2HHHM

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2hhhM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2hhhM02
5ITQA 4DR2M 3J81S 1TDHA 3SARA 4JI4M 1HR0M 1HNZM 4JI6M 4JI1M 3JR5A 4DV3M 4G4NA 4NXMM 3VK8A 1Q3BA 4JI5M 3U6LA 3GQ3A 1J5EM 3SBJA 4G4QA 1R2ZA 5ITUA 1N32M 4JI0M 4PDGA 3GQ5A 2UUCM 2HKJA 4DV6M 1KFVA 3U6EA 3GPYA 1PJJA 3A46A 1L2CA 2F5SA 3J7AS 4X65M 2F5QA 4JYAM 3SAWA 4KHPM 1XMQM 3SASA 2ZM6M 1XNRM 4CISA 2UU9M 3W0FA 4JI2M 2XZFA 2UUAM 1N36M 1HNWM 1PJIA 4DV5M 4K0KM 1N33M 2F4VM 4DR5M 3VK7A 3U6QA 4LF9M 1K3WA 4LFBM 5BR8M 3SAUA 4DR4M 1Z5CA 4DR1M 1IBLM 1K3XA 3U6SA 3A42A 4DUZM 1PM5A 1Z59A 4AQYM 3GP1A 3J80S 3GPUA 1HNXM 2UUBM 4OX9M 4DV7M 1I94M 4LF6M 4YHHM 4G4RA 3U6PA 2VQFM 5IWAM 1XC8A 4DV2M 4ITQA 1Z5BA 4YY3M 5ITTA 5FLXS 3OTOM 4PCZA 4NRVA 1Z5AA 4JI3M 3T1HM 2XZUA 2VQEM 4JI7M 4LF7M 4MB7A 2EA0A 3C58A 4LF8M 3T1YM 1N34M 1IBMM 4JV5M 3DOAA 4NXNM 3SATA 2HHHM 4PD2A 4LFAM 3U6CA 4DR6M 2Q2EB 1R2YA 2UXBM 1L2BA 4X66M 4B3SM 3TWMA 4G4OA 2ZBKB 2E5LM 3GPPA 3JR4A 1MX0A 3TWLA 1L1TA 2F5PA 4NRWA 5ITYA 4X62M 4GKJM 2UXDM 3GO8A 5IT9S 4X64M 5ITXE 3TWKA 4GKKM 4DV4M 3GQ4A 2OQ4A 4JI8M 1K82A 2F5NA 3U6OA 1MU5A 1NNJA 1Q39A 3JAMS 5ITXA 2OPFA 1TDZA 3A45A 4LF4M 3GPXA 5ITRA 5A2QS 4DR3M 3U6DA 4B3MM 1Q3CA 4DV0M 3U6MA 2UXCM 1XMOM 1L2DA 4LF5M 1IBKM 2F5OA 4LFCM 4B3RM 4PDIA 1EE8A 4B3TM 4DR7M 1FJGM 1XNQM 5LMNM 4DUYM 3SAVA 4DV1M 1L1ZA 5LMUM
chains in the Genus database with same CATH superfamily
5ITQA 1GABA 1SG9A 1G59A 2LVPC 4OW0A 1JB0F 4LJ6A 3SARA 4IBJA 4WP2A 2FOIC 3ZH9B 3WHLA 3SMPA 1PJSA 3HJ8A 4A3VB 3PFIA 3NBIA 3KSJA 4GC9A 1QUSA 3DA1A 2I7PA 4D82A 1HT1E 4B7HA 4JI5M 3U6LA 1GL7A 1NHGC 3B7QA 5FTJA 2LNHC 4G4QA 1HT2E 5ITUA 4FWDA 3M7GA 2WZJA 4RF0A 4MH0E 5IREB 1T3TA 2CEAA 1HQCA 3FUXA 5EP2A 1KYIA 1CUKA 3IG5A 3A46A 2J5YA 1IN5A 2QHOB 1TTEA 2XLJA 2QP9X 1J7KA 3SAWA 3SASA 2KZUA 4GH9A 4G6ZA 2CV2A 2KA6B 3W0FA 1SXJE 3ZQJA 2FE8A 3U60B 2L4FA 2KRUA 3AFHA 2UUAM 1N36M 5FTMA 1N33M 1TR8A 2CP8A 2EJSA 4XGIA 1G3IA 2F4VM 3VK7A 5JI3E 3I51A 3GLHA 3W68A 3RGSA 2JY5A 4ZPXA 2ERCA 4NSOB 1IBLM 1K3XA 2RRUA 2J7NA 3M6AA 1PM5A 2R62A 2I7NA 2YNMD 3LCVB 2JZ1A 3J80S 2R18A 2ZTDA 1IY2A 3FTDA 3CF6E 4LRSA 4IJEA 1G71A 3AOEA 1N75A 4NOOB 2ZAMA 4DV2M 1JR3A 4BLCA 2C9CA 2JY8A 1DGFA 3H4MA 4WURA 3LVWA 4NRVA 1GL6A 3TL4X 1ZMWA 3L29A 4KODA 1DO2A 1WGLA 2ZTCA 4MB7A 3LW5F 2KZSA 1PGYA 3TE6A 4OVZA 1WIVA 4II7A 3U61A 4MGHA 2C96A 3KP1E 3T6PA 1DV0A 5KPTA 5FSWA 1L2BA 3NWLA 2D7GA 3L28A 3PNVA 3L25A 1XHBA 3GLHB 4L8RC 1PJQA 2KRKA 2WSFF 2ZBKB 3UZUA 2CV0A 1WXQA 1R6BX 1NSFA 5EJCA 1HQYE 3FYDA 2CHGA 3AV0A 4X64M 1MN3A 1RU3A 3EIEA 1OTRA 3LMMA 1JR3D 3QWLA 4FW9A 2JY6B 1VEGA 1DGBA 4DV4M 5BPVA 3FUWA 4D81A 4Y28F 1NNUC 3NBXX 2JXNA 3JAMS 2HL7A 3HU2A 4IBBA 5DNYA 1IN4A 3MJ5A 4LGMA 3GPXA 4DR3M 3B74A 2Z7JA 4DV0M 4GHLA 1OIZA 3E4RA 2UXCM 3GLGB 1L2DA 1TH3A 4I81A 1EIJA 2DAGA 4MGIE 2QZ4A 1EE8A 4HLQA 2R45A 3K9OA 4B3TM 4D80A 4REZA 3FRIA 4OVZB 1FJGM 1D2NA 4NSRA 4DV1M 5LMUM 4JI6M 3U61B 2KNVA 2M5ZA 1H6UA 1TH2A 3LCUA 4DR2M 3J81S 1P3QQ 1VEJA 4LY6A 3SYLA 4MM3B 4RKUF 5KPRA 4QNMA 1VQ1A 4EIWA 2KEBA 4JI1M 1N78A 1QDRA 1I4WA 1IN6A 3T15A 4G4NA 5DFLA 3L27A 2P5TA 2XF3A 1XB2B 3GRVA 2BJVA 2OO9A 2XSZA 3E46A 3I04M 3KOXE 1OFIA 2L2DA 1IXSA 2R65A 1TH4A 3UK6A 4JI0M 3FYCA 3B9PA 3LVVA 2HKJA 1KFVA 2R4EA 1QAQA 2MJ5B 3GPYA 2K9DA 4LJ8A 4HEOA 1NVMA 3VDUA 3KSXA 1QAMA 3KOZE 2MGWA 1XXHB 4RF1A 2CHVA 1IM2A 3AJIB 2F5SA 3L26A 1W5SA 3FUTA 1XMQM 4JN6A 5L8RF 1N77A 3EIHA 4FCTA 3KW6A 1VG5A 1PJIA 1HNWM 2Y0QA 2K6BA 4DV5M 4CJ6A 2DWNA 1OAIA 2L4EA 4DR5M 2DZOB 3U6QA 2KXEA 2L6OA 2ZAOA 3CF2A 3GRUA 2RGOA 5KPZA 2DAKA 2X4AA 3J7BA 3MMPA 3VKGA 4AQYM 2XSZD 2LWXA 1UFZA 2FH0A 2LTUA 1HNXM 2DWZB 2KW0A 3E9SA 1Q02A 2H5XA 4LJ4A 4M9XA 1D0MA 3HX3A 1I94M 1C1KA 2VQFM 3U6PA 2DWLA 1IXSB 4ITQA 1V92A 4F2LA 5ITTA 1IQPA 1NJFA 2RGHA 4PCZA 3UGJA 4IIWA 5EP3A 2CWBA 3Q8XA 1G41A 2BWEA 2JWSA 1E9RA 4JI7M 4LF7M 2DHYA 3HJQA 8CATA 4QOZC 3RE8A 5FTNA 2FFJA 4JV5M 1VEKA 2QCUA 3SATA 2BWBA 2QPAA 2JP7A 4PD2A 4LFAM 2G5GX 3GLIA 3SHGB 4FWGA 1R2YA 4AKIA 3HHYA 4B3SM 1QZEA 4IJFA 4TUWA 3TWLA 2F5PA 4NRWA 4X62M 2DZLA 5IT9S 4UN2B 2KHHA 2DNAA 4GRIA 3GQ4A 1S3SA 1YE9A 1HJPA 3CF0A 4CIZA 2EKFA 1MU5A 3J27B 3U6OA 1NNJA 2JY7A 1D0LA 1G8PA 1NY5A 2JA2A 4S12A 1KSFX 4RNAA 5ITXA 3KS8A 4GEWA 3U6DA 3F92A 2WSCF 1SXJC 3HGIA 4QHTA 1ZQ9A 2R44A 1FNNA 1XMOM 1D0KA 4L78A 1IBKM 4M0WA 2F5OA 4LFCM 3ZC7B 3PXGA 1OKSA 3GLFA 3FUVA 2HCBA 4DUYM 1L1ZA 2OOAA 3B7ZA 5E6JA 2DENA 3GLIB 3SMSA 1QZMA 1ZMUA 4CGYB 1AIPC 3THGA 1TDHA 4JI4M 1PRBA 4AKGA 2G8LA 3HHXA 3K9PA 3L2AA 2L7IA 3MHVC 1HNZM 3AL0C 4R7GA 4AI6A 5KQDA 1ORYB 3JR5A 4IBGA 4XK8F 4LJ9A 2R0IA 1W5TA 4JXJA 4FVMA 3VK8A 1Q3BA 2C9OA 1TGUA 2QSFX 4I4LA 5KQ8A 1J5EM 1IY1A 5GKNA 3VKHA 2CE7A 4KO8A 4PDGA 3GQ5A 2AHMA 5E26A 2Z4SA 4BBAA 3U6EA 2FNAA 1PJJA 2KDLA 2C5RA 4GMQA 2GQFA 3LQRA 4L16A 2D7EA 4KHPM 3FRHA 5FTKA 2ZM6M 1BVSA 3PVSA 4CISA 3KOWE 4GIPA 2Y21A 3QAUA 1E9SA 1AUAA 4KLNA 2XZFA 3GLFB 4K0KM 3W67A 2K0BX 2LVAA 3RFWA 4I5SA 1E94E 4LF9M 1A5TA 1OAOC 1SXJA 1WJ7A 1ZMVA 1TF0B 2O01F 3IECA 2JUJA 5KO3A 5BR8M 3B89A 3SAUA 1F4IA 1R5LA 4DR1M 2YR0A 2LBCA 2N35A 3HZJA 1OQYA 1ZV1A 3HHZA 1QAOA 3D8LA 2CUZA 5JI2E 4L15A 2DVWB 2WSEF 1DGHA 3SFZA 4YHHM 3W0LB 4MGYE 5IWAM 3GLGE 5EQTA 3HHWA 1XC8A 4L6V6 2MR9A 1VDDA 1Z5BA 2LH0A 3DFZA 1NHWC 3IHPA 3HU3A 4IBDA 1GJSA 1WHCA 1NJGA 3B7NA 3K2LA 1VDLA 3T1HM 2XZUA 1DGGA 2L09A 1C7YA 2VQEM 3KS4A 3DZDA 5EXSA 5C18A 2V1CA 2G3QA 3FD9A 3LQQA 4P17A 4LCBA 2EA0A 2R4JA 2LXEA 1V34A 3C58A 3T1YM 3K92A 1N34M 1IBMM 4LF8M 5EXPA 1SXJD 3DOAA 1LTMA 2C98A 4AKHA 3D8BA 1L2CA 4M9SA 3WHKA 4GHAA 2M60A 1Y8GA 2UXBM 4X66M 3CGWA 4WW0A 1SXJB 2DAIA 2GNOA 2XEPA 3AOGA 3SC3A 1MJGM 2J7OA 3BBZA 4CHTB 1IY0A 4G4OA 2E5LM 3KOYE 1MX0A 1J09A 2Z8YM 1QDTA 2UXDM 3AOEC 4KT0F 5EXTA 1QQWA 1YUBA 3HJSA 4B7GA 4FCWA 3R9XB 4IBFA 4Z6YA 1DGHB 5EXXA 7CATA 2XGNA 1K82A 3I4VA 2F5NA 4LJ5A 1XXHE 1GLNA 1NO1A 1QYRA 4FCVA 3R8FA 3GRYA 1TDZA 1YLAA 3GRRA 2A5YB 4LF4M 2R46A 5A2QS 2QBYA 5IZ7D 1IN8A 4B3MM 1Q3CA 3ZCBB 2DAEA 2MROB 4MGZE 4LF5M 2X49A 2LVQD 2LVOC 1DO0A 1QVRA 2CHQA 3BOSA 1GKIA 4XBOA 3FTEA 2XFSA 4FWHA 4PDIA 2CV1A 3E21A 1UM8A 3BXWA 4DR7M 2LHGA 3IG8A 5LMNM 3TQSA 3FTCA 1GVNA 2OOBA 2QENA 4I8OA 3PNYA 3I4YA 3U5ZA 3FTFA 2X8AA 3VLFB 4P16A 3H4JA 1HR0M 3MK6A 2XFTA 3HKPA 4DV3M 4AZFA 1YSYA 4NXMM 4IBEA 2HWJA 4QOSA 2RKOA 3UJNA 4LJ7A 3GQ3A 1LV7A 2DAMA 3VDPA 3AKZA 3SBJA 3V76A 4Z8XA 1R2ZA 1N32M 1R4GA 3KDSE 2UUCM 4FD2A 4DV6M 1IN7A 1NV8A 1V33A 2DI0A 3KVWA 1XWIA 3FE3A 2QBYB 1R7RA 4LGYA 3J7AS 4X65M 2F5QA 4JYAM 3C3DA 2VF8A 5DYIA 2Z3XA 4GITA 4QHSA 4QNRA 1XNRM 4OU7A 2UU9M 1L8QA 1GO5A 2BNKA 1T43A 2H1RA 2KNZA 3ILKA 4JI2M 5FTLA 4GC5A 2EO2A 2VF7A 1GJTA 3GLGA 2V6ZM 1WR1B 3KXEC 3M0EA 2FS1A 1ZAEA 3K1JA 3KP0E 3RGPA 3TPZA 3I01M 1K3WA 4LFBM 3U5ZB 2ZANA 4HL4A 4F1IA 2EKKA 4L4UA 2XH9A 1Z5CA 5EP1A 4AG6A 4DR4M 3U6SA 3A42A 5F3WA 4DUZM 1Z59A 1NY6A 1Z6TA 3GP1A 2DHRA 4B08A 3GPUA 2CFOA 5H37D 2UUBM 4OX9M 3HU1A 2Z4RA 4Q7JA 4DV7M 3SHFA 2V1UA 4LF6M 3C3EA 4G4RA 1QUTA 4IBIA 4R71A 1OFHA 4R3DA 4YY3M 1IXRC 2LVNC 3CTWB 1T6OA 2VDBB 5FLXS 3OTOM 4LZZA 3T38A 1Z5AA 4JI3M 4AG5A 2YFQA 2DWMA 3TWKA 3GLHE 5EP4A 1G4AE 1PJTA 3FKEA 1E32A 3GLIE 5C1BA 4BB9A 4NC6A 1XXHA 2NQ8C 3FUUA 2Y20A 4NXNM 3J2PB 2R6FA 4MGKE 2HHHM 3SYKA 2B3TA 3U6CA 4DR6M 2Q2EB 3K8ZA 2JZ0A 5DYGA 4IBKA 3TWMA 3QYBA 1JR3E 4M0DA 4LZJA 1EFUB 3GPPA 3JR4A 4M9ZA 1L1TA 2O5RA 2MH8A 5ITYA 2EUCA 2LHCA 4GKJM 3GO8A 2C99A 4W5WA 3VFDA 1QANA 2DZNB 2O25A 2QNJA 5ITXE 4GKKM 3KFUG 1JQJC 2DXIA 1X37A 2OQ4A 2YQZA 4JI8M 3HWSA 3C9PA 4AW4A 4IBCA 1Q39A 1WGNA 4LG2A 3UMMA 4G3OA 2OPFA 2CRUA 3A45A 2D7HA 2KNAA 2L7HA 4DBGB 4LRTA 5ITRA 3A98B 2HAKA 4ANRA 3GLFE 2BJWA 3U6MA 1NV9A 3QYEA 4NL4H 3HY5A 4PT5A 4B7FA 2Y0TA 2K47A 2APLA 2QQ8A 3Q8GA 4B3RM 1OIPA 1IFYA 2VIIA 4LJAA 3U60A 2W82A 1XNQM 2DKLA 3SAVA 1IXZA 1OJLA 2JNHA
chains in the Genus database with same CATH topology
5ITQA 1G59A 4OW0A 4LJ6A 3SARA 4IBJA 2FOIC 3ZH9B 3WHLA 3SMPA 3HJ8A 4A3VB 3PFIA 3NBIA 3KSJA 4GC9A 4D82A 3DA1A 2I7PA 1HT1E 4B7HA 4JI5M 3U6LA 1GL7A 1NHGC 5FTJA 2LNHC 4G4QA 1HT2E 5ITUA 4FWDA 3M7GA 4RF0A 4MH0E 5IREB 1T3TA 2CEAA 1HQCA 3FUXA 5EP2A 1KYIA 3IG5A 3A46A 1IN5A 2XLJA 2QP9X 1J7KA 3SAWA 3SASA 2KZUA 4GH9A 4G6ZA 2CV2A 2KA6B 3W0FA 1SXJE 3U60B 2FE8A 2KRUA 3AFHA 2UUAM 1N36M 5FTMA 1N33M 4XGIA 1G3IA 2F4VM 3VK7A 5JI3E 3I51A 3GLHA 3RGSA 4ZPXA 2ERCA 4NSOB 1IBLM 1K3XA 2J7NA 3M6AA 1PM5A 2R62A 2I7NA 2YNMD 3J80S 2R18A 1IY2A 3FTDA 3CF6E 4LRSA 4IJEA 3AOEA 1N75A 4NOOB 2ZAMA 4DV2M 1JR3A 4BLCA 2C9CA 1DGFA 3H4MA 4WURA 3LVWA 4NRVA 1GL6A 3TL4X 3L29A 4KODA 1DO2A 4MB7A 2KZSA 3TE6A 4OVZA 4II7A 3U61A 4MGHA 2C96A 3KP1E 5KPTA 5FSWA 1L2BA 3NWLA 2D7GA 3L28A 3PNVA 3L25A 1XHBA 3GLHB 4L8RC 2KRKA 2ZBKB 2CV0A 3UZUA 1WXQA 1R6BX 1NSFA 5EJCA 1HQYE 3FYDA 2CHGA 3AV0A 4X64M 3EIEA 3TWKA 3LMMA 3QWLA 1JR3D 4FW9A 4DV4M 1DGBA 5BPVA 3FUWA 4D81A 1NNUC 3JAMS 2HL7A 3HU2A 4IBBA 5DNYA 1IN4A 3MJ5A 4LGMA 3GPXA 4DR3M 2Z7JA 4DV0M 4GHLA 2UXCM 3E4RA 3GLGB 1L2DA 1TH3A 4I81A 4MGIE 2QZ4A 1EE8A 4HLQA 2R45A 4B3TM 4D80A 4REZA 4OVZB 1FJGM 1D2NA 4NSRA 4DV1M 5LMUM 4JI6M 3U61B 2M5ZA 1H6UA 1TH2A 4DR2M 3J81S 4LY6A 3SYLA 4MM3B 5KPRA 4QNMA 4EIWA 2KEBA 4JI1M 1N78A 1I4WA 1IN6A 3T15A 4G4NA 3L27A 2P5TA 2XF3A 3GRVA 2BJVA 2XSZA 3KOXE 1OFIA 2R65A 1TH4A 3UK6A 4JI0M 3FYCA 3B9PA 3LVVA 2HKJA 1KFVA 2R4EA 1QAQA 3GPYA 4LJ8A 1NVMA 3VDUA 3KSXA 1QAMA 3KOZE 4RF1A 1XXHB 1L2CA 2CHVA 1IM2A 3AJIB 2F5SA 3L26A 1W5SA 3FUTA 1XMQM 4JN6A 1N77A 3EIHA 4FCTA 3KW6A 1HNWM 1PJIA 2Y0QA 4DV5M 2DWNA 4DR5M 2DZOB 3U6QA 2KXEA 2L6OA 2ZAOA 3CF2A 3GRUA 2RGOA 5KPZA 2X4AA 3J7BA 3VKGA 4AQYM 2XSZD 2LWXA 1HNXM 2DWZB 2KW0A 4LJ4A 4M9XA 1I94M 1C1KA 2VQFM 3U6PA 2DWLA 1IXSB 4ITQA 5ITTA 1IQPA 1NJFA 2RGHA 4PCZA 3UGJA 4IIWA 5EP3A 3Q8XA 1G41A 1E9RA 4JI7M 4LF7M 3HJQA 8CATA 4QOZC 3RE8A 5FTNA 2FFJA 4JV5M 2QCUA 3SATA 2QPAA 4PD2A 4LFAM 2G5GX 3GLIA 3SHGB 4FWGA 1R2YA 4AKIA 3HHYA 4B3SM 4IJFA 4TUWA 3TWLA 2F5PA 4NRWA 4X62M 5IT9S 4GRIA 3GQ4A 1S3SA 1YE9A 3CF0A 3U6OA 3J27B 1MU5A 1NNJA 1G8PA 1NY5A 2JA2A 4S12A 1KSFX 4RNAA 5ITXA 3KS8A 3U6DA 4QHTA 1SXJC 3HGIA 1ZQ9A 1FNNA 1XMOM 4L78A 1IBKM 4M0WA 2F5OA 4LFCM 3ZC7B 3PXGA 3GLFA 3FUVA 2HCBA 4DUYM 1L1ZA 5E6JA 3GLIB 3SMSA 1QZMA 4CGYB 3THGA 1TDHA 4JI4M 4AKGA 2G8LA 3HHXA 3L2AA 1HNZM 2L7IA 3MHVC 3AL0C 4AI6A 4R7GA 5KQDA 1ORYB 3JR5A 4IBGA 4LJ9A 1W5TA 4JXJA 4FVMA 3VK8A 1Q3BA 2C9OA 1TGUA 4I4LA 5KQ8A 1J5EM 1IY1A 5GKNA 3VKHA 2CE7A 4KO8A 4PDGA 3GQ5A 2AHMA 5E26A 2Z4SA 4BBAA 3U6EA 2FNAA 1PJJA 2C5RA 4GMQA 3LQRA 4L16A 2D7EA 4KHPM 5FTKA 2ZM6M 3PVSA 4CISA 3KOWE 4GIPA 2Y21A 3QAUA 1E9SA 4KLNA 2XZFA 3GLFB 4K0KM 3RFWA 4I5SA 1E94E 4LF9M 1SXJA 5BR8M 3SAUA 5KO3A 4DR1M 2YR0A 3HHZA 1QAOA 3D8LA 2CUZA 5JI2E 4L15A 2DVWB 1DGHA 3SFZA 4YHHM 3W0LB 4MGYE 5IWAM 1XC8A 5EQTA 3HHWA 1VDDA 1Z5BA 2LH0A 3DFZA 1NHWC 4IBDA 3HU3A 1NJGA 3K2LA 3T1HM 2XZUA 1DGGA 2L09A 2VQEM 3KS4A 3DZDA 5EXSA 5C18A 2V1CA 3LQQA 3FD9A 2EA0A 4LCBA 2R4JA 2LXEA 3C58A 4LF8M 3T1YM 3K92A 1N34M 1IBMM 5EXPA 1SXJD 3DOAA 2C98A 4AKHA 3D8BA 4M9SA 3WHKA 4GHAA 2M60A 2UXBM 4X66M 4WW0A 1SXJB 2XEPA 3AOGA 3SC3A 2J7OA 4CHTB 1IY0A 4G4OA 2E5LM 3KOYE 1MX0A 1J09A 2UXDM 3AOEC 5EXTA 1QQWA 1YUBA 3HJSA 4B7GA 4FCWA 3R9XB 4IBFA 4Z6YA 1DGHB 5EXXA 7CATA 2XGNA 1K82A 3I4VA 2F5NA 4LJ5A 1GLNA 1QYRA 4FCVA 3R8FA 3GRYA 1TDZA 3GRRA 2A5YB 4LF4M 2R46A 5A2QS 2QBYA 5IZ7D 1IN8A 4B3MM 1Q3CA 3ZCBB 4MGZE 4LF5M 2X49A 1DO0A 1QVRA 2CHQA 3BOSA 1GKIA 4XBOA 3FTEA 2XFSA 4FWHA 4PDIA 2CV1A 1UM8A 4DR7M 3IG8A 5LMNM 3TQSA 3FTCA 1GVNA 2QENA 4I8OA 3PNYA 3I4YA 3U5ZA 3FTFA 2X8AA 3VLFB 4P16A 1HR0M 3MK6A 2XFTA 3HKPA 4DV3M 4AZFA 1YSYA 4NXMM 4IBEA 3UJNA 4QOSA 2RKOA 4LJ7A 3GQ3A 1LV7A 3VDPA 3AKZA 3SBJA 1R2ZA 4Z8XA 1N32M 3KDSE 2UUCM 4FD2A 4DV6M 1IN7A 3KVWA 1XWIA 2QBYB 1R7RA 4LGYA 3J7AS 4X65M 2F5QA 4JYAM 5DYIA 2Z3XA 4GITA 4QHSA 4QNRA 1XNRM 4OU7A 2UU9M 1L8QA 2BNKA 2H1RA 3ILKA 4JI2M 5FTLA 4GC5A 2EO2A 3GLGA 2V6ZM 3M0EA 3KXEC 1ZAEA 3K1JA 3KP0E 3RGPA 3TPZA 1K3WA 4LFBM 3U5ZB 2ZANA 4HL4A 4L4UA 2XH9A 1Z5CA 5EP1A 4AG6A 4DR4M 3U6SA 3A42A 5F3WA 4DUZM 1Z59A 1NY6A 1Z6TA 3GP1A 2DHRA 4B08A 3GPUA 2CFOA 5H37D 2UUBM 4OX9M 3HU1A 2Z4RA 4DV7M 3SHFA 2V1UA 4LF6M 4G4RA 4IBIA 1OFHA 4R3DA 4YY3M 1IXRC 3CTWB 5FLXS 3OTOM 4LZZA 3T38A 1Z5AA 4JI3M 4AG5A 2YFQA 2DWMA 5EP4A 1G4AE 3FKEA 1E32A 5C1BA 4BB9A 1XXHA 2NQ8C 3FUUA 2Y20A 4NXNM 3J2PB 2HHHM 4MGKE 3SYKA 3U6CA 4DR6M 2Q2EB 3K8ZA 5DYGA 4IBKA 3TWMA 1OJLA 4M0DA 4LZJA 3GPPA 3JR4A 4M9ZA 1L1TA 2O5RA 5ITYA 2EUCA 4GKJM 3GO8A 2C99A 4W5WA 3VFDA 1QANA 2DZNB 5ITXE 4GKKM 3KFUG 1JQJC 2DXIA 1X37A 2OQ4A 2YQZA 4JI8M 3HWSA 4AW4A 4IBCA 1Q39A 4LG2A 3UMMA 2OPFA 3A45A 2D7HA 2L7HA 5ITRA 4LRTA 3A98B 3U6MA 2BJWA 4NL4H 4B7FA 4PT5A 2Y0TA 2K47A 4B3RM 2VIIA 4LJAA 3U60A 2W82A 1XNQM 3SAVA 1IXZA 3E9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITQ A;  4DR2 M;  3J81 S;  1TDH A;  3SAR A;  4JI4 M;  1HR0 M;  1HNZ M;  4JI6 M;  4JI1 M;  3JR5 A;  4DV3 M;  4G4N A;  4NXM M;  3VK8 A;  1Q3B A;  4JI5 M;  3U6L A;  3GQ3 A;  1J5E M;  3SBJ A;  4G4Q A;  1R2Z A;  5ITU A;  1N32 M;  4JI0 M;  4PDG A;  3GQ5 A;  2UUC M;  2HKJ A;  4DV6 M;  1KFV A;  3U6E A;  3GPY A;  1PJJ A;  3A46 A;  1L2C A;  2F5S A;  3J7A S;  4X65 M;  2F5Q A;  4JYA M;  3SAW A;  4KHP M;  1XMQ M;  3SAS A;  2ZM6 M;  1XNR M;  4CIS A;  2UU9 M;  3W0F A;  4JI2 M;  2XZF A;  2UUA M;  1N36 M;  1HNW M;  1PJI A;  4DV5 M;  4K0K M;  1N33 M;  2F4V M;  4DR5 M;  3VK7 A;  3U6Q A;  4LF9 M;  1K3W A;  4LFB M;  5BR8 M;  3SAU A;  4DR4 M;  1Z5C A;  4DR1 M;  1IBL M;  1K3X A;  3U6S A;  3A42 A;  4DUZ M;  1PM5 A;  1Z59 A;  4AQY M;  3GP1 A;  3J80 S;  3GPU A;  1HNX M;  2UUB M;  4OX9 M;  4DV7 M;  1I94 M;  4LF6 M;  4YHH M;  4G4R A;  3U6P A;  2VQF M;  5IWA M;  1XC8 A;  4DV2 M;  4ITQ A;  1Z5B A;  4YY3 M;  5ITT A;  5FLX S;  3OTO M;  4PCZ A;  4NRV A;  1Z5A A;  4JI3 M;  3T1H M;  2XZU A;  2VQE M;  4JI7 M;  4LF7 M;  4MB7 A;  2EA0 A;  3C58 A;  4LF8 M;  3T1Y M;  1N34 M;  1IBM M;  4JV5 M;  3DOA A;  4NXN M;  3SAT A;  2HHH M;  4PD2 A;  4LFA M;  3U6C A;  4DR6 M;  2Q2E B;  1R2Y A;  2UXB M;  1L2B A;  4X66 M;  4B3S M;  3TWM A;  4G4O A;  2ZBK B;  2E5L M;  3GPP A;  3JR4 A;  1MX0 A;  3TWL A;  1L1T A;  2F5P A;  4NRW A;  5ITY A;  4X62 M;  4GKJ M;  2UXD M;  3GO8 A;  5IT9 S;  4X64 M;  5ITX E;  3TWK A;  4GKK M;  4DV4 M;  3GQ4 A;  2OQ4 A;  4JI8 M;  1K82 A;  2F5N A;  3U6O A;  1MU5 A;  1NNJ A;  1Q39 A;  3JAM S;  5ITX A;  2OPF A;  1TDZ A;  3A45 A;  4LF4 M;  3GPX A;  5ITR A;  5A2Q S;  4DR3 M;  3U6D A;  4B3M M;  1Q3C A;  4DV0 M;  3U6M A;  2UXC M;  1XMO M;  1L2D A;  4LF5 M;  1IBK M;  2F5O A;  4LFC M;  4B3R M;  4PDI A;  1EE8 A;  4B3T M;  4DR7 M;  1FJG M;  1XNQ M;  5LMN M;  4DUY M;  3SAV A;  4DV1 M;  1L1Z A;  5LMU M; 
#chains in the Genus database with same CATH topology
 5ITQ A;  1GAB A;  1SG9 A;  1G59 A;  2LVP C;  4OW0 A;  1JB0 F;  4LJ6 A;  3SAR A;  4IBJ A;  4WP2 A;  2FOI C;  3ZH9 B;  3WHL A;  3SMP A;  1PJS A;  3HJ8 A;  4A3V B;  3PFI A;  3NBI A;  3KSJ A;  4GC9 A;  1QUS A;  3DA1 A;  2I7P A;  4D82 A;  1HT1 E;  4B7H A;  4JI5 M;  3U6L A;  1GL7 A;  1NHG C;  3B7Q A;  5FTJ A;  2LNH C;  4G4Q A;  1HT2 E;  5ITU A;  4FWD A;  3M7G A;  2WZJ A;  4RF0 A;  4MH0 E;  5IRE B;  1T3T A;  2CEA A;  1HQC A;  3FUX A;  5EP2 A;  1KYI A;  1CUK A;  3IG5 A;  3A46 A;  2J5Y A;  1IN5 A;  2QHO B;  1TTE A;  2XLJ A;  2QP9 X;  1J7K A;  3SAW A;  3SAS A;  2KZU A;  4GH9 A;  4G6Z A;  2CV2 A;  2KA6 B;  3W0F A;  1SXJ E;  3ZQJ A;  2FE8 A;  3U60 B;  2L4F A;  2KRU A;  3AFH A;  2UUA M;  1N36 M;  5FTM A;  1N33 M;  1TR8 A;  2CP8 A;  2EJS A;  4XGI A;  1G3I A;  2F4V M;  3VK7 A;  5JI3 E;  3I51 A;  3GLH A;  3W68 A;  3RGS A;  2JY5 A;  4ZPX A;  2ERC A;  4NSO B;  1IBL M;  1K3X A;  2RRU A;  2J7N A;  3M6A A;  1PM5 A;  2R62 A;  2I7N A;  2YNM D;  3LCV B;  2JZ1 A;  3J80 S;  2R18 A;  2ZTD A;  1IY2 A;  3FTD A;  3CF6 E;  4LRS A;  4IJE A;  1G71 A;  3AOE A;  1N75 A;  4NOO B;  2ZAM A;  4DV2 M;  1JR3 A;  4BLC A;  2C9C A;  2JY8 A;  1DGF A;  3H4M A;  4WUR A;  3LVW A;  4NRV A;  1GL6 A;  3TL4 X;  1ZMW A;  3L29 A;  4KOD A;  1DO2 A;  1WGL A;  2ZTC A;  4MB7 A;  3LW5 F;  2KZS A;  1PGY A;  3TE6 A;  4OVZ A;  1WIV A;  4II7 A;  3U61 A;  4MGH A;  2C96 A;  3KP1 E;  3T6P A;  1DV0 A;  5KPT A;  5FSW A;  1L2B A;  3NWL A;  2D7G A;  3L28 A;  3PNV A;  3L25 A;  1XHB A;  3GLH B;  4L8R C;  1PJQ A;  2KRK A;  2WSF F;  2ZBK B;  3UZU A;  2CV0 A;  1WXQ A;  1R6B X;  1NSF A;  5EJC A;  1HQY E;  3FYD A;  2CHG A;  3AV0 A;  4X64 M;  1MN3 A;  1RU3 A;  3EIE A;  1OTR A;  3LMM A;  1JR3 D;  3QWL A;  4FW9 A;  2JY6 B;  1VEG A;  1DGB A;  4DV4 M;  5BPV A;  3FUW A;  4D81 A;  4Y28 F;  1NNU C;  3NBX X;  2JXN A;  3JAM S;  2HL7 A;  3HU2 A;  4IBB A;  5DNY A;  1IN4 A;  3MJ5 A;  4LGM A;  3GPX A;  4DR3 M;  3B74 A;  2Z7J A;  4DV0 M;  4GHL A;  1OIZ A;  3E4R A;  2UXC M;  3GLG B;  1L2D A;  1TH3 A;  4I81 A;  1EIJ A;  2DAG A;  4MGI E;  2QZ4 A;  1EE8 A;  4HLQ A;  2R45 A;  3K9O A;  4B3T M;  4D80 A;  4REZ A;  3FRI A;  4OVZ B;  1FJG M;  1D2N A;  4NSR A;  4DV1 M;  5LMU M;  4JI6 M;  3U61 B;  2KNV A;  2M5Z A;  1H6U A;  1TH2 A;  3LCU A;  4DR2 M;  3J81 S;  1P3Q Q;  1VEJ A;  4LY6 A;  3SYL A;  4MM3 B;  4RKU F;  5KPR A;  4QNM A;  1VQ1 A;  4EIW A;  2KEB A;  4JI1 M;  1N78 A;  1QDR A;  1I4W A;  1IN6 A;  3T15 A;  4G4N A;  5DFL A;  3L27 A;  2P5T A;  2XF3 A;  1XB2 B;  3GRV A;  2BJV A;  2OO9 A;  2XSZ A;  3E46 A;  3I04 M;  3KOX E;  1OFI A;  2L2D A;  1IXS A;  2R65 A;  1TH4 A;  3UK6 A;  4JI0 M;  3FYC A;  3B9P A;  3LVV A;  2HKJ A;  1KFV A;  2R4E A;  1QAQ A;  2MJ5 B;  3GPY A;  2K9D A;  4LJ8 A;  4HEO A;  1NVM A;  3VDU A;  3KSX A;  1QAM A;  3KOZ E;  2MGW A;  1XXH B;  4RF1 A;  2CHV A;  1IM2 A;  3AJI B;  2F5S A;  3L26 A;  1W5S A;  3FUT A;  1XMQ M;  4JN6 A;  5L8R F;  1N77 A;  3EIH A;  4FCT A;  3KW6 A;  1VG5 A;  1PJI A;  1HNW M;  2Y0Q A;  2K6B A;  4DV5 M;  4CJ6 A;  2DWN A;  1OAI A;  2L4E A;  4DR5 M;  2DZO B;  3U6Q A;  2KXE A;  2L6O A;  2ZAO A;  3CF2 A;  3GRU A;  2RGO A;  5KPZ A;  2DAK A;  2X4A A;  3J7B A;  3MMP A;  3VKG A;  4AQY M;  2XSZ D;  2LWX A;  1UFZ A;  2FH0 A;  2LTU A;  1HNX M;  2DWZ B;  2KW0 A;  3E9S A;  1Q02 A;  2H5X A;  4LJ4 A;  4M9X A;  1D0M A;  3HX3 A;  1I94 M;  1C1K A;  2VQF M;  3U6P A;  2DWL A;  1IXS B;  4ITQ A;  1V92 A;  4F2L A;  5ITT A;  1IQP A;  1NJF A;  2RGH A;  4PCZ A;  3UGJ A;  4IIW A;  5EP3 A;  2CWB A;  3Q8X A;  1G41 A;  2BWE A;  2JWS A;  1E9R A;  4JI7 M;  4LF7 M;  2DHY A;  3HJQ A;  8CAT A;  4QOZ C;  3RE8 A;  5FTN A;  2FFJ A;  4JV5 M;  1VEK A;  2QCU A;  3SAT A;  2BWB A;  2QPA A;  2JP7 A;  4PD2 A;  4LFA M;  2G5G X;  3GLI A;  3SHG B;  4FWG A;  1R2Y A;  4AKI A;  3HHY A;  4B3S M;  1QZE A;  4IJF A;  4TUW A;  3TWL A;  2F5P A;  4NRW A;  4X62 M;  2DZL A;  5IT9 S;  4UN2 B;  2KHH A;  2DNA A;  4GRI A;  3GQ4 A;  1S3S A;  1YE9 A;  1HJP A;  3CF0 A;  4CIZ A;  2EKF A;  1MU5 A;  3J27 B;  3U6O A;  1NNJ A;  2JY7 A;  1D0L A;  1G8P A;  1NY5 A;  2JA2 A;  4S12 A;  1KSF X;  4RNA A;  5ITX A;  3KS8 A;  4GEW A;  3U6D A;  3F92 A;  2WSC F;  1SXJ C;  3HGI A;  4QHT A;  1ZQ9 A;  2R44 A;  1FNN A;  1XMO M;  1D0K A;  4L78 A;  1IBK M;  4M0W A;  2F5O A;  4LFC M;  3ZC7 B;  3PXG A;  1OKS A;  3GLF A;  3FUV A;  2HCB A;  4DUY M;  1L1Z A;  2OOA A;  3B7Z A;  5E6J A;  2DEN A;  3GLI B;  3SMS A;  1QZM A;  1ZMU A;  4CGY B;  1AIP C;  3THG A;  1TDH A;  4JI4 M;  1PRB A;  4AKG A;  2G8L A;  3HHX A;  3K9P A;  3L2A A;  2L7I A;  3MHV C;  1HNZ M;  3AL0 C;  4R7G A;  4AI6 A;  5KQD A;  1ORY B;  3JR5 A;  4IBG A;  4XK8 F;  4LJ9 A;  2R0I A;  1W5T A;  4JXJ A;  4FVM A;  3VK8 A;  1Q3B A;  2C9O A;  1TGU A;  2QSF X;  4I4L A;  5KQ8 A;  1J5E M;  1IY1 A;  5GKN A;  3VKH A;  2CE7 A;  4KO8 A;  4PDG A;  3GQ5 A;  2AHM A;  5E26 A;  2Z4S A;  4BBA A;  3U6E A;  2FNA A;  1PJJ A;  2KDL A;  2C5R A;  4GMQ A;  2GQF A;  3LQR A;  4L16 A;  2D7E A;  4KHP M;  3FRH A;  5FTK A;  2ZM6 M;  1BVS A;  3PVS A;  4CIS A;  3KOW E;  4GIP A;  2Y21 A;  3QAU A;  1E9S A;  1AUA A;  4KLN A;  2XZF A;  3GLF B;  4K0K M;  3W67 A;  2K0B X;  2LVA A;  3RFW A;  4I5S A;  1E94 E;  4LF9 M;  1A5T A;  1OAO C;  1SXJ A;  1WJ7 A;  1ZMV A;  1TF0 B;  2O01 F;  3IEC A;  2JUJ A;  5KO3 A;  5BR8 M;  3B89 A;  3SAU A;  1F4I A;  1R5L A;  4DR1 M;  2YR0 A;  2LBC A;  2N35 A;  3HZJ A;  1OQY A;  1ZV1 A;  3HHZ A;  1QAO A;  3D8L A;  2CUZ A;  5JI2 E;  4L15 A;  2DVW B;  2WSE F;  1DGH A;  3SFZ A;  4YHH M;  3W0L B;  4MGY E;  5IWA M;  3GLG E;  5EQT A;  3HHW A;  1XC8 A;  4L6V 6;  2MR9 A;  1VDD A;  1Z5B A;  2LH0 A;  3DFZ A;  1NHW C;  3IHP A;  3HU3 A;  4IBD A;  1GJS A;  1WHC A;  1NJG A;  3B7N A;  3K2L A;  1VDL A;  3T1H M;  2XZU A;  1DGG A;  2L09 A;  1C7Y A;  2VQE M;  3KS4 A;  3DZD A;  5EXS A;  5C18 A;  2V1C A;  2G3Q A;  3FD9 A;  3LQQ A;  4P17 A;  4LCB A;  2EA0 A;  2R4J A;  2LXE A;  1V34 A;  3C58 A;  3T1Y M;  3K92 A;  1N34 M;  1IBM M;  4LF8 M;  5EXP A;  1SXJ D;  3DOA A;  1LTM A;  2C98 A;  4AKH A;  3D8B A;  1L2C A;  4M9S A;  3WHK A;  4GHA A;  2M60 A;  1Y8G A;  2UXB M;  4X66 M;  3CGW A;  4WW0 A;  1SXJ B;  2DAI A;  2GNO A;  2XEP A;  3AOG A;  3SC3 A;  1MJG M;  2J7O A;  3BBZ A;  4CHT B;  1IY0 A;  4G4O A;  2E5L M;  3KOY E;  1MX0 A;  1J09 A;  2Z8Y M;  1QDT A;  2UXD M;  3AOE C;  4KT0 F;  5EXT A;  1QQW A;  1YUB A;  3HJS A;  4B7G A;  4FCW A;  3R9X B;  4IBF A;  4Z6Y A;  1DGH B;  5EXX A;  7CAT A;  2XGN A;  1K82 A;  3I4V A;  2F5N A;  4LJ5 A;  1XXH E;  1GLN A;  1NO1 A;  1QYR A;  4FCV A;  3R8F A;  3GRY A;  1TDZ A;  1YLA A;  3GRR A;  2A5Y B;  4LF4 M;  2R46 A;  5A2Q S;  2QBY A;  5IZ7 D;  1IN8 A;  4B3M M;  1Q3C A;  3ZCB B;  2DAE A;  2MRO B;  4MGZ E;  4LF5 M;  2X49 A;  2LVQ D;  2LVO C;  1DO0 A;  1QVR A;  2CHQ A;  3BOS A;  1GKI A;  4XBO A;  3FTE A;  2XFS A;  4FWH A;  4PDI A;  2CV1 A;  3E21 A;  1UM8 A;  3BXW A;  4DR7 M;  2LHG A;  3IG8 A;  5LMN M;  3TQS A;  3FTC A;  1GVN A;  2OOB A;  2QEN A;  4I8O A;  3PNY A;  3I4Y A;  3U5Z A;  3FTF A;  2X8A A;  3VLF B;  4P16 A;  3H4J A;  1HR0 M;  3MK6 A;  2XFT A;  3HKP A;  4DV3 M;  4AZF A;  1YSY A;  4NXM M;  4IBE A;  2HWJ A;  4QOS A;  2RKO A;  3UJN A;  4LJ7 A;  3GQ3 A;  1LV7 A;  2DAM A;  3VDP A;  3AKZ A;  3SBJ A;  3V76 A;  4Z8X A;  1R2Z A;  1N32 M;  1R4G A;  3KDS E;  2UUC M;  4FD2 A;  4DV6 M;  1IN7 A;  1NV8 A;  1V33 A;  2DI0 A;  3KVW A;  1XWI A;  3FE3 A;  2QBY B;  1R7R A;  4LGY A;  3J7A S;  4X65 M;  2F5Q A;  4JYA M;  3C3D A;  2VF8 A;  5DYI A;  2Z3X A;  4GIT A;  4QHS A;  4QNR A;  1XNR M;  4OU7 A;  2UU9 M;  1L8Q A;  1GO5 A;  2BNK A;  1T43 A;  2H1R A;  2KNZ A;  3ILK A;  4JI2 M;  5FTL A;  4GC5 A;  2EO2 A;  2VF7 A;  1GJT A;  3GLG A;  2V6Z M;  1WR1 B;  3KXE C;  3M0E A;  2FS1 A;  1ZAE A;  3K1J A;  3KP0 E;  3RGP A;  3TPZ A;  3I01 M;  1K3W A;  4LFB M;  3U5Z B;  2ZAN A;  4HL4 A;  4F1I A;  2EKK A;  4L4U A;  2XH9 A;  1Z5C A;  5EP1 A;  4AG6 A;  4DR4 M;  3U6S A;  3A42 A;  5F3W A;  4DUZ M;  1Z59 A;  1NY6 A;  1Z6T A;  3GP1 A;  2DHR A;  4B08 A;  3GPU A;  2CFO A;  5H37 D;  2UUB M;  4OX9 M;  3HU1 A;  2Z4R A;  4Q7J A;  4DV7 M;  3SHF A;  2V1U A;  4LF6 M;  3C3E A;  4G4R A;  1QUT A;  4IBI A;  4R71 A;  1OFH A;  4R3D A;  4YY3 M;  1IXR C;  2LVN C;  3CTW B;  1T6O A;  2VDB B;  5FLX S;  3OTO M;  4LZZ A;  3T38 A;  1Z5A A;  4JI3 M;  4AG5 A;  2YFQ A;  2DWM A;  3TWK A;  3GLH E;  5EP4 A;  1G4A E;  1PJT A;  3FKE A;  1E32 A;  3GLI E;  5C1B A;  4BB9 A;  4NC6 A;  1XXH A;  2NQ8 C;  3FUU A;  2Y20 A;  4NXN M;  3J2P B;  2R6F A;  4MGK E;  2HHH M;  3SYK A;  2B3T A;  3U6C A;  4DR6 M;  2Q2E B;  3K8Z A;  2JZ0 A;  5DYG A;  4IBK A;  3TWM A;  3QYB A;  1JR3 E;  4M0D A;  4LZJ A;  1EFU B;  3GPP A;  3JR4 A;  4M9Z A;  1L1T A;  2O5R A;  2MH8 A;  5ITY A;  2EUC A;  2LHC A;  4GKJ M;  3GO8 A;  2C99 A;  4W5W A;  3VFD A;  1QAN A;  2DZN B;  2O25 A;  2QNJ A;  5ITX E;  4GKK M;  3KFU G;  1JQJ C;  2DXI A;  1X37 A;  2OQ4 A;  2YQZ A;  4JI8 M;  3HWS A;  3C9P A;  4AW4 A;  4IBC A;  1Q39 A;  1WGN A;  4LG2 A;  3UMM A;  4G3O A;  2OPF A;  2CRU A;  3A45 A;  2D7H A;  2KNA A;  2L7H A;  4DBG B;  4LRT A;  5ITR A;  3A98 B;  2HAK A;  4ANR A;  3GLF E;  2BJW A;  3U6M A;  1NV9 A;  3QYE A;  4NL4 H;  3HY5 A;  4PT5 A;  4B7F A;  2Y0T A;  2K47 A;  2APL A;  2QQ8 A;  3Q8G A;  4B3R M;  1OIP A;  1IFY A;  2VII A;  4LJA A;  3U60 A;  2W82 A;  1XNQ M;  2DKL A;  3SAV A;  1IXZ A;  1OJL A;  2JNH A; 
#chains in the Genus database with same CATH homology
 5ITQ A;  1G59 A;  4OW0 A;  4LJ6 A;  3SAR A;  4IBJ A;  2FOI C;  3ZH9 B;  3WHL A;  3SMP A;  3HJ8 A;  4A3V B;  3PFI A;  3NBI A;  3KSJ A;  4GC9 A;  4D82 A;  3DA1 A;  2I7P A;  1HT1 E;  4B7H A;  4JI5 M;  3U6L A;  1GL7 A;  1NHG C;  5FTJ A;  2LNH C;  4G4Q A;  1HT2 E;  5ITU A;  4FWD A;  3M7G A;  4RF0 A;  4MH0 E;  5IRE B;  1T3T A;  2CEA A;  1HQC A;  3FUX A;  5EP2 A;  1KYI A;  3IG5 A;  3A46 A;  1IN5 A;  2XLJ A;  2QP9 X;  1J7K A;  3SAW A;  3SAS A;  2KZU A;  4GH9 A;  4G6Z A;  2CV2 A;  2KA6 B;  3W0F A;  1SXJ E;  3U60 B;  2FE8 A;  2KRU A;  3AFH A;  2UUA M;  1N36 M;  5FTM A;  1N33 M;  4XGI A;  1G3I A;  2F4V M;  3VK7 A;  5JI3 E;  3I51 A;  3GLH A;  3RGS A;  4ZPX A;  2ERC A;  4NSO B;  1IBL M;  1K3X A;  2J7N A;  3M6A A;  1PM5 A;  2R62 A;  2I7N A;  2YNM D;  3J80 S;  2R18 A;  1IY2 A;  3FTD A;  3CF6 E;  4LRS A;  4IJE A;  3AOE A;  1N75 A;  4NOO B;  2ZAM A;  4DV2 M;  1JR3 A;  4BLC A;  2C9C A;  1DGF A;  3H4M A;  4WUR A;  3LVW A;  4NRV A;  1GL6 A;  3TL4 X;  3L29 A;  4KOD A;  1DO2 A;  4MB7 A;  2KZS A;  3TE6 A;  4OVZ A;  4II7 A;  3U61 A;  4MGH A;  2C96 A;  3KP1 E;  5KPT A;  5FSW A;  1L2B A;  3NWL A;  2D7G A;  3L28 A;  3PNV A;  3L25 A;  1XHB A;  3GLH B;  4L8R C;  2KRK A;  2ZBK B;  2CV0 A;  3UZU A;  1WXQ A;  1R6B X;  1NSF A;  5EJC A;  1HQY E;  3FYD A;  2CHG A;  3AV0 A;  4X64 M;  3EIE A;  3TWK A;  3LMM A;  3QWL A;  1JR3 D;  4FW9 A;  4DV4 M;  1DGB A;  5BPV A;  3FUW A;  4D81 A;  1NNU C;  3JAM S;  2HL7 A;  3HU2 A;  4IBB A;  5DNY A;  1IN4 A;  3MJ5 A;  4LGM A;  3GPX A;  4DR3 M;  2Z7J A;  4DV0 M;  4GHL A;  2UXC M;  3E4R A;  3GLG B;  1L2D A;  1TH3 A;  4I81 A;  4MGI E;  2QZ4 A;  1EE8 A;  4HLQ A;  2R45 A;  4B3T M;  4D80 A;  4REZ A;  4OVZ B;  1FJG M;  1D2N A;  4NSR A;  4DV1 M;  5LMU M;  4JI6 M;  3U61 B;  2M5Z A;  1H6U A;  1TH2 A;  4DR2 M;  3J81 S;  4LY6 A;  3SYL A;  4MM3 B;  5KPR A;  4QNM A;  4EIW A;  2KEB A;  4JI1 M;  1N78 A;  1I4W A;  1IN6 A;  3T15 A;  4G4N A;  3L27 A;  2P5T A;  2XF3 A;  3GRV A;  2BJV A;  2XSZ A;  3KOX E;  1OFI A;  2R65 A;  1TH4 A;  3UK6 A;  4JI0 M;  3FYC A;  3B9P A;  3LVV A;  2HKJ A;  1KFV A;  2R4E A;  1QAQ A;  3GPY A;  4LJ8 A;  1NVM A;  3VDU A;  3KSX A;  1QAM A;  3KOZ E;  4RF1 A;  1XXH B;  1L2C A;  2CHV A;  1IM2 A;  3AJI B;  2F5S A;  3L26 A;  1W5S A;  3FUT A;  1XMQ M;  4JN6 A;  1N77 A;  3EIH A;  4FCT A;  3KW6 A;  1HNW M;  1PJI A;  2Y0Q A;  4DV5 M;  2DWN A;  4DR5 M;  2DZO B;  3U6Q A;  2KXE A;  2L6O A;  2ZAO A;  3CF2 A;  3GRU A;  2RGO A;  5KPZ A;  2X4A A;  3J7B A;  3VKG A;  4AQY M;  2XSZ D;  2LWX A;  1HNX M;  2DWZ B;  2KW0 A;  4LJ4 A;  4M9X A;  1I94 M;  1C1K A;  2VQF M;  3U6P A;  2DWL A;  1IXS B;  4ITQ A;  5ITT A;  1IQP A;  1NJF A;  2RGH A;  4PCZ A;  3UGJ A;  4IIW A;  5EP3 A;  3Q8X A;  1G41 A;  1E9R A;  4JI7 M;  4LF7 M;  3HJQ A;  8CAT A;  4QOZ C;  3RE8 A;  5FTN A;  2FFJ A;  4JV5 M;  2QCU A;  3SAT A;  2QPA A;  4PD2 A;  4LFA M;  2G5G X;  3GLI A;  3SHG B;  4FWG A;  1R2Y A;  4AKI A;  3HHY A;  4B3S M;  4IJF A;  4TUW A;  3TWL A;  2F5P A;  4NRW A;  4X62 M;  5IT9 S;  4GRI A;  3GQ4 A;  1S3S A;  1YE9 A;  3CF0 A;  3U6O A;  3J27 B;  1MU5 A;  1NNJ A;  1G8P A;  1NY5 A;  2JA2 A;  4S12 A;  1KSF X;  4RNA A;  5ITX A;  3KS8 A;  3U6D A;  4QHT A;  1SXJ C;  3HGI A;  1ZQ9 A;  1FNN A;  1XMO M;  4L78 A;  1IBK M;  4M0W A;  2F5O A;  4LFC M;  3ZC7 B;  3PXG A;  3GLF A;  3FUV A;  2HCB A;  4DUY M;  1L1Z A;  5E6J A;  3GLI B;  3SMS A;  1QZM A;  4CGY B;  3THG A;  1TDH A;  4JI4 M;  4AKG A;  2G8L A;  3HHX A;  3L2A A;  1HNZ M;  2L7I A;  3MHV C;  3AL0 C;  4AI6 A;  4R7G A;  5KQD A;  1ORY B;  3JR5 A;  4IBG A;  4LJ9 A;  1W5T A;  4JXJ A;  4FVM A;  3VK8 A;  1Q3B A;  2C9O A;  1TGU A;  4I4L A;  5KQ8 A;  1J5E M;  1IY1 A;  5GKN A;  3VKH A;  2CE7 A;  4KO8 A;  4PDG A;  3GQ5 A;  2AHM A;  5E26 A;  2Z4S A;  4BBA A;  3U6E A;  2FNA A;  1PJJ A;  2C5R A;  4GMQ A;  3LQR A;  4L16 A;  2D7E A;  4KHP M;  5FTK A;  2ZM6 M;  3PVS A;  4CIS A;  3KOW E;  4GIP A;  2Y21 A;  3QAU A;  1E9S A;  4KLN A;  2XZF A;  3GLF B;  4K0K M;  3RFW A;  4I5S A;  1E94 E;  4LF9 M;  1SXJ A;  5BR8 M;  3SAU A;  5KO3 A;  4DR1 M;  2YR0 A;  3HHZ A;  1QAO A;  3D8L A;  2CUZ A;  5JI2 E;  4L15 A;  2DVW B;  1DGH A;  3SFZ A;  4YHH M;  3W0L B;  4MGY E;  5IWA M;  1XC8 A;  5EQT A;  3HHW A;  1VDD A;  1Z5B A;  2LH0 A;  3DFZ A;  1NHW C;  4IBD A;  3HU3 A;  1NJG A;  3K2L A;  3T1H M;  2XZU A;  1DGG A;  2L09 A;  2VQE M;  3KS4 A;  3DZD A;  5EXS A;  5C18 A;  2V1C A;  3LQQ A;  3FD9 A;  2EA0 A;  4LCB A;  2R4J A;  2LXE A;  3C58 A;  4LF8 M;  3T1Y M;  3K92 A;  1N34 M;  1IBM M;  5EXP A;  1SXJ D;  3DOA A;  2C98 A;  4AKH A;  3D8B A;  4M9S A;  3WHK A;  4GHA A;  2M60 A;  2UXB M;  4X66 M;  4WW0 A;  1SXJ B;  2XEP A;  3AOG A;  3SC3 A;  2J7O A;  4CHT B;  1IY0 A;  4G4O A;  2E5L M;  3KOY E;  1MX0 A;  1J09 A;  2UXD M;  3AOE C;  5EXT A;  1QQW A;  1YUB A;  3HJS A;  4B7G A;  4FCW A;  3R9X B;  4IBF A;  4Z6Y A;  1DGH B;  5EXX A;  7CAT A;  2XGN A;  1K82 A;  3I4V A;  2F5N A;  4LJ5 A;  1GLN A;  1QYR A;  4FCV A;  3R8F A;  3GRY A;  1TDZ A;  3GRR A;  2A5Y B;  4LF4 M;  2R46 A;  5A2Q S;  2QBY A;  5IZ7 D;  1IN8 A;  4B3M M;  1Q3C A;  3ZCB B;  4MGZ E;  4LF5 M;  2X49 A;  1DO0 A;  1QVR A;  2CHQ A;  3BOS A;  1GKI A;  4XBO A;  3FTE A;  2XFS A;  4FWH A;  4PDI A;  2CV1 A;  1UM8 A;  4DR7 M;  3IG8 A;  5LMN M;  3TQS A;  3FTC A;  1GVN A;  2QEN A;  4I8O A;  3PNY A;  3I4Y A;  3U5Z A;  3FTF A;  2X8A A;  3VLF B;  4P16 A;  1HR0 M;  3MK6 A;  2XFT A;  3HKP A;  4DV3 M;  4AZF A;  1YSY A;  4NXM M;  4IBE A;  3UJN A;  4QOS A;  2RKO A;  4LJ7 A;  3GQ3 A;  1LV7 A;  3VDP A;  3AKZ A;  3SBJ A;  1R2Z A;  4Z8X A;  1N32 M;  3KDS E;  2UUC M;  4FD2 A;  4DV6 M;  1IN7 A;  3KVW A;  1XWI A;  2QBY B;  1R7R A;  4LGY A;  3J7A S;  4X65 M;  2F5Q A;  4JYA M;  5DYI A;  2Z3X A;  4GIT A;  4QHS A;  4QNR A;  1XNR M;  4OU7 A;  2UU9 M;  1L8Q A;  2BNK A;  2H1R A;  3ILK A;  4JI2 M;  5FTL A;  4GC5 A;  2EO2 A;  3GLG A;  2V6Z M;  3M0E A;  3KXE C;  1ZAE A;  3K1J A;  3KP0 E;  3RGP A;  3TPZ A;  1K3W A;  4LFB M;  3U5Z B;  2ZAN A;  4HL4 A;  4L4U A;  2XH9 A;  1Z5C A;  5EP1 A;  4AG6 A;  4DR4 M;  3U6S A;  3A42 A;  5F3W A;  4DUZ M;  1Z59 A;  1NY6 A;  1Z6T A;  3GP1 A;  2DHR A;  4B08 A;  3GPU A;  2CFO A;  5H37 D;  2UUB M;  4OX9 M;  3HU1 A;  2Z4R A;  4DV7 M;  3SHF A;  2V1U A;  4LF6 M;  4G4R A;  4IBI A;  1OFH A;  4R3D A;  4YY3 M;  1IXR C;  3CTW B;  5FLX S;  3OTO M;  4LZZ A;  3T38 A;  1Z5A A;  4JI3 M;  4AG5 A;  2YFQ A;  2DWM A;  5EP4 A;  1G4A E;  3FKE A;  1E32 A;  5C1B A;  4BB9 A;  1XXH A;  2NQ8 C;  3FUU A;  2Y20 A;  4NXN M;  3J2P B;  2HHH M;  4MGK E;  3SYK A;  3U6C A;  4DR6 M;  2Q2E B;  3K8Z A;  5DYG A;  4IBK A;  3TWM A;  1OJL A;  4M0D A;  4LZJ A;  3GPP A;  3JR4 A;  4M9Z A;  1L1T A;  2O5R A;  5ITY A;  2EUC A;  4GKJ M;  3GO8 A;  2C99 A;  4W5W A;  3VFD A;  1QAN A;  2DZN B;  5ITX E;  4GKK M;  3KFU G;  1JQJ C;  2DXI A;  1X37 A;  2OQ4 A;  2YQZ A;  4JI8 M;  3HWS A;  4AW4 A;  4IBC A;  1Q39 A;  4LG2 A;  3UMM A;  2OPF A;  3A45 A;  2D7H A;  2L7H A;  5ITR A;  4LRT A;  3A98 B;  3U6M A;  2BJW A;  4NL4 H;  4B7F A;  4PT5 A;  2Y0T A;  2K47 A;  4B3R M;  2VII A;  4LJA A;  3U60 A;  2W82 A;  1XNQ M;  3SAV A;  1IXZ A;  3E9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...