2HGFA

Hairpin loop containing domain of hepatocyte growth factor, nmr, minimized average structure
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
GQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR
publication title The solution structure of the N-terminal domain of hepatocyte growth factor reveals a potential heparin-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hepatocyte growth factor
total genus 14
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 1997-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 2hgfA00
2Z8VA 2J8LA 1BHTA 4R1AA 2YILA 4UAOA 2K13X 5EOKA 2QJ4A 2QJ2A 1GMNA 1YXEA 2Q8BA 4Z0DA 1GP9A 2HGFA 2J8JA 5CT3A 1GMOA 1HKYA 3HN4A 5CT2A 2Y8RA 5CS3A 3MKPA 2LL3A 3HMRA 5I25A 4APMA 5EODA 3SRJA 5CT1A 5COEA 2Q8AA 2F83A 5CS9A 3ZWZA 4IUAA 4Z09A 2YIPA 4R1BA 2LL4M 3SP8A 2Z8WA 1NK1A 4Z0EA 5CS5A 2X2ZA 2YIOA 1W81A 3HMTA 4UV6A 4DURA 5CS1A 3HMSA 3ZLEA 5CP9A 5CSQA 4Z0FA 4A5TS 1W8KA 4R1CA 4APLA 3SRIA 1I8NA 1Z40A 4R19A
chains in the Genus database with same CATH superfamily
2Z8VA 4YIZA 2J8LA 1BHTA 4R1AA 2YILA 4UAOA 4YIVA 2K13X 5EOKA 2QJ4A 1GMNA 2QJ2A 1YXEA 2Q8BA 4Z0DA 1GP9A 2HGFA 2J8JA 5CT3A 1GMOA 1HKYA 3HN4A 5CT2A 2Y8RA 5CS3A 3MKPA 2LL3A 3HMRA 5I25A 4APMA 5EODA 3SRJA 5CT1A 5COEA 2KL5A 2Q8AA 2F83A 5CS9A 3ZWZA 4IUAA 4Z09A 2YIPA 4R1BA 2LL4M 3SP8A 2Z8WA 1NK1A 4Z0EA 5CS5A 2X2ZA 2YIOA 1W81A 3HMTA 4UV6A 4DURA 5CS1A 3HMSA 3ZLEA 5CP9A 5CSQA 4Z0FA 4A5TS 1W8KA 4R1CA 4APLA 3SRIA 1I8NA 1Z40A 4R19A
chains in the Genus database with same CATH topology
2Z8VA 4YIZA 2J8LA 1BHTA 4R1AA 2YILA 4UAOA 4YIVA 2K13X 5EOKA 2QJ4A 1GMNA 2QJ2A 1YXEA 2Q8BA 4Z0DA 1GP9A 2HGFA 2J8JA 5CT3A 1GMOA 1HKYA 3HN4A 5CT2A 2Y8RA 5CS3A 3MKPA 2LL3A 3HMRA 5I25A 4APMA 5EODA 3SRJA 5CT1A 5COEA 2KL5A 2Q8AA 2F83A 5CS9A 3ZWZA 4IUAA 4Z09A 2YIPA 4R1BA 2LL4M 3SP8A 2Z8WA 1NK1A 4Z0EA 5CS5A 2X2ZA 2YIOA 1W81A 3HMTA 4UV6A 4DURA 5CS1A 3HMSA 3ZLEA 5CP9A 5CSQA 4Z0FA 4A5TS 1W8KA 4R1CA 4APLA 3SRIA 1I8NA 1Z40A 4R19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8V A;  2J8L A;  1BHT A;  4R1A A;  2YIL A;  4UAO A;  2K13 X;  5EOK A;  2QJ4 A;  2QJ2 A;  1GMN A;  1YXE A;  2Q8B A;  4Z0D A;  1GP9 A;  2HGF A;  2J8J A;  5CT3 A;  1GMO A;  1HKY A;  3HN4 A;  5CT2 A;  2Y8R A;  5CS3 A;  3MKP A;  2LL3 A;  3HMR A;  5I25 A;  4APM A;  5EOD A;  3SRJ A;  5CT1 A;  5COE A;  2Q8A A;  2F83 A;  5CS9 A;  3ZWZ A;  4IUA A;  4Z09 A;  2YIP A;  4R1B A;  2LL4 M;  3SP8 A;  2Z8W A;  1NK1 A;  4Z0E A;  5CS5 A;  2X2Z A;  2YIO A;  1W81 A;  3HMT A;  4UV6 A;  4DUR A;  5CS1 A;  3HMS A;  3ZLE A;  5CP9 A;  5CSQ A;  4Z0F A;  4A5T S;  1W8K A;  4R1C A;  4APL A;  3SRI A;  1I8N A;  1Z40 A;  4R19 A; 
#chains in the Genus database with same CATH topology
 2Z8V A;  4YIZ A;  2J8L A;  1BHT A;  4R1A A;  2YIL A;  4UAO A;  4YIV A;  2K13 X;  5EOK A;  2QJ4 A;  1GMN A;  2QJ2 A;  1YXE A;  2Q8B A;  4Z0D A;  1GP9 A;  2HGF A;  2J8J A;  5CT3 A;  1GMO A;  1HKY A;  3HN4 A;  5CT2 A;  2Y8R A;  5CS3 A;  3MKP A;  2LL3 A;  3HMR A;  5I25 A;  4APM A;  5EOD A;  3SRJ A;  5CT1 A;  5COE A;  2KL5 A;  2Q8A A;  2F83 A;  5CS9 A;  3ZWZ A;  4IUA A;  4Z09 A;  2YIP A;  4R1B A;  2LL4 M;  3SP8 A;  2Z8W A;  1NK1 A;  4Z0E A;  5CS5 A;  2X2Z A;  2YIO A;  1W81 A;  3HMT A;  4UV6 A;  4DUR A;  5CS1 A;  3HMS A;  3ZLE A;  5CP9 A;  5CSQ A;  4Z0F A;  4A5T S;  1W8K A;  4R1C A;  4APL A;  3SRI A;  1I8N A;  1Z40 A;  4R19 A; 
#chains in the Genus database with same CATH homology
 2Z8V A;  4YIZ A;  2J8L A;  1BHT A;  4R1A A;  2YIL A;  4UAO A;  4YIV A;  2K13 X;  5EOK A;  2QJ4 A;  1GMN A;  2QJ2 A;  1YXE A;  2Q8B A;  4Z0D A;  1GP9 A;  2HGF A;  2J8J A;  5CT3 A;  1GMO A;  1HKY A;  3HN4 A;  5CT2 A;  2Y8R A;  5CS3 A;  3MKP A;  2LL3 A;  3HMR A;  5I25 A;  4APM A;  5EOD A;  3SRJ A;  5CT1 A;  5COE A;  2KL5 A;  2Q8A A;  2F83 A;  5CS9 A;  3ZWZ A;  4IUA A;  4Z09 A;  2YIP A;  4R1B A;  2LL4 M;  3SP8 A;  2Z8W A;  1NK1 A;  4Z0E A;  5CS5 A;  2X2Z A;  2YIO A;  1W81 A;  3HMT A;  4UV6 A;  4DUR A;  5CS1 A;  3HMS A;  3ZLE A;  5CP9 A;  5CSQ A;  4Z0F A;  4A5T S;  1W8K A;  4R1C A;  4APL A;  3SRI A;  1I8N A;  1Z40 A;  4R19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...