2HHHM

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2hhhM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2hhhM02
1HR0M 1KFVA 3U6PA 4DV5M 4X65M 4JI1M 3JAMS 1L2CA 4NXNM 1Q3BA 1XMQM 4JI6M 4LFCM 3OTOM 1PJJA 3SARA 3GPPA 4JI3M 3TWKA 3J80S 4DR5M 2XZUA 5A2QS 4DV3M 1I94M 1XNQM 5ITRA 1J5EM 4JI5M 4NXMM 3SAUA 3GPUA 4PCZA 5BR8M 2VQEM 3SAWA 1N36M 2UUCM 1XNRM 2F5QA 4LF4M 1R2YA 4AQYM 2E5LM 3T1YM 3VK8A 1Z5AA 4GKJM 4JI2M 1Q39A 1HNXM 1TDHA 3GQ5A 1IBKM 2UU9M 4GKKM 2OPFA 4OX9M 1Z5CA 3T1HM 1R2ZA 1Z59A 4NRWA 3C58A 1TDZA 3U6LA 4DR4M 4PDIA 3U6EA 1XC8A 4PDGA 1Z5BA 4DV0M 4DUYM 3U6SA 4JI7M 2Q2EB 1PM5A 4LFAM 1MX0A 1L2DA 4G4OA 4JI4M 4DUZM 3TWMA 3A45A 3GQ4A 3J7AS 3GPXA 4JI8M 1L1TA 2UXDM 1N32M 2HKJA 3GP1A 1Q3CA 4DR7M 1FJGM 4B3MM 3U6QA 4LF9M 5ITQA 3SASA 3J81S 4LF7M 2UXBM 2UXCM 4JI0M 1HNZM 1L1ZA 4DV2M 3GPYA 1EE8A 1IBLM 4K0KM 3A42A 1PJIA 1NNJA 4DV7M 3SATA 5IT9S 4X66M 4LFBM 3W0FA 1N33M 3JR4A 2VQFM 4NRVA 3A46A 5ITUA 2OQ4A 4JV5M 3U6CA 2ZM6M 5LMUM 1MU5A 2EA0A 4G4RA 3TWLA 4DR3M 5IWAM 4ITQA 4LF8M 1HNWM 4B3RM 2HHHM 4YHHM 3SAVA 3SBJA 4X64M 2UUAM 2F5PA 3U6OA 1L2BA 5LMNM 4DR2M 5ITXA 2UUBM 5ITTA 4DR1M 4G4QA 1IBMM 5ITXE 4B3TM 3DOAA 4DR6M 2XZFA 5ITYA 1K3XA 4KHPM 4JYAM 4CISA 2F5SA 4X62M 3U6DA 2F5OA 3JR5A 4G4NA 3GQ3A 3VK7A 4LF5M 4MB7A 4DV4M 3GO8A 4PD2A 1N34M 2F5NA 1XMOM 1K3WA 4B3SM 2ZBKB 4LF6M 4DV6M 2F4VM 4DV1M 4YY3M 5FLXS 3U6MA 1K82A
chains in the Genus database with same CATH superfamily
3AKZA 4LJ7A 1HR0M 4LGMA 2CHQA 4FCTA 3KW6A 4MGKE 3J2PB 1UFZA 1WIVA 3MMPA 4WP2A 4JI1M 3JAMS 4GHAA 2Y0TA 1L2CA 2R46A 2R6FA 3OTOM 3HZJA 3VDPA 3FD9A 3TPZA 3I4YA 5KPTA 3M6AA 1PJTA 2N35A 5A2QS 4R71A 1G41A 2R44A 5ITRA 5C1BA 1L8QA 2BJWA 3FUWA 3IG5A 4QOSA 2DHRA 2VQEM 3DA1A 3SAWA 3GLGA 1N36M 2EKFA 3MJ5A 3KOZE 2WZJA 3U5ZA 2F5QA 2NQ8C 3T1YM 1DGGA 3VK8A 2H1RA 1DGBA 1IXZA 1TDHA 3KVWA 1E94E 8CATA 5FTLA 3GQ5A 3RFWA 4QHSA 2O01F 4GKKM 2CP8A 2LVNC 3K1JA 2K6BA 2C98A 1Z5CA 2JUJA 2XF3A 2OPFA 4IBJA 3T1HM 1JB0F 4R3DA 1R2ZA 3LCUA 4L6V6 1HT2E 4GIPA 2CRUA 3GLFE 2ERCA 4PDIA 1ZMWA 3B89A 3LQQA 4PDGA 1OFIA 4DV0M 2XFSA 4DUYM 3U6SA 4L8RC 4L16A 4CJ6A 2R18A 3HJSA 1NY6A 2DI0A 1GVNA 2R65A 3GLHB 3UK6A 1UM8A 1TR8A 1QVRA 4DUZM 3A45A 3J7AS 3GLHE 3THGA 4F2LA 2HCBA 3MK6A 1IXSB 1J09A 4NL4H 4QNRA 2BJVA 2MROB 4OVZB 2KNZA 4DR7M 1XXHA 3UJNA 1Q02A 3W68A 3ILKA 3VFDA 1VDDA 4FCWA 1X37A 4LF7M 2H5XA 4JI0M 2VDBB 3H4MA 1HNZM 1OJLA 1OQYA 1OIZA 1L1ZA 1GJTA 2DAGA 3KSXA 2EO2A 3KSJA 3E9SA 4IBEA 3U61B 1EE8A 3SMSA 1IBLM 4LRTA 1E9SA 3FUVA 3GLHA 3VKHA 3HU3A 4IBBA 3PVSA 3EIHA 3IHPA 4BBAA 3QYBA 1XWIA 4LFBM 4FWGA 2X4AA 4GEWA 2QBYA 2VQFM 1YE9A 1C1KA 5JI2E 2OQ4A 3I04M 4JV5M 1OFHA 1V33A 4DR3M 1Z6TA 4IBIA 4LF8M 4LJAA 2HWJA 3B74A 2HHHM 1T6OA 3SAVA 3K9PA 3HX3A 2LXEA 2R0IA 5E26A 5KQ8A 3SBJA 4I4LA 1E32A 3FYDA 1DO0A 3IECA 5ITXA 1ZQ9A 5EQTA 4R7GA 2DHYA 2KRUA 3FUTA 4M9SA 2QSFX 2DWLA 2MR9A 2DWNA 1BVSA 3SYLA 2OO9A 2LVPC 5JI3E 2KA6B 3U61A 4LJ8A 3DOAA 4B3TM 1SG9A 2KNAA 3FTCA 4KHPM 4CISA 4MGIE 4XBOA 3U6DA 4GHLA 1DGFA 4WURA 4D80A 1WGNA 1QAQA 2LVAA 4IBDA 3CTWB 3SFZA 3GO8A 1KYIA 4DV4M 1IY0A 2RGHA 3HGIA 3FE3A 1XMOM 2F5NA 2ZBKB 4DV6M 1CUKA 4XGIA 1NHGC 5FLXS 2MJ5B 1JR3A 2JWSA 2V6ZM 2XFTA 3HU1A 1D0LA 1SXJB 1QUTA 4EIWA 4DV5M 4X65M 2L09A 4KLNA 4MGHA 4NXNM 4LFCM 1XMQM 2Z4RA 1W5SA 1PJJA 3TE6A 1EIJA 1HQYE 2JY8A 3SARA 3B7ZA 4HEOA 3M7GA 2GNOA 2L2DA 4DV3M 2X49A 2KZUA 4RF0A 4JI5M 4NXMM 3SC3A 3SAUA 1I4WA 3GPUA 4PCZA 3I4VA 5BR8M 1GL6A 2CE7A 5FTMA 1D2NA 4AQYM 3C3EA 5IZ7D 1TGUA 1Q39A 2C9CA 4OW0A 2JY7A 5EXPA 1ZAEA 2LTUA 5DYGA 4S12A 4W5WA 2QHOB 1TH2A 3SHFA 5EP4A 3KOYE 1PJQA 4FD2A 3C58A 4P17A 1E9RA 2APLA 4FW9A 3HHZA 4DR4M 2LH0A 3QAUA 3J27B 2QQ8A 4I8OA 1XC8A 2X8AA 3FYCA 1NHWC 1Z5BA 2Q2EB 3I01M 2QCUA 1PM5A 4OVZA 4LG2A 3HHWA 3TWMA 1IM2A 1QANA 2JY5A 4A3VB 2DVWB 4JI8M 3KOXE 2KXEA 1YUBA 3HHXA 4REZA 1Q3CA 3AV0A 3LCVB 5EXTA 1QUSA 3NWLA 3U6QA 4B3MM 3NBIA 4B7GA 3SASA 3J81S 5EP3A 3SMPA 5EP2A 1W5TA 2LWXA 1HQCA 3K8ZA 4LJ9A 3DZDA 2JY6B 4AKIA 3EIEA 1VDLA 4LY6A 4K0KM 1ZV1A 1IN6A 2DZNB 2RKOA 4CHTB 2M60A 1YLAA 3LMMA 3KS8A 2ZTDA 1QYRA 3SATA 5IT9S 1QZMA 4HL4A 4CGYB 1QQWA 3K2LA 3VDUA 2XSZD 2YNMD 1TH4A 5IREB 3WHLA 2LBCA 5ITUA 3HU2A 3U6CA 2DENA 2ZM6M 2EA0A 2DWMA 3TWLA 4L78A 3PNVA 4G6ZA 2J7OA 4ITQA 3KFUG 1HNWM 2BNKA 1ZMUA 1IY2A 1JR3D 4X64M 4RF1A 2F5PA 1GKIA 4GITA 3U60B 3D8LA 2Z3XA 1L2BA 1PGYA 4QOZC 1GJSA 4IJEA 2CWBA 1QZEA 1RU3A 2FH0A 1DGHB 4DR1M 1IN7A 1FNNA 3GLIE 1IN4A 4RNAA 4NSOB 4DBGB 2GQFA 4B7FA 1IBMM 3L25A 5ITXE 4D81A 1IXSA 4JXJA 4DR6M 3QYEA 2XZFA 1DV0A 1XHBA 1NNUC 4IBKA 1VEKA 2F5OA 2EUCA 4G4NA 3CF6E 1OTRA 2QNJA 1N34M 4XK8F 1MN3A 3BOSA 4B3SM 4LJ4A 4LZZA 5F3WA 4MGZE 3RE8A 4DV1M 4GKJM 2QZ4A 4AG5A 1K82A 4GC9A 2EKKA 3FTDA 1R6BX 4FWDA 2HAKA 4IBGA 2C96A 2G3QA 3PXGA 3VKGA 3U60A 1T43A 2BWBA 5EXSA 1JR3E 1Q3BA 1VQ1A 4JI6M 2JA2A 1HJPA 2JZ0A 3GPPA 3FTEA 4JI3M 3ZQJA 2DWZB 3J80S 4DR5M 2XEPA 2XZUA 1I94M 2DAEA 4AKHA 1DO2A 2LHGA 2XGNA 5FSWA 3W67A 4ZPXA 4QHTA 1G59A 2VIIA 1JQJC 1SXJC 2UUCM 5FTNA 4B7HA 3UMMA 3GLGE 2KHHA 2A5YB 4P16A 2E5LM 1F4IA 2K9DA 1Z5AA 1NO1A 4JI2M 2FE8A 4GH9A 1IN5A 3LVWA 4D82A 3V76A 2FFJA 4OX9M 3HJQA 1NSFA 2KEBA 4NRWA 3QWLA 1KSFX 1TDZA 1IQPA 3A98B 3LVVA 1PJSA 1ZMVA 3PNYA 3U6LA 4M9XA 3U6EA 3GLFA 3ZCBB 4L4UA 4IJFA 2D7GA 2QP9X 4IBFA 4JI7M 5DFLA 4Z8XA 1Y8GA 3R9XB 2BWEA 2XLJA 1A5TA 2DKLA 4QNMA 5KQDA 1L1TA 5KO3A 2ZAOA 4B08A 2CV2A 1N32M 2UXDM 3GP1A 1XXHE 2Y21A 2W82A 3FUUA 3UGJA 2O5RA 3KXEC 2HL7A 4LF9M 3RGPA 2Z7JA 3SYKA 5ITQA 3AJIB 4TUWA 3FUXA 4M0DA 4RKUF 3W0LB 4AZFA 1EFUB 3T6PA 2CHVA 1IFYA 1TH3A 4LGYA 2L7HA 3GPYA 3IG8A 4KT0F 3L29A 5KPRA 3A42A 1QDRA 3L27A 5H37D 3HJ8A 1QDTA 1NNJA 3U5ZB 3J7BA 4CIZA 4GRIA 3C3DA 2Y20A 4X66M 5EXXA 3CGWA 1N33M 3A46A 4NRVA 2WSEF 3RGSA 1NJFA 5LMUM 1MU5A 2L4FA 2Y0QA 7CATA 3B7QA 4OU7A 1VEGA 4FVMA 4IIWA 4KO8A 2KW0A 4ANRA 4YHHM 2C5RA 1WJ7A 1WGLA 3U6OA 2DAIA 4G3OA 5LMNM 2K0BX 2LVOC 4FWHA 3Q8XA 2UUBM 3GLIB 2JNHA 4F1IA 4MM3B 4IBCA 2ZAMA 3E21A 4G4QA 1R4GA 3H4JA 2CEAA 2DAMA 3B9PA 2V1UA 4NOOB 1C7YA 1QAMA 3AOEC 1PRBA 4KODA 1IXRC 2JP7A 3D8BA 4AG6A 3AOGA 1XB2B 5DYIA 2R4JA 4I81A 2DNAA 3K9OA 4X62M 2F5SA 2LNHC 1LV7A 1XXHB 3JR5A 4JN6A 1NY5A 4UN2B 3VK7A 4Z6YA 1ORYB 4LJ5A 4MB7A 5GKNA 4LF5M 4PD2A 4AI6A 3CF2A 2K47A 3I51A 1L2DA 1VEJA 1V92A 2C99A 2P5TA 4BLCA 2OOAA 3GLGB 1DGHA 4NSRA 2LVQD 2R4EA 1KFVA 3U6PA 1TF0B 4I5SA 1V34A 3UZUA 3FRHA 2CFOA 4GMQA 4Q7JA 2FOIC 3F92A 1OAIA 3GLIA 4AKGA 1G71A 2L7IA 3KP0E 3TWKA 1WXQA 1HT1E 2MH8A 3K92A 5EJCA 2ZANA 3BBZA 2DXIA 3T15A 5BPVA 1XNQM 1G4AE 1J5EM 3FKEA 2AHMA 3L2AA 3E46A 1N78A 1D0MA 2XSZA 3HY5A 3LW5F 4LRSA 3PFIA 1XNRM 1J7KA 2D7HA 1NV9A 4WW0A 1LTMA 3AOEA 1R2YA 5DNYA 4PT5A 4LF4M 2G8LA 3L26A 2OOBA 2R45A 2RGOA 1HNXM 1IBKM 2UU9M 2V1CA 2YQZA 2QENA 3SHGB 1IY1A 1SXJA 3WHKA 2R62A 2VF8A 5E6JA 2FS1A 1Z59A 1YSYA 2DZOB 3Q8GA 4II7A 4MH0E 1H6UA 2I7PA 3R8FA 2CHGA 2CUZA 2CV1A 3C9PA 1GO5A 3ZC7B 3E4RA 2D7EA 4L15A 1G8PA 1VG5A 2B3TA 2Z8YM 4LFAM 2RRUA 1MX0A 4JI4M 5L8RF 1AIPC 4G4OA 4LCBA 2FNAA 1NV8A 3GQ4A 4NC6A 3GPXA 1SXJE 2HKJA 2VF7A 2I7NA 2CV0A 1N75A 1OIPA 4M9ZA 4Y28F 2J7NA 2QPAA 2Z4SA 3BXWA 1S3SA 4HLQA 3T38A 1GL7A 1FJGM 2EJSA 2YR0A 1OAOC 2UXBM 2UXCM 3ZH9B 1GLNA 3GLFB 5FTKA 2KRKA 4BB9A 2M5ZA 4DV2M 3FTFA 3AFHA 2L6OA 3GRYA 3HWSA 1TTEA 3GRRA 2LHCA 2ZTCA 1PJIA 1OKSA 2WSCF 3GRVA 1WHCA 3FRIA 3HHYA 4DV7M 1GABA 2KDLA 3KS4A 3NBXX 3W0FA 4MGYE 2JXNA 3JR4A 1WR1B 1QAOA 2DAKA 1IN8A 2JZ1A 2C9OA 3CF0A 2KNVA 3KP1E 4G4RA 2L4EA 5IWAM 5EP1A 1G3IA 4GC5A 4B3RM 1P3QQ 1N77A 4FCVA 3KDSE 3MHVC 2UUAM 1NVMA 4AW4A 3DFZA 4DR2M 1SXJD 1R5LA 3GRUA 2WSFF 3B7NA 1NJGA 2MGWA 2XH9A 3M0EA 3TL4X 2O25A 2J5YA 5KPZA 5ITTA 2QBYB 1D0KA 5FTJA 5ITYA 4LJ6A 1K3XA 2G5GX 3AL0C 4JYAM 1R7RA 4LZJA 1MJGM 3LQRA 3TQSA 3VLFB 3GQ3A 2YFQA 5C18A 2KZSA 1K3WA 2F4VM 4LF6M 3HKPA 3KOWE 2DZLA 1AUAA 3L28A 4YY3M 3U6MA 1T3TA 4M0WA
chains in the Genus database with same CATH topology
3AKZA 4LJ7A 1HR0M 4LGMA 2CHQA 4FCTA 3KW6A 4MGKE 3J2PB 4JI1M 3JAMS 4GHAA 2Y0TA 1L2CA 2R46A 3OTOM 3VDPA 3FD9A 3TPZA 3I4YA 5KPTA 3M6AA 5A2QS 1G41A 5ITRA 5C1BA 1L8QA 2BJWA 3FUWA 3IG5A 4QOSA 2DHRA 2VQEM 3DA1A 3SAWA 3GLGA 1N36M 3MJ5A 3KOZE 3U5ZA 2F5QA 2NQ8C 3T1YM 1DGGA 3VK8A 2H1RA 1DGBA 1IXZA 1TDHA 3KVWA 1E94E 8CATA 5FTLA 3GQ5A 3RFWA 4QHSA 4GKKM 3K1JA 2OPFA 2C98A 1Z5CA 2XF3A 3T1HM 4IBJA 1R2ZA 4R3DA 1HT2E 4GIPA 2ERCA 4PDIA 3LQQA 4PDGA 1OFIA 4DV0M 2XFSA 4DUYM 3U6SA 4L8RC 4L16A 2R18A 3HJSA 1NY6A 3UK6A 1GVNA 2R65A 3GLHB 1UM8A 1QVRA 4DUZM 3A45A 3J7AS 3THGA 2HCBA 3MK6A 1IXSB 1J09A 4NL4H 4QNRA 2BJVA 4OVZB 4DR7M 1XXHA 3UJNA 3ILKA 3VFDA 1VDDA 4FCWA 1X37A 4LF7M 4JI0M 3H4MA 1HNZM 1OJLA 1L1ZA 3KSXA 2EO2A 3KSJA 3E9SA 4IBEA 3U61B 1EE8A 3SMSA 1IBLM 4LRTA 1E9SA 3FUVA 3GLHA 3VKHA 3HU3A 4IBBA 3PVSA 3EIHA 4BBAA 1XWIA 4LFBM 4FWGA 2X4AA 2QBYA 2VQFM 1YE9A 1C1KA 5JI2E 2OQ4A 4JV5M 1OFHA 4DR3M 1Z6TA 4IBIA 4LF8M 4LJAA 2HHHM 3SAVA 3SBJA 5E26A 2LXEA 5KQ8A 4I4LA 1E32A 3FYDA 1DO0A 5ITXA 1ZQ9A 5EQTA 4R7GA 2KRUA 3FUTA 4M9SA 2DWLA 2DWNA 3SYLA 5JI3E 2KA6B 3U61A 4LJ8A 3DOAA 4B3TM 3FTCA 4KHPM 4CISA 4MGIE 4XBOA 3U6DA 4GHLA 1DGFA 4WURA 4D80A 1QAQA 4IBDA 3CTWB 3SFZA 3GO8A 1KYIA 4DV4M 1IY0A 2RGHA 3HGIA 1XMOM 2F5NA 2ZBKB 4DV6M 4XGIA 1NHGC 5FLXS 1JR3A 2V6ZM 2XFTA 3HU1A 1SXJB 4EIWA 4DV5M 4X65M 2L09A 4KLNA 4MGHA 4NXNM 4LFCM 1XMQM 2Z4RA 1W5SA 1PJJA 3TE6A 1HQYE 3SARA 3M7GA 4DV3M 2X49A 2KZUA 4RF0A 4JI5M 4NXMM 3SC3A 3SAUA 1I4WA 3GPUA 4PCZA 3I4VA 5BR8M 1GL6A 2CE7A 5FTMA 1D2NA 4AQYM 5IZ7D 1TGUA 1Q39A 2C9CA 4OW0A 5EXPA 1ZAEA 5DYGA 4S12A 4W5WA 1TH2A 3SHFA 5EP4A 3KOYE 4FD2A 3C58A 1E9RA 4FW9A 3HHZA 4DR4M 2LH0A 3QAUA 3J27B 4I8OA 1XC8A 2X8AA 3FYCA 1NHWC 1Z5BA 2Q2EB 2QCUA 1PM5A 4OVZA 4LG2A 3HHWA 3TWMA 1IM2A 1QANA 4A3VB 2DVWB 4JI8M 3KOXE 2KXEA 1YUBA 3HHXA 4REZA 1Q3CA 3AV0A 5EXTA 3NWLA 3U6QA 4B3MM 3NBIA 4B7GA 3SASA 3J81S 5EP3A 3SMPA 5EP2A 1W5TA 2LWXA 1HQCA 3K8ZA 4LJ9A 3DZDA 4AKIA 3EIEA 4LY6A 4K0KM 1IN6A 2DZNB 2RKOA 4CHTB 2M60A 3KS8A 3LMMA 3SATA 1QYRA 5IT9S 1QZMA 4HL4A 4CGYB 1QQWA 3K2LA 3VDUA 2XSZD 2YNMD 1TH4A 5IREB 3WHLA 5ITUA 3HU2A 3U6CA 2ZM6M 2EA0A 2DWMA 3TWLA 4L78A 3PNVA 4G6ZA 2J7OA 4ITQA 3KFUG 1HNWM 2BNKA 1IY2A 1JR3D 4X64M 4RF1A 2F5PA 1GKIA 4GITA 3U60B 3D8LA 2Z3XA 1L2BA 4QOZC 4IJEA 1DGHB 4DR1M 1IN7A 1FNNA 1IN4A 4RNAA 4NSOB 1IBMM 4B7FA 3L25A 5ITXE 4D81A 4JXJA 4DR6M 2XZFA 1XHBA 1NNUC 4IBKA 2F5OA 2EUCA 4G4NA 3CF6E 1N34M 3BOSA 4B3SM 4LJ4A 4LZZA 5F3WA 4MGZE 3RE8A 4DV1M 4GKJM 2QZ4A 4AG5A 1K82A 4GC9A 3FTDA 1R6BX 4FWDA 4IBGA 3PXGA 2C96A 3VKGA 3U60A 5EXSA 1Q3BA 4JI6M 2JA2A 3GPPA 3FTEA 4JI3M 2DWZB 3J80S 4DR5M 2XEPA 2XZUA 1I94M 4AKHA 1DO2A 2XGNA 5FSWA 4ZPXA 4QHTA 1G59A 2VIIA 1JQJC 1SXJC 2UUCM 5FTNA 4B7HA 3UMMA 2A5YB 4P16A 2E5LM 1Z5AA 4JI2M 2FE8A 4GH9A 1IN5A 3LVWA 4D82A 2FFJA 4OX9M 3HJQA 1NSFA 2KEBA 4NRWA 3QWLA 1KSFX 1TDZA 1IQPA 3A98B 3LVVA 3PNYA 3U6LA 4M9XA 3U6EA 3GLFA 3ZCBB 4L4UA 4IJFA 2D7GA 2QP9X 4IBFA 4JI7M 4Z8XA 3R9XB 2XLJA 4QNMA 5KQDA 1L1TA 5KO3A 2ZAOA 4B08A 2CV2A 1N32M 2UXDM 3GP1A 2Y21A 2W82A 3FUUA 3UGJA 2O5RA 3KXEC 2HL7A 4LF9M 3RGPA 2Z7JA 3SYKA 5ITQA 3AJIB 4TUWA 3FUXA 4M0DA 3W0LB 4AZFA 2CHVA 1TH3A 4LGYA 2L7HA 3GPYA 3IG8A 3L29A 5KPRA 3A42A 3L27A 5H37D 3HJ8A 1NNJA 3U5ZB 3J7BA 4GRIA 2Y20A 4X66M 5EXXA 1N33M 3A46A 4NRVA 3RGSA 1NJFA 5LMUM 1MU5A 2Y0QA 7CATA 4OU7A 4FVMA 4IIWA 4KO8A 2KW0A 4YHHM 2C5RA 3U6OA 5LMNM 4FWHA 3Q8XA 2UUBM 3GLIB 4MM3B 4IBCA 2ZAMA 4G4QA 2CEAA 3B9PA 2V1UA 4NOOB 1QAMA 3AOEC 4KODA 1IXRC 3D8BA 4AG6A 3AOGA 5DYIA 2R4JA 4I81A 2F5SA 4X62M 2LNHC 1LV7A 1XXHB 3JR5A 4JN6A 1NY5A 3VK7A 4Z6YA 1ORYB 4LJ5A 4MB7A 5GKNA 4LF5M 4PD2A 4AI6A 3CF2A 2K47A 3I51A 1L2DA 2C99A 2P5TA 4BLCA 3GLGB 1DGHA 4NSRA 2R4EA 1KFVA 3U6PA 4I5SA 3UZUA 4GMQA 2CFOA 2FOIC 3GLIA 4AKGA 2L7IA 3KP0E 3TWKA 1WXQA 1HT1E 3K92A 5EJCA 2ZANA 2DXIA 3T15A 5BPVA 1XNQM 1G4AE 1J5EM 3FKEA 2AHMA 3L2AA 1N78A 2XSZA 4LRSA 3PFIA 1XNRM 1J7KA 2D7HA 4WW0A 3AOEA 1R2YA 5DNYA 4PT5A 4LF4M 2G8LA 3L26A 2R45A 2RGOA 1HNXM 1IBKM 2UU9M 2V1CA 2YQZA 2QENA 3SHGB 1IY1A 1SXJA 3WHKA 2R62A 5E6JA 1Z59A 1YSYA 2DZOB 4MH0E 4II7A 1H6UA 2I7PA 3R8FA 2CHGA 2CUZA 2CV1A 3ZC7B 3E4RA 2D7EA 4L15A 1G8PA 4LFAM 1MX0A 4JI4M 4G4OA 4LCBA 2FNAA 3GQ4A 3GPXA 1SXJE 2HKJA 2CV0A 2I7NA 1N75A 4M9ZA 2J7NA 2QPAA 2Z4SA 4HLQA 1S3SA 3T38A 1FJGM 1GL7A 2YR0A 2UXBM 2UXCM 3ZH9B 1GLNA 3GLFB 5FTKA 2KRKA 4BB9A 2M5ZA 4DV2M 3FTFA 3AFHA 2L6OA 3GRYA 3HWSA 3GRRA 1PJIA 3GRVA 3HHYA 4DV7M 3KS4A 3W0FA 4MGYE 3JR4A 1QAOA 1IN8A 2C9OA 3CF0A 4G4RA 3KP1E 5IWAM 5EP1A 1G3IA 4GC5A 4B3RM 1N77A 4FCVA 3KDSE 3MHVC 2UUAM 1NVMA 4AW4A 3DFZA 4DR2M 1SXJD 3GRUA 3TL4X 1NJGA 2XH9A 3M0EA 5KPZA 5ITTA 2QBYB 5FTJA 5ITYA 4LJ6A 1K3XA 2G5GX 3AL0C 4JYAM 1R7RA 4LZJA 3LQRA 3TQSA 3VLFB 3GQ3A 2YFQA 5C18A 2KZSA 1K3WA 2F4VM 4LF6M 3HKPA 3KOWE 3L28A 4YY3M 3U6MA 1T3TA 4M0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 M;  1KFV A;  3U6P A;  4DV5 M;  4X65 M;  4JI1 M;  3JAM S;  1L2C A;  4NXN M;  1Q3B A;  1XMQ M;  4JI6 M;  4LFC M;  3OTO M;  1PJJ A;  3SAR A;  3GPP A;  4JI3 M;  3TWK A;  3J80 S;  4DR5 M;  2XZU A;  5A2Q S;  4DV3 M;  1I94 M;  1XNQ M;  5ITR A;  1J5E M;  4JI5 M;  4NXM M;  3SAU A;  3GPU A;  4PCZ A;  5BR8 M;  2VQE M;  3SAW A;  1N36 M;  2UUC M;  1XNR M;  2F5Q A;  4LF4 M;  1R2Y A;  4AQY M;  2E5L M;  3T1Y M;  3VK8 A;  1Z5A A;  4GKJ M;  4JI2 M;  1Q39 A;  1HNX M;  1TDH A;  3GQ5 A;  1IBK M;  2UU9 M;  4GKK M;  2OPF A;  4OX9 M;  1Z5C A;  3T1H M;  1R2Z A;  1Z59 A;  4NRW A;  3C58 A;  1TDZ A;  3U6L A;  4DR4 M;  4PDI A;  3U6E A;  1XC8 A;  4PDG A;  1Z5B A;  4DV0 M;  4DUY M;  3U6S A;  4JI7 M;  2Q2E B;  1PM5 A;  4LFA M;  1MX0 A;  1L2D A;  4G4O A;  4JI4 M;  4DUZ M;  3TWM A;  3A45 A;  3GQ4 A;  3J7A S;  3GPX A;  4JI8 M;  1L1T A;  2UXD M;  1N32 M;  2HKJ A;  3GP1 A;  1Q3C A;  4DR7 M;  1FJG M;  4B3M M;  3U6Q A;  4LF9 M;  5ITQ A;  3SAS A;  3J81 S;  4LF7 M;  2UXB M;  2UXC M;  4JI0 M;  1HNZ M;  1L1Z A;  4DV2 M;  3GPY A;  1EE8 A;  1IBL M;  4K0K M;  3A42 A;  1PJI A;  1NNJ A;  4DV7 M;  3SAT A;  5IT9 S;  4X66 M;  4LFB M;  3W0F A;  1N33 M;  3JR4 A;  2VQF M;  4NRV A;  3A46 A;  5ITU A;  2OQ4 A;  4JV5 M;  3U6C A;  2ZM6 M;  5LMU M;  1MU5 A;  2EA0 A;  4G4R A;  3TWL A;  4DR3 M;  5IWA M;  4ITQ A;  4LF8 M;  1HNW M;  4B3R M;  2HHH M;  4YHH M;  3SAV A;  3SBJ A;  4X64 M;  2UUA M;  2F5P A;  3U6O A;  1L2B A;  5LMN M;  4DR2 M;  5ITX A;  2UUB M;  5ITT A;  4DR1 M;  4G4Q A;  1IBM M;  5ITX E;  4B3T M;  3DOA A;  4DR6 M;  2XZF A;  5ITY A;  1K3X A;  4KHP M;  4JYA M;  4CIS A;  2F5S A;  4X62 M;  3U6D A;  2F5O A;  3JR5 A;  4G4N A;  3GQ3 A;  3VK7 A;  4LF5 M;  4MB7 A;  4DV4 M;  3GO8 A;  4PD2 A;  1N34 M;  2F5N A;  1XMO M;  1K3W A;  4B3S M;  2ZBK B;  4LF6 M;  4DV6 M;  2F4V M;  4DV1 M;  4YY3 M;  5FLX S;  3U6M A;  1K82 A; 
#chains in the Genus database with same CATH topology
 3AKZ A;  4LJ7 A;  1HR0 M;  4LGM A;  2CHQ A;  4FCT A;  3KW6 A;  4MGK E;  3J2P B;  1UFZ A;  1WIV A;  3MMP A;  4WP2 A;  4JI1 M;  3JAM S;  4GHA A;  2Y0T A;  1L2C A;  2R46 A;  2R6F A;  3OTO M;  3HZJ A;  3VDP A;  3FD9 A;  3TPZ A;  3I4Y A;  5KPT A;  3M6A A;  1PJT A;  2N35 A;  5A2Q S;  4R71 A;  1G41 A;  2R44 A;  5ITR A;  5C1B A;  1L8Q A;  2BJW A;  3FUW A;  3IG5 A;  4QOS A;  2DHR A;  2VQE M;  3DA1 A;  3SAW A;  3GLG A;  1N36 M;  2EKF A;  3MJ5 A;  3KOZ E;  2WZJ A;  3U5Z A;  2F5Q A;  2NQ8 C;  3T1Y M;  1DGG A;  3VK8 A;  2H1R A;  1DGB A;  1IXZ A;  1TDH A;  3KVW A;  1E94 E;  8CAT A;  5FTL A;  3GQ5 A;  3RFW A;  4QHS A;  2O01 F;  4GKK M;  2CP8 A;  2LVN C;  3K1J A;  2K6B A;  2C98 A;  1Z5C A;  2JUJ A;  2XF3 A;  2OPF A;  4IBJ A;  3T1H M;  1JB0 F;  4R3D A;  1R2Z A;  3LCU A;  4L6V 6;  1HT2 E;  4GIP A;  2CRU A;  3GLF E;  2ERC A;  4PDI A;  1ZMW A;  3B89 A;  3LQQ A;  4PDG A;  1OFI A;  4DV0 M;  2XFS A;  4DUY M;  3U6S A;  4L8R C;  4L16 A;  4CJ6 A;  2R18 A;  3HJS A;  1NY6 A;  2DI0 A;  1GVN A;  2R65 A;  3GLH B;  3UK6 A;  1UM8 A;  1TR8 A;  1QVR A;  4DUZ M;  3A45 A;  3J7A S;  3GLH E;  3THG A;  4F2L A;  2HCB A;  3MK6 A;  1IXS B;  1J09 A;  4NL4 H;  4QNR A;  2BJV A;  2MRO B;  4OVZ B;  2KNZ A;  4DR7 M;  1XXH A;  3UJN A;  1Q02 A;  3W68 A;  3ILK A;  3VFD A;  1VDD A;  4FCW A;  1X37 A;  4LF7 M;  2H5X A;  4JI0 M;  2VDB B;  3H4M A;  1HNZ M;  1OJL A;  1OQY A;  1OIZ A;  1L1Z A;  1GJT A;  2DAG A;  3KSX A;  2EO2 A;  3KSJ A;  3E9S A;  4IBE A;  3U61 B;  1EE8 A;  3SMS A;  1IBL M;  4LRT A;  1E9S A;  3FUV A;  3GLH A;  3VKH A;  3HU3 A;  4IBB A;  3PVS A;  3EIH A;  3IHP A;  4BBA A;  3QYB A;  1XWI A;  4LFB M;  4FWG A;  2X4A A;  4GEW A;  2QBY A;  2VQF M;  1YE9 A;  1C1K A;  5JI2 E;  2OQ4 A;  3I04 M;  4JV5 M;  1OFH A;  1V33 A;  4DR3 M;  1Z6T A;  4IBI A;  4LF8 M;  4LJA A;  2HWJ A;  3B74 A;  2HHH M;  1T6O A;  3SAV A;  3K9P A;  3HX3 A;  2LXE A;  2R0I A;  5E26 A;  5KQ8 A;  3SBJ A;  4I4L A;  1E32 A;  3FYD A;  1DO0 A;  3IEC A;  5ITX A;  1ZQ9 A;  5EQT A;  4R7G A;  2DHY A;  2KRU A;  3FUT A;  4M9S A;  2QSF X;  2DWL A;  2MR9 A;  2DWN A;  1BVS A;  3SYL A;  2OO9 A;  2LVP C;  5JI3 E;  2KA6 B;  3U61 A;  4LJ8 A;  3DOA A;  4B3T M;  1SG9 A;  2KNA A;  3FTC A;  4KHP M;  4CIS A;  4MGI E;  4XBO A;  3U6D A;  4GHL A;  1DGF A;  4WUR A;  4D80 A;  1WGN A;  1QAQ A;  2LVA A;  4IBD A;  3CTW B;  3SFZ A;  3GO8 A;  1KYI A;  4DV4 M;  1IY0 A;  2RGH A;  3HGI A;  3FE3 A;  1XMO M;  2F5N A;  2ZBK B;  4DV6 M;  1CUK A;  4XGI A;  1NHG C;  5FLX S;  2MJ5 B;  1JR3 A;  2JWS A;  2V6Z M;  2XFT A;  3HU1 A;  1D0L A;  1SXJ B;  1QUT A;  4EIW A;  4DV5 M;  4X65 M;  2L09 A;  4KLN A;  4MGH A;  4NXN M;  4LFC M;  1XMQ M;  2Z4R A;  1W5S A;  1PJJ A;  3TE6 A;  1EIJ A;  1HQY E;  2JY8 A;  3SAR A;  3B7Z A;  4HEO A;  3M7G A;  2GNO A;  2L2D A;  4DV3 M;  2X49 A;  2KZU A;  4RF0 A;  4JI5 M;  4NXM M;  3SC3 A;  3SAU A;  1I4W A;  3GPU A;  4PCZ A;  3I4V A;  5BR8 M;  1GL6 A;  2CE7 A;  5FTM A;  1D2N A;  4AQY M;  3C3E A;  5IZ7 D;  1TGU A;  1Q39 A;  2C9C A;  4OW0 A;  2JY7 A;  5EXP A;  1ZAE A;  2LTU A;  5DYG A;  4S12 A;  4W5W A;  2QHO B;  1TH2 A;  3SHF A;  5EP4 A;  3KOY E;  1PJQ A;  4FD2 A;  3C58 A;  4P17 A;  1E9R A;  2APL A;  4FW9 A;  3HHZ A;  4DR4 M;  2LH0 A;  3QAU A;  3J27 B;  2QQ8 A;  4I8O A;  1XC8 A;  2X8A A;  3FYC A;  1NHW C;  1Z5B A;  2Q2E B;  3I01 M;  2QCU A;  1PM5 A;  4OVZ A;  4LG2 A;  3HHW A;  3TWM A;  1IM2 A;  1QAN A;  2JY5 A;  4A3V B;  2DVW B;  4JI8 M;  3KOX E;  2KXE A;  1YUB A;  3HHX A;  4REZ A;  1Q3C A;  3AV0 A;  3LCV B;  5EXT A;  1QUS A;  3NWL A;  3U6Q A;  4B3M M;  3NBI A;  4B7G A;  3SAS A;  3J81 S;  5EP3 A;  3SMP A;  5EP2 A;  1W5T A;  2LWX A;  1HQC A;  3K8Z A;  4LJ9 A;  3DZD A;  2JY6 B;  4AKI A;  3EIE A;  1VDL A;  4LY6 A;  4K0K M;  1ZV1 A;  1IN6 A;  2DZN B;  2RKO A;  4CHT B;  2M60 A;  1YLA A;  3LMM A;  3KS8 A;  2ZTD A;  1QYR A;  3SAT A;  5IT9 S;  1QZM A;  4HL4 A;  4CGY B;  1QQW A;  3K2L A;  3VDU A;  2XSZ D;  2YNM D;  1TH4 A;  5IRE B;  3WHL A;  2LBC A;  5ITU A;  3HU2 A;  3U6C A;  2DEN A;  2ZM6 M;  2EA0 A;  2DWM A;  3TWL A;  4L78 A;  3PNV A;  4G6Z A;  2J7O A;  4ITQ A;  3KFU G;  1HNW M;  2BNK A;  1ZMU A;  1IY2 A;  1JR3 D;  4X64 M;  4RF1 A;  2F5P A;  1GKI A;  4GIT A;  3U60 B;  3D8L A;  2Z3X A;  1L2B A;  1PGY A;  4QOZ C;  1GJS A;  4IJE A;  2CWB A;  1QZE A;  1RU3 A;  2FH0 A;  1DGH B;  4DR1 M;  1IN7 A;  1FNN A;  3GLI E;  1IN4 A;  4RNA A;  4NSO B;  4DBG B;  2GQF A;  4B7F A;  1IBM M;  3L25 A;  5ITX E;  4D81 A;  1IXS A;  4JXJ A;  4DR6 M;  3QYE A;  2XZF A;  1DV0 A;  1XHB A;  1NNU C;  4IBK A;  1VEK A;  2F5O A;  2EUC A;  4G4N A;  3CF6 E;  1OTR A;  2QNJ A;  1N34 M;  4XK8 F;  1MN3 A;  3BOS A;  4B3S M;  4LJ4 A;  4LZZ A;  5F3W A;  4MGZ E;  3RE8 A;  4DV1 M;  4GKJ M;  2QZ4 A;  4AG5 A;  1K82 A;  4GC9 A;  2EKK A;  3FTD A;  1R6B X;  4FWD A;  2HAK A;  4IBG A;  2C96 A;  2G3Q A;  3PXG A;  3VKG A;  3U60 A;  1T43 A;  2BWB A;  5EXS A;  1JR3 E;  1Q3B A;  1VQ1 A;  4JI6 M;  2JA2 A;  1HJP A;  2JZ0 A;  3GPP A;  3FTE A;  4JI3 M;  3ZQJ A;  2DWZ B;  3J80 S;  4DR5 M;  2XEP A;  2XZU A;  1I94 M;  2DAE A;  4AKH A;  1DO2 A;  2LHG A;  2XGN A;  5FSW A;  3W67 A;  4ZPX A;  4QHT A;  1G59 A;  2VII A;  1JQJ C;  1SXJ C;  2UUC M;  5FTN A;  4B7H A;  3UMM A;  3GLG E;  2KHH A;  2A5Y B;  4P16 A;  2E5L M;  1F4I A;  2K9D A;  1Z5A A;  1NO1 A;  4JI2 M;  2FE8 A;  4GH9 A;  1IN5 A;  3LVW A;  4D82 A;  3V76 A;  2FFJ A;  4OX9 M;  3HJQ A;  1NSF A;  2KEB A;  4NRW A;  3QWL A;  1KSF X;  1TDZ A;  1IQP A;  3A98 B;  3LVV A;  1PJS A;  1ZMV A;  3PNY A;  3U6L A;  4M9X A;  3U6E A;  3GLF A;  3ZCB B;  4L4U A;  4IJF A;  2D7G A;  2QP9 X;  4IBF A;  4JI7 M;  5DFL A;  4Z8X A;  1Y8G A;  3R9X B;  2BWE A;  2XLJ A;  1A5T A;  2DKL A;  4QNM A;  5KQD A;  1L1T A;  5KO3 A;  2ZAO A;  4B08 A;  2CV2 A;  1N32 M;  2UXD M;  3GP1 A;  1XXH E;  2Y21 A;  2W82 A;  3FUU A;  3UGJ A;  2O5R A;  3KXE C;  2HL7 A;  4LF9 M;  3RGP A;  2Z7J A;  3SYK A;  5ITQ A;  3AJI B;  4TUW A;  3FUX A;  4M0D A;  4RKU F;  3W0L B;  4AZF A;  1EFU B;  3T6P A;  2CHV A;  1IFY A;  1TH3 A;  4LGY A;  2L7H A;  3GPY A;  3IG8 A;  4KT0 F;  3L29 A;  5KPR A;  3A42 A;  1QDR A;  3L27 A;  5H37 D;  3HJ8 A;  1QDT A;  1NNJ A;  3U5Z B;  3J7B A;  4CIZ A;  4GRI A;  3C3D A;  2Y20 A;  4X66 M;  5EXX A;  3CGW A;  1N33 M;  3A46 A;  4NRV A;  2WSE F;  3RGS A;  1NJF A;  5LMU M;  1MU5 A;  2L4F A;  2Y0Q A;  7CAT A;  3B7Q A;  4OU7 A;  1VEG A;  4FVM A;  4IIW A;  4KO8 A;  2KW0 A;  4ANR A;  4YHH M;  2C5R A;  1WJ7 A;  1WGL A;  3U6O A;  2DAI A;  4G3O A;  5LMN M;  2K0B X;  2LVO C;  4FWH A;  3Q8X A;  2UUB M;  3GLI B;  2JNH A;  4F1I A;  4MM3 B;  4IBC A;  2ZAM A;  3E21 A;  4G4Q A;  1R4G A;  3H4J A;  2CEA A;  2DAM A;  3B9P A;  2V1U A;  4NOO B;  1C7Y A;  1QAM A;  3AOE C;  1PRB A;  4KOD A;  1IXR C;  2JP7 A;  3D8B A;  4AG6 A;  3AOG A;  1XB2 B;  5DYI A;  2R4J A;  4I81 A;  2DNA A;  3K9O A;  4X62 M;  2F5S A;  2LNH C;  1LV7 A;  1XXH B;  3JR5 A;  4JN6 A;  1NY5 A;  4UN2 B;  3VK7 A;  4Z6Y A;  1ORY B;  4LJ5 A;  4MB7 A;  5GKN A;  4LF5 M;  4PD2 A;  4AI6 A;  3CF2 A;  2K47 A;  3I51 A;  1L2D A;  1VEJ A;  1V92 A;  2C99 A;  2P5T A;  4BLC A;  2OOA A;  3GLG B;  1DGH A;  4NSR A;  2LVQ D;  2R4E A;  1KFV A;  3U6P A;  1TF0 B;  4I5S A;  1V34 A;  3UZU A;  3FRH A;  2CFO A;  4GMQ A;  4Q7J A;  2FOI C;  3F92 A;  1OAI A;  3GLI A;  4AKG A;  1G71 A;  2L7I A;  3KP0 E;  3TWK A;  1WXQ A;  1HT1 E;  2MH8 A;  3K92 A;  5EJC A;  2ZAN A;  3BBZ A;  2DXI A;  3T15 A;  5BPV A;  1XNQ M;  1G4A E;  1J5E M;  3FKE A;  2AHM A;  3L2A A;  3E46 A;  1N78 A;  1D0M A;  2XSZ A;  3HY5 A;  3LW5 F;  4LRS A;  3PFI A;  1XNR M;  1J7K A;  2D7H A;  1NV9 A;  4WW0 A;  1LTM A;  3AOE A;  1R2Y A;  5DNY A;  4PT5 A;  4LF4 M;  2G8L A;  3L26 A;  2OOB A;  2R45 A;  2RGO A;  1HNX M;  1IBK M;  2UU9 M;  2V1C A;  2YQZ A;  2QEN A;  3SHG B;  1IY1 A;  1SXJ A;  3WHK A;  2R62 A;  2VF8 A;  5E6J A;  2FS1 A;  1Z59 A;  1YSY A;  2DZO B;  3Q8G A;  4II7 A;  4MH0 E;  1H6U A;  2I7P A;  3R8F A;  2CHG A;  2CUZ A;  2CV1 A;  3C9P A;  1GO5 A;  3ZC7 B;  3E4R A;  2D7E A;  4L15 A;  1G8P A;  1VG5 A;  2B3T A;  2Z8Y M;  4LFA M;  2RRU A;  1MX0 A;  4JI4 M;  5L8R F;  1AIP C;  4G4O A;  4LCB A;  2FNA A;  1NV8 A;  3GQ4 A;  4NC6 A;  3GPX A;  1SXJ E;  2HKJ A;  2VF7 A;  2I7N A;  2CV0 A;  1N75 A;  1OIP A;  4M9Z A;  4Y28 F;  2J7N A;  2QPA A;  2Z4S A;  3BXW A;  1S3S A;  4HLQ A;  3T38 A;  1GL7 A;  1FJG M;  2EJS A;  2YR0 A;  1OAO C;  2UXB M;  2UXC M;  3ZH9 B;  1GLN A;  3GLF B;  5FTK A;  2KRK A;  4BB9 A;  2M5Z A;  4DV2 M;  3FTF A;  3AFH A;  2L6O A;  3GRY A;  3HWS A;  1TTE A;  3GRR A;  2LHC A;  2ZTC A;  1PJI A;  1OKS A;  2WSC F;  3GRV A;  1WHC A;  3FRI A;  3HHY A;  4DV7 M;  1GAB A;  2KDL A;  3KS4 A;  3NBX X;  3W0F A;  4MGY E;  2JXN A;  3JR4 A;  1WR1 B;  1QAO A;  2DAK A;  1IN8 A;  2JZ1 A;  2C9O A;  3CF0 A;  2KNV A;  3KP1 E;  4G4R A;  2L4E A;  5IWA M;  5EP1 A;  1G3I A;  4GC5 A;  4B3R M;  1P3Q Q;  1N77 A;  4FCV A;  3KDS E;  3MHV C;  2UUA M;  1NVM A;  4AW4 A;  3DFZ A;  4DR2 M;  1SXJ D;  1R5L A;  3GRU A;  2WSF F;  3B7N A;  1NJG A;  2MGW A;  2XH9 A;  3M0E A;  3TL4 X;  2O25 A;  2J5Y A;  5KPZ A;  5ITT A;  2QBY B;  1D0K A;  5FTJ A;  5ITY A;  4LJ6 A;  1K3X A;  2G5G X;  3AL0 C;  4JYA M;  1R7R A;  4LZJ A;  1MJG M;  3LQR A;  3TQS A;  3VLF B;  3GQ3 A;  2YFQ A;  5C18 A;  2KZS A;  1K3W A;  2F4V M;  4LF6 M;  3HKP A;  3KOW E;  2DZL A;  1AUA A;  3L28 A;  4YY3 M;  3U6M A;  1T3T A;  4M0W A; 
#chains in the Genus database with same CATH homology
 3AKZ A;  4LJ7 A;  1HR0 M;  4LGM A;  2CHQ A;  4FCT A;  3KW6 A;  4MGK E;  3J2P B;  4JI1 M;  3JAM S;  4GHA A;  2Y0T A;  1L2C A;  2R46 A;  3OTO M;  3VDP A;  3FD9 A;  3TPZ A;  3I4Y A;  5KPT A;  3M6A A;  5A2Q S;  1G41 A;  5ITR A;  5C1B A;  1L8Q A;  2BJW A;  3FUW A;  3IG5 A;  4QOS A;  2DHR A;  2VQE M;  3DA1 A;  3SAW A;  3GLG A;  1N36 M;  3MJ5 A;  3KOZ E;  3U5Z A;  2F5Q A;  2NQ8 C;  3T1Y M;  1DGG A;  3VK8 A;  2H1R A;  1DGB A;  1IXZ A;  1TDH A;  3KVW A;  1E94 E;  8CAT A;  5FTL A;  3GQ5 A;  3RFW A;  4QHS A;  4GKK M;  3K1J A;  2OPF A;  2C98 A;  1Z5C A;  2XF3 A;  3T1H M;  4IBJ A;  1R2Z A;  4R3D A;  1HT2 E;  4GIP A;  2ERC A;  4PDI A;  3LQQ A;  4PDG A;  1OFI A;  4DV0 M;  2XFS A;  4DUY M;  3U6S A;  4L8R C;  4L16 A;  2R18 A;  3HJS A;  1NY6 A;  3UK6 A;  1GVN A;  2R65 A;  3GLH B;  1UM8 A;  1QVR A;  4DUZ M;  3A45 A;  3J7A S;  3THG A;  2HCB A;  3MK6 A;  1IXS B;  1J09 A;  4NL4 H;  4QNR A;  2BJV A;  4OVZ B;  4DR7 M;  1XXH A;  3UJN A;  3ILK A;  3VFD A;  1VDD A;  4FCW A;  1X37 A;  4LF7 M;  4JI0 M;  3H4M A;  1HNZ M;  1OJL A;  1L1Z A;  3KSX A;  2EO2 A;  3KSJ A;  3E9S A;  4IBE A;  3U61 B;  1EE8 A;  3SMS A;  1IBL M;  4LRT A;  1E9S A;  3FUV A;  3GLH A;  3VKH A;  3HU3 A;  4IBB A;  3PVS A;  3EIH A;  4BBA A;  1XWI A;  4LFB M;  4FWG A;  2X4A A;  2QBY A;  2VQF M;  1YE9 A;  1C1K A;  5JI2 E;  2OQ4 A;  4JV5 M;  1OFH A;  4DR3 M;  1Z6T A;  4IBI A;  4LF8 M;  4LJA A;  2HHH M;  3SAV A;  3SBJ A;  5E26 A;  2LXE A;  5KQ8 A;  4I4L A;  1E32 A;  3FYD A;  1DO0 A;  5ITX A;  1ZQ9 A;  5EQT A;  4R7G A;  2KRU A;  3FUT A;  4M9S A;  2DWL A;  2DWN A;  3SYL A;  5JI3 E;  2KA6 B;  3U61 A;  4LJ8 A;  3DOA A;  4B3T M;  3FTC A;  4KHP M;  4CIS A;  4MGI E;  4XBO A;  3U6D A;  4GHL A;  1DGF A;  4WUR A;  4D80 A;  1QAQ A;  4IBD A;  3CTW B;  3SFZ A;  3GO8 A;  1KYI A;  4DV4 M;  1IY0 A;  2RGH A;  3HGI A;  1XMO M;  2F5N A;  2ZBK B;  4DV6 M;  4XGI A;  1NHG C;  5FLX S;  1JR3 A;  2V6Z M;  2XFT A;  3HU1 A;  1SXJ B;  4EIW A;  4DV5 M;  4X65 M;  2L09 A;  4KLN A;  4MGH A;  4NXN M;  4LFC M;  1XMQ M;  2Z4R A;  1W5S A;  1PJJ A;  3TE6 A;  1HQY E;  3SAR A;  3M7G A;  4DV3 M;  2X49 A;  2KZU A;  4RF0 A;  4JI5 M;  4NXM M;  3SC3 A;  3SAU A;  1I4W A;  3GPU A;  4PCZ A;  3I4V A;  5BR8 M;  1GL6 A;  2CE7 A;  5FTM A;  1D2N A;  4AQY M;  5IZ7 D;  1TGU A;  1Q39 A;  2C9C A;  4OW0 A;  5EXP A;  1ZAE A;  5DYG A;  4S12 A;  4W5W A;  1TH2 A;  3SHF A;  5EP4 A;  3KOY E;  4FD2 A;  3C58 A;  1E9R A;  4FW9 A;  3HHZ A;  4DR4 M;  2LH0 A;  3QAU A;  3J27 B;  4I8O A;  1XC8 A;  2X8A A;  3FYC A;  1NHW C;  1Z5B A;  2Q2E B;  2QCU A;  1PM5 A;  4OVZ A;  4LG2 A;  3HHW A;  3TWM A;  1IM2 A;  1QAN A;  4A3V B;  2DVW B;  4JI8 M;  3KOX E;  2KXE A;  1YUB A;  3HHX A;  4REZ A;  1Q3C A;  3AV0 A;  5EXT A;  3NWL A;  3U6Q A;  4B3M M;  3NBI A;  4B7G A;  3SAS A;  3J81 S;  5EP3 A;  3SMP A;  5EP2 A;  1W5T A;  2LWX A;  1HQC A;  3K8Z A;  4LJ9 A;  3DZD A;  4AKI A;  3EIE A;  4LY6 A;  4K0K M;  1IN6 A;  2DZN B;  2RKO A;  4CHT B;  2M60 A;  3KS8 A;  3LMM A;  3SAT A;  1QYR A;  5IT9 S;  1QZM A;  4HL4 A;  4CGY B;  1QQW A;  3K2L A;  3VDU A;  2XSZ D;  2YNM D;  1TH4 A;  5IRE B;  3WHL A;  5ITU A;  3HU2 A;  3U6C A;  2ZM6 M;  2EA0 A;  2DWM A;  3TWL A;  4L78 A;  3PNV A;  4G6Z A;  2J7O A;  4ITQ A;  3KFU G;  1HNW M;  2BNK A;  1IY2 A;  1JR3 D;  4X64 M;  4RF1 A;  2F5P A;  1GKI A;  4GIT A;  3U60 B;  3D8L A;  2Z3X A;  1L2B A;  4QOZ C;  4IJE A;  1DGH B;  4DR1 M;  1IN7 A;  1FNN A;  1IN4 A;  4RNA A;  4NSO B;  1IBM M;  4B7F A;  3L25 A;  5ITX E;  4D81 A;  4JXJ A;  4DR6 M;  2XZF A;  1XHB A;  1NNU C;  4IBK A;  2F5O A;  2EUC A;  4G4N A;  3CF6 E;  1N34 M;  3BOS A;  4B3S M;  4LJ4 A;  4LZZ A;  5F3W A;  4MGZ E;  3RE8 A;  4DV1 M;  4GKJ M;  2QZ4 A;  4AG5 A;  1K82 A;  4GC9 A;  3FTD A;  1R6B X;  4FWD A;  4IBG A;  3PXG A;  2C96 A;  3VKG A;  3U60 A;  5EXS A;  1Q3B A;  4JI6 M;  2JA2 A;  3GPP A;  3FTE A;  4JI3 M;  2DWZ B;  3J80 S;  4DR5 M;  2XEP A;  2XZU A;  1I94 M;  4AKH A;  1DO2 A;  2XGN A;  5FSW A;  4ZPX A;  4QHT A;  1G59 A;  2VII A;  1JQJ C;  1SXJ C;  2UUC M;  5FTN A;  4B7H A;  3UMM A;  2A5Y B;  4P16 A;  2E5L M;  1Z5A A;  4JI2 M;  2FE8 A;  4GH9 A;  1IN5 A;  3LVW A;  4D82 A;  2FFJ A;  4OX9 M;  3HJQ A;  1NSF A;  2KEB A;  4NRW A;  3QWL A;  1KSF X;  1TDZ A;  1IQP A;  3A98 B;  3LVV A;  3PNY A;  3U6L A;  4M9X A;  3U6E A;  3GLF A;  3ZCB B;  4L4U A;  4IJF A;  2D7G A;  2QP9 X;  4IBF A;  4JI7 M;  4Z8X A;  3R9X B;  2XLJ A;  4QNM A;  5KQD A;  1L1T A;  5KO3 A;  2ZAO A;  4B08 A;  2CV2 A;  1N32 M;  2UXD M;  3GP1 A;  2Y21 A;  2W82 A;  3FUU A;  3UGJ A;  2O5R A;  3KXE C;  2HL7 A;  4LF9 M;  3RGP A;  2Z7J A;  3SYK A;  5ITQ A;  3AJI B;  4TUW A;  3FUX A;  4M0D A;  3W0L B;  4AZF A;  2CHV A;  1TH3 A;  4LGY A;  2L7H A;  3GPY A;  3IG8 A;  3L29 A;  5KPR A;  3A42 A;  3L27 A;  5H37 D;  3HJ8 A;  1NNJ A;  3U5Z B;  3J7B A;  4GRI A;  2Y20 A;  4X66 M;  5EXX A;  1N33 M;  3A46 A;  4NRV A;  3RGS A;  1NJF A;  5LMU M;  1MU5 A;  2Y0Q A;  7CAT A;  4OU7 A;  4FVM A;  4IIW A;  4KO8 A;  2KW0 A;  4YHH M;  2C5R A;  3U6O A;  5LMN M;  4FWH A;  3Q8X A;  2UUB M;  3GLI B;  4MM3 B;  4IBC A;  2ZAM A;  4G4Q A;  2CEA A;  3B9P A;  2V1U A;  4NOO B;  1QAM A;  3AOE C;  4KOD A;  1IXR C;  3D8B A;  4AG6 A;  3AOG A;  5DYI A;  2R4J A;  4I81 A;  2F5S A;  4X62 M;  2LNH C;  1LV7 A;  1XXH B;  3JR5 A;  4JN6 A;  1NY5 A;  3VK7 A;  4Z6Y A;  1ORY B;  4LJ5 A;  4MB7 A;  5GKN A;  4LF5 M;  4PD2 A;  4AI6 A;  3CF2 A;  2K47 A;  3I51 A;  1L2D A;  2C99 A;  2P5T A;  4BLC A;  3GLG B;  1DGH A;  4NSR A;  2R4E A;  1KFV A;  3U6P A;  4I5S A;  3UZU A;  4GMQ A;  2CFO A;  2FOI C;  3GLI A;  4AKG A;  2L7I A;  3KP0 E;  3TWK A;  1WXQ A;  1HT1 E;  3K92 A;  5EJC A;  2ZAN A;  2DXI A;  3T15 A;  5BPV A;  1XNQ M;  1G4A E;  1J5E M;  3FKE A;  2AHM A;  3L2A A;  1N78 A;  2XSZ A;  4LRS A;  3PFI A;  1XNR M;  1J7K A;  2D7H A;  4WW0 A;  3AOE A;  1R2Y A;  5DNY A;  4PT5 A;  4LF4 M;  2G8L A;  3L26 A;  2R45 A;  2RGO A;  1HNX M;  1IBK M;  2UU9 M;  2V1C A;  2YQZ A;  2QEN A;  3SHG B;  1IY1 A;  1SXJ A;  3WHK A;  2R62 A;  5E6J A;  1Z59 A;  1YSY A;  2DZO B;  4MH0 E;  4II7 A;  1H6U A;  2I7P A;  3R8F A;  2CHG A;  2CUZ A;  2CV1 A;  3ZC7 B;  3E4R A;  2D7E A;  4L15 A;  1G8P A;  4LFA M;  1MX0 A;  4JI4 M;  4G4O A;  4LCB A;  2FNA A;  3GQ4 A;  3GPX A;  1SXJ E;  2HKJ A;  2CV0 A;  2I7N A;  1N75 A;  4M9Z A;  2J7N A;  2QPA A;  2Z4S A;  4HLQ A;  1S3S A;  3T38 A;  1FJG M;  1GL7 A;  2YR0 A;  2UXB M;  2UXC M;  3ZH9 B;  1GLN A;  3GLF B;  5FTK A;  2KRK A;  4BB9 A;  2M5Z A;  4DV2 M;  3FTF A;  3AFH A;  2L6O A;  3GRY A;  3HWS A;  3GRR A;  1PJI A;  3GRV A;  3HHY A;  4DV7 M;  3KS4 A;  3W0F A;  4MGY E;  3JR4 A;  1QAO A;  1IN8 A;  2C9O A;  3CF0 A;  4G4R A;  3KP1 E;  5IWA M;  5EP1 A;  1G3I A;  4GC5 A;  4B3R M;  1N77 A;  4FCV A;  3KDS E;  3MHV C;  2UUA M;  1NVM A;  4AW4 A;  3DFZ A;  4DR2 M;  1SXJ D;  3GRU A;  3TL4 X;  1NJG A;  2XH9 A;  3M0E A;  5KPZ A;  5ITT A;  2QBY B;  5FTJ A;  5ITY A;  4LJ6 A;  1K3X A;  2G5G X;  3AL0 C;  4JYA M;  1R7R A;  4LZJ A;  3LQR A;  3TQS A;  3VLF B;  3GQ3 A;  2YFQ A;  5C18 A;  2KZS A;  1K3W A;  2F4V M;  4LF6 M;  3HKP A;  3KOW E;  3L28 A;  4YY3 M;  3U6M A;  1T3T A;  4M0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...