2HH2A

Solution structure of the fourth kh domain of ksrp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
GEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the C-Terminal KH Domains of KSRP Reveals a Noncanonical Motif Important for mRNA Degradation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords KH-type splicing regulatory protein
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2hh2A00
2CTLA 2CTMA 4NBQA 2CTFA 1ZZKA 2CTJA 3U1KA 5JEAG 1J4WA 2PY9A 3AEVB 5C0XG 4OO1G 1KHMA 2OPVA 1J5KA 2FMRA 2YQRA 4IFDG 1ZTGA 1K1GA 2Z0SA 1ZZJA 2JZXA 4JVYA 2AXYA 2PQUA 2HH2A 2JVZA 1DT4A 2BL5A 2BA0A 2HH3A 1VIGA 1X4NA 4AIMA 2JEAI 4BA1I 2JEBI 1DTJA 2CTKA 2QNDA 4QMFB 3V69A 4WALA 4BA2I 4AM3A 3VKEA 4WANA 2P2RA 1VIHA 2CPQA 4B8TA 2ANRA 2OPUA 1WVNA 2NN6G 2E3UA 2JE6I 4LIJA 2CTEA 1WE8A 1TUAA 1ZZIA 1X4MA 2ANNA 3L7ZC 2DGRA 1EC6A 4JVHA 5K36G 2MJHA 2JA9A
chains in the Genus database with same CATH superfamily
2CTLA 4NBQA 3AEVB 1N33H 1X0AA 4LFAH 5IT9W 4JI3H 2CWFA 4OO1G 4NZTM 1I94H 1XNQH 2FMRA 2VKCA 4DUYH 1N32H 2Z0SA 4JI0H 2JZXA 2AXYA 1FJGH 2JVZA 4B3RH 4DR2H 2BL5A 1F0XA 3J81W 4AIMA 2JEAI 5K36G 2K1HA 1DTJA 2LTMA 2X06A 5FLXW 4WANA 4JI2H 3GR5A 2CPQA 1WHRA 2ANRA 2D9IA 4G08A 4X62H 4AQYH 1PQXA 1AN7A 4LF8H 2ANNA 1SEIA 2DGRA 3NCVA 5LL6b 3RF2A 1EC6A 4X66H 2MJHA 1V8CA 4X65H 3U1KA 4JI8H 5JEAG 2UUBH 1J4WA 3KDKA 1KHMA 2OPVA 4LF4H 2PT7G 3FAUA 5IWAH 4DV7H 1ZTGA 2F4VH 4JYAH 2A1SA 5DT9A 1ZZJA 4JVYA 2M8WA 4EC5A 3OSSD 4OD6A 1VIGA 3T1YH 4DV4H 1N34H 2QNDA 4WALA 4B8CD 4GKJH 4JI6H 2FPHX 4B3SH 1IBKH 1VIHA 4B8TA 5BR8H 4K0KH 2LF0A 4YY3H 1S20A 2JE6I 3OETA 2CTEA 4LIJA 1ODHA 3J7AK 1MSZA 4DR1H 5A2QW 3J80W 3JAMW 2E5LH 2JA9A 4JI1H 2CTMA 2CTFA 1ZZKA 2CTJA 4LF5H 1I6UA 5C0XG 1V9NA 1NXUA 1XMQH 4JI5H 2YQRA 4DV5H 1IBLH 4DV0H 4JI4H 2CPMA 1HNWH 1X9ZA 4FJUA 2UXBH 2HH2A 4B3MH 2O4CA 2BA0A 2HH3A 1X4NA 4PDBA 2FFMA 2JEBI 4QMFB 3V69A 2UU9H 1Z2IA 4LF7H 4DR7H 4AM3A 4KHPH 3UOEA 3T1HH 4DV6H 2OPUA 1WVNA 4GKKH 4NXMH 1S03G 4LFCH 3OTOH 3QD7X 2UUCH 4DV3H 1N36H 1HR0H 2VQFH 4JI7H 4FJSA 4JVHA 1J5EH 3I0PA 4H8AA 3GKUA 1HNXH 2PY9A 4LF6H 2G8YA 5LMNH 2UXCH 1UG8A 2CWHA 2ZM6H 4DV1H 3EZJA 4DR5H 1J5KA 2UUAH 4IFDG 1XMOH 1K1GA 4YHHH 1FKAH 2HHHH 2PQUA 2UXDH 2VQEH 4DV2H 1DT4A 4OX9H 1XRHA 4B3TH 4BA1I 2CTKA 3KDGA 4X64H 4BA2I 2ZQEA 1HNZH 1XNRH 3VKEA 4E9JA 2LTLA 3SB1A 2P2RA 2M6QA 4LF9H 4DR4H 1WTJA 1VBIA 2E3UA 2NN6G 4JV5H 2Y3MA 4NXNH 1WE8A 3GABA 2LRRA 1TUAA 4DUZH 1X4MA 1ZZIA 4DR6H 3L7ZC 4LFBH 5LMUH 4OCHA 4DR3H 4NZRM 1IBMH
chains in the Genus database with same CATH topology
2CTLA 2CTMA 4NBQA 2CTFA 1ZZKA 2CTJA 3U1KA 5JEAG 1J4WA 2PY9A 3AEVB 5C0XG 4OO1G 1KHMA 2OPVA 1J5KA 2FMRA 2YQRA 4IFDG 1ZTGA 1K1GA 2Z0SA 1ZZJA 2JZXA 4JVYA 2AXYA 2PQUA 2HH2A 2JVZA 1DT4A 2BL5A 2BA0A 2HH3A 1VIGA 1X4NA 4AIMA 2JEAI 4BA1I 2JEBI 1DTJA 2CTKA 2QNDA 4QMFB 3V69A 4WALA 4BA2I 4AM3A 3VKEA 4WANA 2P2RA 1VIHA 2CPQA 4B8TA 2ANRA 2OPUA 1WVNA 2NN6G 2E3UA 2JE6I 4LIJA 2CTEA 1WE8A 1TUAA 1ZZIA 1X4MA 2ANNA 3L7ZC 2DGRA 1EC6A 4JVHA 5K36G 2MJHA 2JA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTL A;  2CTM A;  4NBQ A;  2CTF A;  1ZZK A;  2CTJ A;  3U1K A;  5JEA G;  1J4W A;  2PY9 A;  3AEV B;  5C0X G;  4OO1 G;  1KHM A;  2OPV A;  1J5K A;  2FMR A;  2YQR A;  4IFD G;  1ZTG A;  1K1G A;  2Z0S A;  1ZZJ A;  2JZX A;  4JVY A;  2AXY A;  2PQU A;  2HH2 A;  2JVZ A;  1DT4 A;  2BL5 A;  2BA0 A;  2HH3 A;  1VIG A;  1X4N A;  4AIM A;  2JEA I;  4BA1 I;  2JEB I;  1DTJ A;  2CTK A;  2QND A;  4QMF B;  3V69 A;  4WAL A;  4BA2 I;  4AM3 A;  3VKE A;  4WAN A;  2P2R A;  1VIH A;  2CPQ A;  4B8T A;  2ANR A;  2OPU A;  1WVN A;  2NN6 G;  2E3U A;  2JE6 I;  4LIJ A;  2CTE A;  1WE8 A;  1TUA A;  1ZZI A;  1X4M A;  2ANN A;  3L7Z C;  2DGR A;  1EC6 A;  4JVH A;  5K36 G;  2MJH A;  2JA9 A; 
#chains in the Genus database with same CATH topology
 2CTL A;  4NBQ A;  3AEV B;  1N33 H;  1X0A A;  4LFA H;  5IT9 W;  4JI3 H;  2CWF A;  4OO1 G;  4NZT M;  1I94 H;  1XNQ H;  2FMR A;  2VKC A;  4DUY H;  1N32 H;  2Z0S A;  4JI0 H;  2JZX A;  2AXY A;  1FJG H;  2JVZ A;  4B3R H;  4DR2 H;  2BL5 A;  1F0X A;  3J81 W;  4AIM A;  2JEA I;  5K36 G;  2K1H A;  1DTJ A;  2LTM A;  2X06 A;  5FLX W;  4WAN A;  4JI2 H;  3GR5 A;  2CPQ A;  1WHR A;  2ANR A;  2D9I A;  4G08 A;  4X62 H;  4AQY H;  1PQX A;  1AN7 A;  4LF8 H;  2ANN A;  1SEI A;  2DGR A;  3NCV A;  5LL6 b;  3RF2 A;  1EC6 A;  4X66 H;  2MJH A;  1V8C A;  4X65 H;  3U1K A;  4JI8 H;  5JEA G;  2UUB H;  1J4W A;  3KDK A;  1KHM A;  2OPV A;  4LF4 H;  2PT7 G;  3FAU A;  5IWA H;  4DV7 H;  1ZTG A;  2F4V H;  4JYA H;  2A1S A;  5DT9 A;  1ZZJ A;  4JVY A;  2M8W A;  4EC5 A;  3OSS D;  4OD6 A;  1VIG A;  3T1Y H;  4DV4 H;  1N34 H;  2QND A;  4WAL A;  4B8C D;  4GKJ H;  4JI6 H;  2FPH X;  4B3S H;  1IBK H;  1VIH A;  4B8T A;  5BR8 H;  4K0K H;  2LF0 A;  4YY3 H;  1S20 A;  2JE6 I;  3OET A;  2CTE A;  4LIJ A;  1ODH A;  3J7A K;  1MSZ A;  4DR1 H;  5A2Q W;  3J80 W;  3JAM W;  2E5L H;  2JA9 A;  4JI1 H;  2CTM A;  2CTF A;  1ZZK A;  2CTJ A;  4LF5 H;  1I6U A;  5C0X G;  1V9N A;  1NXU A;  1XMQ H;  4JI5 H;  2YQR A;  4DV5 H;  1IBL H;  4DV0 H;  4JI4 H;  2CPM A;  1HNW H;  1X9Z A;  4FJU A;  2UXB H;  2HH2 A;  4B3M H;  2O4C A;  2BA0 A;  2HH3 A;  1X4N A;  4PDB A;  2FFM A;  2JEB I;  4QMF B;  3V69 A;  2UU9 H;  1Z2I A;  4LF7 H;  4DR7 H;  4AM3 A;  4KHP H;  3UOE A;  3T1H H;  4DV6 H;  2OPU A;  1WVN A;  4GKK H;  4NXM H;  1S03 G;  4LFC H;  3OTO H;  3QD7 X;  2UUC H;  4DV3 H;  1N36 H;  1HR0 H;  2VQF H;  4JI7 H;  4FJS A;  4JVH A;  1J5E H;  3I0P A;  4H8A A;  3GKU A;  1HNX H;  2PY9 A;  4LF6 H;  2G8Y A;  5LMN H;  2UXC H;  1UG8 A;  2CWH A;  2ZM6 H;  4DV1 H;  3EZJ A;  4DR5 H;  1J5K A;  2UUA H;  4IFD G;  1XMO H;  1K1G A;  4YHH H;  1FKA H;  2HHH H;  2PQU A;  2UXD H;  2VQE H;  4DV2 H;  1DT4 A;  4OX9 H;  1XRH A;  4B3T H;  4BA1 I;  2CTK A;  3KDG A;  4X64 H;  4BA2 I;  2ZQE A;  1HNZ H;  1XNR H;  3VKE A;  4E9J A;  2LTL A;  3SB1 A;  2P2R A;  2M6Q A;  4LF9 H;  4DR4 H;  1WTJ A;  1VBI A;  2E3U A;  2NN6 G;  4JV5 H;  2Y3M A;  4NXN H;  1WE8 A;  3GAB A;  2LRR A;  1TUA A;  4DUZ H;  1X4M A;  1ZZI A;  4DR6 H;  3L7Z C;  4LFB H;  5LMU H;  4OCH A;  4DR3 H;  4NZR M;  1IBM H; 
#chains in the Genus database with same CATH homology
 2CTL A;  2CTM A;  4NBQ A;  2CTF A;  1ZZK A;  2CTJ A;  3U1K A;  5JEA G;  1J4W A;  2PY9 A;  3AEV B;  5C0X G;  4OO1 G;  1KHM A;  2OPV A;  1J5K A;  2FMR A;  2YQR A;  4IFD G;  1ZTG A;  1K1G A;  2Z0S A;  1ZZJ A;  2JZX A;  4JVY A;  2AXY A;  2PQU A;  2HH2 A;  2JVZ A;  1DT4 A;  2BL5 A;  2BA0 A;  2HH3 A;  1VIG A;  1X4N A;  4AIM A;  2JEA I;  4BA1 I;  2JEB I;  1DTJ A;  2CTK A;  2QND A;  4QMF B;  3V69 A;  4WAL A;  4BA2 I;  4AM3 A;  3VKE A;  4WAN A;  2P2R A;  1VIH A;  2CPQ A;  4B8T A;  2ANR A;  2OPU A;  1WVN A;  2NN6 G;  2E3U A;  2JE6 I;  4LIJ A;  2CTE A;  1WE8 A;  1TUA A;  1ZZI A;  1X4M A;  2ANN A;  3L7Z C;  2DGR A;  1EC6 A;  4JVH A;  5K36 G;  2MJH A;  2JA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...