AK2A 3L72H 2CAZC 5H5NA 2PYLA 4DO2A 2ZE7A 2ITCC 5GONB 4Z1VA 4IHJA 1XILA 3RYCA 1V55C 1Y67A 5L3EA 1P7BA 4LFAO 5JJEB 4KFMA 2ETNA 3B4SA 2EZOA 2ZM6B 4X1IB 3B40A 1D2DA 2A9HA 4K3AA 5EYPB 5KMGA 1VF6C 1US6A 2JJ1G 4DV3B 4NXNB 3CXHF 2UU9O 3KKYA 1KKCA 1VF7A 3HKBA 4JI4B 2ZINA 3K5NA 2QDOA 1ZLZA 4X66O 2UXNA 3BHPA 2KSDA 4U3JB 1Q8IA 4B3SB 4DR7O 3K9AA 2H3OA 1WB8A 3P3PA 2KB1A 5B1AC 3M99B 2EIKB 1NR1A 1OCZB 4LH7A 3OTOO 4X1KA 3FB7C 1MZEA 4X20A 1KD1W 5IJ9A 4FMTA 5IYCO 3E8BA 3SYAA 4W4KA 1QCEA 4JI5B 4DR4B 1UPGA 1EFRG 1NQTA 4EEQA 3D3IA 1WPBA 1TUBA 4Q6GA 4BAYA 1Z2GA 1J5EO 1I94B 1A32A 1QR9A 4JI4O 4LNUB 4JAAA 3QNEA 1SQXH 1KKDA 5LMNB 1X4TA 3KG2A 4B3SO 4OPHA 3W7XA 1VQLV 2Q5ZA 2DYSB 1NH2D 1XHXA 2YDEA 4YXWG 1N32O 4UUJC 1GM8A 4B3TB 4J9ZB 1NTKH 3STLC 3LDDA 4UV8A 2XAFA 3CB2A 2X7RB 3K5LA 4GLXA 2AHYA 3JD4A 3ZEDA 1LR1A 5IYBO 2P7TC 2PTMA 1RSOB 1WP8A 3QO8A 5LYJB 4CH6A 2UXCB 5GTHZ 5LBQA 1KU9A 4X1YA 4CS2A 3LSUA 4DV7B 2YC0A 2F4VB 4FK5C 4BIZA 1I94O 2E74B 1HR0B 3S3XA 3T1YO 3G71V 4QJFB 4K0KB 1KYOF 4GKJB 4UB6Z 1YIJV 3LNMB 2HLDG 3OMIB 3GWKC 1S72V 5A2QN 2ADPA 4GX0A 1LUVA 2XASA 4YJ3A 1SQPH 4EKWA 4MSWC 3LUTB 3VOUA 3ZCCA 4MVOA 4WBNA 5IYDO 4I55B 4X65B 1Q82W 1KBHA 2UUAO 2IW5A 3CMAV 3ZMTA 3A0RA 3AEIA 4CH4A 5LA6B 2BTOA 3JAKA 3DC6A 3CRMA 3JCUZ 1SA0A 3N2KB 1S0VA 2QSAA 2Z3YA 2DMXA 4FLYA 4GKJO 4X9QA 1Q81W 1R73A 4YHHO 4XDLA 1SQVH 3AK1A 1P4RA 1T5EA 4PI0A 1EM1A 3CX5F 4EB6A 4K35A 3SYPA 3ZHSA 4GYCB 3CCJV 4UVAA 1E79G 2OCCB 3TCUA 2DN9A 3UT5A 5IYZA 1N36B 1DF5A 1WA8A 2QJ1A 4TQDA 1YTFB 1XMQO 2Q8VA 1I0HA 1L8DA 3CYOA 5EC2C 3AG3C 1IXMA 5LP6C 2OIGA 4DV1B 1YHQV 2F1MA 4DR1O 1YXBA 4DR5O 3QO5A 4TUYB 2YICA 1Q43A 3E22A 1P84F 2ADQB 1K4DC 1AB3A 4I4TA 3H1HH 1V54B 3UM7A 5BMVA 1Q86W 1QBZA 2P06A 1FAFA 5EBMC 3CJHA 2WAMA 3N27A 4NVPA 3L74H 1J95A 1Q6IA 3I55V 2JGDB 1SRYA 1SQFA 2H8PC 4QE9A 1K5SA 1FFTB 5J2TA 4DR3O 5LMUB 1EN6A 4EFEA 1HNZB 3CD6V 2QM4A 4DRXB 2HEPA 5CBHA 2X6CA 1KP2A 4X8AA 1OHHG 2YEVA 3APQA 3CCQV 3THOA 1SQQH 2Q73A 2LW1A 2ZDIA 1GK9A 4DV1O 5K1PA 3ML0A 1AJQA 4ZOLB 1EN5A 1M57C 1S5HC 5IWAB 5KHKA 2JS5A 4MVZA 4TV9A 4MVMA 3GVMA 3L71H 1PP9H 2CK3G 4X62B 2B5UA 1VQ6V 4U7OA 4FJCC 2YXYA 2YI9A 2NNUA 1AI6A 5AG2A 2YIAA 3W7SA 3B09A 1VQKV 2QA4V 1PL0A 1F23A 5GW7A 4IT5A 3D8CA 1FJGB 1PNLA 4QPJA 5DN6G 1I5YA 3IGAC 2HG5C 4HNAA 5EIBD 1CPYA 1HNZO 1JPXA 3OFNG 5EIBC 1X59A 3K08A 4GUNA 3JD1A 3RYIB 2ZD9A 1LNQA 4K8XA 3D36A 5LXTB 2F43G 1N4CA 2QTOA 2RMKB 3KZIZ 2EX3A 1YTFD 4OX9O 1IBLB 1SS3A 3DSQA 4FLWA 3FB8C 2XNDG 4X88A 1MZFA 4DUYB 2ODMA 2HFEC 4LP8A 4LF8O 2VQFB 5CA0A 1MSWD 2EIJB 5LGUA 3ABMB 2Q4PA 3EFFK 3H9VA 1K97A 1V54C 2XTAA 2VQEB 1DGSA 1YZBA 1OCOB 1K4CC 2DWDC 4I50B 4O4HB 1NR7A 1O9GA 1K33A 2P4KA 3AK3A 3SPIA 4YIOA 4ZI7B 1FXKB 4LH6A 2VWJA 1PKXA 3RGBA 3WFVA 4DV2B 4DV0O 4A5UB 1IBLO 2JIZG 5GTIZ 4JI7O 5L3GA 1IBKB 4DR6B 1SKVA 1K8AW 1JR9A 2HHHO 1B04A 1Y76B 3SJCC 4IIJA 4J11A 2RQ6A 2UXBO 1GN3A 3CCRV 2BSKB 2X0LA 2HKOA 5H2FZ 5LHGA 2JEUA 4FM1A 3BEHA 1HP8A 3U10A 3FX7A 3VQVA 1WAZA 1XMOO 4FFBB 2P67A 3RYFB 1K34A 5CA3A 2ZNIA 1GMGA 4IYIA 4MTFA 4PA3A 4TV8B 3TETA 3EXAA 4DV2O 3WU2Z 2WLIA 3ZN0A 1VARA 2ZXWC 3OGIB 3ZHVA 2ITDC 4DR6O 3Q4HB 3T1HO 4L87A 3W7TA 3BY6A 3BA9A 1WLEA 4FM2A 4FLXA 3H1JH 1MABG 5EK0A 2F23A 4X1IA 3TJTA 4DW0A 1FXVA 1KQSU 4JI1B 5F2VO 2OTLV 1NTMH 1JCHA 2A79B 1GN4A 5FPRA 1Y6XA 3U11A 3VQWA 4RWUA 4WFFA 1AI7A 1V55B 2ARHA 2M7WA 3FFQA 1IBMB 2XAHA 2JJ2G 2Y0PA 4P30A 4U3JA 2L35A 1W0KG 1CP9A 3KCYA 4H13B 2UUBB 2KQXA 2BTQB 4ZKIA 1JJ2U 4G27B 1DLBA 4WFEA 5LOVA 4D6TH 1OCOC 2DQ0A 4KHPB 3C90A 4O4LB 1AR4A 5KHHA 1FXKC 4LF9O 3OR7C 2P90A 2DYRC 3JASB 4UV9A 5JH7B 4JV5B 1JFFA 1Y74B 3HKCB 1XL6A 2MK3A 3WB1A 3DTUB 5CBGA 1R6KA 4X64O 5CBFA 4R50A 3EVKA 2QM7A 4I9WA 1HNXB 2P5OA 2UUBO 1QQCA 2CTQA 1YEWA 1WNSA 2AHZA 4F6RB 5K1XA 3CCMV 1P49A 3JD0A 2XT9A 1BCCH 5ITZB 3F5TA 4FIPC 1LUWA 4JF3A 1PNMA 1R3JC 1URFA 2CTRA 1NKDA 4J7KA 1RSOA 2IJKA 3JD2A 4JV5O 3RVZA 4YY3B 1YDXA 4HYOA 1SQGA 3CEIA 3B2EE 4GX2A 4E2LA 3MHHC 3T2MA 3E86A 2EIMC 3O9OA 1Q3EA 5KX5A 2A0LA 2Q7EA 3TXSA 2B9ZA 4BW9A 3P3NA 2ZR3A 3CSXA 4RUFA 3MD0A 3CC2V 1N8RW 3ZIAG 2L6LA 2GV9A 3CXCU 5CMUA 3FYEB 1N33B 3E83A 1OCRC 1QHTA 4QE7A 3ZHUA 4LWSA 2HVKC 5J2UB 4MW8A 2ZNJA 1GM9A 1NVPD 1XOUA 4GX1A 5LA6A 5B1BC 5CA1A 5J9PC 3DC5A 4CBCA 4JI8O 4TOIA 1F51A 1OJHA 1D5NA 2ATKC 3O65A 1Z5WA 1SESA 4G28B 2JS3A 2OCHA 3ABUA 5JCOA 2QGNA 1XNRB 4MTXA 2OWOA 1Q6HA 2HVJC 3VQXA 1GAXA 3AG4C 5C93A 3CC7V 4O4JA 5IE9A 4RQFA 4NKGB 3K5MA 2ZM6O 2HJDA 4FZ1A 4DK0A 1GM7A 4I0XA 3TXQA 4JI6B 2XOKG 1JJOA 3CCUV 4DV3O 4NXNO 5BXZA 4TWKA 1W0JG 2XAJA 4JTAB 1PM9A 2B1GA 4LC1A 4NTYA 4TUYA 4MS2A 3JATB 4UXNA 4LF7B 2P22C 3CMEV 1VQPV 5EZYA 4J41A 1ZTEA 4PA7A 4IGGA 5IJ0B 3AG3B 5LP6B 4EFBA 1G1XB 2JGDA 4TQFA 1L1FA 4QGPA 1MG1A 4U7NA 2ZQMA 1DK1A 1ZX3A 2ZT9B 1AI5A 2AW9A 3DXRB 1B3QA 4JI5O 4DR4O 4RO2A 1HW7A 3HKDB 2EULA 1R3KC 4IL6Z 4LF7O 2JVDA 5LMNO 3ASOB 4O2AB 3FAVA 1M1KW 1MA1A 4DR2B 3N2GA 3ZRXA 2OTJV 2NN4A 2NR5A 3LSQA 5KAIZ 2EJ7A 3BCCH 4PI2A 2AZ2A 4CH3A 4JZ2A 4NTXA 1RM1C 3K9SA 4B3TO 1M57B 2UXDB 2QR4A 2YXLA 1QNMA 3T4ZA 1AR1B 1BHAA 2F93B 3LDEA 5L3FA 2UXCO 4HBNA 2IJIA 5JQGB 3UO3A 3P32A 4Z1MG 2XAQA 2EZPA 4UVCA 4DV7O 5LXTA 2F4VO 2PY5A 1JOYA 4FLVA 1HR0O 5HFMA 4YJ2B 4DV5B 1H2GA 4K0KO 2GUZB 2X6AA 2R72A 5KMGB 3IC7A 4GKKB 1VQMV 4DV6B 4R8CA 1XHZA 1NT2B 4Q20A 3F5WC 3MHSC 5KA5A 4TSFG 2WLLB 3OMNB 4MVRA 4C7UA 1RPRA 4X65O 1R1BA 1ZWIC 2CE4A 1BL8A 3G67A 4O4HA 3ICXA 1BGYH 1TVKB 2PF4E 4ZI7A 2E76B 1XBLA 2R9AA 5FNVA 3CHXA 3BABA 4LFCB 1AJPA 1SZXA 2M6YA 4GKKO 3DGEA 3WG7C 2IM9A 1TUBB 1S77D 2FMLA 3E8FA 1AP5A 1Y76A 4KL1A 1SF9A 1QLNA 5BR8B 4FM0A 1N36O 3BRCA 3ASOC 1PV0A 3SJAC 1VF5B 4IYHA 4CZZA 5C8YB 1B06A 3IJ4A 4B3MB 4DYLA 1IX9A 4FFBA 1NI8A 4TV8A 2N04A 5IY5B 3ZHTA 2YIDA 2PZSA 4LFBB 2QE7G 1GRJA 2QKSA 2JK5C 2NLJC 4LFCO 3K5OA 1GTOA 2Q0AA 2X6BA 4W4LA 3MDSA 3Q4HA 4NYKA 2WLJA 4O4IB 1ORQC 3F7YC 4UCVA 1Q90D 4XBFA 5LMUO 1L0LH 3RVYA 1AR5A 5IT9N 2ZXWB 3X2QC 2EILC 2QWQB 3RBZA 4ZHQB 2GTAA 3K57A 1FPOA 3OT7A 2EINC 4ZIBA 2RN9A 1Q7YW 4JZGA 5LGNA 4LFBO 5B5EZ 4PDLA 3FKSG 5IWAO 4B3RB 4O2BA 2BTQA 3ETEA 2Z5UA 1VIBA 1I7FA 3GWOA 5KHGA 4X62O 4KP4A 4LF5B 4H44B 2KKWA 2R9RB 2QWPB 4HZ3A 4ABMA 3OM3B 2ZIMA 1K7DA 2Q6AA 1UJWB 3W7UA 3SDLA 2QM8A 1AP6A 4DW1A 1FJGO 5KHIA 2WLHA 2Q69A 3BPZA 3JARB 2WSSG 3K0DA 2K1EA 1GKFA 4EB6B 2IBZH 1I08A 5H6QA 4F6EA 3UT5B 5IYZB 3FB5C 3OD4A 1WA8B 2GBOA 1IZ3A 2DYRB 4R7CA 2QWRB 3G6EV 4LF4B 3L75H 3RW0A 2RJZA 4QIWF 2JDIG 4OPAA 4FLZA 3SR2C 4DUYO 1FFXA 2CUGA 4MVUA 5IY5C 1ZL8A 2VS0A 3APOA 2CH7A 2VQFO 3W7WA 3H1KH 2BE3A 5CB4A 2LO1A 2LQTA 1SZTA 3I56V 2VQEO 4F4LA 3OR6C 5FLXN 3TK1A 4PHZA 1N34B 3ABLB 1HDJA 2CGNA 3G80A 2CTWA 2YSUB 3B77A 4JYAB 4JI0B 5EBLC 4D7SA 2D2CB 4OGQB 2CGOA 1VQ9V 1M56C 2GSMB 2QWOB 3ETDA 3VBBA 5GONA 1VMGA 4UB8Z 4HAMA 4NTWA 5B3SB 2VWKA 4JTDB 2EIMB 1M9NA 5J2UA 5EYPA 4UFZA 3CRQA 5DEDA 4AQYB 4TV9B 1GH6A 3G6BA 3T4DA 3CWBH 3ZHQA 1Q5OA 4DXWA 3WB2A 2XUMA 2EJRA 1OCRB 3H1IH 3NR7A 1BS3A 1U96A 1F7YA 4UCSA 1G6UA 2A3QA 5H9CA 3C3SA 2ZCEA 4HNAB 3SPJA 5B1BB 1O9HA 1ZAUA 4WFHA 2E5LB 2WPDG 1NVPB 3ZMZA 1NJIW 3M8AA 1S3JA 5B1OA 5DM6V 2UUCB 4JI3B 2OT5A 1RP3B 2E3CA 5E79Z 3D3QA 3A0BZ 3TGUH 4AHCA 3CPWU 4GCZA 4JI1O 3S3WA 1BE3H 1ZSPA 1JVMA 3H01A 1BQZA 4JAVA 4LNUA 3K3WA 2FL4A 3E35A 1IBMO 3UKMA 3AG4B 2AZ0A 5CA0B 4NXMB 3RWRD 4FZ0A 1OCCC 5IJ0A 1XNQB 5LP6A 4N23A 5A9GA
chains in the Genus database with same CATH topology
1VQNV 4PA7A 4JPRA 3CCLV 1K4DC 1AJNA 2WLMA 3AG3B 3K03A 3E8GA 1V54B 3UM7A 1KP3A 1Q86W 3K0GA 1QBZA 2IU0A 3ABLC 3OMAB 2DW4A 1OCCB 1ROPA 5EBMC 4PA4A 4G2KA 3ETGA 2WAMA 5IDJA 1L1FA 1MG1A 1J95A 4U7NA 2ZQMA 4WCEV 4PDVA 3I55V 1H8HG 1PNKA 1SRYA 1XL4A 3EHBB 1KC8W 1VQ4V 2H8PC 1AI5A 2WWWA 1MOFA 4QE9A 1K5SA 1FFTB 2XAGA 4RO2A 4XDKA 2V7QG 1OZ0A 3E89A 3ABKB 3CD6V 4I5SA 4H37A 5B3SC 2ZDIC 5CBHA 2X6CA 1YITV 1KP2A 2C2AA 2ZR2A 4JYBA 4X8AA 1OHHG 2YEVA 1R3KC 5KUKA 3CCQV 1K73W 3NXSA 2ZDIA 1GK9A 4WFBV 3ML0A 1AJQA 1EZJA 1E1QG 1K9MW 1M57C 3ASOB 2YEVB 1S5HC 4JASA 1M1KW 4MVZA 3ZRXA 2OTJV 3LSQA 4MVMA 3ZRWA 1BHBA 2CK3G 2B5UA 1VQ6V 4U7OA 3CCEV 1RM1C 1VQ8V 1F4MA 4FJCC 1M57B 3ZRWB 5L3DA 2WLKA 2NNUA 1THZA 1AI6A 1I5XA 3W7SA 3ZRVA 3SYCA 1TUEB 1AR1B 3T4ZA 1W2BU 1BHAA 1VQKV 2QA4V 1PL0A 1F23A 2WLIB 5GW7A 4PDMA 1PNLA 3LDEA 3LSSA 5L3FA 4QPJA 1RM1B 3IFXA 5DN6G 2IJIA 1I5YA 3IGAC 1R3LC 2HG5C 1R3IC 3P30A 1CPYA 3P32A 4GX5A 2XAQA 4QPKA 2EZPA 4Z1MG 2HR3A 4LCUC 3ZMSA 2IU3A 4UVCA 1JPXA 3ZN1A 3OFNG 1JOYA 1SETA 1RPOA 1F4NA 1KECA 3K08A 3K06A 5HFMA 3JD1A 2ZD9A 1LNQA 3D36A 3SPHA 2F43G 1H2GA 3CCVV 4ASUG 1QVGU 2QTOA 2X6AA 1QVFU 2P6JA 3OE7G 1VQ7V 3G4SV 3AG1C 4JGSA 4MW3A 1YTFD 2R9IA 2Y69C 3IC7A 1VQMV 4R8CA 2WLLA 4Q20A 5L3CA 3F5WC 2EIJC 4ZBMA 2W6IG 2JEXA 4JYCA 3ABMC 3MHSC 3FB8C 5KA5A 2XNDG 3JYCA 4X88A 4TSFG 3OEEG 2WLLB 4LBEC 3SJQC 3JCZA 2HFEC 4LP8A 2IJHA 2Y69B 3OMNB 2GHYA 4MVRA 1GO3F 1ENVA 3F7VC 1RPRA 1MSWD 2EIJB 1ZWIC 5LGUA 3ABMB 1FXHA 1S76D 1BL8A 3EFFK 5L3BA 1K97A 1V54C 2DQ3A 4GT1A 1OCOB 1K4CC 4KUMA 3LDCA 4PDRA 2DWDC 4QNHB 2QEXV 5B1AB 2DWEC 1NR7A 1K33A 5E1AC 2EBOA 3SPIA 4MTGA 2LP7A 2WLNA 2IH3C 3SPGA 3AG2C 5FL7G 3HPLC 1FXKB 2Q67A 1AJPA 1PKXA 4UVBA 1WPXA 3DGEA 3WFVA 3WG7C 3K79A 3ABKC 1S77D 5EBWC 2JIZG 3E8FA 3CCSV 4P9PA 2Y48A 5L3GA 5LGTA 3ASNC 3AG2B 5EC1C 4X89A 4TT3G 1K8AW 1EBOA 4MTOA 1QLNA 2BOCC 3R65A 3WG7B 2V1DA 3ASOC 5B1NA 4CZZA 3CCRV 4PELA 1B6QA 4JTCB 1DF4A 3ASNB 2X0LA 2HKOA 1K5QA 5LHGA 2JEUA 2LFRA 3FYIB 4MT8A 1QLEC 3BEHA 5IY5B 1H38A 2P67A 2QE7G 1NH2B 2UXXA 3K04A 2QKSA 2LFSA 1YJNV 1K34A 5CA3A 1PD3A 1GMGA 4MTFA 4PA3A 3TETA 2JK5C 2NLJC 1GTOA 3E8HA 1E1RG 2X6BA 3OEHG 1QLEB 3JD3A 2WLIA 3ZN0A 2ZXWC 3HB3B 2WLJA 1AROP 4DO2A 1ORQC 3FB6C 2ITDC 4L87A 2ITCC 3F7YC 3BY6A 5H6RA 3W7TA 1WLEA 3B8MA 4XBFA 1V55C 3RVYA 5KUMA 1MABG 5EK0A 5L3EA 3OAAG 1P7BA 2ZXWB 1FXVA 1KQSU 3X2QC 2EILC 2OTLV 1JCHA 4KFMA 3RBZA 2A79B 4BIUA 2EZOA 2A9HA 4OXSA 4WFFA 1AI7A 2EINC 1V55B 2JJ1G 2M7WA 1Q7YW 5LGNA 3X2QB 2XAHA 2JJ2G 3FKSG 2EILB 4PDLA 4P30A 4WFAV 3ETEA 2Z5UA 3GWOA 1W0KG 1CP9A 2EIKC 4KP4A 1OCZC 2UXNA 2EINB 2R9RB 4HZ3A 4ZKIA 1JJ2U 4G27B 3SYOA 3K9AA 1DLBA 2IJJA 3OM3B 4WFEA 2BOBC 1K7DA 2Q6AA 3ZRSA 1UJWB 4WF9V 1OCOC 1R6NA 2DQ0A 3W7UA 2KB1A 2QM8A 3STZC 5B1AC 3M99B 2EIKB 2H94A 1SERA 1NR1A 1OCZB 2WLHA 2Q69A 2B1IA 3FB7C 1FXKC 3GB7C 2WSSG 3K0DA 1YJWV 2K1EA 1KD1W 3ZMVA 4PA9A 1GKFA 3OR7C 4FMTA 2P90A 5IYCO 3E8BA 3SYQA 2DYRC 3SYAA 3SPCA 1FXKA 1QCEA 4UV9A 3ZMUA 1XL6A 2MK3A 4N21A 1EFRG 3DTUB 5CBGA 1NQTA 3ABTA 1R6KA 3D3IA 4RUEA 1M90W 1QR8A 4BAYA 5H6QA 5CBFA 2DYSC 3FB5C 1QR9A 4R50A 2DYRB 3QNEA 1BMFG 2PI5A 1KKDA 4R7CA 2QM7A 4I9WA 4MVSA 3G6EV 5KA6A 3RW0A 4QIWF 3KG2A 2AHZA 1K92A 2JDIG 3W7XA 3CCMV 4PA6A 1YJ9V 1VQLV 2DYSB 1JX9A 1NH2D 3JD0A 4MVUA 5IY5C 5BZBA 2FTKA 4YXWG 4FIPC 2PI4A 1YSCA 4JF3A 1PNMA 1R3JC 1G8MA 4UUJC 1GM8A 3W7WA 4J9ZB 3STLC 4MVQA 1NKDA 3LDDA 2XAFA 1SZTA 3OUFA 4UV8A 2X7RB 3I56V 3CC4V 2IJKA 2AHYA 4F4LA 3JD4A 3OR6C 5IYBO 2P7TC 3JD2A 1H8EG 1JQ0A 3TK1A 4XDJA 3ABLB 3QO8A 3RVZA 4RQEA 1VQOV 2YSUB 3B77A 4FPPA 4HYOA 5EBLC 5LBQA 4WFGA 1DTOA 4GX2A 4E2LA 1VQ5V 3MHHC 4FK5C 3T2MA 4BIZA 3E86A 2EIMC 1VQ9V 1M56C 2A0LA 2GSMB 3ETDA 3VBBA 5LHIA 4R6ZA 3G71V 4QJFB 4JAUA 4HAMA 1Y4MA 2ZR3A 4RUFA 5B3SB 3MD0A 1YIJV 2Q68A 3LNMB 3PJSK 4JTDB 2D3OW 3CC2V 1N8RW 3ZIAG 2EIMB 1M9NA 2HLDG 2IH1C 3CXCU 1M56B 5CMUA 3FYEB 3OMIB 1YI2V 1S72V 3E83A 1OCRC 4GX0A 2XASA 4QE7A 3T4DA 3E2EA 2HVKC 4MW8A 4EKWA 4MSWC 1GM9A 1NVPD 3LUTB 4DXWA 3VOUA 3ZCCA 4GX1A 4MVOA 5LHHA 5IYDO 1HWYA 2EJRA 5B1BC 1OCRB 1Q82W 2IW5A 5J9PC 1COWG 3CMAV 3ZMTA 3A0RA 3AEIA 4RAIA 4CBCA 4BW5A 5H9CA 1CEZA 3ZJZA 1F51A 2HJFC 1NBMG 3OW2U 3SPJA 2ATKC 3CP1A 5B1BB 1SESA 4WFHA 2WPDG 4G28B 3ZMZA 1NVPB 1S0VA 1NJIW 1S3JA 5B1OA 5DM6V 1K3EA 2Z3YA 2OT5A 3T1CA 3ABUA 2OCCC 1FS0G 1Q81W 1R73A 4XDLA 1P4RA 3B8NA 3OUSA 2W0FC 4MTXA 3CPWU 4GCZA 1G4YB 1AI4A 2HVJC 3SYPA 3AG4C 5C93A 1JVMA 3CC7V 2W6JG 4P2ZA 4RQFA 3CCJV 4UVAA 3H01A 1E79G 2OCCB 4J9YB 3TCUA 3AG1B 1DF5A 1GM7A 4JAVA 2XOKG 4H33A 3CCUV 5HFLA 3K3WA 3E35A 4TWKA 1YTFB 1W0JG 2XAJA 5CN0A 3UKMA 3OGCC 4JTAB 3CYOA 5EC2C 3AG3C 1IXMA 3AG4B 2B1GA 4LC1A 4MS2A 4UXNA 3QO7A 4P9OA 1YHQV 1OCCC 1Y66A 3QO5A 3CMEV 1VQPV 4N23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABM C;  4PA7 A;  1P7B A;  4HYO A;  3X2Q C;  3FB8 C;  5EBL C;  2EIL C;  1K4D C;  3JYC A;  4X88 A;  2WLM A;  4KFM A;  2WLL B;  2A79 B;  4WFG A;  3RBZ A;  4GX2 A;  4LBE C;  3K03 A;  3SJQ C;  2HFE C;  4LP8 A;  3E8G A;  3UM7 A;  3T2M A;  3E86 A;  2EIM C;  2A9H A;  3K0G A;  4MVR A;  1M56 C;  3ABL C;  2A0L A;  4OXS A;  4WFF A;  2EIN C;  3F7V C;  5EBM C;  4R6Z A;  4PA4 A;  1ZWI C;  1BL8 A;  1J95 A;  3EFF K;  4PDL A;  4PDV A;  1V54 C;  4RUF A;  4P30 A;  1XL4 A;  2Q68 A;  2H8P C;  3LNM B;  3PJS K;  4JTD B;  4QE9 A;  1K4C C;  2EIK C;  2IH1 C;  3LDC A;  2DWD C;  4PDR A;  1OCZ C;  4QNH B;  4RO2 A;  4XDK A;  2DWE C;  2R9R B;  5E1A C;  3E83 A;  4HZ3 A;  3SPI A;  1OCR C;  3E89 A;  2WLN A;  4GX0 A;  4MTG A;  4G27 B;  3SYO A;  2IH3 C;  4WFE A;  4QE7 A;  2BOB C;  4H37 A;  3SPG A;  3T4D A;  5B3S C;  3ZRS A;  2Q6A A;  3AG2 C;  1OCO C;  5CBH A;  2X6C A;  3HPL C;  2Q67 A;  2HVK C;  4X8A A;  5KUK A;  2KB1 A;  1R3K C;  2YEV A;  4MW8 A;  3STZ C;  4MSW C;  4EKW A;  5B1A C;  3LUT B;  3WG7 C;  4DXW A;  3VOU A;  4GX1 A;  4MVO A;  3ABK C;  5EBW C;  2WLH A;  2Q69 A;  5B1B C;  1M57 C;  3E8F A;  3FB7 C;  4P9P A;  1S5H C;  5J9P C;  3GB7 C;  3K0D A;  3ASN C;  2K1E A;  4MVZ A;  4RAI A;  5EC1 C;  4BW5 A;  4X89 A;  4CBC A;  4MVM A;  4PA9 A;  4MTO A;  3OR7 C;  3E8B A;  3SYQ A;  2DYR C;  3SYA A;  3SPC A;  3ZJZ A;  2BOC C;  3R65 A;  2HJF C;  3ASO C;  1XL6 A;  3SPJ A;  2ATK C;  5CBG A;  4WFH A;  4G28 B;  4RUE A;  4ZBM A;  2WLK A;  5CBF A;  4JTC B;  3T1C A;  2DYS C;  3FB5 C;  3SYC A;  2OCC C;  3T4Z A;  4R50 A;  2WLI B;  1QLE C;  3BEH A;  4XDL A;  1KKD A;  4R7C A;  4PDM A;  4I9W A;  3OUS A;  3LDE A;  4MVS A;  2W0F C;  3IFX A;  3RW0 A;  3K04 A;  2QKS A;  3IGA C;  1R3L C;  2HG5 C;  1R3I C;  3KG2 A;  2AHZ A;  1G4Y B;  4GX5 A;  2HVJ C;  4LCU C;  4MTF A;  3SYP A;  3AG4 C;  4PA3 A;  1JVM A;  2JK5 C;  2NLJ C;  4PA6 A;  3TET A;  4P2Z A;  3E8H A;  4J9Y B;  4MVU A;  3TCU A;  5IY5 C;  2X6B A;  5BZB A;  3K08 A;  3K06 A;  1R3J C;  4UUJ C;  2ZD9 A;  1LNQ A;  2WLI A;  4H33 A;  3SPH A;  4J9Z B;  2ZXW C;  4TWK A;  3STL C;  4MVQ A;  3LDD A;  2WLJ A;  2QTO A;  2X6A A;  3UKM A;  3OGC C;  4JTA B;  5EC2 C;  3OUF A;  1ORQ C;  3AG3 C;  3FB6 C;  3AG1 C;  2ITD C;  4MW3 A;  2Y69 C;  4MS2 A;  2AHY A;  4F4L A;  3OR6 C;  2ITC C;  3F7Y C;  4P9O A;  2P7T C;  4R8C A;  2WLL A;  1OCC C;  1V55 C;  3RVY A;  4XDJ A;  3F5W C;  5KUM A;  2EIJ C;  3RVZ A;  5EK0 A; 
#chains in the Genus database with same CATH topology
 1VQN V;  1AJN A;  1U97 A;  3K03 A;  2UUC O;  4KHP O;  4JI3 O;  3E8G A;  1VEW A;  3ABL C;  3OMA B;  2DW4 A;  3FD9 A;  2VRZ A;  4B7K A;  4G2K A;  2Y4T A;  3ETG A;  5IDJ A;  2JRI A;  2ZE6 A;  1S5L Z;  5KLV H;  5LYJ A;  1H8H G;  1PNK A;  5JJN B;  1KC8 W;  4Z2W A;  2WWW A;  5JJJ B;  2QKA A;  4L8J A;  2V7Q G;  1NU1 H;  3ABK B;  5B3S C;  2ZDI C;  4B7E A;  2YIB A;  4J42 A;  2BCC H;  2ZR2 A;  4JYB A;  5KUK A;  4O2A A;  4KXR A;  1K73 W;  2Q9L A;  4WFB V;  1HNX O;  1E1Q G;  1K9M W;  3IC9 A;  2UU9 B;  1IBK O;  3U0Z A;  5TIS Z;  1IVS A;  1BHB A;  4J10 A;  4X66 B;  4PJ0 Z;  3CCE V;  1VQ8 V;  2Q7H A;  5KAF Z;  3ZRW B;  5L3D A;  4I55 A;  1THZ A;  1I5X A;  1D5A A;  3ZRV A;  1TUE B;  5JQG A;  1W2B U;  1TAE A;  2G38 A;  2WLI B;  3LSS A;  1RM1 B;  4YY3 O;  3QVN A;  3OTO B;  3P30 A;  4GX5 A;  2LW7 A;  4QPK A;  3N2K A;  2HR3 A;  2RNB A;  4LCU C;  4YJ2 A;  4BR6 A;  1AVM A;  3ZN1 A;  3D36 C;  2KG7 B;  1F4N A;  2GUZ A;  1IDS A;  3SPH A;  3CCV V;  1QVG U;  3ZS8 C;  3J7A U;  1QVF U;  3OE7 G;  4MW3 A;  1J5E B;  4LR3 A;  2AXT Z;  2Y69 C;  2WLL A;  1N33 O;  5L3C A;  2JEX A;  3JYC A;  3OEE G;  1YF2 A;  3RYH B;  3HKE B;  2IJH A;  1KB9 F;  2E75 B;  1ENV A;  1ZUQ A;  1XEQ A;  3ZHR A;  1N32 B;  4UCO A;  4DK1 A;  3OTF A;  5LOV B;  1TVK A;  1VP7 A;  3WB0 A;  4NR1 A;  3ZX6 A;  3AG7 A;  4GT1 A;  2OYQ A;  1H2K A;  4BIO A;  4QNH B;  2O57 A;  4E4E A;  1SC5 B;  4MTG A;  2LP7 A;  3CE2 A;  2IH3 C;  3SPG A;  3AG2 C;  2PGG A;  1NTZ H;  3HPL C;  2Q67 A;  4CC6 A;  1JFF B;  3JAW B;  1XUQ A;  1WPX A;  3K79 A;  3T1Y B;  1XNR O;  3ABK C;  1RFY A;  2F66 C;  5JVD B;  1TGO A;  3JAL B;  2Y48 A;  3CRR A;  5LGT A;  1P7G A;  3ASN C;  5EC1 C;  4DRX A;  1EBO A;  5C8Y A;  3VQY A;  4DUZ B;  3R65 A;  3WG7 B;  2V1D A;  5B1N A;  3K59 A;  4JI6 O;  2ZKO A;  1B6Q A;  4ZOL A;  2ZE5 A;  4U3F H;  3RN4 A;  2LFR A;  4MT8 A;  3BVO A;  1QLE C;  1XI1 A;  5LL6 Y;  2UXX A;  3K04 A;  2LFS A;  1YJN V;  4J7Z A;  1PD3 A;  2UUA B;  2RDC A;  3UO2 A;  2DE0 X;  3E8H A;  2PYJ A;  1E1R G;  4B08 A;  4O4I A;  3JD3 A;  2MW2 B;  3HB3 B;  5FPO A;  1ARO P;  3FB6 C;  5KX5 B;  1GN6 A;  5H6R A;  2Y0I A;  4YHH B;  3B8M A;  4DUZ O;  1CXZ B;  4ZHQ A;  5KUM A;  3OAA G;  1NZ6 A;  3RYI A;  4IHJ B;  3RYC B;  4BIU A;  2FB5 A;  1MNG A;  2ILM A;  1WP7 A;  3H1L H;  4OXS A;  4CS4 A;  4I7Z B;  3QF7 A;  4LWS B;  1SQB H;  1XMQ B;  3X2Q B;  2EIL B;  4DR2 O;  4WFA V;  1HNW B;  4JYY A;  2EIK C;  5CA1 B;  4DR1 B;  1OCZ C;  1PPJ H;  4DR5 B;  2EIN B;  4PD4 F;  3HKB B;  4AIL C;  2UXD O;  3SYO A;  2RCV A;  2IJJ A;  2BOB C;  3ZRS A;  4WF9 V;  1R6N A;  2GTS A;  1YVW A;  3JSN A;  3STZ C;  2H94 A;  2V4D A;  1SER A;  3JAR A;  3HR0 A;  1H2M A;  2WA4 A;  2B1I A;  4I50 A;  3ZBH A;  3GB7 C;  1YJW V;  3L9D A;  3ZMV A;  4PA9 A;  3SYQ A;  3SPC A;  4X1K B;  1FXK A;  4DV5 O;  4DR3 B;  3ZMU A;  4N21 A;  4X20 B;  5IJ9 B;  3ABT A;  4O4J B;  4RUE A;  1M90 W;  1QR8 A;  1WN7 A;  2DYS C;  4DV6 O;  4I0X B;  2W0X A;  1HNW O;  1BMF G;  2PI5 A;  1BZK A;  4MVS A;  5KA6 A;  4JI2 B;  1BT8 A;  3KCX A;  5D5P A;  1K92 A;  2N74 A;  2FYU H;  1EZV H;  4PA6 A;  1YJ9 V;  1JX9 A;  2BSK A;  5BZB A;  2FTK A;  5EZY B;  2PI4 A;  1NS1 A;  1M5I A;  1YSC A;  1G8M A;  1OV9 A;  2FKX A;  4MVQ A;  2WA3 A;  4J7J A;  3OUF A;  1UFI A;  1H2L A;  3RYF A;  3CC4 V;  2PUS A;  2YIB D;  2YI8 A;  2LJ2 A;  1PL4 A;  1H8E G;  1JQ0 A;  4XDJ A;  3SGI A;  4RQE A;  1VQO V;  2A06 H;  4FPP A;  1KMI Z;  2K9P A;  4YIP A;  3CS5 A;  4WFG A;  1DTO A;  4CC5 A;  4H0L B;  2GDS A;  3QG5 A;  5JWP A;  1VQ5 V;  1FKA O;  4X1Y B;  5LHI A;  4R6Z A;  4UCR A;  4FVM A;  4D7T A;  4JI2 O;  4JAU A;  1Y4M A;  4ICG A;  2Q68 A;  3PJS K;  2D3O W;  4OX9 B;  5BR8 O;  2IH1 C;  1M56 B;  3FAV B;  4UCU A;  1YI2 V;  3N2G B;  3CRA A;  4B3M O;  2OIE A;  2P4V A;  3E2E A;  4YJ3 B;  4LF8 B;  2JGU A;  4J80 A;  5LHH A;  1HWY A;  4K8Z A;  1VF6 A;  1IUR A;  1COW G;  4LF6 B;  4RAI A;  4BW5 A;  1WJZ A;  2DJV A;  4WBN B;  1CEZ A;  3ZJZ A;  2HP8 A;  2HJF C;  1NBM G;  3OW2 U;  3A0H Z;  2Q7G A;  4O4L A;  1L0N H;  3CP1 A;  2DOS A;  4BWA A;  3A2F A;  3I5D A;  3BFR A;  5JCO C;  3JAK B;  1YCI A;  1R6T A;  4UCT A;  1K3E A;  3T1C A;  1SA0 B;  2YS8 A;  3L70 H;  2OCC C;  1FS0 G;  3IAY A;  1W59 A;  4DV0 B;  3B8N A;  3OUS A;  1WB7 A;  1KUQ A;  3JAS A;  2W0F C;  5JH7 A;  2Z0A A;  4JI7 B;  1Y74 A;  3HKC A;  1G4Y B;  1AI4 A;  3J81 N;  2W6J G;  4P2Z A;  4J9Y B;  5D5Q A;  3AG1 B;  2HHH B;  2F95 B;  5BY1 A;  4H33 A;  5DEC A;  2UXB B;  5HFL A;  4CS3 A;  1XRE A;  5CN0 A;  1EN4 A;  3R66 A;  3OGC C;  4B3R O;  3QTC A;  3LNN A;  4LF6 O;  4F6R A;  3QO7 A;  4P9O A;  4LF5 O;  2YXH A;  1Y66 A;  1XMO B;  5ITZ A;  3PN1 A;  4JPR A;  3CCL V;  1Z5V A;  2WLM A;  3BAA A;  1H2S B;  1MMM A;  4I9Q A;  1KP3 A;  3E22 B;  3K0G A;  2IU0 A;  2Q0O C;  5FNV B;  1OCC B;  1ROP A;  1TA8 A;  4I4T B;  4PA4 A;  3MAQ A;  5BMV B;  2CDY A;  4WCE V;  4PDV A;  2LGQ A;  1XL4 A;  3EHB B;  1VQ4 V;  2QWN B;  1MOF A;  3CJH B;  3T1H B;  4AI8 A;  2XAG A;  1M93 A;  4XDK A;  1OZ0 A;  1N0J A;  3E89 A;  1MSD A;  4I5S A;  4H37 A;  5J2T B;  1FD9 A;  1YIT V;  1FYJ A;  2C2A A;  2R70 A;  1S5J A;  3NXS A;  1M4U A;  1EZJ A;  4LF4 O;  2YEV B;  4NB5 A;  1XQ8 A;  4JAS A;  3M7M X;  3ZRW A;  2QTS A;  1GN2 A;  1JA8 A;  1F4M A;  2WLK A;  4PV1 B;  3UCS C;  5KHJ A;  1IXB A;  4DV4 B;  3SYC A;  3SJB C;  5B66 Z;  1V9P A;  2XHB A;  4PDM A;  1N34 O;  3A8T A;  2KG7 A;  3IFX A;  1R3L C;  1R3I C;  4JYA O;  4JI0 O;  2LGW A;  3ZMS A;  2IU3 A;  4LF9 B;  1BSM A;  1SET A;  1RPO A;  1KEC A;  3K06 A;  3ETQ A;  3UQ8 A;  4ASU G;  1JMK C;  4X64 B;  2P6J A;  4CH5 A;  1VQ7 V;  2AGA A;  3G4S V;  3AG1 C;  4JGS A;  2R9I A;  3RFR A;  1BQ0 A;  2A7W A;  2EIJ C;  4ZBM A;  2W6I G;  3HKE A;  4JYC A;  3RYH A;  3ABM C;  4AQY O;  4O2B B;  4LBE C;  3SJQ C;  3JCZ A;  2Y69 B;  4DV4 O;  1QU7 A;  2GHY A;  1GO3 F;  2ZE8 A;  3F7V C;  4FLU A;  3JAT A;  3JSL A;  1FXH A;  1S76 D;  5L3B A;  2DQ3 A;  4FLT A;  1N0N A;  4FFK A;  4KUM A;  3LDC A;  4PDR A;  2YUA A;  2QEX V;  5B1A B;  2DWE C;  5E1A C;  3RT3 C;  2EBO A;  2WLN A;  3JAW A;  3K58 A;  2E5L O;  3C3T A;  2ZIO A;  5FL7 G;  4GZR B;  5JVD A;  4UVB A;  3JAL A;  2Y4U A;  1XDC A;  5EBW C;  3DXR A;  3CCS V;  4P9P A;  1H2N A;  3AG2 B;  3HKD A;  4X89 A;  1Q6U A;  4TT3 G;  4MTO A;  3BA8 A;  2QKC A;  2BOC C;  4LFA B;  1FFX B;  4PEL A;  4JTC B;  1DF4 A;  1ZL8 B;  3ASN B;  1K5Q A;  4IIJ B;  2CH7 B;  4NXM O;  3CRC A;  3FYI B;  1XNQ O;  5CB4 B;  1H38 A;  1NH2 B;  1AIL A;  2CTP A;  4JI8 B;  3L73 H;  3JAM N;  3OEH G;  1QLE B;  4DR7 B;  3J80 N;  2N05 A;  3AK2 A;  3L72 H;  2CAZ C;  5H5N A;  2PYL A;  4DO2 A;  2ZE7 A;  2ITC C;  5GON B;  4Z1V A;  4IHJ A;  1XIL A;  3RYC A;  1V55 C;  1Y67 A;  5L3E A;  1P7B A;  4LFA O;  5JJE B;  4KFM A;  2ETN A;  3B4S A;  2EZO A;  2ZM6 B;  4X1I B;  3B40 A;  1D2D A;  2A9H A;  4K3A A;  5EYP B;  5KMG A;  1VF6 C;  1US6 A;  2JJ1 G;  4DV3 B;  4NXN B;  3CXH F;  2UU9 O;  3KKY A;  1KKC A;  1VF7 A;  3HKB A;  4JI4 B;  2ZIN A;  3K5N A;  2QDO A;  1ZLZ A;  4X66 O;  2UXN A;  3BHP A;  2KSD A;  4U3J B;  1Q8I A;  4B3S B;  4DR7 O;  3K9A A;  2H3O A;  1WB8 A;  3P3P A;  2KB1 A;  5B1A C;  3M99 B;  2EIK B;  1NR1 A;  1OCZ B;  4LH7 A;  3OTO O;  4X1K A;  3FB7 C;  1MZE A;  4X20 A;  1KD1 W;  5IJ9 A;  4FMT A;  5IYC O;  3E8B A;  3SYA A;  4W4K A;  1QCE A;  4JI5 B;  4DR4 B;  1UPG A;  1EFR G;  1NQT A;  4EEQ A;  3D3I A;  1WPB A;  1TUB A;  4Q6G A;  4BAY A;  1Z2G A;  1J5E O;  1I94 B;  1A32 A;  1QR9 A;  4JI4 O;  4LNU B;  4JAA A;  3QNE A;  1SQX H;  1KKD A;  5LMN B;  1X4T A;  3KG2 A;  4B3S O;  4OPH A;  3W7X A;  1VQL V;  2Q5Z A;  2DYS B;  1NH2 D;  1XHX A;  2YDE A;  4YXW G;  1N32 O;  4UUJ C;  1GM8 A;  4B3T B;  4J9Z B;  1NTK H;  3STL C;  3LDD A;  4UV8 A;  2XAF A;  3CB2 A;  2X7R B;  3K5L A;  4GLX A;  2AHY A;  3JD4 A;  3ZED A;  1LR1 A;  5IYB O;  2P7T C;  2PTM A;  1RSO B;  1WP8 A;  3QO8 A;  5LYJ B;  4CH6 A;  2UXC B;  5GTH Z;  5LBQ A;  1KU9 A;  4X1Y A;  4CS2 A;  3LSU A;  4DV7 B;  2YC0 A;  2F4V B;  4FK5 C;  4BIZ A;  1I94 O;  2E74 B;  1HR0 B;  3S3X A;  3T1Y O;  3G71 V;  4QJF B;  4K0K B;  1KYO F;  4GKJ B;  4UB6 Z;  1YIJ V;  3LNM B;  2HLD G;  3OMI B;  3GWK C;  1S72 V;  5A2Q N;  2ADP A;  4GX0 A;  1LUV A;  2XAS A;  4YJ3 A;  1SQP H;  4EKW A;  4MSW C;  3LUT B;  3VOU A;  3ZCC A;  4MVO A;  4WBN A;  5IYD O;  4I55 B;  4X65 B;  1Q82 W;  1KBH A;  2UUA O;  2IW5 A;  3CMA V;  3ZMT A;  3A0R A;  3AEI A;  4CH4 A;  5LA6 B;  2BTO A;  3JAK A;  3DC6 A;  3CRM A;  3JCU Z;  1SA0 A;  3N2K B;  1S0V A;  2QSA A;  2Z3Y A;  2DMX A;  4FLY A;  4GKJ O;  4X9Q A;  1Q81 W;  1R73 A;  4YHH O;  4XDL A;  1SQV H;  3AK1 A;  1P4R A;  1T5E A;  4PI0 A;  1EM1 A;  3CX5 F;  4EB6 A;  4K35 A;  3SYP A;  3ZHS A;  4GYC B;  3CCJ V;  4UVA A;  1E79 G;  2OCC B;  3TCU A;  2DN9 A;  3UT5 A;  5IYZ A;  1N36 B;  1DF5 A;  1WA8 A;  2QJ1 A;  4TQD A;  1YTF B;  1XMQ O;  2Q8V A;  1I0H A;  1L8D A;  3CYO A;  5EC2 C;  3AG3 C;  1IXM A;  5LP6 C;  2OIG A;  4DV1 B;  1YHQ V;  2F1M A;  4DR1 O;  1YXB A;  4DR5 O;  3QO5 A;  4TUY B;  2YIC A;  1Q43 A;  3E22 A;  1P84 F;  2ADQ B;  1K4D C;  1AB3 A;  4I4T A;  3H1H H;  1V54 B;  3UM7 A;  5BMV A;  1Q86 W;  1QBZ A;  2P06 A;  1FAF A;  5EBM C;  3CJH A;  2WAM A;  3N27 A;  4NVP A;  3L74 H;  1J95 A;  1Q6I A;  3I55 V;  2JGD B;  1SRY A;  1SQF A;  2H8P C;  4QE9 A;  1K5S A;  1FFT B;  5J2T A;  4DR3 O;  5LMU B;  1EN6 A;  4EFE A;  1HNZ B;  3CD6 V;  2QM4 A;  4DRX B;  2HEP A;  5CBH A;  2X6C A;  1KP2 A;  4X8A A;  1OHH G;  2YEV A;  3APQ A;  3CCQ V;  3THO A;  1SQQ H;  2Q73 A;  2LW1 A;  2ZDI A;  1GK9 A;  4DV1 O;  5K1P A;  3ML0 A;  1AJQ A;  4ZOL B;  1EN5 A;  1M57 C;  1S5H C;  5IWA B;  5KHK A;  2JS5 A;  4MVZ A;  4TV9 A;  4MVM A;  3GVM A;  3L71 H;  1PP9 H;  2CK3 G;  4X62 B;  2B5U A;  1VQ6 V;  4U7O A;  4FJC C;  2YXY A;  2YI9 A;  2NNU A;  1AI6 A;  5AG2 A;  2YIA A;  3W7S A;  3B09 A;  1VQK V;  2QA4 V;  1PL0 A;  1F23 A;  5GW7 A;  4IT5 A;  3D8C A;  1FJG B;  1PNL A;  4QPJ A;  5DN6 G;  1I5Y A;  3IGA C;  2HG5 C;  4HNA A;  5EIB D;  1CPY A;  1HNZ O;  1JPX A;  3OFN G;  5EIB C;  1X59 A;  3K08 A;  4GUN A;  3JD1 A;  3RYI B;  2ZD9 A;  1LNQ A;  4K8X A;  3D36 A;  5LXT B;  2F43 G;  1N4C A;  2QTO A;  2RMK B;  3KZI Z;  2EX3 A;  1YTF D;  4OX9 O;  1IBL B;  1SS3 A;  3DSQ A;  4FLW A;  3FB8 C;  2XND G;  4X88 A;  1MZF A;  4DUY B;  2ODM A;  2HFE C;  4LP8 A;  4LF8 O;  2VQF B;  5CA0 A;  1MSW D;  2EIJ B;  5LGU A;  3ABM B;  2Q4P A;  3EFF K;  3H9V A;  1K97 A;  1V54 C;  2XTA A;  2VQE B;  1DGS A;  1YZB A;  1OCO B;  1K4C C;  2DWD C;  4I50 B;  4O4H B;  1NR7 A;  1O9G A;  1K33 A;  2P4K A;  3AK3 A;  3SPI A;  4YIO A;  4ZI7 B;  1FXK B;  4LH6 A;  2VWJ A;  1PKX A;  3RGB A;  3WFV A;  4DV2 B;  4DV0 O;  4A5U B;  1IBL O;  2JIZ G;  5GTI Z;  4JI7 O;  5L3G A;  1IBK B;  4DR6 B;  1SKV A;  1K8A W;  1JR9 A;  2HHH O;  1B04 A;  1Y76 B;  3SJC C;  4IIJ A;  4J11 A;  2RQ6 A;  2UXB O;  1GN3 A;  3CCR V;  2BSK B;  2X0L A;  2HKO A;  5H2F Z;  5LHG A;  2JEU A;  4FM1 A;  3BEH A;  1HP8 A;  3U10 A;  3FX7 A;  3VQV A;  1WAZ A;  1XMO O;  4FFB B;  2P67 A;  3RYF B;  1K34 A;  5CA3 A;  2ZNI A;  1GMG A;  4IYI A;  4MTF A;  4PA3 A;  4TV8 B;  3TET A;  3EXA A;  4DV2 O;  3WU2 Z;  2WLI A;  3ZN0 A;  1VAR A;  2ZXW C;  3OGI B;  3ZHV A;  2ITD C;  4DR6 O;  3Q4H B;  3T1H O;  4L87 A;  3W7T A;  3BY6 A;  3BA9 A;  1WLE A;  4FM2 A;  4FLX A;  3H1J H;  1MAB G;  5EK0 A;  2F23 A;  4X1I A;  3TJT A;  4DW0 A;  1FXV A;  1KQS U;  4JI1 B;  5F2V O;  2OTL V;  1NTM H;  1JCH A;  2A79 B;  1GN4 A;  5FPR A;  1Y6X A;  3U11 A;  3VQW A;  4RWU A;  4WFF A;  1AI7 A;  1V55 B;  2ARH A;  2M7W A;  3FFQ A;  1IBM B;  2XAH A;  2JJ2 G;  2Y0P A;  4P30 A;  4U3J A;  2L35 A;  1W0K G;  1CP9 A;  3KCY A;  4H13 B;  2UUB B;  2KQX A;  2BTQ B;  4ZKI A;  1JJ2 U;  4G27 B;  1DLB A;  4WFE A;  5LOV A;  4D6T H;  1OCO C;  2DQ0 A;  4KHP B;  3C90 A;  4O4L B;  1AR4 A;  5KHH A;  1FXK C;  4LF9 O;  3OR7 C;  2P90 A;  2DYR C;  3JAS B;  4UV9 A;  5JH7 B;  4JV5 B;  1JFF A;  1Y74 B;  3HKC B;  1XL6 A;  2MK3 A;  3WB1 A;  3DTU B;  5CBG A;  1R6K A;  4X64 O;  5CBF A;  4R50 A;  3EVK A;  2QM7 A;  4I9W A;  1HNX B;  2P5O A;  2UUB O;  1QQC A;  2CTQ A;  1YEW A;  1WNS A;  2AHZ A;  4F6R B;  5K1X A;  3CCM V;  1P49 A;  3JD0 A;  2XT9 A;  1BCC H;  5ITZ B;  3F5T A;  4FIP C;  1LUW A;  4JF3 A;  1PNM A;  1R3J C;  1URF A;  2CTR A;  1NKD A;  4J7K A;  1RSO A;  2IJK A;  3JD2 A;  4JV5 O;  3RVZ A;  4YY3 B;  1YDX A;  4HYO A;  1SQG A;  3CEI A;  3B2E E;  4GX2 A;  4E2L A;  3MHH C;  3T2M A;  3E86 A;  2EIM C;  3O9O A;  1Q3E A;  5KX5 A;  2A0L A;  2Q7E A;  3TXS A;  2B9Z A;  4BW9 A;  3P3N A;  2ZR3 A;  3CSX A;  4RUF A;  3MD0 A;  3CC2 V;  1N8R W;  3ZIA G;  2L6L A;  2GV9 A;  3CXC U;  5CMU A;  3FYE B;  1N33 B;  3E83 A;  1OCR C;  1QHT A;  4QE7 A;  3ZHU A;  4LWS A;  2HVK C;  5J2U B;  4MW8 A;  2ZNJ A;  1GM9 A;  1NVP D;  1XOU A;  4GX1 A;  5LA6 A;  5B1B C;  5CA1 A;  5J9P C;  3DC5 A;  4CBC A;  4JI8 O;  4TOI A;  1F51 A;  1OJH A;  1D5N A;  2ATK C;  3O65 A;  1Z5W A;  1SES A;  4G28 B;  2JS3 A;  2OCH A;  3ABU A;  5JCO A;  2QGN A;  1XNR B;  4MTX A;  2OWO A;  1Q6H A;  2HVJ C;  3VQX A;  1GAX A;  3AG4 C;  5C93 A;  3CC7 V;  4O4J A;  5IE9 A;  4RQF A;  4NKG B;  3K5M A;  2ZM6 O;  2HJD A;  4FZ1 A;  4DK0 A;  1GM7 A;  4I0X A;  3TXQ A;  4JI6 B;  2XOK G;  1JJO A;  3CCU V;  4DV3 O;  4NXN O;  5BXZ A;  4TWK A;  1W0J G;  2XAJ A;  4JTA B;  1PM9 A;  2B1G A;  4LC1 A;  4NTY A;  4TUY A;  4MS2 A;  3JAT B;  4UXN A;  4LF7 B;  2P22 C;  3CME V;  1VQP V;  5EZY A;  4J41 A;  1ZTE A;  4PA7 A;  4IGG A;  5IJ0 B;  3AG3 B;  5LP6 B;  4EFB A;  1G1X B;  2JGD A;  4TQF A;  1L1F A;  4QGP A;  1MG1 A;  4U7N A;  2ZQM A;  1DK1 A;  1ZX3 A;  2ZT9 B;  1AI5 A;  2AW9 A;  3DXR B;  1B3Q A;  4JI5 O;  4DR4 O;  4RO2 A;  1HW7 A;  3HKD B;  2EUL A;  1R3K C;  4IL6 Z;  4LF7 O;  2JVD A;  5LMN O;  3ASO B;  4O2A B;  3FAV A;  1M1K W;  1MA1 A;  4DR2 B;  3N2G A;  3ZRX A;  2OTJ V;  2NN4 A;  2NR5 A;  3LSQ A;  5KAI Z;  2EJ7 A;  3BCC H;  4PI2 A;  2AZ2 A;  4CH3 A;  4JZ2 A;  4NTX A;  1RM1 C;  3K9S A;  4B3T O;  1M57 B;  2UXD B;  2QR4 A;  2YXL A;  1QNM A;  3T4Z A;  1AR1 B;  1BHA A;  2F93 B;  3LDE A;  5L3F A;  2UXC O;  4HBN A;  2IJI A;  5JQG B;  3UO3 A;  3P32 A;  4Z1M G;  2XAQ A;  2EZP A;  4UVC A;  4DV7 O;  5LXT A;  2F4V O;  2PY5 A;  1JOY A;  4FLV A;  1HR0 O;  5HFM A;  4YJ2 B;  4DV5 B;  1H2G A;  4K0K O;  2GUZ B;  2X6A A;  2R72 A;  5KMG B;  3IC7 A;  4GKK B;  1VQM V;  4DV6 B;  4R8C A;  1XHZ A;  1NT2 B;  4Q20 A;  3F5W C;  3MHS C;  5KA5 A;  4TSF G;  2WLL B;  3OMN B;  4MVR A;  4C7U A;  1RPR A;  4X65 O;  1R1B A;  1ZWI C;  2CE4 A;  1BL8 A;  3G67 A;  4O4H A;  3ICX A;  1BGY H;  1TVK B;  2PF4 E;  4ZI7 A;  2E76 B;  1XBL A;  2R9A A;  5FNV A;  3CHX A;  3BAB A;  4LFC B;  1AJP A;  1SZX A;  2M6Y A;  4GKK O;  3DGE A;  3WG7 C;  2IM9 A;  1TUB B;  1S77 D;  2FML A;  3E8F A;  1AP5 A;  1Y76 A;  4KL1 A;  1SF9 A;  1QLN A;  5BR8 B;  4FM0 A;  1N36 O;  3BRC A;  3ASO C;  1PV0 A;  3SJA C;  1VF5 B;  4IYH A;  4CZZ A;  5C8Y B;  1B06 A;  3IJ4 A;  4B3M B;  4DYL A;  1IX9 A;  4FFB A;  1NI8 A;  4TV8 A;  2N04 A;  5IY5 B;  3ZHT A;  2YID A;  2PZS A;  4LFB B;  2QE7 G;  1GRJ A;  2QKS A;  2JK5 C;  2NLJ C;  4LFC O;  3K5O A;  1GTO A;  2Q0A A;  2X6B A;  4W4L A;  3MDS A;  3Q4H A;  4NYK A;  2WLJ A;  4O4I B;  1ORQ C;  3F7Y C;  4UCV A;  1Q90 D;  4XBF A;  5LMU O;  1L0L H;  3RVY A;  1AR5 A;  5IT9 N;  2ZXW B;  3X2Q C;  2EIL C;  2QWQ B;  3RBZ A;  4ZHQ B;  2GTA A;  3K57 A;  1FPO A;  3OT7 A;  2EIN C;  4ZIB A;  2RN9 A;  1Q7Y W;  4JZG A;  5LGN A;  4LFB O;  5B5E Z;  4PDL A;  3FKS G;  5IWA O;  4B3R B;  4O2B A;  2BTQ A;  3ETE A;  2Z5U A;  1VIB A;  1I7F A;  3GWO A;  5KHG A;  4X62 O;  4KP4 A;  4LF5 B;  4H44 B;  2KKW A;  2R9R B;  2QWP B;  4HZ3 A;  4ABM A;  3OM3 B;  2ZIM A;  1K7D A;  2Q6A A;  1UJW B;  3W7U A;  3SDL A;  2QM8 A;  1AP6 A;  4DW1 A;  1FJG O;  5KHI A;  2WLH A;  2Q69 A;  3BPZ A;  3JAR B;  2WSS G;  3K0D A;  2K1E A;  1GKF A;  4EB6 B;  2IBZ H;  1I08 A;  5H6Q A;  4F6E A;  3UT5 B;  5IYZ B;  3FB5 C;  3OD4 A;  1WA8 B;  2GBO A;  1IZ3 A;  2DYR B;  4R7C A;  2QWR B;  3G6E V;  4LF4 B;  3L75 H;  3RW0 A;  2RJZ A;  4QIW F;  2JDI G;  4OPA A;  4FLZ A;  3SR2 C;  4DUY O;  1FFX A;  2CUG A;  4MVU A;  5IY5 C;  1ZL8 A;  2VS0 A;  3APO A;  2CH7 A;  2VQF O;  3W7W A;  3H1K H;  2BE3 A;  5CB4 A;  2LO1 A;  2LQT A;  1SZT A;  3I56 V;  2VQE O;  4F4L A;  3OR6 C;  5FLX N;  3TK1 A;  4PHZ A;  1N34 B;  3ABL B;  1HDJ A;  2CGN A;  3G80 A;  2CTW A;  2YSU B;  3B77 A;  4JYA B;  4JI0 B;  5EBL C;  4D7S A;  2D2C B;  4OGQ B;  2CGO A;  1VQ9 V;  1M56 C;  2GSM B;  2QWO B;  3ETD A;  3VBB A;  5GON A;  1VMG A;  4UB8 Z;  4HAM A;  4NTW A;  5B3S B;  2VWK A;  4JTD B;  2EIM B;  1M9N A;  5J2U A;  5EYP A;  4UFZ A;  3CRQ A;  5DED A;  4AQY B;  4TV9 B;  1GH6 A;  3G6B A;  3T4D A;  3CWB H;  3ZHQ A;  1Q5O A;  4DXW A;  3WB2 A;  2XUM A;  2EJR A;  1OCR B;  3H1I H;  3NR7 A;  1BS3 A;  1U96 A;  1F7Y A;  4UCS A;  1G6U A;  2A3Q A;  5H9C A;  3C3S A;  2ZCE A;  4HNA B;  3SPJ A;  5B1B B;  1O9H A;  1ZAU A;  4WFH A;  2E5L B;  2WPD G;  1NVP B;  3ZMZ A;  1NJI W;  3M8A A;  1S3J A;  5B1O A;  5DM6 V;  2UUC B;  4JI3 B;  2OT5 A;  1RP3 B;  2E3C A;  5E79 Z;  3D3Q A;  3A0B Z;  3TGU H;  4AHC A;  3CPW U;  4GCZ A;  4JI1 O;  3S3W A;  1BE3 H;  1ZSP A;  1JVM A;  3H01 A;  1BQZ A;  4JAV A;  4LNU A;  3K3W A;  2FL4 A;  3E35 A;  1IBM O;  3UKM A;  3AG4 B;  2AZ0 A;  5CA0 B;  4NXM B;  3RWR D;  4FZ0 A;  1OCC C;  5IJ0 A;  1XNQ B;  5LP6 A;  4N23 A;  5A9G A; 
#chains in the Genus database with same CATH homology
 1VQN V;  4PA7 A;  4JPR A;  3CCL V;  1K4D C;  1AJN A;  2WLM A;  3AG3 B;  3K03 A;  3E8G A;  1V54 B;  3UM7 A;  1KP3 A;  1Q86 W;  3K0G A;  1QBZ A;  2IU0 A;  3ABL C;  3OMA B;  2DW4 A;  1OCC B;  1ROP A;  5EBM C;  4PA4 A;  4G2K A;  3ETG A;  2WAM A;  5IDJ A;  1L1F A;  1MG1 A;  1J95 A;  4U7N A;  2ZQM A;  4WCE V;  4PDV A;  3I55 V;  1H8H G;  1PNK A;  1SRY A;  1XL4 A;  3EHB B;  1KC8 W;  1VQ4 V;  2H8P C;  1AI5 A;  2WWW A;  1MOF A;  4QE9 A;  1K5S A;  1FFT B;  2XAG A;  4RO2 A;  4XDK A;  2V7Q G;  1OZ0 A;  3E89 A;  3ABK B;  3CD6 V;  4I5S A;  4H37 A;  5B3S C;  2ZDI C;  5CBH A;  2X6C A;  1YIT V;  1KP2 A;  2C2A A;  2ZR2 A;  4JYB A;  4X8A A;  1OHH G;  2YEV A;  1R3K C;  5KUK A;  3CCQ V;  1K73 W;  3NXS A;  2ZDI A;  1GK9 A;  4WFB V;  3ML0 A;  1AJQ A;  1EZJ A;  1E1Q G;  1K9M W;  1M57 C;  3ASO B;  2YEV B;  1S5H C;  4JAS A;  1M1K W;  4MVZ A;  3ZRX A;  2OTJ V;  3LSQ A;  4MVM A;  3ZRW A;  1BHB A;  2CK3 G;  2B5U A;  1VQ6 V;  4U7O A;  3CCE V;  1RM1 C;  1VQ8 V;  1F4M A;  4FJC C;  1M57 B;  3ZRW B;  5L3D A;  2WLK A;  2NNU A;  1THZ A;  1AI6 A;  1I5X A;  3W7S A;  3ZRV A;  3SYC A;  1TUE B;  1AR1 B;  3T4Z A;  1W2B U;  1BHA A;  1VQK V;  2QA4 V;  1PL0 A;  1F23 A;  2WLI B;  5GW7 A;  4PDM A;  1PNL A;  3LDE A;  3LSS A;  5L3F A;  4QPJ A;  1RM1 B;  3IFX A;  5DN6 G;  2IJI A;  1I5Y A;  3IGA C;  1R3L C;  2HG5 C;  1R3I C;  3P30 A;  1CPY A;  3P32 A;  4GX5 A;  2XAQ A;  4QPK A;  2EZP A;  4Z1M G;  2HR3 A;  4LCU C;  3ZMS A;  2IU3 A;  4UVC A;  1JPX A;  3ZN1 A;  3OFN G;  1JOY A;  1SET A;  1RPO A;  1F4N A;  1KEC A;  3K08 A;  3K06 A;  5HFM A;  3JD1 A;  2ZD9 A;  1LNQ A;  3D36 A;  3SPH A;  2F43 G;  1H2G A;  3CCV V;  4ASU G;  1QVG U;  2QTO A;  2X6A A;  1QVF U;  2P6J A;  3OE7 G;  1VQ7 V;  3G4S V;  3AG1 C;  4JGS A;  4MW3 A;  1YTF D;  2R9I A;  2Y69 C;  3IC7 A;  1VQM V;  4R8C A;  2WLL A;  4Q20 A;  5L3C A;  3F5W C;  2EIJ C;  4ZBM A;  2W6I G;  2JEX A;  4JYC A;  3ABM C;  3MHS C;  3FB8 C;  5KA5 A;  2XND G;  3JYC A;  4X88 A;  4TSF G;  3OEE G;  2WLL B;  4LBE C;  3SJQ C;  3JCZ A;  2HFE C;  4LP8 A;  2IJH A;  2Y69 B;  3OMN B;  2GHY A;  4MVR A;  1GO3 F;  1ENV A;  3F7V C;  1RPR A;  1MSW D;  2EIJ B;  1ZWI C;  5LGU A;  3ABM B;  1FXH A;  1S76 D;  1BL8 A;  3EFF K;  5L3B A;  1K97 A;  1V54 C;  2DQ3 A;  4GT1 A;  1OCO B;  1K4C C;  4KUM A;  3LDC A;  4PDR A;  2DWD C;  4QNH B;  2QEX V;  5B1A B;  2DWE C;  1NR7 A;  1K33 A;  5E1A C;  2EBO A;  3SPI A;  4MTG A;  2LP7 A;  2WLN A;  2IH3 C;  3SPG A;  3AG2 C;  5FL7 G;  3HPL C;  1FXK B;  2Q67 A;  1AJP A;  1PKX A;  4UVB A;  1WPX A;  3DGE A;  3WFV A;  3WG7 C;  3K79 A;  3ABK C;  1S77 D;  5EBW C;  2JIZ G;  3E8F A;  3CCS V;  4P9P A;  2Y48 A;  5L3G A;  5LGT A;  3ASN C;  3AG2 B;  5EC1 C;  4X89 A;  4TT3 G;  1K8A W;  1EBO A;  4MTO A;  1QLN A;  2BOC C;  3R65 A;  3WG7 B;  2V1D A;  3ASO C;  5B1N A;  4CZZ A;  3CCR V;  4PEL A;  1B6Q A;  4JTC B;  1DF4 A;  3ASN B;  2X0L A;  2HKO A;  1K5Q A;  5LHG A;  2JEU A;  2LFR A;  3FYI B;  4MT8 A;  1QLE C;  3BEH A;  5IY5 B;  1H38 A;  2P67 A;  2QE7 G;  1NH2 B;  2UXX A;  3K04 A;  2QKS A;  2LFS A;  1YJN V;  1K34 A;  5CA3 A;  1PD3 A;  1GMG A;  4MTF A;  4PA3 A;  3TET A;  2JK5 C;  2NLJ C;  1GTO A;  3E8H A;  1E1R G;  2X6B A;  3OEH G;  1QLE B;  3JD3 A;  2WLI A;  3ZN0 A;  2ZXW C;  3HB3 B;  2WLJ A;  1ARO P;  4DO2 A;  1ORQ C;  3FB6 C;  2ITD C;  4L87 A;  2ITC C;  3F7Y C;  3BY6 A;  5H6R A;  3W7T A;  1WLE A;  3B8M A;  4XBF A;  1V55 C;  3RVY A;  5KUM A;  1MAB G;  5EK0 A;  5L3E A;  3OAA G;  1P7B A;  2ZXW B;  1FXV A;  1KQS U;  3X2Q C;  2EIL C;  2OTL V;  1JCH A;  4KFM A;  3RBZ A;  2A79 B;  4BIU A;  2EZO A;  2A9H A;  4OXS A;  4WFF A;  1AI7 A;  2EIN C;  1V55 B;  2JJ1 G;  2M7W A;  1Q7Y W;  5LGN A;  3X2Q B;  2XAH A;  2JJ2 G;  3FKS G;  2EIL B;  4PDL A;  4P30 A;  4WFA V;  3ETE A;  2Z5U A;  3GWO A;  1W0K G;  1CP9 A;  2EIK C;  4KP4 A;  1OCZ C;  2UXN A;  2EIN B;  2R9R B;  4HZ3 A;  4ZKI A;  1JJ2 U;  4G27 B;  3SYO A;  3K9A A;  1DLB A;  2IJJ A;  3OM3 B;  4WFE A;  2BOB C;  1K7D A;  2Q6A A;  3ZRS A;  1UJW B;  4WF9 V;  1OCO C;  1R6N A;  2DQ0 A;  3W7U A;  2KB1 A;  2QM8 A;  3STZ C;  5B1A C;  3M99 B;  2EIK B;  2H94 A;  1SER A;  1NR1 A;  1OCZ B;  2WLH A;  2Q69 A;  2B1I A;  3FB7 C;  1FXK C;  3GB7 C;  2WSS G;  3K0D A;  1YJW V;  2K1E A;  1KD1 W;  3ZMV A;  4PA9 A;  1GKF A;  3OR7 C;  4FMT A;  2P90 A;  5IYC O;  3E8B A;  3SYQ A;  2DYR C;  3SYA A;  3SPC A;  1FXK A;  1QCE A;  4UV9 A;  3ZMU A;  1XL6 A;  2MK3 A;  4N21 A;  1EFR G;  3DTU B;  5CBG A;  1NQT A;  3ABT A;  1R6K A;  3D3I A;  4RUE A;  1M90 W;  1QR8 A;  4BAY A;  5H6Q A;  5CBF A;  2DYS C;  3FB5 C;  1QR9 A;  4R50 A;  2DYR B;  3QNE A;  1BMF G;  2PI5 A;  1KKD A;  4R7C A;  2QM7 A;  4I9W A;  4MVS A;  3G6E V;  5KA6 A;  3RW0 A;  4QIW F;  3KG2 A;  2AHZ A;  1K92 A;  2JDI G;  3W7X A;  3CCM V;  4PA6 A;  1YJ9 V;  1VQL V;  2DYS B;  1JX9 A;  1NH2 D;  3JD0 A;  4MVU A;  5IY5 C;  5BZB A;  2FTK A;  4YXW G;  4FIP C;  2PI4 A;  1YSC A;  4JF3 A;  1PNM A;  1R3J C;  1G8M A;  4UUJ C;  1GM8 A;  3W7W A;  4J9Z B;  3STL C;  4MVQ A;  1NKD A;  3LDD A;  2XAF A;  1SZT A;  3OUF A;  4UV8 A;  2X7R B;  3I56 V;  3CC4 V;  2IJK A;  2AHY A;  4F4L A;  3JD4 A;  3OR6 C;  5IYB O;  2P7T C;  3JD2 A;  1H8E G;  1JQ0 A;  3TK1 A;  4XDJ A;  3ABL B;  3QO8 A;  3RVZ A;  4RQE A;  1VQO V;  2YSU B;  3B77 A;  4FPP A;  4HYO A;  5EBL C;  5LBQ A;  4WFG A;  1DTO A;  4GX2 A;  4E2L A;  1VQ5 V;  3MHH C;  4FK5 C;  3T2M A;  4BIZ A;  3E86 A;  2EIM C;  1VQ9 V;  1M56 C;  2A0L A;  2GSM B;  3ETD A;  3VBB A;  5LHI A;  4R6Z A;  3G71 V;  4QJF B;  4JAU A;  4HAM A;  1Y4M A;  2ZR3 A;  4RUF A;  5B3S B;  3MD0 A;  1YIJ V;  2Q68 A;  3LNM B;  3PJS K;  4JTD B;  2D3O W;  3CC2 V;  1N8R W;  3ZIA G;  2EIM B;  1M9N A;  2HLD G;  2IH1 C;  3CXC U;  1M56 B;  5CMU A;  3FYE B;  3OMI B;  1YI2 V;  1S72 V;  3E83 A;  1OCR C;  4GX0 A;  2XAS A;  4QE7 A;  3T4D A;  3E2E A;  2HVK C;  4MW8 A;  4EKW A;  4MSW C;  1GM9 A;  1NVP D;  3LUT B;  4DXW A;  3VOU A;  3ZCC A;  4GX1 A;  4MVO A;  5LHH A;  5IYD O;  1HWY A;  2EJR A;  5B1B C;  1OCR B;  1Q82 W;  2IW5 A;  5J9P C;  1COW G;  3CMA V;  3ZMT A;  3A0R A;  3AEI A;  4RAI A;  4CBC A;  4BW5 A;  5H9C A;  1CEZ A;  3ZJZ A;  1F51 A;  2HJF C;  1NBM G;  3OW2 U;  3SPJ A;  2ATK C;  3CP1 A;  5B1B B;  1SES A;  4WFH A;  2WPD G;  4G28 B;  3ZMZ A;  1NVP B;  1S0V A;  1NJI W;  1S3J A;  5B1O A;  5DM6 V;  1K3E A;  2Z3Y A;  2OT5 A;  3T1C A;  3ABU A;  2OCC C;  1FS0 G;  1Q81 W;  1R73 A;  4XDL A;  1P4R A;  3B8N A;  3OUS A;  2W0F C;  4MTX A;  3CPW U;  4GCZ A;  1G4Y B;  1AI4 A;  2HVJ C;  3SYP A;  3AG4 C;  5C93 A;  1JVM A;  3CC7 V;  2W6J G;  4P2Z A;  4RQF A;  3CCJ V;  4UVA A;  3H01 A;  1E79 G;  2OCC B;  4J9Y B;  3TCU A;  3AG1 B;  1DF5 A;  1GM7 A;  4JAV A;  2XOK G;  4H33 A;  3CCU V;  5HFL A;  3K3W A;  3E35 A;  4TWK A;  1YTF B;  1W0J G;  2XAJ A;  5CN0 A;  3UKM A;  3OGC C;  4JTA B;  3CYO A;  5EC2 C;  3AG3 C;  1IXM A;  3AG4 B;  2B1G A;  4LC1 A;  4MS2 A;  4UXN A;  3QO7 A;  4P9O A;  1YHQ V;  1OCC C;  1Y66 A;  3QO5 A;  3CME V;  1VQP V;  4N23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...