2HH2A

Solution structure of the fourth kh domain of ksrp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
b'GEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KH-type splicing regulatory protein
molecule tags Rna binding protein
source organism Homo sapiens
publication title The Structure of the C-Terminal KH Domains of KSRP Reveals a Noncanonical Motif Important for mRNA Degradation.
pubmed doi rcsb
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2hh2A00
2DGRA 5C0XG 2JVZA 2BA0A 4IFDG 3L7ZC 4WANA 2CTEA 2QNDA 2OPUA 3AEVB 3V69A 2HH2A 1ZZJA 2CTMA 1VIHA 2E3UA 4NBQA 4OO1G 5JEAG 2JA9A 1K1GA 2JEAI 2CTKA 2NN6G 4JVYA 4JVHA 1EC6A 5K36G 2CTFA 1TUAA 1J4WA 2AXYA 1WVNA 1DT4A 1DTJA 2JEBI 2PY9A 4LIJA 1KHMA 4BA1I 1X4MA 2CTJA 4B8TA 2ANRA 1WE8A 4QMFB 1VIGA 2OPVA 2YQRA 1J5KA 4BA2I 1ZZIA 2HH3A 2Z0SA 3VKEA 2CTLA 2CPQA 3U1KA 2FMRA 1ZTGA 2PQUA 1X4NA 2MJHA 2JE6I 4WALA 4AIMA 2BL5A 2ANNA 2P2RA 4AM3A 2JZXA 1ZZKA
chains in the Genus database with same CATH superfamily
2K1HA 5C0XG 4LF7H 4DV0H 3FAUA 1IBMH 3AEVB 4X66H 4GKKH 3GABA 5DT9A 2FFMA 4X65H 2E3UA 4NBQA 4OO1G 4H8AA 1I6UA 2F4VH 1VBIA 2JEAI 4JVHA 1TUAA 3RF2A 1J5EH 4DV4H 5BR8H 2HHHH 2FPHX 2LTMA 1AN7A 2CTJA 2LTLA 4OCHA 4JI8H 5A2QW 4PDBA 1HNXH 2HH3A 4JI2H 1ZTGA 4DV5H 4B3SH 4DR2H 2ANNA 1V8CA 3J80W 4LF4H 1XNQH 4AM3A 5IWAH 2DGRA 1FJGH 4JI7H 2LRRA 3UOEA 1N34H 4JI5H 4DUZH 4DV1H 4GKJH 1WTJA 1V9NA 2CTEA 2QNDA 2OPUA 1N36H 1FKAH 3OTOH 3GR5A 1HR0H 4DUYH 2UU9H 4NXMH 4YY3H 2VQEH 4NZRM 1HNZH 4DV3H 2CTKA 2UXBH 4JI3H 5K36G 1S03G 4LF6H 2CTFA 1WVNA 1DT4A 1Z2IA 4LFBH 4B3RH 4JV5H 4B8TA 2ANRA 1X9ZA 1VIGA 2OPVA 2YQRA 4DV7H 1J5KA 4DR6H 1N33H 4K0KH 2Z0SA 1S20A 3T1HH 5FLXW 3U1KA 4DV2H 2PQUA 5LMUH 3QD7X 2UXCH 4AIMA 3OSSD 2ZQEA 1XRHA 2JZXA 2E5LH 4DR3H 2CWFA 2O4CA 4JYAH 2BA0A 1ODHA 1IBKH 4JI1H 3I0PA 4LF8H 1UG8A 4DV6H 4JI0H 1ZZJA 2CTMA 2UUCH 1VIHA 2CWHA 5JEAG 4JVYA 1ZZKA 1J4WA 4B3MH 4X62H 2AXYA 2PY9A 1MSZA 1SEIA 2JEBI 4G08A 2UUAH 4LIJA 4OX9H 4DR1H 3NCVA 3J7AK 1X4MA 2VKCA 5LMNH 1N32H 4LF9H 3EZJA 1XMQH 4BA2I 4LFAH 1ZZIA 3VKEA 2CTLA 2G8YA 4KHPH 4B3TH 2CPMA 1X4NA 2MJHA 4WALA 2M6QA 2D9IA 3KDGA 2M8WA 4X64H 4YHHH 1EC6A 1IBLH 5IT9W 4FJUA 4OD6A 2UXDH 4IFDG 2VQFH 3L7ZC 4WANA 3JAMW 1PQXA 5LL6b 3V69A 2HH2A 4FJSA 2Y3MA 3SB1A 1F0XA 4B8CD 3GKUA 4EC5A 3J81W 1I94H 4DR4H 1WHRA 2JA9A 1K1GA 2NN6G 2LF0A 2PT7G 1DTJA 3OETA 2ZM6H 1XMOH 1KHMA 4BA1I 4AQYH 1WE8A 2X06A 4QMFB 4E9JA 4LF5H 4NZTM 4LFCH 4JI6H 2CPQA 1XNRH 1HNWH 2FMRA 4DR7H 4JI4H 2JE6I 2UUBH 4DR5H 4NXNH 1NXUA 1X0AA 2A1SA 2BL5A 3T1YH 2P2RA 2JVZA 3KDKA
chains in the Genus database with same CATH topology
2DGRA 5C0XG 2JVZA 2BA0A 4IFDG 3L7ZC 4WANA 2CTEA 2QNDA 2OPUA 3AEVB 3V69A 2HH2A 1ZZJA 2CTMA 1VIHA 2E3UA 4NBQA 4OO1G 5JEAG 2JA9A 1K1GA 2JEAI 2CTKA 2NN6G 4JVYA 4JVHA 1EC6A 5K36G 2CTFA 1TUAA 1J4WA 2AXYA 1WVNA 1DT4A 1DTJA 2JEBI 2PY9A 4LIJA 1KHMA 4BA1I 1X4MA 2CTJA 4B8TA 2ANRA 1WE8A 4QMFB 1VIGA 2OPVA 2YQRA 1J5KA 4BA2I 1ZZIA 2HH3A 2Z0SA 3VKEA 2CTLA 2CPQA 3U1KA 2FMRA 1ZTGA 2PQUA 1X4NA 2MJHA 2JE6I 4WALA 4AIMA 2BL5A 2ANNA 2P2RA 4AM3A 2JZXA 1ZZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGR A;  5C0X G;  2JVZ A;  2BA0 A;  4IFD G;  3L7Z C;  4WAN A;  2CTE A;  2QND A;  2OPU A;  3AEV B;  3V69 A;  2HH2 A;  1ZZJ A;  2CTM A;  1VIH A;  2E3U A;  4NBQ A;  4OO1 G;  5JEA G;  2JA9 A;  1K1G A;  2JEA I;  2CTK A;  2NN6 G;  4JVY A;  4JVH A;  1EC6 A;  5K36 G;  2CTF A;  1TUA A;  1J4W A;  2AXY A;  1WVN A;  1DT4 A;  1DTJ A;  2JEB I;  2PY9 A;  4LIJ A;  1KHM A;  4BA1 I;  1X4M A;  2CTJ A;  4B8T A;  2ANR A;  1WE8 A;  4QMF B;  1VIG A;  2OPV A;  2YQR A;  1J5K A;  4BA2 I;  1ZZI A;  2HH3 A;  2Z0S A;  3VKE A;  2CTL A;  2CPQ A;  3U1K A;  2FMR A;  1ZTG A;  2PQU A;  1X4N A;  2MJH A;  2JE6 I;  4WAL A;  4AIM A;  2BL5 A;  2ANN A;  2P2R A;  4AM3 A;  2JZX A;  1ZZK A; 
#chains in the Genus database with same CATH topology
 2K1H A;  5C0X G;  4LF7 H;  4DV0 H;  3FAU A;  1IBM H;  3AEV B;  4X66 H;  4GKK H;  3GAB A;  5DT9 A;  2FFM A;  4X65 H;  2E3U A;  4NBQ A;  4OO1 G;  4H8A A;  1I6U A;  2F4V H;  1VBI A;  2JEA I;  4JVH A;  1TUA A;  3RF2 A;  1J5E H;  4DV4 H;  5BR8 H;  2HHH H;  2FPH X;  2LTM A;  1AN7 A;  2CTJ A;  2LTL A;  4OCH A;  4JI8 H;  5A2Q W;  4PDB A;  1HNX H;  2HH3 A;  4JI2 H;  1ZTG A;  4DV5 H;  4B3S H;  4DR2 H;  2ANN A;  1V8C A;  3J80 W;  4LF4 H;  1XNQ H;  4AM3 A;  5IWA H;  2DGR A;  1FJG H;  4JI7 H;  2LRR A;  3UOE A;  1N34 H;  4JI5 H;  4DUZ H;  4DV1 H;  4GKJ H;  1WTJ A;  1V9N A;  2CTE A;  2QND A;  2OPU A;  1N36 H;  1FKA H;  3OTO H;  3GR5 A;  1HR0 H;  4DUY H;  2UU9 H;  4NXM H;  4YY3 H;  2VQE H;  4NZR M;  1HNZ H;  4DV3 H;  2CTK A;  2UXB H;  4JI3 H;  5K36 G;  1S03 G;  4LF6 H;  2CTF A;  1WVN A;  1DT4 A;  1Z2I A;  4LFB H;  4B3R H;  4JV5 H;  4B8T A;  2ANR A;  1X9Z A;  1VIG A;  2OPV A;  2YQR A;  4DV7 H;  1J5K A;  4DR6 H;  1N33 H;  4K0K H;  2Z0S A;  1S20 A;  3T1H H;  5FLX W;  3U1K A;  4DV2 H;  2PQU A;  5LMU H;  3QD7 X;  2UXC H;  4AIM A;  3OSS D;  2ZQE A;  1XRH A;  2JZX A;  2E5L H;  4DR3 H;  2CWF A;  2O4C A;  4JYA H;  2BA0 A;  1ODH A;  1IBK H;  4JI1 H;  3I0P A;  4LF8 H;  1UG8 A;  4DV6 H;  4JI0 H;  1ZZJ A;  2CTM A;  2UUC H;  1VIH A;  2CWH A;  5JEA G;  4JVY A;  1ZZK A;  1J4W A;  4B3M H;  4X62 H;  2AXY A;  2PY9 A;  1MSZ A;  1SEI A;  2JEB I;  4G08 A;  2UUA H;  4LIJ A;  4OX9 H;  4DR1 H;  3NCV A;  3J7A K;  1X4M A;  2VKC A;  5LMN H;  1N32 H;  4LF9 H;  3EZJ A;  1XMQ H;  4BA2 I;  4LFA H;  1ZZI A;  3VKE A;  2CTL A;  2G8Y A;  4KHP H;  4B3T H;  2CPM A;  1X4N A;  2MJH A;  4WAL A;  2M6Q A;  2D9I A;  3KDG A;  2M8W A;  4X64 H;  4YHH H;  1EC6 A;  1IBL H;  5IT9 W;  4FJU A;  4OD6 A;  2UXD H;  4IFD G;  2VQF H;  3L7Z C;  4WAN A;  3JAM W;  1PQX A;  5LL6 b;  3V69 A;  2HH2 A;  4FJS A;  2Y3M A;  3SB1 A;  1F0X A;  4B8C D;  3GKU A;  4EC5 A;  3J81 W;  1I94 H;  4DR4 H;  1WHR A;  2JA9 A;  1K1G A;  2NN6 G;  2LF0 A;  2PT7 G;  1DTJ A;  3OET A;  2ZM6 H;  1XMO H;  1KHM A;  4BA1 I;  4AQY H;  1WE8 A;  2X06 A;  4QMF B;  4E9J A;  4LF5 H;  4NZT M;  4LFC H;  4JI6 H;  2CPQ A;  1XNR H;  1HNW H;  2FMR A;  4DR7 H;  4JI4 H;  2JE6 I;  2UUB H;  4DR5 H;  4NXN H;  1NXU A;  1X0A A;  2A1S A;  2BL5 A;  3T1Y H;  2P2R A;  2JVZ A;  3KDK A; 
#chains in the Genus database with same CATH homology
 2DGR A;  5C0X G;  2JVZ A;  2BA0 A;  4IFD G;  3L7Z C;  4WAN A;  2CTE A;  2QND A;  2OPU A;  3AEV B;  3V69 A;  2HH2 A;  1ZZJ A;  2CTM A;  1VIH A;  2E3U A;  4NBQ A;  4OO1 G;  5JEA G;  2JA9 A;  1K1G A;  2JEA I;  2CTK A;  2NN6 G;  4JVY A;  4JVH A;  1EC6 A;  5K36 G;  2CTF A;  1TUA A;  1J4W A;  2AXY A;  1WVN A;  1DT4 A;  1DTJ A;  2JEB I;  2PY9 A;  4LIJ A;  1KHM A;  4BA1 I;  1X4M A;  2CTJ A;  4B8T A;  2ANR A;  1WE8 A;  4QMF B;  1VIG A;  2OPV A;  2YQR A;  1J5K A;  4BA2 I;  1ZZI A;  2HH3 A;  2Z0S A;  3VKE A;  2CTL A;  2CPQ A;  3U1K A;  2FMR A;  1ZTG A;  2PQU A;  1X4N A;  2MJH A;  2JE6 I;  4WAL A;  4AIM A;  2BL5 A;  2ANN A;  2P2R A;  4AM3 A;  2JZX A;  1ZZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...