2HH2A

Solution structure of the fourth kh domain of ksrp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
GEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KH-type splicing regulatory protein
publication title The Structure of the C-Terminal KH Domains of KSRP Reveals a Noncanonical Motif Important for mRNA Degradation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2hh2A00
2P2RA 2HH3A 5JEAG 1TUAA 4AIMA 3U1KA 2E3UA 4LIJA 1WE8A 2CTKA 2CTEA 2JZXA 2FMRA 2CTMA 1X4MA 3V69A 1J4WA 1ZTGA 2JA9A 2ANRA 2JEBI 4WANA 1DTJA 1VIGA 4B8TA 1EC6A 2OPVA 5K36G 2CTFA 2HH2A 2PY9A 2ANNA 4IFDG 2JVZA 5C0XG 4BA1I 1J5KA 2PQUA 4JVYA 2BL5A 2BA0A 2NN6G 2QNDA 1ZZIA 3L7ZC 4BA2I 1VIHA 1K1GA 1X4NA 1ZZJA 1ZZKA 2JE6I 2YQRA 1WVNA 2OPUA 4WALA 1DT4A 2MJHA 2Z0SA 2JEAI 3VKEA 3AEVB 2AXYA 2DGRA 2CTJA 2CTLA 4NBQA 4AM3A 2CPQA 4JVHA 4OO1G 4QMFB 1KHMA
chains in the Genus database with same CATH superfamily
4DV2H 3OETA 4DR3H 4LIJA 4B3SH 1PQXA 2CTKA 2CTEA 4DR5H 1IBMH 2FMRA 2UXDH 3KDKA 3V69A 4DR1H 4JI0H 2JA9A 4WANA 2JEBI 3GR5A 4LFCH 1VIGA 2X06A 4B8TA 2OPVA 4JI5H 1XMOH 5K36G 2VKCA 2PY9A 1SEIA 1FJGH 4JV5H 4JI3H 1WHRA 2JVZA 4BA1I 1I6UA 2NN6G 5IT9W 4JI7H 2FPHX 2LTMA 1ZZJA 3UOEA 2JEAI 2CWHA 2Z0SA 1AN7A 4LF7H 2DGRA 5LMNH 4AM3A 5LMUH 2CPMA 2PT7G 2LF0A 4NZRM 4FJUA 1HR0H 4AIMA 1XNQH 1V8CA 1WTJA 4OD6A 4LF6H 4JI8H 1XNRH 2JZXA 1VBIA 1X4MA 4X62H 4B8CD 1ZTGA 2ANRA 4B3MH 4YHHH 4DUYH 4DR7H 2LRRA 4YY3H 4DV4H 4JI1H 2UXCH 4DV6H 3NCVA 4DV1H 4LF9H 1J5EH 2UUCH 1J5KA 3GABA 4B3TH 2BA0A 3KDGA 1ZZIA 3L7ZC 4B3RH 2UUBH 1HNWH 1K1GA 1X4NA 4NZTM 4DV7H 4EC5A 1WVNA 4LF5H 1DT4A 1N33H 4LF4H 2M8WA 2AXYA 2A1SA 3RF2A 1X0AA 4X65H 1ODHA 4JVHA 2CPQA 5C0XG 1KHMA 3T1YH 3J81W 4JI2H 1XRHA 4H8AA 2FFMA 1TUAA 1IBLH 2P2RA 1X9ZA 2F4VH 3U1KA 1IBKH 4OX9H 2D9IA 1I94H 4FJSA 5DT9A 1V9NA 1Z2IA 5FLXW 2UXBH 1DTJA 1S03G 1EC6A 2K1HA 2LTLA 3I0PA 3QD7X 3JAMW 3EZJA 3GKUA 1XMQH 1N32H 2G8YA 2HH2A 4DV3H 4JI4H 2ANNA 4IFDG 2PQUA 2BL5A 2CWFA 3FAUA 4AQYH 1S20A 4JI6H 1NXUA 4LFAH 4NXMH 4LFBH 1ZZKA 2JE6I 2VQEH 2OPUA 4X64H 2MJHA 2M6QA 4G08A 3VKEA 4DUZH 2CTJA 2CTLA 1F0XA 4NBQA 4PDBA 4OO1G 4KHPH 3T1HH 2HH3A 5JEAG 4E9JA 4GKKH 3SB1A 1HNXH 2E3UA 1MSZA 1WE8A 1UG8A 1J4WA 2CTMA 2UUAH 3J7AK 4NXNH 2Y3MA 5IWAH 2ZM6H 4K0KH 2E5LH 4JYAH 2CTFA 2O4CA 4GKJH 4LF8H 5BR8H 4DR2H 1N34H 3J80W 3OTOH 4JVYA 5LL6b 2QNDA 2HHHH 4DV0H 1FKAH 2UU9H 4BA2I 1HNZH 1VIHA 4DV5H 4DR4H 2YQRA 4WALA 3AEVB 4DR6H 3OSSD 4X66H 2ZQEA 1N36H 4OCHA 5A2QW 4QMFB 2VQFH
chains in the Genus database with same CATH topology
2P2RA 2HH3A 5JEAG 1TUAA 4AIMA 3U1KA 2E3UA 4LIJA 1WE8A 2CTKA 2CTEA 2JZXA 2FMRA 2CTMA 1X4MA 3V69A 1J4WA 1ZTGA 2JA9A 2ANRA 2JEBI 4WANA 1DTJA 1VIGA 4B8TA 1EC6A 2OPVA 5K36G 2CTFA 2HH2A 2PY9A 2ANNA 4IFDG 2JVZA 5C0XG 4BA1I 1J5KA 2PQUA 4JVYA 2BL5A 2BA0A 2NN6G 2QNDA 1ZZIA 3L7ZC 4BA2I 1VIHA 1K1GA 1X4NA 1ZZJA 1ZZKA 2JE6I 2YQRA 1WVNA 2OPUA 4WALA 1DT4A 2MJHA 2Z0SA 2JEAI 3VKEA 3AEVB 2AXYA 2DGRA 2CTJA 2CTLA 4NBQA 4AM3A 2CPQA 4JVHA 4OO1G 4QMFB 1KHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P2R A;  2HH3 A;  5JEA G;  1TUA A;  4AIM A;  3U1K A;  2E3U A;  4LIJ A;  1WE8 A;  2CTK A;  2CTE A;  2JZX A;  2FMR A;  2CTM A;  1X4M A;  3V69 A;  1J4W A;  1ZTG A;  2JA9 A;  2ANR A;  2JEB I;  4WAN A;  1DTJ A;  1VIG A;  4B8T A;  1EC6 A;  2OPV A;  5K36 G;  2CTF A;  2HH2 A;  2PY9 A;  2ANN A;  4IFD G;  2JVZ A;  5C0X G;  4BA1 I;  1J5K A;  2PQU A;  4JVY A;  2BL5 A;  2BA0 A;  2NN6 G;  2QND A;  1ZZI A;  3L7Z C;  4BA2 I;  1VIH A;  1K1G A;  1X4N A;  1ZZJ A;  1ZZK A;  2JE6 I;  2YQR A;  1WVN A;  2OPU A;  4WAL A;  1DT4 A;  2MJH A;  2Z0S A;  2JEA I;  3VKE A;  3AEV B;  2AXY A;  2DGR A;  2CTJ A;  2CTL A;  4NBQ A;  4AM3 A;  2CPQ A;  4JVH A;  4OO1 G;  4QMF B;  1KHM A; 
#chains in the Genus database with same CATH topology
 4DV2 H;  3OET A;  4DR3 H;  4LIJ A;  4B3S H;  1PQX A;  2CTK A;  2CTE A;  4DR5 H;  1IBM H;  2FMR A;  2UXD H;  3KDK A;  3V69 A;  4DR1 H;  4JI0 H;  2JA9 A;  4WAN A;  2JEB I;  3GR5 A;  4LFC H;  1VIG A;  2X06 A;  4B8T A;  2OPV A;  4JI5 H;  1XMO H;  5K36 G;  2VKC A;  2PY9 A;  1SEI A;  1FJG H;  4JV5 H;  4JI3 H;  1WHR A;  2JVZ A;  4BA1 I;  1I6U A;  2NN6 G;  5IT9 W;  4JI7 H;  2FPH X;  2LTM A;  1ZZJ A;  3UOE A;  2JEA I;  2CWH A;  2Z0S A;  1AN7 A;  4LF7 H;  2DGR A;  5LMN H;  4AM3 A;  5LMU H;  2CPM A;  2PT7 G;  2LF0 A;  4NZR M;  4FJU A;  1HR0 H;  4AIM A;  1XNQ H;  1V8C A;  1WTJ A;  4OD6 A;  4LF6 H;  4JI8 H;  1XNR H;  2JZX A;  1VBI A;  1X4M A;  4X62 H;  4B8C D;  1ZTG A;  2ANR A;  4B3M H;  4YHH H;  4DUY H;  4DR7 H;  2LRR A;  4YY3 H;  4DV4 H;  4JI1 H;  2UXC H;  4DV6 H;  3NCV A;  4DV1 H;  4LF9 H;  1J5E H;  2UUC H;  1J5K A;  3GAB A;  4B3T H;  2BA0 A;  3KDG A;  1ZZI A;  3L7Z C;  4B3R H;  2UUB H;  1HNW H;  1K1G A;  1X4N A;  4NZT M;  4DV7 H;  4EC5 A;  1WVN A;  4LF5 H;  1DT4 A;  1N33 H;  4LF4 H;  2M8W A;  2AXY A;  2A1S A;  3RF2 A;  1X0A A;  4X65 H;  1ODH A;  4JVH A;  2CPQ A;  5C0X G;  1KHM A;  3T1Y H;  3J81 W;  4JI2 H;  1XRH A;  4H8A A;  2FFM A;  1TUA A;  1IBL H;  2P2R A;  1X9Z A;  2F4V H;  3U1K A;  1IBK H;  4OX9 H;  2D9I A;  1I94 H;  4FJS A;  5DT9 A;  1V9N A;  1Z2I A;  5FLX W;  2UXB H;  1DTJ A;  1S03 G;  1EC6 A;  2K1H A;  2LTL A;  3I0P A;  3QD7 X;  3JAM W;  3EZJ A;  3GKU A;  1XMQ H;  1N32 H;  2G8Y A;  2HH2 A;  4DV3 H;  4JI4 H;  2ANN A;  4IFD G;  2PQU A;  2BL5 A;  2CWF A;  3FAU A;  4AQY H;  1S20 A;  4JI6 H;  1NXU A;  4LFA H;  4NXM H;  4LFB H;  1ZZK A;  2JE6 I;  2VQE H;  2OPU A;  4X64 H;  2MJH A;  2M6Q A;  4G08 A;  3VKE A;  4DUZ H;  2CTJ A;  2CTL A;  1F0X A;  4NBQ A;  4PDB A;  4OO1 G;  4KHP H;  3T1H H;  2HH3 A;  5JEA G;  4E9J A;  4GKK H;  3SB1 A;  1HNX H;  2E3U A;  1MSZ A;  1WE8 A;  1UG8 A;  1J4W A;  2CTM A;  2UUA H;  3J7A K;  4NXN H;  2Y3M A;  5IWA H;  2ZM6 H;  4K0K H;  2E5L H;  4JYA H;  2CTF A;  2O4C A;  4GKJ H;  4LF8 H;  5BR8 H;  4DR2 H;  1N34 H;  3J80 W;  3OTO H;  4JVY A;  5LL6 b;  2QND A;  2HHH H;  4DV0 H;  1FKA H;  2UU9 H;  4BA2 I;  1HNZ H;  1VIH A;  4DV5 H;  4DR4 H;  2YQR A;  4WAL A;  3AEV B;  4DR6 H;  3OSS D;  4X66 H;  2ZQE A;  1N36 H;  4OCH A;  5A2Q W;  4QMF B;  2VQF H; 
#chains in the Genus database with same CATH homology
 2P2R A;  2HH3 A;  5JEA G;  1TUA A;  4AIM A;  3U1K A;  2E3U A;  4LIJ A;  1WE8 A;  2CTK A;  2CTE A;  2JZX A;  2FMR A;  2CTM A;  1X4M A;  3V69 A;  1J4W A;  1ZTG A;  2JA9 A;  2ANR A;  2JEB I;  4WAN A;  1DTJ A;  1VIG A;  4B8T A;  1EC6 A;  2OPV A;  5K36 G;  2CTF A;  2HH2 A;  2PY9 A;  2ANN A;  4IFD G;  2JVZ A;  5C0X G;  4BA1 I;  1J5K A;  2PQU A;  4JVY A;  2BL5 A;  2BA0 A;  2NN6 G;  2QND A;  1ZZI A;  3L7Z C;  4BA2 I;  1VIH A;  1K1G A;  1X4N A;  1ZZJ A;  1ZZK A;  2JE6 I;  2YQR A;  1WVN A;  2OPU A;  4WAL A;  1DT4 A;  2MJH A;  2Z0S A;  2JEA I;  3VKE A;  3AEV B;  2AXY A;  2DGR A;  2CTJ A;  2CTL A;  4NBQ A;  4AM3 A;  2CPQ A;  4JVH A;  4OO1 G;  4QMF B;  1KHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...