2HGKA

Solution nmr structure of protein yqcc from e. coli: northeast structural genomics consortium target er225
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
b'MTTHDRVRLQLQALEALLREHQHWRNDEPQPHQFNSTQPFFMDTMEPLEWLQWVLIPRMHDLLDNKQPLPGAFAVAPYYEMALATDHPQRALILAELEKLDALFADDASLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqcC
publication title NMR structure of protein YqcC from E.coli
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 31
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04287 DUF446 tRNA pseudouridine synthase C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.40 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) YqcC-like 2hgkA01
2HGKA
chains in the Genus database with same CATH superfamily
1U5KA 3IAM1 3UITA 4OAVB 4PL4A 2KKMA 4AS3A 4NV2A 4O1PA 4HEA1 2ZRRA 2HGKA 5HGIA 1JQOA 4Z7GA 3DO9A 2QZGA 4AS2A 2F66B 2CAZB 4G75A 2QGMA 4HFVA 2F6MB 2JBWA 4YZ9A 2V6EA 4I1TA 2RADA 3IAS1 3I9V1 2V1CC 2YFBA 2GSCA 3Q8DA 3KP9A 3JSBA 2JB3A 2ETDA 4PL3A 4OAUC 3L0IA 3B55A 2FEFA 3P23A 3LJ2A 4NV5A 3VA9A 2RLDA 2JB2A 3DA3A 5LNK1 4JCVE 2FUG1 2QSBA 3LJ1A 2L1LB 2A2DA 3FBVA 2JB1A 2XMXA 4GXTA 1SJ8A 3LJ0A 2MJFB 4O1OA 2BL7A 2FU2A 2XTRA 4Z7HA 3AJFA 4YZDA 3FVVA 2E8GA 2K19A 1W3SA 2A2CA 4PL5A 2JAEA 4Q9VA 2YFAA 3SDJA 3DA4A 4U6RA 2BL8A 2IP6A 2RIOA 1YO7A 1TDPA 4DWLA 2P22B 3FNBA 2ZW3A 2XTQA 4YZCA 3F4MA 4G76A
chains in the Genus database with same CATH topology
2HGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGK A; 
#chains in the Genus database with same CATH topology
 1U5K A;  3IAM 1;  3UIT A;  4OAV B;  4PL4 A;  2KKM A;  4AS3 A;  4NV2 A;  4O1P A;  4HEA 1;  2ZRR A;  2HGK A;  5HGI A;  1JQO A;  4Z7G A;  3DO9 A;  2QZG A;  4AS2 A;  2F66 B;  2CAZ B;  4G75 A;  2QGM A;  4HFV A;  2F6M B;  2JBW A;  4YZ9 A;  2V6E A;  4I1T A;  2RAD A;  3IAS 1;  3I9V 1;  2V1C C;  2YFB A;  2GSC A;  3Q8D A;  3KP9 A;  3JSB A;  2JB3 A;  2ETD A;  4PL3 A;  4OAU C;  3L0I A;  3B55 A;  2FEF A;  3P23 A;  3LJ2 A;  4NV5 A;  3VA9 A;  2RLD A;  2JB2 A;  3DA3 A;  5LNK 1;  4JCV E;  2FUG 1;  2QSB A;  3LJ1 A;  2L1L B;  2A2D A;  3FBV A;  2JB1 A;  2XMX A;  4GXT A;  1SJ8 A;  3LJ0 A;  2MJF B;  4O1O A;  2BL7 A;  2FU2 A;  2XTR A;  4Z7H A;  3AJF A;  4YZD A;  3FVV A;  2E8G A;  2K19 A;  1W3S A;  2A2C A;  4PL5 A;  2JAE A;  4Q9V A;  2YFA A;  3SDJ A;  3DA4 A;  4U6R A;  2BL8 A;  2IP6 A;  2RIO A;  1YO7 A;  1TDP A;  4DWL A;  2P22 B;  3FNB A;  2ZW3 A;  2XTQ A;  4YZC A;  3F4M A;  4G76 A; 
#chains in the Genus database with same CATH homology
 2HGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...