2HG5C

Cs+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB HEAVY CHAIN
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
molecule tags Membrane protein
total genus 21
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hg5C00
4PA4A 3E83A 2ITDC 3AG4C 4GX1A 2X6CA 2A9HA 2WLMA 4OXSA 4KFMA 2WLKA 3X2QC 2YEVA 3IFXA 4X8AA 2Q67A 3VOUA 4PDMA 3SPIA 4R8CA 4H37A 2DYRC 4GX2A 1P7BA 1M56C 5E1AC 3OR7C 5EK0A 3SYAA 1R3LC 4LP8A 3T4DA 3K03A 4MTGA 3E8HA 4P30A 2WLNA 3F7VC 2AHYA 2KB1A 4G28B 2HFEC 4PDRA 4XDKA 5CBFA 2HVJC 3T1CA 3ASOC 3ABMC 3T4ZA 4GX0A 3KG2A 1S5HC 2IH1C 4MW3A 4PA9A 2Q6AA 5CBGA 3E8BA 5IY5C 4QE9A 4MVZA 3SJQC 3OUSA 4I9WA 1R3KC 3SYCA 4F4LA 1G4YB 1OCRC 3RVZA 5B3SC 4J9ZB 3RVYA 1K4CC 1KKDA 3ABKC 1XL6A 2NLJC 3LDDA 3HPLC 3SYOA 4JTDB 2AHZA 3TETA 2WLJA 2A0LA 3E89A 4RO2A 4P2ZA 1BL8A 4H33A 3LDEA 5B1BC 3WG7C 5KUMA 2BOCC 4XDLA 3IGAC 3FB5C 4MVRA 4MW8A 2OCCC 2DWEC 2X6BA 3F5WC 3STLC 3R65A 4BW5A 4GX5A 1V54C 1R3JC 4LCUC 4WFHA 2R9RB 4MTFA 1K4DC 2Q69A 2HVKC 5EBLC 1QLEC 3E8FA 4QNHB 2QTOA 2EIMC 1LNQA 2EIKC 2WLLA 4XDJA 3ZRSA 5CBHA 2EIJC 2H8PC 2X6AA 3BEHA 4PA6A 4PDLA 1XL4A 4HZ3A 1R3IC 4TWKA 2DYSC 1V55C 2ATKC 3K08A 3SPGA 3EFFK 2ITCC 2P7TC 4X89A 1M57C 3SYQA 3T2MA 1JVMA 2QKSA 4MS2A 4JTAB 4RUFA 4MTOA 4PDVA 4UUJC 4P9PA 3ZJZA 1OCOC 3FB8C 4MVMA 3RBZA 5B1AC 4X88A 3K06A 3SYPA 2Q68A 4R7CA 3UKMA 2HJFC 3AG2C 3LUTB 2WLIA 4LBEC 2A79B 5KUKA 2K1EA 2BOBC 4WFFA 1ORQC 1OCCC 3PJSK 2WLLB 3LNMB 4MVQA 5EC2C 2ZD9A 3TCUA 4WFGA 5EC1C 4PA3A 3ASNC 3LDCA 3SPCA 3JYCA 4J9YB 4QE7A 3UM7A 3FB6C 3E8GA 5BZBA 3OGCC 4RAIA 1OCZC 2EINC 4MVSA 5EBWC 3RW0A 2EILC 2HG5C 3F7YC 3SPHA 2Y69C 2JK5C 4HYOA 2ZXWC 3K0DA 4P9OA 4DXWA 3OR6C 4EKWA 3K0GA 4R50A 1J95A 4WFEA 4JTCB 3SPJA 3AG3C 4ZBMA 4MVOA 2WLIB 4MSWC 4PA7A 1ZWIC 5EBMC 2WLHA 4MVUA 3K04A 3E86A 4R6ZA 3FB7C 2DWDC 3AG1C 2IH3C 4CBCA 3STZC 2W0FC 5J9PC 4RUEA 3OUFA 3ABLC 4G27B 3GB7C
chains in the Genus database with same CATH superfamily
4FFBA 4GX1A 1LUWA 2P6JA 1YSCA 4O2AB 2FKXA 1F4NA 3AK2A 1K7DA 3CD6V 4FMTA 1ENVA 2CTWA 1VEWA 2RN9A 4TV8B 3I55V 4DR6O 1Y76B 3K5OA 4KHPO 5LBQA 2HFEC 2N04A 2EILB 4FLUA 1FJGO 1PNKA 1R3KC 1G4YB 3RVYA 2P22C 2ILMA 4X65O 2PYJA 4CH4A 5CB4B 3E89A 3S3WA 3K59A 1UJWB 1AILA 2BOCC 4U7NA 4XDLA 4K35A 4JI0B 2ZE5A 3L9DA 4LH6A 4WBNA 1X59A 1FD9A 4PDLA 2BTQB 1R3IC 4ICGA 2VQEB 2UUAO 4X89A 2EULA 1FXVA 2PGGA 1N34B 3OTFA 5IT9N 2R72A 3FB8C 4DV4O 3NXSA 5LHIA 1KUQA 4X62O 1NZ6A 2BOBC 2YIBD 1ORQC 2ZR2A 4OPHA 2ZM6O 5H6RA 1IBKO 2E76B 3MAQA 3VBBA 1XHZA 1JFFB 5BZBA 4KHPB 2F1MA 3HKDA 5D5QA 4DV1B 1XBLA 1VIBA 1BSMA 4QPJA 3CCEV 1R1BA 5C8YB 3OEEG 3JASA 4JYYA 4EFEA 4JV5B 1DTOA 4QNHB 1FXKC 1AROP 3B8NA 3JD3A 2G38A 3QG5A 2ITDC 4B3SB 2OCHA 2JJ1G 2QJ1A 4TV9B 2LW7A 2KG7A 4FLWA 4LF8O 1M56C 1P7BA 4LF4B 1K9MW 1SA0B 1X4TA 4I9QA 1THZA 3CE2A 2D2CB 5IWAB 2YXYA 3BPZA 1KQSU 2CDYA 2XHBA 2EINB 2LW1A 4FM1A 3KG2A 1S5HC 2Q6AA 3RYCA 2AW9A 4F4LA 2LFRA 1VQLV 1SESA 2AHZA 2JIZG 4B7EA 2ZM6B 2EZPA 4GX5A 1YI2V 5EYPA 1FS0G 5JJEB 5EBLC 3ZHQA 2EBOA 2QWQB 4NTXA 4AHCA 3L74H 4JI6B 5CA3A 1AI5A 1VF6C 2JGDB 5JWPA 1KU9A 2WA4A 3JATB 5KMGA 3RBZA 3IC9A 2ZE7A 4BAYA 4DO2A 1M93A 2EJ7A 4O4LB 2QKAA 5H2FZ 4LBEC 4B08A 1BHAA 5JCOA 3B77A 1PV0A 1NH2D 1VF7A 1NS1A 2XOKG 5EZYB 2R9AA 4H0LB 2N74A 1HWYA 1TVKA 1I7FA 1J95A 3K5NA 2PUSA 2WLHA 4JAUA 4JI3O 4LFCO 5BY1A 4CC5A 1DGSA 3J80N 4IL6Z 2N05A 4AQYB 3MD0A 1OCCB 5CA0B 1HR0O 1L0LH 2Y4TA 1XEQA 1SKVA 3E8HA 3M8AA 1O9GA 3F7VC 4O4IA 3UCSC 3U11A 2JGUA 3ABMC 3VQXA 1YIJV 2Q7EA 1MOFA 3CRRA 2WLJA 1NR1A 3E2EA 3KCXA 4ZKIA 3QO7A 3AG1B 2ZE6A 2OIEA 1D2DA 3HB3B 3A0RA 1IBMO 1XREA 1WPXA 4ZHQB 3ZRWB 1AR1B 4X1KB 3RT3C 5K1PA 4KP4A 4PHZA 3M7MX 5IYDO 1XMOO 3BEHA 1JA8A 1XNRB 1VQ6V 4BR6A 2ATKC 2JVDA 3RWRD 3SYQA 4JZGA 2UUBO 3CRCA 1DLBA 1TAEA 4YJ3B 5LMNB 4TV8A 3NR7A 4DV3O 3DXRB 1JQ0A 4RWUA 4I0XB 2HJFC 1AP5A 4GKKO 3ABTA 1EBOA 4LNUB 1FKAO 4UCRA 3E8GA 2Y0IA 1P84F 2V7QG 4IIJB 4N23A 3CJHA 3OGIB 4GKJO 3G80A 1VQ7V 1NBMG 4MVOA 1B06A 3K04A 5LP6A 1AB3A 4YJ2B 5A9GA 1RM1B 2CK3G 3CCJV 1IBMB 4PV1B 3W7XA 1GN3A 2X6CA 4DV5B 3AG2B 2WLKA 2YEVA 2LJ2A 5DN6G 3SJBC 5J2UB 1TUBA 4E4EA 1AI6A 5GONA 1R3LC 3TK1A 1Y74A 3K03A 2QWNB 3P32A 2UUBB 2KSDA 2AHYA 2KB1A 1OCZB 4FVMA 4F6EA 2X0LA 3FD9A 4MW3A 4I9WA 5LHHA 1KKDA 2Q4PA 3GWOA 4JI8B 1EN6A 1HDJA 4U3FH 2E5LO 3K5MA 2XASA 3T1YB 2W6JG 2YSUB 4MW8A 3AG4B 2NN4A 2DMXA 1QQCA 1PNLA 2Z3YA 3B09A 4X66B 1CPYA 1D5NA 4LF9O 4JI1O 2EIJC 3ZN1A 1QLNA 4NXNB 3SGIA 1ZL8A 5TISZ 2CGNA 4MS2A 4IGGA 1IXBA 2VQFB 2PI5A 2QKCA 3ASOB 4P9PA 3BRCA 5FNVA 5JCOC 5H9CA 2FL4A 5IJ9A 1YHQV 3QF7A 5B3SB 2Q68A 2RMKB 3FAVB 4WFAV 2M7WA 4LFAB 1IURA 1GN2A 3N2KA 4PA3A 1S76D 5L3FA 1QNMA 3ASNC 3B40A 4YY3B 3FYIB 4XBFA 4F6RB 3KZIZ 5EBWC 2CH7B 3RW0A 4TUYB 2GTSA 1P7GA 4DXWA 2Q5ZA 2UUCO 5IYZB 1YJNV 2OWOA 2B9ZA 4R6ZA 2YXHA 2YC0A 3A2FA 2E5LB 5KAIZ 4UXNA 2PZSA 4EB6B 1CXZB 1XOUA 2WLMA 1WA8A 3ZEDA 1RSOA 3HKEA 5GTHZ 5GW7A 4H37A 4GLXA 4LC1A 4JI5B 3JALB 4CS4A 2WWWA 4FM2A 5KA6A 1GAXA 5JJNB 1R6TA 5KHIA 4QE9A 1VQOV 4LF6B 3ZS8C 4UV8A 4PI2A 3QO8A 4JTDB 3JD1A 3LDEA 3APOA 1YTFD 1WB7A 4X1IB 3F5WC 4X20A 2PY5A 1Q86W 3K5LA 4G2KA 5K1XA 4B3TB 2GTAA 2M6YA 3CHXA 4PA6A 4K8ZA 2PI4A 5KUKA 2DYSC 1XQ8A 3D36A 1GTOA 4X64B 1O9HA 4UUJC 3VQWA 3O65A 2DOSA 3DSQA 3W7UA 1VQPV 1ZAUA 4Q6GA 4L8JA 1NR7A 3UKMA 1MSDA 1JX9A 1H38A 1IVSA 3AEIA 1WAZA 1B04A 3APQA 5B1BB 4B3MB 3IC7A 2JJ2G 3OAAG 3RYFA 5HFMA 4J9YB 2PYLA 2QTSA 4HAMA 1HNWB 1W59A 2LGWA 4FLXA 3JARA 5LP6C 3CCMV 1GN6A 1NI8A 3ETDA 4B7KA 3AG7A 4J11A 1Q6HA 1D5AA 3L71H 4MVUA 1SRYA 3RFRA 4DRXB 5DECA 1IDSA 3LNNA 4JI0O 1K73W 4DR3B 3ZMSA 4I50B 4IT5A 2GDSA 4JYCA 3SDLA 2F66C 2Q67A 1EN4A 3Q4HA 1Q6IA 4UCOA 4UCUA 1RPOA 4FLZA 1MG1A 2XTAA 2VQEO 2UXNA 4DK0A 4DV2B 4HNAB 3T4ZA 1SQFA 2LQTA 3E8BA 1TUEB 1N34O 1NVPB 3CCSV 5C93A 4X1YB 3K9AA 1BHBA 3E22A 3L70H 5LGNA 3A0HZ 2A0LA 5EIBC 4TSFG 1KP3A 1TA8A 4BW9A 4LWSA 4UVBA 4J80A 4I4TB 1F23A 3X2QB 1WP8A 2YIDA 2R9RB 4MTFA 1S72V 1J5EO 3E8FA 2EIKC 4XDJA 4I7ZB 3CCVV 1I08A 4DV1O 2DYRB 3RYIB 4H13B 4TWKA 4ZOLA 3T2MA 2QKSA 5IJ0B 4AILC 3IAYA 3UT5A 4GZRB 3F5TA 3N2GB 4JV5O 3I56V 1S5LZ 2Y0PA 2ZKOA 4B3SO 4JYBA 4IHJB 3H9VA 3OMAB 1XHXA 4WFGA 1K33A 3BY6A 2OCCB 4LF4O 2R70A 3H1HH 5LYJB 3CCRV 3EXAA 3JYCA 2NR5A 1BE3H 3ZBHA 1K34A 4PJ0Z 5IWAO 5IY5B 4PELA 4CS3A 1K92A 2UXDB 3DTUB 2Q9LA 4DK1A 4LF5O 3DC6A 5LOVB 5KHHA 4EFBA 4WFEA 3AG3C 1OHHG 5LXTB 3K3WA 3OM3B 5JH7B 1YJ9V 3C3TA 1XMQB 4DUZB 4UV9A 1JJOA 1SETA 4GT1A 2AZ2A 5KHKA 5J2TA 1Y4MA 1J5EB 5EIBD 2ZDIA 3SPIA 2UXCO 4FLYA 1JCHA 5B66Z 4YIOA 3WB1A 1SF9A 3ZHTA 4UB8Z 1S77D 4FLVA 4JI6O 1G1XB 2IU3A 3BHPA 1MZEA 1ZTEA 3ETQA 3CXCU 2JRIA 1G8MA 1SC5B 3A8TA 1UFIA 3H1JH 2VS0A 2Z5UA 1XL6A 3CX5F 4FIPC 3ABUA 3OT7A 3WG7C 2KKWA 3JAKA 4LFBB 3LSSA 2QGNA 4UB6Z 3D36C 1M4UA 4LCUC 2XAFA 4ZI7A 3HKBA 4BWAA 2X6AA 1GMGA 2B1IA 4LF5B 4DR2B 2GV9A 2P7TC 1E1QG 1K8AW 3ZMUA 3ETEA 2HR3A 2BSKA 3G6BA 1I0HA 1I5XA 4PI0A 2F23A 1SQVH 4H44B 1DF5A 1PD3A 3ZRXA 1PNMA 3G6EV 4WFFA 4AQYO 2GSMB 2ZR3A 4MVQA 1N32B 3K58A 2UXCB 5EC1C 5JQGA 3TJTA 2PTMA 1GN4A 3UM7A 2XAHA 1IBLO 2LFSA 3H1KH 4D6TH 2XT9A 3SPHA 4ASUG 4D7SA 2ZXWC 4P9OA 5KX5B 2WLIB 1ZWIC 1EZVH 3LSUA 4O4HA 4LR3A 3ABLC 2QM4A 3SJAC 4KFMA 5CN0A 2CTQA 4DYLA 2GUZB 4B3RB 2QEXV 4PDMA 5CA1B 4Z1MG 4TQFA 1YEWA 3ZHVA 3KCYA 1XNRO 4L87A 4LP8A 4QGPA 3OTOB 1SQPH 4PA9A 4W4LA 1XNQB 1YZBA 3U10A 5LMNO 3HR0A 4UCVA 1H2NA 5BXZA 4TT3G 4BIOA 1N36B 1FXKB 5FL7G 3FYEB 3R65A 3K57A 2HP8A 5LA6B 1K5SA 1NH2B 5KA5A 1BCCH 2WLLA 4AI8A 4DR4B 1IBLB 1M56B 1T5EA 5ITZB 1N4CA 4A5UB 3K08A 4J42A 4O2BB 5BMVA 1S0VA 2JS3A 1HNXB 3K9SA 1KBHA 4CH6A 2FTKA 3AK1A 4DUYB 2RQ6A 2P4KA 3KKYA 3CSXA 1OCOC 1MMMA 2Z0AA 4DV5O 3N27A 3HKCA 1EZJA 5JVDB 5IYCO 2ZINA 3TGUH 3RYHA 3T1HO 3ZMZA 4U3JB 3JD4A 2XAGA 4O2AA 1GM9A 1U96A 1SQGA 3OR6C 3ZMVA 1OZ0A 1ZX3A 1Y76A 3CS5A 1HP8A 2Q0AA 4JI8O 3K79A 2B5UA 2Y48A 3E86A 4DV0B 2ZDIC 3RYIA 3STZC 2W0FC 3T1YO 2IM9A 3BA9A 2Q0OC 4CS2A 1Q6UA 5CB4A 4WF9V 2RJZA 1E1RG 2A06H 3N2GA 4X66O 4TQDA 1AJPA 4R8CA 3OR7C 2NNUA 3PN1A 4NXNO 1YXBA 3FFQA 4LF7B 4MTGA 4GCZA 2WLNA 3JAWB 1VMGA 2QWOB 2VQFO 1H8HG 4X9QA 2F43G 1VQNV 3ZCCA 1YDXA 2BTQA 2JDIG 4FFBB 1VQ5V 1OCRC 1Y6XA 4J9ZB 3ABKC 1M5IA 1S3JA 4JASA 2E3CA 2PF4E 1BL8A 4LFAO 4JI7B 3T1HB 3L75H 2X6BA 4DV6B 1GRJA 1V54C 2QDOA 4BIZA 3EHBB 1M9NA 4WFHA 5KLVH 4YY3O 1MSWD 4K3AA 2EIMC 1PL4A 2ZNIA 1PP9H 1WJZA 3CEIA 1V55C 3WB2A 1JFFA 4FFKA 3P3PA 3A0BZ 3ABMB 3W7WA 1NT2B 5BR8B 3UO3A 1FFXB 2CTPA 5B1AC 5C8YA 3SYPA 3B4SA 2BTOA 4WBNB 4K0KB 4K8XA 1BT8A 5EC2C 4JI5O 4TV9A 1B6QA 3E35A 3FB6C 5B1NA 4RAIA 1BQZA 3S3XA 2HG5C 2Y69C 3OFNG 4JGSA 1SA0A 1FFTB 4LF6O 3OD4A 1MA1A 1SQBH 3SPJA 5EBMC 2A3QA 2Q7HA 1BS3A 1DF4A 3ZMTA 1R73A 1F4MA 3ZX6A 3HKDB 4OPAA 4B3TO 2E75B 4JZ2A 1P4RA 2RDCA 4HBNA 3JASB 4P30A 2YIAA 4PDRA 4X64O 2QM7A 3T1CA 4GX0A 1I94B 5B5EZ 1AR4A 2C2AA 3RVZA 4JF3A 2JGDA 1I5YA 1PPJH 3B8MA 3C3SA 4W4KA 1EM1A 2KG7B 3JATA 4B3MO 4GUNA 3IJ4A 4QIWF 4O4LA 1GKFA 2ZNJA 2XAJA 1K4DC 4DR1B 1HNWO 1KC8W 1QLEC 3QO5A 1H2GA 4DV7B 3RYCB 2ZT9B 2QSAA 1M57C 1WLEA 5E79Z 1JVMA 4JTAB 3CCLV 5EZYA 2VRZA 1VQ4V 3CMEV 4O4JB 1Q82W 2H3OA 5CMUA 3SR2C 1JMKC 3QTCA 4DR3O 5EYPB 1K5QA 2DE0X 1S5JA 5L3DA 3G4SV 1VQKV 1KYOF 3C90A 5L3CA 1URFA 2WA3A 3WU2Z 4DW0A 3DGEA 3UO2A 3H01A 4FK5C 3ETGA 4YHHB 2HHHB 1NTMH 1AJQA 4DV2O 1BZKA 4MVSA 2EIJB 5KMGB 2EILC 5CA0A 5LMUB 1QCEA 3FX7A 4R50A 1MNGA 2EJRA 3CB2A 1RPRA 3G67A 2OTJV 3JCUZ 1IXMA 3CWBH 4NXMB 5IYBO 4ZIBA 1HW7A 4X8AA 1WPBA 2ARHA 3JD2A 1K3EA 3OMNB 4GX2A 1NTZH 3ASNB 1F7YA 2Q7GA 4ZHQA 4JI2B 3ZRWA 4FPPA 1PL0A 4X1KA 5CBFA 1F51A 4QPKA 3JCZA 2IJHA 1HNZB 1K4CC 3LDDA 4OX9B 1EN5A 2JEUA 1NTKH 1W0KG 1N0NA 3EVKA 2FMLA 1NVPD 4YJ3A 1GK9A 1Q43A 5KUMA 3VQYA 3DXRA 3JAMN 4I0XA 3OEHG 1TGOA 2RCVA 4O4IB 2Q69A 4LNUA 2DW4A 1M90W 2IJJA 2WAMA 2WPDG 2UXDO 4YXWG 1H2MA 2H94A 2ITCC 5KHJA 2P06A 1SERA 1EFRG 2UXBO 1QR8A 2ZIMA 4IIJA 4ABMA 4JYAB 3RN4A 2AZ0A 1XMQO 2R9IA 4DUZO 4R7CA 3WB0A 2LO1A 2IJIA 3QNEA 4NYKA 1L1FA 3PJSK 4YJ2A 1R6KA 1NKDA 3CP1A 1Z5WA 2OTLV 3J7AU 1AJNA 5D5PA 2EINC 5J2UA 2CTRA 3F7YC 2DYSB 5L3EA 4JTCB 2XNDG 3CRQA 1VQMV 3ZIAG 2QA4V 2IW5A 4DR5B 4G27B 2ETNA 1KKCA 2XUMA 2QM8A 3QVNA 4LFBO 4NB5A 3R66A 2UU9B 3CJHB 1FFXA 1Q7YW 1XI1A 4CH5A 4DR2O 2W6IG 4G28B 2UXBB 1CP9A 4J10A 2P4VA 5LP6B 3MDSA 2P67A 3SYCA 1Q5OA 5F2VO 1RP3B 4NTWA 1A32A 2NLJC 4JAAA 2E74B 2YEVB 2RNBA 2IJKA 1DK1A 3TXQA 1TUBB 1N32O 3FB5C 5GONB 2DWEC 1Y74B 2CE4A 3ZRVA 3FAVA 2L6LA 1KP2A 4MT8A 5CBHA 4WFBV 1JPXA 1BGYH 4DR6B 5FPRA 1N33O 1ROPA 3OE7G 4F6RA 2CH7A 1FJGB 1NU1H 4TUYA 3H1IH 4MVMA 4X88A 2FYUH 4FZ0A 5H5NA 3L73H 4X65B 4C7UA 2DJVA 1R6NA 1JOYA 1H8EG 5IYZA 1GO3F 5LGUA 4B3RO 1FAFA 1OCCC 2ZD9A 3I5DA 4E2LA 1KECA 5IE9A 4GYCB 4EB6A 3O9OA 1ZL8B 4YIPA 3W7SA 2BE3A 4QE7A 3U0ZA 2EIKB 3OTOO 4PD4F 1G6UA 5FNVB 2F95B 1XNQO 3CYOA 1JR9A 2DQ0A 5IJ9B 2UUAB 3JALA 3K0GA 2ZQMA 2DWDC 3AG1C 2IH3C 2X7RB 1VARA 3N2KB 1N36O 1LR1A 2IU0A 1KMIZ 5LL6Y 4DV4B 4PA4A 1SS3A 3ZN0A 4X62B 2P5OA 2Q8VA 1BQ0A 3IFXA 3OMIB 2F93B 1PM9A 4NVPA 4DR4O 1IBKB 4O4JA 4X1IA 5L3GA 2KQXA 1GM7A 1N33B 1JJ2U 1FYJA 1HNXO 3D8CA 2HVJC 3JSLA 3H1LH 4DUYO 1AI4A 3ZHSA 1SZXA 3CXHF 3THOA 1WA8B 3AG3B 1RSOB 3SYOA 3TETA 3HKEB 2VWJA 4MVRA 1R3JC 2QTOA 4LF8B 1MABG 1ZUQA 2H8PC 1W2BU 1Q81W 3RGBA 3MHHC 2LP7A 4Z1VA 4Q20A 2AGAA 1LUVA 4MTOA 4PDVA 4DV0O 1RM1C 4NTYA 1QU7A 3CRAA 4X20B 4UFZA 3AG2C 1P49A 2DQ3A 1OJHA 1Q8IA 2AXTZ 3LNMB 4DRXA 3WG7B 3SPCA 3BAAA 4LF7O 1Y66A 4I50A 4JPRA 2P90A 3OGCC 1OCZC 4KL1A 1Z5VA 5AG2A 1U97A 3M99B 4IYIA 4HNAA 1Q3EA 1XILA 5HFLA 4RUEA 2K9PA 3OUFA 4JI7O 4I55B 4X1YA 3RYFB 5DM6V 3AG4C 4RQFA 4DV6O 3VOUA 3JARB 1FXHA 3WFVA 2MW2B 2GBOA 3BVOA 4I4TA 3T4DA 2Y4UA 1NQTA 4IYHA 5GTIZ 2B1GA 3ASOC 1IX9A 2GHYA 3W7TA 5JJJB 3SJQC 3OUSA 5BR8O 2ZXWB 3BABA 4WCEV 5B3SC 2CAZC 3HPLC 5IJ0A 4U7OA 3MHSC 4P2ZA 4K0KO 3Q4HB 4H33A 4Z2WA 4JI3B 2QWPB 3ABLB 2W0XA 1H2SB 4LFCB 3STLC 1XUQA 5FLXN 1QVFU 1WNSA 2YI9A 4IHJA 5LHGA 1VP7A 2YDEA 4FM0A 2XAQA 2F4VO 1HR0B 1BMFG 4HZ3A 3E22B 5LYJA 1US6A 1IZ3A 4J7ZA 2WSSG 3BFRA 4UVAA 1VQ9V 1N8RW 3GWKC 3CCUV 1N0JA 2EX3A 1AVMA 5A2QN 4LWSB 3K06A 5LOVA 1CEZA 2HJDA 1QVGU 3B2EE 1WN7A 2JS5A 2K1EA 5LXTA 4OGQB 4D7TA 5JH7A 4FZ1A 4NKGB 1E79G 1QR9A 3BCCH 4ZOLB 4N21A 4TOIA 3AK3A 1V9PA 3UT5B 1XMOB 1I94O 1L0NH 2BCCH 3JSNA 1YJWV 1Y67A 3P3NA 5DEDA 4BIUA 1H2LA 3D3IA 2MK3A 3BA8A 3DC5A 2CGOA 2YI8A 3VQVA 3D3QA 4DV3B 1OCOB 1KB9F 3ICXA 3E83A 4JAVA 2A9HA 4OXSA 4GKKB 5KHGA 2ZIOA 4DR1O 2YIBA 2F4VB 4DV7O 2FB5A 5E1AC 5EK0A 3SYAA 3CC4V 2OIGA 2YUAA 4DR7O 3ZHRA 3UQ8A 4CZZA 1GH6A 1YCIA 4XDKA 5CBGA 2IH1C 4GKJB 4CC6A 3J81N 5J2TB 5FPOA 4RO2A 3ML0A 4KUMA 5B1BC 1WP7A 4UVCA 3G71V 4BW5A 1M1KW 3L72H 1H2KA 4YHHO 2HHHO 2HVKC 1PKXA 2QR4A 5LMUO 1XL4A 4CH3A 3SPGA 4J7JA 4J41A 4J7KA 2OYQA 1FPOA 1OCRB 2JEXA 3JAKB 4NXMO 2YICA 3ABKB 5KX5A 1YVWA 3LUTB 2WLIA 1VQ8V 4ZI7B 3OW2U 3HKBB 1RFYA 5IDJA 1YITV 4JI4O 4JI2O 1V54B 2ZCEA 4QJFB 5H6QA 4DR7B 1XDCA 2GUZA 2DN9A 2BSKB 2V4DA 4LH7A 2ADPA 2EIMB 4LF9B 4JI1B 5CA1A 1Z2GA 2JK5C 1V55B 2ODMA 3K0DA 1KD1W 1HNZO 2UXXA 3CRMA 4EKWA 1MZFA 3CCQV 4OX9O 3CC2V 2OT5A 3CMAV 1QBZA 1QHTA 4CBCA 5JQGB 1AI7A 5B1AB 2LGQA 1B3QA 3X2QC 2HEPA 2ZE8A 1YF2A 3FKSG 1FXKA 2A7WA 2DYRC 2IBZH 2QE7G 5LA6A 1NJIW 1GM8A 3CC7V 3P30A 4O4HB 3SJCC 4JYAO 4MVZA 5ITZA 2Y69B 3LSQA 1YTFB 4UCTA 1COWG 1SZTA 1ZLZA 2UUCB 4O2BA 1SQQH 1WB8A 4UCSA 2ADQB 2VWKA 4NR1A 4JI4B 3IGAC 2OCCC 2O57A 1Q90D 4EEQA 1TVKB 1L8DA 5JVDA 1SQXH 5IY5C 1LNQA 3ZRSA 5B1OA 2HKOA 1AP6A 4I55A 2Q73A 2CUGA 1UPGA 3EFFK 4U3JA 4I5SA 4RUFA 3TXSA 5KAFZ 2QWRB 2EZOA 3ZJZA 1AR5A 4DR5O 3JD0A 4KXRA 1VF6A 4FJCC 2A79B 2YXLA 2UU9O 2HLDG 4FLTA 2WLLB 3TCUA 3ZHUA 1K97A 3LDCA 5L3BA 2L35A 2YS8A 1W0JG 5BMVB 2D3OW 1VF5B 1QLEB 2V1DA 4DW1A 1ZSPA 3GVMA 1OV9A 4HYOA 4RQEA 1M57B 3JAWA 4ZBMA 4MSWC 4PA7A 3HKCB 4MTXA 3FB7C 3CPWU 3RYHB 5J9PC 5LGTA 3GB7C
chains in the Genus database with same CATH topology
4PA4A 4GX1A 3ZN0A 2WLMA 2P6JA 1YSCA 4WF9V 3IFXA 3OMIB 1F4NA 1E1RG 1K7DA 3CD6V 4FMTA 1AJPA 5GW7A 1ENVA 4R8CA 4H37A 3OR7C 5L3GA 2NNUA 4LC1A 1GM7A 3I55V 4MTGA 4GCZA 2WLNA 1JJ2U 2WWWA 5LBQA 2HFEC 5KA6A 1H8HG 2HVJC 2EILB 2F43G 1VQNV 4QE9A 3ZCCA 2JDIG 1PNKA 1AI4A 1R3KC 1VQOV 1G4YB 1OCRC 1VQ5V 4J9ZB 3RVYA 3ABKC 4UV8A 3AG3B 3SYOA 1S3JA 3QO8A 4JASA 4JTDB 3TETA 3E89A 1BL8A 1UJWB 3JD1A 3LDEA 1YTFD 2BOCC 4U7NA 4XDLA 4MVRA 2X6BA 3F5WC 1Q86W 1V54C 4BIZA 3EHBB 1M9NA 1R3JC 4WFHA 4G2KA 1MSWD 2EIMC 2QTOA 1MABG 2H8PC 1W2BU 4PA6A 4PDLA 1Q81W 3MHHC 1R3IC 2LP7A 2DYSC 1V55C 5KUKA 2PI4A 4X89A 3D36A 4Q20A 1GTOA 1FXVA 4MTOA 3ABMB 4PDVA 4UUJC 1RM1C 1VQPV 3W7UA 3W7WA 3FB8C 5B1AC 3NXSA 1NR7A 3SYPA 3UKMA 5LHIA 1JX9A 3AG2C 2DQ3A 1H38A 2BOBC 1ORQC 3AEIA 2ZR2A 3LNMB 5EC2C 5B1BB 3WG7B 3IC7A 5H6RA 2JJ2G 3OAAG 5HFMA 3VBBA 3SPCA 4J9YB 1Y66A 4JPRA 1B6QA 2P90A 3E35A 3FB6C 4HAMA 5B1NA 3OGCC 4RAIA 5BZBA 1OCZC 3CCMV 2HG5C 4QPJA 3CCEV 3ETDA 2Y69C 3OFNG 4JGSA 3OEEG 1FFTB 3M99B 3SPJA 5LGTA 5EBMC 4MVUA 1SRYA 1DTOA 5HFLA 4RUEA 4QNHB 1FXKC 3OUFA 1AROP 5DM6V 3B8NA 3JD3A 2ITDC 1DF4A 3AG4C 4RQFA 1K73W 2JJ1G 3ZMSA 3ZMTA 1R73A 1F4MA 4JYCA 2Q67A 3VOUA 1P4RA 1RPOA 1FXHA 1M56C 1P7BA 3WFVA 1MG1A 1K9MW 3T4DA 1THZA 1NQTA 2UXNA 4P30A 4PDRA 1KQSU 2B1GA 2EINB 2QM7A 3ASOC 3T1CA 3T4ZA 4GX0A 3KG2A 1S5HC 2GHYA 2Q6AA 3W7TA 3E8BA 1TUEB 1NVPB 3SJQC 5C93A 3CCSV 3OUSA 2C2AA 3K9AA 4F4LA 2ZXWB 3RVZA 1BHBA 2LFRA 5B3SC 4WCEV 4JF3A 1VQLV 5LGNA 3HPLC 1I5YA 1SESA 2AHZA 2JIZG 4U7OA 3B8MA 2A0LA 3MHSC 4P2ZA 4H33A 4TSFG 3ABLB 1KP3A 4QIWF 3STLC 4UVBA 1QVFU 2EZPA 1GKFA 4GX5A 1F23A 1YI2V 3X2QB 2XAJA 1FS0G 2R9RB 1K4DC 4MTFA 5LHGA 1S72V 5EBLC 1KC8W 1QLEC 3E8FA 2EIKC 3QO5A 1H2GA 4XDJA 2XAQA 3CCVV 2DYRB 2EBOA 1BMFG 4HZ3A 4TWKA 1M57C 1WLEA 5CA3A 3T2MA 1AI5A 1JVMA 2QKSA 4JTAB 3CCLV 2WSSG 1VQ4V 1VQ9V 4UVAA 1N8RW 3CMEV 3CCUV 3RBZA 3I56V 1Q82W 4BAYA 5CMUA 3K06A 4DO2A 1CEZA 1QVGU 4JYBA 4LBEC 1K5QA 2K1EA 3OMAB 5L3DA 3G4SV 1VQKV 1BHAA 5L3CA 4WFGA 1K33A 3BY6A 1E79G 2OCCB 1QR9A 3B77A 3DGEA 3H01A 4FK5C 3CCRV 4N21A 3JYCA 1NH2D 3ETGA 1K34A 1AJQA 5IY5B 4PELA 4MVSA 2XOKG 2EIJB 2EILC 1K92A 3DTUB 1YJWV 1HWYA 1QCEA 1J95A 4R50A 4BIUA 2EJRA 4WFEA 3AG3C 3D3IA 2MK3A 1OHHG 2WLHA 1RPRA 3K3WA 2OTJV 3OM3B 4JAUA 1IXMA 1YJ9V 1OCOB 3E83A 4JAVA 5IYBO 2A9HA 1SETA 4GT1A 4OXSA 4UV9A 1Y4MA 4X8AA 3MD0A 1OCCB 2ZDIA 3SPIA 3JD2A 1K3EA 3OMNB 4GX2A 5E1AC 5EK0A 3SYAA 1JCHA 3ASNB 3ZRWA 1S77D 3CC4V 4FPPA 1PL0A 3E8HA 3F7VC 2IU3A 4CZZA 4XDKA 1F51A 4QPKA 5CBFA 3ABMC 5CBGA 2IH1C 3JCZA 3CXCU 1G8MA 2IJHA 1YIJV 1K4CC 2Z5UA 1MOFA 1XL6A 3LDDA 2JEUA 2WLJA 1NR1A 4FIPC 3E2EA 4RO2A 1W0KG 4ZKIA 3QO7A 3ML0A 3AG1B 3ABUA 1NVPD 4KUMA 1GK9A 5B1BC 3WG7C 5KUMA 3HB3B 4UVCA 3A0RA 1WPXA 3G71V 3ZRWB 4BW5A 3LSSA 1M1KW 3OEHG 1AR1B 4LCUC 4KP4A 2Q69A 2HVKC 2DW4A 2XAFA 1M90W 2IJJA 1PKXA 2WAMA 5IYDO 2X6AA 3BEHA 2WPDG 1GMGA 1XL4A 1VQ6V 4YXWG 2B1IA 2H94A 2ATKC 3SPGA 2ITCC 2P7TC 1E1QG 1K8AW 3SYQA 3ZMUA 3ETEA 1SERA 1EFRG 2HR3A 1DLBA 1QR8A 1I5XA 1JQ0A 1OCRB 2JEXA 2R9IA 1DF5A 1PD3A 4R7CA 3ABKB 2HJFC 1PNMA 3ZRXA 3LUTB 2WLIA 3G6EV 2IJIA 3QNEA 3ABTA 1EBOA 1VQ8V 3OW2U 4WFFA 1L1FA 3PJSK 5IDJA 2GSMB 2ZR3A 4MVQA 1YITV 5EC1C 1R6KA 1NKDA 3CP1A 1V54B 2OTLV 4QJFB 5H6QA 1AJNA 3UM7A 3E8GA 2V7QG 4N23A 2EIMB 2XAHA 2EINC 2LFSA 3F7YC 3SPHA 4ASUG 2JK5C 2DYSB 1V55B 2ZXWC 3K0DA 4P9OA 1KD1W 2UXXA 4EKWA 5L3EA 3CCQV 1VQ7V 1NBMG 4JTCB 2XNDG 4MVOA 2WLIB 2OT5A 3CC2V 1ZWIC 3K04A 3CMAV 1QBZA 4CBCA 1VQMV 3ZIAG 1RM1B 2CK3G 2QA4V 2IW5A 3ABLC 4G27B 3CCJV 1AI7A 5B1AB 3W7XA 2QM8A 2X6CA 3AG2B 4KFMA 2WLKA 5CN0A 3X2QC 2YEVA 5DN6G 2QEXV 4PDMA 4Z1MG 3FKSG 1FXKA 2DYRC 1AI6A 1Q7YW 1R3LC 2QE7G 4L87A 3TK1A 4LP8A 3K03A 1NJIW 3P32A 1GM8A 2W6IG 2AHYA 2KB1A 4G28B 1OCZB 1CP9A 3CC7V 3P30A 2X0LA 4PA9A 4MW3A 4MVZA 2P67A 2Y69B 4I9WA 3SYCA 3LSQA 1YTFB 5LHHA 1COWG 1SZTA 1KKDA 3GWOA 2NLJC 2YEVB 2IJKA 4TT3G 2XASA 1FXKB 5FL7G 3FYEB 3IGAC 3FB5C 2W6JG 2YSUB 2OCCC 2DWEC 4MW8A 3AG4B 3R65A 1K5SA 3ZRVA 1PNLA 2Z3YA 1NH2B 1CPYA 1KP2A 5IY5C 5KA5A 1LNQA 3ZRSA 2WLLA 5B1OA 2HKOA 4MT8A 2EIJC 5CBHA 3ZN1A 1QLNA 1M56B 4WFBV 3K08A 1JPXA 3EFFK 4MS2A 1S0VA 2PI5A 1ROPA 3OE7G 2FTKA 4I5SA 4RUFA 3ASOB 2EZOA 4P9PA 3ZJZA 5H9CA 1OCOC 4MVMA 3JD0A 4X88A 1YHQV 5B3SB 2Q68A 1R6NA 4FJCC 1H8EG 1JOYA 2A79B 1GO3F 1EZJA 4WFAV 2M7WA 5LGUA 5IYCO 2HLDG 1OCCC 2WLLB 2ZD9A 3TCUA 4E2LA 1KECA 4PA3A 1S76D 1K97A 5L3FA 3ASNC 3ZMZA 3LDCA 5L3BA 3JD4A 3W7SA 1W0JG 4QE7A 3FYIB 2D3OW 2XAGA 4XBFA 1QLEB 1GM9A 2EIKB 2V1DA 5EBWC 3RW0A 3CYOA 2DQ0A 4HYOA 4DXWA 4RQEA 3OR6C 3ZMVA 1OZ0A 1M57B 3K0GA 2ZQMA 4ZBMA 1YJNV 4MSWC 4PA7A 3K79A 2B5UA 2Y48A 3E86A 3FB7C 4MTXA 2DWDC 2ZDIC 2IH3C 3AG1C 4R6ZA 3STZC 3CPWU 2W0FC 2X7RB 4UXNA 5J9PC 2IU0A 3GB7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA4 A;  3E83 A;  2ITD C;  3AG4 C;  4GX1 A;  2X6C A;  2A9H A;  2WLM A;  4OXS A;  4KFM A;  2WLK A;  3X2Q C;  2YEV A;  3IFX A;  4X8A A;  2Q67 A;  3VOU A;  4PDM A;  3SPI A;  4R8C A;  4H37 A;  2DYR C;  4GX2 A;  1P7B A;  1M56 C;  5E1A C;  3OR7 C;  5EK0 A;  3SYA A;  1R3L C;  4LP8 A;  3T4D A;  3K03 A;  4MTG A;  3E8H A;  4P30 A;  2WLN A;  3F7V C;  2AHY A;  2KB1 A;  4G28 B;  2HFE C;  4PDR A;  4XDK A;  5CBF A;  2HVJ C;  3T1C A;  3ASO C;  3ABM C;  3T4Z A;  4GX0 A;  3KG2 A;  1S5H C;  2IH1 C;  4MW3 A;  4PA9 A;  2Q6A A;  5CBG A;  3E8B A;  5IY5 C;  4QE9 A;  4MVZ A;  3SJQ C;  3OUS A;  4I9W A;  1R3K C;  3SYC A;  4F4L A;  1G4Y B;  1OCR C;  3RVZ A;  5B3S C;  4J9Z B;  3RVY A;  1K4C C;  1KKD A;  3ABK C;  1XL6 A;  2NLJ C;  3LDD A;  3HPL C;  3SYO A;  4JTD B;  2AHZ A;  3TET A;  2WLJ A;  2A0L A;  3E89 A;  4RO2 A;  4P2Z A;  1BL8 A;  4H33 A;  3LDE A;  5B1B C;  3WG7 C;  5KUM A;  2BOC C;  4XDL A;  3IGA C;  3FB5 C;  4MVR A;  4MW8 A;  2OCC C;  2DWE C;  2X6B A;  3F5W C;  3STL C;  3R65 A;  4BW5 A;  4GX5 A;  1V54 C;  1R3J C;  4LCU C;  4WFH A;  2R9R B;  4MTF A;  1K4D C;  2Q69 A;  2HVK C;  5EBL C;  1QLE C;  3E8F A;  4QNH B;  2QTO A;  2EIM C;  1LNQ A;  2EIK C;  2WLL A;  4XDJ A;  3ZRS A;  5CBH A;  2EIJ C;  2H8P C;  2X6A A;  3BEH A;  4PA6 A;  4PDL A;  1XL4 A;  4HZ3 A;  1R3I C;  4TWK A;  2DYS C;  1V55 C;  2ATK C;  3K08 A;  3SPG A;  3EFF K;  2ITC C;  2P7T C;  4X89 A;  1M57 C;  3SYQ A;  3T2M A;  1JVM A;  2QKS A;  4MS2 A;  4JTA B;  4RUF A;  4MTO A;  4PDV A;  4UUJ C;  4P9P A;  3ZJZ A;  1OCO C;  3FB8 C;  4MVM A;  3RBZ A;  5B1A C;  4X88 A;  3K06 A;  3SYP A;  2Q68 A;  4R7C A;  3UKM A;  2HJF C;  3AG2 C;  3LUT B;  2WLI A;  4LBE C;  2A79 B;  5KUK A;  2K1E A;  2BOB C;  4WFF A;  1ORQ C;  1OCC C;  3PJS K;  2WLL B;  3LNM B;  4MVQ A;  5EC2 C;  2ZD9 A;  3TCU A;  4WFG A;  5EC1 C;  4PA3 A;  3ASN C;  3LDC A;  3SPC A;  3JYC A;  4J9Y B;  4QE7 A;  3UM7 A;  3FB6 C;  3E8G A;  5BZB A;  3OGC C;  4RAI A;  1OCZ C;  2EIN C;  4MVS A;  5EBW C;  3RW0 A;  2EIL C;  2HG5 C;  3F7Y C;  3SPH A;  2Y69 C;  2JK5 C;  4HYO A;  2ZXW C;  3K0D A;  4P9O A;  4DXW A;  3OR6 C;  4EKW A;  3K0G A;  4R50 A;  1J95 A;  4WFE A;  4JTC B;  3SPJ A;  3AG3 C;  4ZBM A;  4MVO A;  2WLI B;  4MSW C;  4PA7 A;  1ZWI C;  5EBM C;  2WLH A;  4MVU A;  3K04 A;  3E86 A;  4R6Z A;  3FB7 C;  2DWD C;  3AG1 C;  2IH3 C;  4CBC A;  3STZ C;  2W0F C;  5J9P C;  4RUE A;  3OUF A;  3ABL C;  4G27 B;  3GB7 C; 
#chains in the Genus database with same CATH topology
 4FFB A;  4GX1 A;  1LUW A;  2P6J A;  1YSC A;  4O2A B;  2FKX A;  1F4N A;  3AK2 A;  1K7D A;  3CD6 V;  4FMT A;  1ENV A;  2CTW A;  1VEW A;  2RN9 A;  4TV8 B;  3I55 V;  4DR6 O;  1Y76 B;  3K5O A;  4KHP O;  5LBQ A;  2HFE C;  2N04 A;  2EIL B;  4FLU A;  1FJG O;  1PNK A;  1R3K C;  1G4Y B;  3RVY A;  2P22 C;  2ILM A;  4X65 O;  2PYJ A;  4CH4 A;  5CB4 B;  3E89 A;  3S3W A;  3K59 A;  1UJW B;  1AIL A;  2BOC C;  4U7N A;  4XDL A;  4K35 A;  4JI0 B;  2ZE5 A;  3L9D A;  4LH6 A;  4WBN A;  1X59 A;  1FD9 A;  4PDL A;  2BTQ B;  1R3I C;  4ICG A;  2VQE B;  2UUA O;  4X89 A;  2EUL A;  1FXV A;  2PGG A;  1N34 B;  3OTF A;  5IT9 N;  2R72 A;  3FB8 C;  4DV4 O;  3NXS A;  5LHI A;  1KUQ A;  4X62 O;  1NZ6 A;  2BOB C;  2YIB D;  1ORQ C;  2ZR2 A;  4OPH A;  2ZM6 O;  5H6R A;  1IBK O;  2E76 B;  3MAQ A;  3VBB A;  1XHZ A;  1JFF B;  5BZB A;  4KHP B;  2F1M A;  3HKD A;  5D5Q A;  4DV1 B;  1XBL A;  1VIB A;  1BSM A;  4QPJ A;  3CCE V;  1R1B A;  5C8Y B;  3OEE G;  3JAS A;  4JYY A;  4EFE A;  4JV5 B;  1DTO A;  4QNH B;  1FXK C;  1ARO P;  3B8N A;  3JD3 A;  2G38 A;  3QG5 A;  2ITD C;  4B3S B;  2OCH A;  2JJ1 G;  2QJ1 A;  4TV9 B;  2LW7 A;  2KG7 A;  4FLW A;  4LF8 O;  1M56 C;  1P7B A;  4LF4 B;  1K9M W;  1SA0 B;  1X4T A;  4I9Q A;  1THZ A;  3CE2 A;  2D2C B;  5IWA B;  2YXY A;  3BPZ A;  1KQS U;  2CDY A;  2XHB A;  2EIN B;  2LW1 A;  4FM1 A;  3KG2 A;  1S5H C;  2Q6A A;  3RYC A;  2AW9 A;  4F4L A;  2LFR A;  1VQL V;  1SES A;  2AHZ A;  2JIZ G;  4B7E A;  2ZM6 B;  2EZP A;  4GX5 A;  1YI2 V;  5EYP A;  1FS0 G;  5JJE B;  5EBL C;  3ZHQ A;  2EBO A;  2QWQ B;  4NTX A;  4AHC A;  3L74 H;  4JI6 B;  5CA3 A;  1AI5 A;  1VF6 C;  2JGD B;  5JWP A;  1KU9 A;  2WA4 A;  3JAT B;  5KMG A;  3RBZ A;  3IC9 A;  2ZE7 A;  4BAY A;  4DO2 A;  1M93 A;  2EJ7 A;  4O4L B;  2QKA A;  5H2F Z;  4LBE C;  4B08 A;  1BHA A;  5JCO A;  3B77 A;  1PV0 A;  1NH2 D;  1VF7 A;  1NS1 A;  2XOK G;  5EZY B;  2R9A A;  4H0L B;  2N74 A;  1HWY A;  1TVK A;  1I7F A;  1J95 A;  3K5N A;  2PUS A;  2WLH A;  4JAU A;  4JI3 O;  4LFC O;  5BY1 A;  4CC5 A;  1DGS A;  3J80 N;  4IL6 Z;  2N05 A;  4AQY B;  3MD0 A;  1OCC B;  5CA0 B;  1HR0 O;  1L0L H;  2Y4T A;  1XEQ A;  1SKV A;  3E8H A;  3M8A A;  1O9G A;  3F7V C;  4O4I A;  3UCS C;  3U11 A;  2JGU A;  3ABM C;  3VQX A;  1YIJ V;  2Q7E A;  1MOF A;  3CRR A;  2WLJ A;  1NR1 A;  3E2E A;  3KCX A;  4ZKI A;  3QO7 A;  3AG1 B;  2ZE6 A;  2OIE A;  1D2D A;  3HB3 B;  3A0R A;  1IBM O;  1XRE A;  1WPX A;  4ZHQ B;  3ZRW B;  1AR1 B;  4X1K B;  3RT3 C;  5K1P A;  4KP4 A;  4PHZ A;  3M7M X;  5IYD O;  1XMO O;  3BEH A;  1JA8 A;  1XNR B;  1VQ6 V;  4BR6 A;  2ATK C;  2JVD A;  3RWR D;  3SYQ A;  4JZG A;  2UUB O;  3CRC A;  1DLB A;  1TAE A;  4YJ3 B;  5LMN B;  4TV8 A;  3NR7 A;  4DV3 O;  3DXR B;  1JQ0 A;  4RWU A;  4I0X B;  2HJF C;  1AP5 A;  4GKK O;  3ABT A;  1EBO A;  4LNU B;  1FKA O;  4UCR A;  3E8G A;  2Y0I A;  1P84 F;  2V7Q G;  4IIJ B;  4N23 A;  3CJH A;  3OGI B;  4GKJ O;  3G80 A;  1VQ7 V;  1NBM G;  4MVO A;  1B06 A;  3K04 A;  5LP6 A;  1AB3 A;  4YJ2 B;  5A9G A;  1RM1 B;  2CK3 G;  3CCJ V;  1IBM B;  4PV1 B;  3W7X A;  1GN3 A;  2X6C A;  4DV5 B;  3AG2 B;  2WLK A;  2YEV A;  2LJ2 A;  5DN6 G;  3SJB C;  5J2U B;  1TUB A;  4E4E A;  1AI6 A;  5GON A;  1R3L C;  3TK1 A;  1Y74 A;  3K03 A;  2QWN B;  3P32 A;  2UUB B;  2KSD A;  2AHY A;  2KB1 A;  1OCZ B;  4FVM A;  4F6E A;  2X0L A;  3FD9 A;  4MW3 A;  4I9W A;  5LHH A;  1KKD A;  2Q4P A;  3GWO A;  4JI8 B;  1EN6 A;  1HDJ A;  4U3F H;  2E5L O;  3K5M A;  2XAS A;  3T1Y B;  2W6J G;  2YSU B;  4MW8 A;  3AG4 B;  2NN4 A;  2DMX A;  1QQC A;  1PNL A;  2Z3Y A;  3B09 A;  4X66 B;  1CPY A;  1D5N A;  4LF9 O;  4JI1 O;  2EIJ C;  3ZN1 A;  1QLN A;  4NXN B;  3SGI A;  1ZL8 A;  5TIS Z;  2CGN A;  4MS2 A;  4IGG A;  1IXB A;  2VQF B;  2PI5 A;  2QKC A;  3ASO B;  4P9P A;  3BRC A;  5FNV A;  5JCO C;  5H9C A;  2FL4 A;  5IJ9 A;  1YHQ V;  3QF7 A;  5B3S B;  2Q68 A;  2RMK B;  3FAV B;  4WFA V;  2M7W A;  4LFA B;  1IUR A;  1GN2 A;  3N2K A;  4PA3 A;  1S76 D;  5L3F A;  1QNM A;  3ASN C;  3B40 A;  4YY3 B;  3FYI B;  4XBF A;  4F6R B;  3KZI Z;  5EBW C;  2CH7 B;  3RW0 A;  4TUY B;  2GTS A;  1P7G A;  4DXW A;  2Q5Z A;  2UUC O;  5IYZ B;  1YJN V;  2OWO A;  2B9Z A;  4R6Z A;  2YXH A;  2YC0 A;  3A2F A;  2E5L B;  5KAI Z;  4UXN A;  2PZS A;  4EB6 B;  1CXZ B;  1XOU A;  2WLM A;  1WA8 A;  3ZED A;  1RSO A;  3HKE A;  5GTH Z;  5GW7 A;  4H37 A;  4GLX A;  4LC1 A;  4JI5 B;  3JAL B;  4CS4 A;  2WWW A;  4FM2 A;  5KA6 A;  1GAX A;  5JJN B;  1R6T A;  5KHI A;  4QE9 A;  1VQO V;  4LF6 B;  3ZS8 C;  4UV8 A;  4PI2 A;  3QO8 A;  4JTD B;  3JD1 A;  3LDE A;  3APO A;  1YTF D;  1WB7 A;  4X1I B;  3F5W C;  4X20 A;  2PY5 A;  1Q86 W;  3K5L A;  4G2K A;  5K1X A;  4B3T B;  2GTA A;  2M6Y A;  3CHX A;  4PA6 A;  4K8Z A;  2PI4 A;  5KUK A;  2DYS C;  1XQ8 A;  3D36 A;  1GTO A;  4X64 B;  1O9H A;  4UUJ C;  3VQW A;  3O65 A;  2DOS A;  3DSQ A;  3W7U A;  1VQP V;  1ZAU A;  4Q6G A;  4L8J A;  1NR7 A;  3UKM A;  1MSD A;  1JX9 A;  1H38 A;  1IVS A;  3AEI A;  1WAZ A;  1B04 A;  3APQ A;  5B1B B;  4B3M B;  3IC7 A;  2JJ2 G;  3OAA G;  3RYF A;  5HFM A;  4J9Y B;  2PYL A;  2QTS A;  4HAM A;  1HNW B;  1W59 A;  2LGW A;  4FLX A;  3JAR A;  5LP6 C;  3CCM V;  1GN6 A;  1NI8 A;  3ETD A;  4B7K A;  3AG7 A;  4J11 A;  1Q6H A;  1D5A A;  3L71 H;  4MVU A;  1SRY A;  3RFR A;  4DRX B;  5DEC A;  1IDS A;  3LNN A;  4JI0 O;  1K73 W;  4DR3 B;  3ZMS A;  4I50 B;  4IT5 A;  2GDS A;  4JYC A;  3SDL A;  2F66 C;  2Q67 A;  1EN4 A;  3Q4H A;  1Q6I A;  4UCO A;  4UCU A;  1RPO A;  4FLZ A;  1MG1 A;  2XTA A;  2VQE O;  2UXN A;  4DK0 A;  4DV2 B;  4HNA B;  3T4Z A;  1SQF A;  2LQT A;  3E8B A;  1TUE B;  1N34 O;  1NVP B;  3CCS V;  5C93 A;  4X1Y B;  3K9A A;  1BHB A;  3E22 A;  3L70 H;  5LGN A;  3A0H Z;  2A0L A;  5EIB C;  4TSF G;  1KP3 A;  1TA8 A;  4BW9 A;  4LWS A;  4UVB A;  4J80 A;  4I4T B;  1F23 A;  3X2Q B;  1WP8 A;  2YID A;  2R9R B;  4MTF A;  1S72 V;  1J5E O;  3E8F A;  2EIK C;  4XDJ A;  4I7Z B;  3CCV V;  1I08 A;  4DV1 O;  2DYR B;  3RYI B;  4H13 B;  4TWK A;  4ZOL A;  3T2M A;  2QKS A;  5IJ0 B;  4AIL C;  3IAY A;  3UT5 A;  4GZR B;  3F5T A;  3N2G B;  4JV5 O;  3I56 V;  1S5L Z;  2Y0P A;  2ZKO A;  4B3S O;  4JYB A;  4IHJ B;  3H9V A;  3OMA B;  1XHX A;  4WFG A;  1K33 A;  3BY6 A;  2OCC B;  4LF4 O;  2R70 A;  3H1H H;  5LYJ B;  3CCR V;  3EXA A;  3JYC A;  2NR5 A;  1BE3 H;  3ZBH A;  1K34 A;  4PJ0 Z;  5IWA O;  5IY5 B;  4PEL A;  4CS3 A;  1K92 A;  2UXD B;  3DTU B;  2Q9L A;  4DK1 A;  4LF5 O;  3DC6 A;  5LOV B;  5KHH A;  4EFB A;  4WFE A;  3AG3 C;  1OHH G;  5LXT B;  3K3W A;  3OM3 B;  5JH7 B;  1YJ9 V;  3C3T A;  1XMQ B;  4DUZ B;  4UV9 A;  1JJO A;  1SET A;  4GT1 A;  2AZ2 A;  5KHK A;  5J2T A;  1Y4M A;  1J5E B;  5EIB D;  2ZDI A;  3SPI A;  2UXC O;  4FLY A;  1JCH A;  5B66 Z;  4YIO A;  3WB1 A;  1SF9 A;  3ZHT A;  4UB8 Z;  1S77 D;  4FLV A;  4JI6 O;  1G1X B;  2IU3 A;  3BHP A;  1MZE A;  1ZTE A;  3ETQ A;  3CXC U;  2JRI A;  1G8M A;  1SC5 B;  3A8T A;  1UFI A;  3H1J H;  2VS0 A;  2Z5U A;  1XL6 A;  3CX5 F;  4FIP C;  3ABU A;  3OT7 A;  3WG7 C;  2KKW A;  3JAK A;  4LFB B;  3LSS A;  2QGN A;  4UB6 Z;  3D36 C;  1M4U A;  4LCU C;  2XAF A;  4ZI7 A;  3HKB A;  4BWA A;  2X6A A;  1GMG A;  2B1I A;  4LF5 B;  4DR2 B;  2GV9 A;  2P7T C;  1E1Q G;  1K8A W;  3ZMU A;  3ETE A;  2HR3 A;  2BSK A;  3G6B A;  1I0H A;  1I5X A;  4PI0 A;  2F23 A;  1SQV H;  4H44 B;  1DF5 A;  1PD3 A;  3ZRX A;  1PNM A;  3G6E V;  4WFF A;  4AQY O;  2GSM B;  2ZR3 A;  4MVQ A;  1N32 B;  3K58 A;  2UXC B;  5EC1 C;  5JQG A;  3TJT A;  2PTM A;  1GN4 A;  3UM7 A;  2XAH A;  1IBL O;  2LFS A;  3H1K H;  4D6T H;  2XT9 A;  3SPH A;  4ASU G;  4D7S A;  2ZXW C;  4P9O A;  5KX5 B;  2WLI B;  1ZWI C;  1EZV H;  3LSU A;  4O4H A;  4LR3 A;  3ABL C;  2QM4 A;  3SJA C;  4KFM A;  5CN0 A;  2CTQ A;  4DYL A;  2GUZ B;  4B3R B;  2QEX V;  4PDM A;  5CA1 B;  4Z1M G;  4TQF A;  1YEW A;  3ZHV A;  3KCY A;  1XNR O;  4L87 A;  4LP8 A;  4QGP A;  3OTO B;  1SQP H;  4PA9 A;  4W4L A;  1XNQ B;  1YZB A;  3U10 A;  5LMN O;  3HR0 A;  4UCV A;  1H2N A;  5BXZ A;  4TT3 G;  4BIO A;  1N36 B;  1FXK B;  5FL7 G;  3FYE B;  3R65 A;  3K57 A;  2HP8 A;  5LA6 B;  1K5S A;  1NH2 B;  5KA5 A;  1BCC H;  2WLL A;  4AI8 A;  4DR4 B;  1IBL B;  1M56 B;  1T5E A;  5ITZ B;  1N4C A;  4A5U B;  3K08 A;  4J42 A;  4O2B B;  5BMV A;  1S0V A;  2JS3 A;  1HNX B;  3K9S A;  1KBH A;  4CH6 A;  2FTK A;  3AK1 A;  4DUY B;  2RQ6 A;  2P4K A;  3KKY A;  3CSX A;  1OCO C;  1MMM A;  2Z0A A;  4DV5 O;  3N27 A;  3HKC A;  1EZJ A;  5JVD B;  5IYC O;  2ZIN A;  3TGU H;  3RYH A;  3T1H O;  3ZMZ A;  4U3J B;  3JD4 A;  2XAG A;  4O2A A;  1GM9 A;  1U96 A;  1SQG A;  3OR6 C;  3ZMV A;  1OZ0 A;  1ZX3 A;  1Y76 A;  3CS5 A;  1HP8 A;  2Q0A A;  4JI8 O;  3K79 A;  2B5U A;  2Y48 A;  3E86 A;  4DV0 B;  2ZDI C;  3RYI A;  3STZ C;  2W0F C;  3T1Y O;  2IM9 A;  3BA9 A;  2Q0O C;  4CS2 A;  1Q6U A;  5CB4 A;  4WF9 V;  2RJZ A;  1E1R G;  2A06 H;  3N2G A;  4X66 O;  4TQD A;  1AJP A;  4R8C A;  3OR7 C;  2NNU A;  3PN1 A;  4NXN O;  1YXB A;  3FFQ A;  4LF7 B;  4MTG A;  4GCZ A;  2WLN A;  3JAW B;  1VMG A;  2QWO B;  2VQF O;  1H8H G;  4X9Q A;  2F43 G;  1VQN V;  3ZCC A;  1YDX A;  2BTQ A;  2JDI G;  4FFB B;  1VQ5 V;  1OCR C;  1Y6X A;  4J9Z B;  3ABK C;  1M5I A;  1S3J A;  4JAS A;  2E3C A;  2PF4 E;  1BL8 A;  4LFA O;  4JI7 B;  3T1H B;  3L75 H;  2X6B A;  4DV6 B;  1GRJ A;  1V54 C;  2QDO A;  4BIZ A;  3EHB B;  1M9N A;  4WFH A;  5KLV H;  4YY3 O;  1MSW D;  4K3A A;  2EIM C;  1PL4 A;  2ZNI A;  1PP9 H;  1WJZ A;  3CEI A;  1V55 C;  3WB2 A;  1JFF A;  4FFK A;  3P3P A;  3A0B Z;  3ABM B;  3W7W A;  1NT2 B;  5BR8 B;  3UO3 A;  1FFX B;  2CTP A;  5B1A C;  5C8Y A;  3SYP A;  3B4S A;  2BTO A;  4WBN B;  4K0K B;  4K8X A;  1BT8 A;  5EC2 C;  4JI5 O;  4TV9 A;  1B6Q A;  3E35 A;  3FB6 C;  5B1N A;  4RAI A;  1BQZ A;  3S3X A;  2HG5 C;  2Y69 C;  3OFN G;  4JGS A;  1SA0 A;  1FFT B;  4LF6 O;  3OD4 A;  1MA1 A;  1SQB H;  3SPJ A;  5EBM C;  2A3Q A;  2Q7H A;  1BS3 A;  1DF4 A;  3ZMT A;  1R73 A;  1F4M A;  3ZX6 A;  3HKD B;  4OPA A;  4B3T O;  2E75 B;  4JZ2 A;  1P4R A;  2RDC A;  4HBN A;  3JAS B;  4P30 A;  2YIA A;  4PDR A;  4X64 O;  2QM7 A;  3T1C A;  4GX0 A;  1I94 B;  5B5E Z;  1AR4 A;  2C2A A;  3RVZ A;  4JF3 A;  2JGD A;  1I5Y A;  1PPJ H;  3B8M A;  3C3S A;  4W4K A;  1EM1 A;  2KG7 B;  3JAT A;  4B3M O;  4GUN A;  3IJ4 A;  4QIW F;  4O4L A;  1GKF A;  2ZNJ A;  2XAJ A;  1K4D C;  4DR1 B;  1HNW O;  1KC8 W;  1QLE C;  3QO5 A;  1H2G A;  4DV7 B;  3RYC B;  2ZT9 B;  2QSA A;  1M57 C;  1WLE A;  5E79 Z;  1JVM A;  4JTA B;  3CCL V;  5EZY A;  2VRZ A;  1VQ4 V;  3CME V;  4O4J B;  1Q82 W;  2H3O A;  5CMU A;  3SR2 C;  1JMK C;  3QTC A;  4DR3 O;  5EYP B;  1K5Q A;  2DE0 X;  1S5J A;  5L3D A;  3G4S V;  1VQK V;  1KYO F;  3C90 A;  5L3C A;  1URF A;  2WA3 A;  3WU2 Z;  4DW0 A;  3DGE A;  3UO2 A;  3H01 A;  4FK5 C;  3ETG A;  4YHH B;  2HHH B;  1NTM H;  1AJQ A;  4DV2 O;  1BZK A;  4MVS A;  2EIJ B;  5KMG B;  2EIL C;  5CA0 A;  5LMU B;  1QCE A;  3FX7 A;  4R50 A;  1MNG A;  2EJR A;  3CB2 A;  1RPR A;  3G67 A;  2OTJ V;  3JCU Z;  1IXM A;  3CWB H;  4NXM B;  5IYB O;  4ZIB A;  1HW7 A;  4X8A A;  1WPB A;  2ARH A;  3JD2 A;  1K3E A;  3OMN B;  4GX2 A;  1NTZ H;  3ASN B;  1F7Y A;  2Q7G A;  4ZHQ A;  4JI2 B;  3ZRW A;  4FPP A;  1PL0 A;  4X1K A;  5CBF A;  1F51 A;  4QPK A;  3JCZ A;  2IJH A;  1HNZ B;  1K4C C;  3LDD A;  4OX9 B;  1EN5 A;  2JEU A;  1NTK H;  1W0K G;  1N0N A;  3EVK A;  2FML A;  1NVP D;  4YJ3 A;  1GK9 A;  1Q43 A;  5KUM A;  3VQY A;  3DXR A;  3JAM N;  4I0X A;  3OEH G;  1TGO A;  2RCV A;  4O4I B;  2Q69 A;  4LNU A;  2DW4 A;  1M90 W;  2IJJ A;  2WAM A;  2WPD G;  2UXD O;  4YXW G;  1H2M A;  2H94 A;  2ITC C;  5KHJ A;  2P06 A;  1SER A;  1EFR G;  2UXB O;  1QR8 A;  2ZIM A;  4IIJ A;  4ABM A;  4JYA B;  3RN4 A;  2AZ0 A;  1XMQ O;  2R9I A;  4DUZ O;  4R7C A;  3WB0 A;  2LO1 A;  2IJI A;  3QNE A;  4NYK A;  1L1F A;  3PJS K;  4YJ2 A;  1R6K A;  1NKD A;  3CP1 A;  1Z5W A;  2OTL V;  3J7A U;  1AJN A;  5D5P A;  2EIN C;  5J2U A;  2CTR A;  3F7Y C;  2DYS B;  5L3E A;  4JTC B;  2XND G;  3CRQ A;  1VQM V;  3ZIA G;  2QA4 V;  2IW5 A;  4DR5 B;  4G27 B;  2ETN A;  1KKC A;  2XUM A;  2QM8 A;  3QVN A;  4LFB O;  4NB5 A;  3R66 A;  2UU9 B;  3CJH B;  1FFX A;  1Q7Y W;  1XI1 A;  4CH5 A;  4DR2 O;  2W6I G;  4G28 B;  2UXB B;  1CP9 A;  4J10 A;  2P4V A;  5LP6 B;  3MDS A;  2P67 A;  3SYC A;  1Q5O A;  5F2V O;  1RP3 B;  4NTW A;  1A32 A;  2NLJ C;  4JAA A;  2E74 B;  2YEV B;  2RNB A;  2IJK A;  1DK1 A;  3TXQ A;  1TUB B;  1N32 O;  3FB5 C;  5GON B;  2DWE C;  1Y74 B;  2CE4 A;  3ZRV A;  3FAV A;  2L6L A;  1KP2 A;  4MT8 A;  5CBH A;  4WFB V;  1JPX A;  1BGY H;  4DR6 B;  5FPR A;  1N33 O;  1ROP A;  3OE7 G;  4F6R A;  2CH7 A;  1FJG B;  1NU1 H;  4TUY A;  3H1I H;  4MVM A;  4X88 A;  2FYU H;  4FZ0 A;  5H5N A;  3L73 H;  4X65 B;  4C7U A;  2DJV A;  1R6N A;  1JOY A;  1H8E G;  5IYZ A;  1GO3 F;  5LGU A;  4B3R O;  1FAF A;  1OCC C;  2ZD9 A;  3I5D A;  4E2L A;  1KEC A;  5IE9 A;  4GYC B;  4EB6 A;  3O9O A;  1ZL8 B;  4YIP A;  3W7S A;  2BE3 A;  4QE7 A;  3U0Z A;  2EIK B;  3OTO O;  4PD4 F;  1G6U A;  5FNV B;  2F95 B;  1XNQ O;  3CYO A;  1JR9 A;  2DQ0 A;  5IJ9 B;  2UUA B;  3JAL A;  3K0G A;  2ZQM A;  2DWD C;  3AG1 C;  2IH3 C;  2X7R B;  1VAR A;  3N2K B;  1N36 O;  1LR1 A;  2IU0 A;  1KMI Z;  5LL6 Y;  4DV4 B;  4PA4 A;  1SS3 A;  3ZN0 A;  4X62 B;  2P5O A;  2Q8V A;  1BQ0 A;  3IFX A;  3OMI B;  2F93 B;  1PM9 A;  4NVP A;  4DR4 O;  1IBK B;  4O4J A;  4X1I A;  5L3G A;  2KQX A;  1GM7 A;  1N33 B;  1JJ2 U;  1FYJ A;  1HNX O;  3D8C A;  2HVJ C;  3JSL A;  3H1L H;  4DUY O;  1AI4 A;  3ZHS A;  1SZX A;  3CXH F;  3THO A;  1WA8 B;  3AG3 B;  1RSO B;  3SYO A;  3TET A;  3HKE B;  2VWJ A;  4MVR A;  1R3J C;  2QTO A;  4LF8 B;  1MAB G;  1ZUQ A;  2H8P C;  1W2B U;  1Q81 W;  3RGB A;  3MHH C;  2LP7 A;  4Z1V A;  4Q20 A;  2AGA A;  1LUV A;  4MTO A;  4PDV A;  4DV0 O;  1RM1 C;  4NTY A;  1QU7 A;  3CRA A;  4X20 B;  4UFZ A;  3AG2 C;  1P49 A;  2DQ3 A;  1OJH A;  1Q8I A;  2AXT Z;  3LNM B;  4DRX A;  3WG7 B;  3SPC A;  3BAA A;  4LF7 O;  1Y66 A;  4I50 A;  4JPR A;  2P90 A;  3OGC C;  1OCZ C;  4KL1 A;  1Z5V A;  5AG2 A;  1U97 A;  3M99 B;  4IYI A;  4HNA A;  1Q3E A;  1XIL A;  5HFL A;  4RUE A;  2K9P A;  3OUF A;  4JI7 O;  4I55 B;  4X1Y A;  3RYF B;  5DM6 V;  3AG4 C;  4RQF A;  4DV6 O;  3VOU A;  3JAR B;  1FXH A;  3WFV A;  2MW2 B;  2GBO A;  3BVO A;  4I4T A;  3T4D A;  2Y4U A;  1NQT A;  4IYH A;  5GTI Z;  2B1G A;  3ASO C;  1IX9 A;  2GHY A;  3W7T A;  5JJJ B;  3SJQ C;  3OUS A;  5BR8 O;  2ZXW B;  3BAB A;  4WCE V;  5B3S C;  2CAZ C;  3HPL C;  5IJ0 A;  4U7O A;  3MHS C;  4P2Z A;  4K0K O;  3Q4H B;  4H33 A;  4Z2W A;  4JI3 B;  2QWP B;  3ABL B;  2W0X A;  1H2S B;  4LFC B;  3STL C;  1XUQ A;  5FLX N;  1QVF U;  1WNS A;  2YI9 A;  4IHJ A;  5LHG A;  1VP7 A;  2YDE A;  4FM0 A;  2XAQ A;  2F4V O;  1HR0 B;  1BMF G;  4HZ3 A;  3E22 B;  5LYJ A;  1US6 A;  1IZ3 A;  4J7Z A;  2WSS G;  3BFR A;  4UVA A;  1VQ9 V;  1N8R W;  3GWK C;  3CCU V;  1N0J A;  2EX3 A;  1AVM A;  5A2Q N;  4LWS B;  3K06 A;  5LOV A;  1CEZ A;  2HJD A;  1QVG U;  3B2E E;  1WN7 A;  2JS5 A;  2K1E A;  5LXT A;  4OGQ B;  4D7T A;  5JH7 A;  4FZ1 A;  4NKG B;  1E79 G;  1QR9 A;  3BCC H;  4ZOL B;  4N21 A;  4TOI A;  3AK3 A;  1V9P A;  3UT5 B;  1XMO B;  1I94 O;  1L0N H;  2BCC H;  3JSN A;  1YJW V;  1Y67 A;  3P3N A;  5DED A;  4BIU A;  1H2L A;  3D3I A;  2MK3 A;  3BA8 A;  3DC5 A;  2CGO A;  2YI8 A;  3VQV A;  3D3Q A;  4DV3 B;  1OCO B;  1KB9 F;  3ICX A;  3E83 A;  4JAV A;  2A9H A;  4OXS A;  4GKK B;  5KHG A;  2ZIO A;  4DR1 O;  2YIB A;  2F4V B;  4DV7 O;  2FB5 A;  5E1A C;  5EK0 A;  3SYA A;  3CC4 V;  2OIG A;  2YUA A;  4DR7 O;  3ZHR A;  3UQ8 A;  4CZZ A;  1GH6 A;  1YCI A;  4XDK A;  5CBG A;  2IH1 C;  4GKJ B;  4CC6 A;  3J81 N;  5J2T B;  5FPO A;  4RO2 A;  3ML0 A;  4KUM A;  5B1B C;  1WP7 A;  4UVC A;  3G71 V;  4BW5 A;  1M1K W;  3L72 H;  1H2K A;  4YHH O;  2HHH O;  2HVK C;  1PKX A;  2QR4 A;  5LMU O;  1XL4 A;  4CH3 A;  3SPG A;  4J7J A;  4J41 A;  4J7K A;  2OYQ A;  1FPO A;  1OCR B;  2JEX A;  3JAK B;  4NXM O;  2YIC A;  3ABK B;  5KX5 A;  1YVW A;  3LUT B;  2WLI A;  1VQ8 V;  4ZI7 B;  3OW2 U;  3HKB B;  1RFY A;  5IDJ A;  1YIT V;  4JI4 O;  4JI2 O;  1V54 B;  2ZCE A;  4QJF B;  5H6Q A;  4DR7 B;  1XDC A;  2GUZ A;  2DN9 A;  2BSK B;  2V4D A;  4LH7 A;  2ADP A;  2EIM B;  4LF9 B;  4JI1 B;  5CA1 A;  1Z2G A;  2JK5 C;  1V55 B;  2ODM A;  3K0D A;  1KD1 W;  1HNZ O;  2UXX A;  3CRM A;  4EKW A;  1MZF A;  3CCQ V;  4OX9 O;  3CC2 V;  2OT5 A;  3CMA V;  1QBZ A;  1QHT A;  4CBC A;  5JQG B;  1AI7 A;  5B1A B;  2LGQ A;  1B3Q A;  3X2Q C;  2HEP A;  2ZE8 A;  1YF2 A;  3FKS G;  1FXK A;  2A7W A;  2DYR C;  2IBZ H;  2QE7 G;  5LA6 A;  1NJI W;  1GM8 A;  3CC7 V;  3P30 A;  4O4H B;  3SJC C;  4JYA O;  4MVZ A;  5ITZ A;  2Y69 B;  3LSQ A;  1YTF B;  4UCT A;  1COW G;  1SZT A;  1ZLZ A;  2UUC B;  4O2B A;  1SQQ H;  1WB8 A;  4UCS A;  2ADQ B;  2VWK A;  4NR1 A;  4JI4 B;  3IGA C;  2OCC C;  2O57 A;  1Q90 D;  4EEQ A;  1TVK B;  1L8D A;  5JVD A;  1SQX H;  5IY5 C;  1LNQ A;  3ZRS A;  5B1O A;  2HKO A;  1AP6 A;  4I55 A;  2Q73 A;  2CUG A;  1UPG A;  3EFF K;  4U3J A;  4I5S A;  4RUF A;  3TXS A;  5KAF Z;  2QWR B;  2EZO A;  3ZJZ A;  1AR5 A;  4DR5 O;  3JD0 A;  4KXR A;  1VF6 A;  4FJC C;  2A79 B;  2YXL A;  2UU9 O;  2HLD G;  4FLT A;  2WLL B;  3TCU A;  3ZHU A;  1K97 A;  3LDC A;  5L3B A;  2L35 A;  2YS8 A;  1W0J G;  5BMV B;  2D3O W;  1VF5 B;  1QLE B;  2V1D A;  4DW1 A;  1ZSP A;  3GVM A;  1OV9 A;  4HYO A;  4RQE A;  1M57 B;  3JAW A;  4ZBM A;  4MSW C;  4PA7 A;  3HKC B;  4MTX A;  3FB7 C;  3CPW U;  3RYH B;  5J9P C;  5LGT A;  3GB7 C; 
#chains in the Genus database with same CATH homology
 4PA4 A;  4GX1 A;  3ZN0 A;  2WLM A;  2P6J A;  1YSC A;  4WF9 V;  3IFX A;  3OMI B;  1F4N A;  1E1R G;  1K7D A;  3CD6 V;  4FMT A;  1AJP A;  5GW7 A;  1ENV A;  4R8C A;  4H37 A;  3OR7 C;  5L3G A;  2NNU A;  4LC1 A;  1GM7 A;  3I55 V;  4MTG A;  4GCZ A;  2WLN A;  1JJ2 U;  2WWW A;  5LBQ A;  2HFE C;  5KA6 A;  1H8H G;  2HVJ C;  2EIL B;  2F43 G;  1VQN V;  4QE9 A;  3ZCC A;  2JDI G;  1PNK A;  1AI4 A;  1R3K C;  1VQO V;  1G4Y B;  1OCR C;  1VQ5 V;  4J9Z B;  3RVY A;  3ABK C;  4UV8 A;  3AG3 B;  3SYO A;  1S3J A;  3QO8 A;  4JAS A;  4JTD B;  3TET A;  3E89 A;  1BL8 A;  1UJW B;  3JD1 A;  3LDE A;  1YTF D;  2BOC C;  4U7N A;  4XDL A;  4MVR A;  2X6B A;  3F5W C;  1Q86 W;  1V54 C;  4BIZ A;  3EHB B;  1M9N A;  1R3J C;  4WFH A;  4G2K A;  1MSW D;  2EIM C;  2QTO A;  1MAB G;  2H8P C;  1W2B U;  4PA6 A;  4PDL A;  1Q81 W;  3MHH C;  1R3I C;  2LP7 A;  2DYS C;  1V55 C;  5KUK A;  2PI4 A;  4X89 A;  3D36 A;  4Q20 A;  1GTO A;  1FXV A;  4MTO A;  3ABM B;  4PDV A;  4UUJ C;  1RM1 C;  1VQP V;  3W7U A;  3W7W A;  3FB8 C;  5B1A C;  3NXS A;  1NR7 A;  3SYP A;  3UKM A;  5LHI A;  1JX9 A;  3AG2 C;  2DQ3 A;  1H38 A;  2BOB C;  1ORQ C;  3AEI A;  2ZR2 A;  3LNM B;  5EC2 C;  5B1B B;  3WG7 B;  3IC7 A;  5H6R A;  2JJ2 G;  3OAA G;  5HFM A;  3VBB A;  3SPC A;  4J9Y B;  1Y66 A;  4JPR A;  1B6Q A;  2P90 A;  3E35 A;  3FB6 C;  4HAM A;  5B1N A;  3OGC C;  4RAI A;  5BZB A;  1OCZ C;  3CCM V;  2HG5 C;  4QPJ A;  3CCE V;  3ETD A;  2Y69 C;  3OFN G;  4JGS A;  3OEE G;  1FFT B;  3M99 B;  3SPJ A;  5LGT A;  5EBM C;  4MVU A;  1SRY A;  1DTO A;  5HFL A;  4RUE A;  4QNH B;  1FXK C;  3OUF A;  1ARO P;  5DM6 V;  3B8N A;  3JD3 A;  2ITD C;  1DF4 A;  3AG4 C;  4RQF A;  1K73 W;  2JJ1 G;  3ZMS A;  3ZMT A;  1R73 A;  1F4M A;  4JYC A;  2Q67 A;  3VOU A;  1P4R A;  1RPO A;  1FXH A;  1M56 C;  1P7B A;  3WFV A;  1MG1 A;  1K9M W;  3T4D A;  1THZ A;  1NQT A;  2UXN A;  4P30 A;  4PDR A;  1KQS U;  2B1G A;  2EIN B;  2QM7 A;  3ASO C;  3T1C A;  3T4Z A;  4GX0 A;  3KG2 A;  1S5H C;  2GHY A;  2Q6A A;  3W7T A;  3E8B A;  1TUE B;  1NVP B;  3SJQ C;  5C93 A;  3CCS V;  3OUS A;  2C2A A;  3K9A A;  4F4L A;  2ZXW B;  3RVZ A;  1BHB A;  2LFR A;  5B3S C;  4WCE V;  4JF3 A;  1VQL V;  5LGN A;  3HPL C;  1I5Y A;  1SES A;  2AHZ A;  2JIZ G;  4U7O A;  3B8M A;  2A0L A;  3MHS C;  4P2Z A;  4H33 A;  4TSF G;  3ABL B;  1KP3 A;  4QIW F;  3STL C;  4UVB A;  1QVF U;  2EZP A;  1GKF A;  4GX5 A;  1F23 A;  1YI2 V;  3X2Q B;  2XAJ A;  1FS0 G;  2R9R B;  1K4D C;  4MTF A;  5LHG A;  1S72 V;  5EBL C;  1KC8 W;  1QLE C;  3E8F A;  2EIK C;  3QO5 A;  1H2G A;  4XDJ A;  2XAQ A;  3CCV V;  2DYR B;  2EBO A;  1BMF G;  4HZ3 A;  4TWK A;  1M57 C;  1WLE A;  5CA3 A;  3T2M A;  1AI5 A;  1JVM A;  2QKS A;  4JTA B;  3CCL V;  2WSS G;  1VQ4 V;  1VQ9 V;  4UVA A;  1N8R W;  3CME V;  3CCU V;  3RBZ A;  3I56 V;  1Q82 W;  4BAY A;  5CMU A;  3K06 A;  4DO2 A;  1CEZ A;  1QVG U;  4JYB A;  4LBE C;  1K5Q A;  2K1E A;  3OMA B;  5L3D A;  3G4S V;  1VQK V;  1BHA A;  5L3C A;  4WFG A;  1K33 A;  3BY6 A;  1E79 G;  2OCC B;  1QR9 A;  3B77 A;  3DGE A;  3H01 A;  4FK5 C;  3CCR V;  4N21 A;  3JYC A;  1NH2 D;  3ETG A;  1K34 A;  1AJQ A;  5IY5 B;  4PEL A;  4MVS A;  2XOK G;  2EIJ B;  2EIL C;  1K92 A;  3DTU B;  1YJW V;  1HWY A;  1QCE A;  1J95 A;  4R50 A;  4BIU A;  2EJR A;  4WFE A;  3AG3 C;  3D3I A;  2MK3 A;  1OHH G;  2WLH A;  1RPR A;  3K3W A;  2OTJ V;  3OM3 B;  4JAU A;  1IXM A;  1YJ9 V;  1OCO B;  3E83 A;  4JAV A;  5IYB O;  2A9H A;  1SET A;  4GT1 A;  4OXS A;  4UV9 A;  1Y4M A;  4X8A A;  3MD0 A;  1OCC B;  2ZDI A;  3SPI A;  3JD2 A;  1K3E A;  3OMN B;  4GX2 A;  5E1A C;  5EK0 A;  3SYA A;  1JCH A;  3ASN B;  3ZRW A;  1S77 D;  3CC4 V;  4FPP A;  1PL0 A;  3E8H A;  3F7V C;  2IU3 A;  4CZZ A;  4XDK A;  1F51 A;  4QPK A;  5CBF A;  3ABM C;  5CBG A;  2IH1 C;  3JCZ A;  3CXC U;  1G8M A;  2IJH A;  1YIJ V;  1K4C C;  2Z5U A;  1MOF A;  1XL6 A;  3LDD A;  2JEU A;  2WLJ A;  1NR1 A;  4FIP C;  3E2E A;  4RO2 A;  1W0K G;  4ZKI A;  3QO7 A;  3ML0 A;  3AG1 B;  3ABU A;  1NVP D;  4KUM A;  1GK9 A;  5B1B C;  3WG7 C;  5KUM A;  3HB3 B;  4UVC A;  3A0R A;  1WPX A;  3G71 V;  3ZRW B;  4BW5 A;  3LSS A;  1M1K W;  3OEH G;  1AR1 B;  4LCU C;  4KP4 A;  2Q69 A;  2HVK C;  2DW4 A;  2XAF A;  1M90 W;  2IJJ A;  1PKX A;  2WAM A;  5IYD O;  2X6A A;  3BEH A;  2WPD G;  1GMG A;  1XL4 A;  1VQ6 V;  4YXW G;  2B1I A;  2H94 A;  2ATK C;  3SPG A;  2ITC C;  2P7T C;  1E1Q G;  1K8A W;  3SYQ A;  3ZMU A;  3ETE A;  1SER A;  1EFR G;  2HR3 A;  1DLB A;  1QR8 A;  1I5X A;  1JQ0 A;  1OCR B;  2JEX A;  2R9I A;  1DF5 A;  1PD3 A;  4R7C A;  3ABK B;  2HJF C;  1PNM A;  3ZRX A;  3LUT B;  2WLI A;  3G6E V;  2IJI A;  3QNE A;  3ABT A;  1EBO A;  1VQ8 V;  3OW2 U;  4WFF A;  1L1F A;  3PJS K;  5IDJ A;  2GSM B;  2ZR3 A;  4MVQ A;  1YIT V;  5EC1 C;  1R6K A;  1NKD A;  3CP1 A;  1V54 B;  2OTL V;  4QJF B;  5H6Q A;  1AJN A;  3UM7 A;  3E8G A;  2V7Q G;  4N23 A;  2EIM B;  2XAH A;  2EIN C;  2LFS A;  3F7Y C;  3SPH A;  4ASU G;  2JK5 C;  2DYS B;  1V55 B;  2ZXW C;  3K0D A;  4P9O A;  1KD1 W;  2UXX A;  4EKW A;  5L3E A;  3CCQ V;  1VQ7 V;  1NBM G;  4JTC B;  2XND G;  4MVO A;  2WLI B;  2OT5 A;  3CC2 V;  1ZWI C;  3K04 A;  3CMA V;  1QBZ A;  4CBC A;  1VQM V;  3ZIA G;  1RM1 B;  2CK3 G;  2QA4 V;  2IW5 A;  3ABL C;  4G27 B;  3CCJ V;  1AI7 A;  5B1A B;  3W7X A;  2QM8 A;  2X6C A;  3AG2 B;  4KFM A;  2WLK A;  5CN0 A;  3X2Q C;  2YEV A;  5DN6 G;  2QEX V;  4PDM A;  4Z1M G;  3FKS G;  1FXK A;  2DYR C;  1AI6 A;  1Q7Y W;  1R3L C;  2QE7 G;  4L87 A;  3TK1 A;  4LP8 A;  3K03 A;  1NJI W;  3P32 A;  1GM8 A;  2W6I G;  2AHY A;  2KB1 A;  4G28 B;  1OCZ B;  1CP9 A;  3CC7 V;  3P30 A;  2X0L A;  4PA9 A;  4MW3 A;  4MVZ A;  2P67 A;  2Y69 B;  4I9W A;  3SYC A;  3LSQ A;  1YTF B;  5LHH A;  1COW G;  1SZT A;  1KKD A;  3GWO A;  2NLJ C;  2YEV B;  2IJK A;  4TT3 G;  2XAS A;  1FXK B;  5FL7 G;  3FYE B;  3IGA C;  3FB5 C;  2W6J G;  2YSU B;  2OCC C;  2DWE C;  4MW8 A;  3AG4 B;  3R65 A;  1K5S A;  3ZRV A;  1PNL A;  2Z3Y A;  1NH2 B;  1CPY A;  1KP2 A;  5IY5 C;  5KA5 A;  1LNQ A;  3ZRS A;  2WLL A;  5B1O A;  2HKO A;  4MT8 A;  2EIJ C;  5CBH A;  3ZN1 A;  1QLN A;  1M56 B;  4WFB V;  3K08 A;  1JPX A;  3EFF K;  4MS2 A;  1S0V A;  2PI5 A;  1ROP A;  3OE7 G;  2FTK A;  4I5S A;  4RUF A;  3ASO B;  2EZO A;  4P9P A;  3ZJZ A;  5H9C A;  1OCO C;  4MVM A;  3JD0 A;  4X88 A;  1YHQ V;  5B3S B;  2Q68 A;  1R6N A;  4FJC C;  1H8E G;  1JOY A;  2A79 B;  1GO3 F;  1EZJ A;  4WFA V;  2M7W A;  5LGU A;  5IYC O;  2HLD G;  1OCC C;  2WLL B;  2ZD9 A;  3TCU A;  4E2L A;  1KEC A;  4PA3 A;  1S76 D;  1K97 A;  5L3F A;  3ASN C;  3ZMZ A;  3LDC A;  5L3B A;  3JD4 A;  3W7S A;  1W0J G;  4QE7 A;  3FYI B;  2D3O W;  2XAG A;  4XBF A;  1QLE B;  1GM9 A;  2EIK B;  2V1D A;  5EBW C;  3RW0 A;  3CYO A;  2DQ0 A;  4HYO A;  4DXW A;  4RQE A;  3OR6 C;  3ZMV A;  1OZ0 A;  1M57 B;  3K0G A;  2ZQM A;  4ZBM A;  1YJN V;  4MSW C;  4PA7 A;  3K79 A;  2B5U A;  2Y48 A;  3E86 A;  3FB7 C;  4MTX A;  2DWD C;  2ZDI C;  2IH3 C;  3AG1 C;  4R6Z A;  3STZ C;  3CPW U;  2W0F C;  2X7R B;  4UXN A;  5J9P C;  2IU0 A;  3GB7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...