2HHIA

The solution structure of antigen mpt64 from mycobacterium tuberculosis defines a novel class of beta-grasp proteins
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
204
structure length
204
Chain Sequence
PKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunogenic protein MPT64
publication title The Solution Structure of Antigen MPT64 from Mycobacterium tuberculosis Defines a New Family of Beta-Grasp Proteins.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 25
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 2hhiA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 2hhiA02
4E72A 3S5TA 3CYGA 5JENA 2HHIA
chains in the Genus database with same CATH superfamily
4YKUA 4JN4A 2OANA 3TZ0A 2BYIA 4R1FA 4LWGA 4CBWA 1TYQB 3G7BA 5M4PA 4EMVA 3QFPA 1Y4UA 1KZNA 1GKXA 2WEPA 3EKRA 1YETA 4CZFA 3D36A 3HZ1A 1E4FT 4W7TA 1AJ6A 3GDQA 5F0XA 1RDWX 2KHOA 1D4XA 1QQOA 3ATVA 5AFUH 4A2BA 2P9PA 4XDMA 4EGKA 1S14A 2Q8HA 2H55A 3T0ZA 2YJXA 2V7YA 3ATUA 3HZ5A 3WHAA 3MN5A 2IOQA 3K98A 3ZKDA 5J71A 1H1VA 3U9ZA 3ULEB 1AH8A 4PL8A 5J6AA 3CIPA 1R62A 1YC3A 4JD2B 4JHDB 2FF3B 5F3KA 4GCZA 3D2FA 5JLFA 3M3ZA 3IUCA 5AQUA 4MPEA 2YJFA 5D7RA 3MN6A 4I6MB 4WUBA 1UYFA 3UKRA 1IJJA 4B1XB 4GT8A 4YKWA 2HMPA 1U2VB 2WUSA 4O04A 5JLHA 2WI2A 2VCJA 3EHGA 3H80A 1I5BA 1K8KB 3A5MC 1UYHA 1KXPA 4HYPA 2XDKA 1UY7A 2ESAA 4EGHA 3FFKB 3NMQA 4XTJA 3EHFA 3TTZA 3HYZA 4YKYA 1ZWHA 2BTZA 1NWKA 2FWYA 2QW9A 1MU5A 2QFOA 4NH8A 5I9EB 2BU7A 1MX0A 4JAUA 3JZ3A 4O07A 4CZGA 1UYGA 4L8ZA 5FPNA 5AQQA 2HG1A 4BE7B 5F1XA 2Q8FA 5D7CA 5C93A 4XIQA 2FXSA 2IWXA 4URLA 4CWOA 4JQLA 4L94A 3WQ9A 2QWLA 3T10A 3UB5A 3CYGA 3DGEA 3INWA 3FZFA 2FWZA 4WUDA 2Q36A 1LCUA 2XHTA 2YK9A 3ULEA 3FE1A 3U8XA 1UYKA 4JD2A 1BUPA 1ATSA 3QFUA 5FPDA 3SL2A 3M6GA 5EX5A 2YGAA 2H8MA 1NGJA 1Y64A 2YEAA 1NGGA 4PRVA 1NGDA 3ZKBA 2XABA 1ATNA 3R91A 1I59A 5AQWA 3FT8A 2XJGA 3CRKA 4AWOA 1EI1A 1L0OA 4FMTA 1OSFA 2XJXA 3A8YA 5AQOA 4XCJA 3D2EB 1QZ5A 5FNDA 4GGLA 5M4NA 3I33A 2O1WA 3C0EA 1YT2A 3JXUA 1QQMA 4PU9A 2A40A 4K42A 3T1KA 1UYMA 4GQTA 3D2RA 3GIGB 5CTYA 5AQHA 3UE5A 3EKUA 4A2AA 3K99A 4B1WB 2Q0RA 3HHUA 4FPPA 4PKIA 5CTXA 4I3HA 3LDQA 4KFGA 1S16A 2ASOA 3GIEA 2XDXA 1ATRA 3OWBA 2P9KA 5BOCA 1UYCA 3DXMA 3LDLA 3INXA 4LWEA 1TH8A 4K43A 2VW5A 1EQYA 4UROA 2E8AA 1DEJA 1QYEA 5F5RA 4HXWA 2CGFA 2Q0UA 2XJJA 3QDDA 1P8ZA 4PKGA 1Y4SA 5AQRA 4PL7A 3RSEB 3WEEA 2YGEA 4O05A 3R4MA 4CZLA 2WERA 1JCGA 5M4KA 2CG9A 1TC0A 1Z5CA 3CQXA 1YS3A 4DUHA 3EL2A 2FYPA 3TZ4A 4KBOA 4FCPA 2CCTA 4ASAA 1MA9B 1C0FA 1YC1A 1AMWA 3RLRA 1H7SA 3A0ZA 1RFQA 2CCUA 1AH6A 2YE4A 5D7DA 1H7UA 4NH9A 4E72A 4EFUA 2XCMA 4KP4A 4H03B 2Q2EB 1C0GA 2P9NA 1YXQA 2V7ZA 5EVZA 4XITA 1UY6A 4B7PA 2UWDA 5M4MA 4FL9A 2BZ5A 4LP0A 5AQKA 4H0YB 4H5WA 4GY2B 4P8OA 2PBDA 4CZEA 4H0XB 3VADA 4BXIA 4U93A 2ZDXA 3ZM7A 2P9LA 1QY8A 2XHRA 1B62A 4MB9A 1HX1A 2W00A 4GEEA 3O2FA 3G7EA 4HZ0A 1A4HA 3D2EA 4CBXA 2WI7A 4MPCA 1UY8A 1YUWA 2P9IA 2VCIA 4V26A 2YE2A 2YEFA 2QWMA 3J8AA 2YKIA 1AM1A 3A0RA 3TUHA 4CBUA 4MPNA 3BM9A 5BN9A 3EHJA 2P9SB 3MN7A 5AQLA 2WI5A 4YKXA 4PKHA 3H4LA 1JCEA 3B24A 3CGYA 4FSVA 4XE2A 5AQJA 3HSCA 2HF3A 1SQKA 1GJVA 2BU6A 4YKRA 1B3QA 3B28A 5CTUA 5M4EA 1BA1A 1U2OA 1S22A 2Q31A 4HXZA 4K4OA 1UYIA 2WI1A 4EGIA 4NH7A 2WEQA 5AQTA 5BPNA 3A5NC 4CWNA 1J6ZA 4HYMA 4J8FA 3A5LC 2BREA 1THNA 5AQNA 3OWDA 4B1YB 5ADXA 5TKYA 4HY6A 1HPMA 5FPEA 3QB0A 5AQSA 4YKTA 3U67A 1TYQA 4KSHA 2PAVA 1Y8OA 2XDLA 4H81A 4JAVA 2QXLA 3A5OC 2BYHA 3U4LA 2XDSA 2XX5A 3U2DA 1BGQA 3K97A 4CE1A 4EFHA 3UKUB 4ASFA 2PNRA 2YE7A 5AQYA 3SJHA 4XIPA 4ASGA 2Q1NA 2QWOA 3M1FA 1KIJA 3FZLA 3W3DA 1DKGD 2YEIA 3DXKB 1YC4A 1NGHA 4WUCA 2IWSA 1Z59A 4B9QA 1HJOA 2K5BA 3LMMA 4BQJA 1ZXNA 4BQGA 3FZMA 4CZMA 4JHDA 1QZ6A 4Q20A 3Q5LA 5CPHA 3QMLA 5F2RA 4CZHA 2YEHA 1YT1A 5CF0A 2V51B 5BN8A 3FZHA 4XCLA 3B26A 2D1KA 4FCQA 4I6MA 5D6QA 1KAZA 3AY9A 3C7NB 2YEJA 4YKZA 3KVGA 2HKJA 3HYYA 5L3JA 3EKSA 3DWLA 4BEBA 5EY4A 1I58A 1U2VA 3C11A 2XK2A 2GQPA 1E4GT 5AQPA 5JENA 3EKOA 4CWSA 1K8KA 4YKQA 1QZRA 4CWQA 1I5CA 4EFTA 4XEIA 4H5VA 3OPDA 3CWVA 4IO8A 4L91A 4KSGA 1T44A 2VWCA 2YI7A 4HWIA 4XC0A 4XD8A 3DAWA 4ZKIA 4URNA 4X9LA 3LPSA 3CHWA 1NLVA 2YKEA 2A5XA 2ZBKB 4URMA 3L6QA 4KQVA 4JNEA 2QWNA 2ZKJA 4U7OA 1B63A 1GKZA 1NHJA 2HF4A 3O0IA 4H5RA 2P9UB 4BIUA 1YSRA 4R3AA 2GWKA 3UKUA 2ASMA 5ADXH 3O6OA 2YJEA 1NHIA 3G75A 2HHIA 5IDMA 1TIDA 4CWFA 3VHDA 3FT5A 4O0BA 5AQZA 3UKRB 4XKKA 4MBCA 2XHXA 1Z5BA 2YKJA 4O09A 1XQSC 2O1UA 2YE8A 2YEEA 3EHHA 3FZKA 3BMYA 2Q8IA 2AKPA 1NGIA 1YAGA 4R3MA 5BPMA 2Q8GA 1S3XA 2WI4A 4H85A 4LWFA 2YI0A 4QPKA 2YE9A 2QG0A 2C1GA 5AQIA 4AM7A 2JJCA 4QPJA 3QTFA 4XJXA 1TILA 2YE6A 3OMUA 1NGFA 4KTNA 4U7NA 1HLUA 3LDOA 4AM6A 1NM1A 1Z5AA 3HBTA 1BKNA 3U9DA 4XKAA 2QG2A 3TZ2A 2YK2A 1NGAA 2BTFA 2YEDA 2YI5A 1NGBA 3GIGA 4HY1A 4EAHD 3K60A 1NMDA 2YKCA 3B27A 3CJCA 2QF6A 2YEBA 2QWPA 4CE2A 3CI5A 3RLQA 2BU2A 1RGIA 2WI3A 1JCFA 4FCRA 5AQXA 3GIFA 2BUPA 1Y8PA 3VHCA 4BECA 4MP2A 4PRXA 5BODA 2P9UA 1BA0A 4BIZA 4CWRA 2YKBA 1US7A 3RSEA 5AR0A 1YVNA 1NGEA 4H0VB 4CE3A 1JM6A 4H5NA 3KE6A 3A0XA 3TPQA 2EXLA 5FWKA 2VYPA 4B1ZA 1ZW9A 1YERA 1Y8NA 3PEHA 2BRCA 2IWUA 1UYDA 4GFNA 4LPBA 3T0HA 4RWTA 3VHAA 5CE3A 2FTKA 4JASA 3LDPA 2E0AA 2WI6A 4ASBA 2A41A 4H5TA 4AWQA 1MDUB 3LNUA 2YI6A 4E01A 3FV5A 5FPMA 1KAXA 3HEKA 3D0BA 3CJBA 3Q5KA 3L4IA 2XDUA 4L93A 4E00A 2YJWA 5AQFA 2XD6A 3CRLA 1TC6A 4CI6A 4BAEA 2FF6A 3R92A 2P9KB 5AQVA 3DXMB 4MP7A 3T2SA 5IDJA 2A42A 4ZVIA 2O1VA 4WYBA 3MMVA 2CH4A 2P9SA 2YECA 3U2KA 4AS9A 2BT0A 3ZXQA 4I5SA 3PEJA 3WEEB 2YEGA 2BU8A 2IORA 3R4PA 1UYLA 4LWIA 4M63C 3CGZA 4XIRA 3S5TA 1ID0A 1QQNA 3OW6A 2IOPA 5FNFA 3RKZA 1I5DA 3B25A 1TBWA 2YE5A 4MOTA 3BUZB 1EA6A 2BU5A 5AFUA 4PL9A 2GWJA 2Q97A 4CZIA 3R4OA 1KAYA 3A0YA 3TU5A 2P9NB 1YSZA 5BPLA 3Q5JA 4XKOA 4EEHA 4DZYA 1YESA 2C1IA 4K41A 1NGCA 1NHHA 1LOTB 2P9PB 2QWQA 2P9LB 2ZWHA 3RLPA 5CTWA 5AQGA 4L90A 2BSMA 4AWPA 4CZKA 5AQMA 4LWHA 5IN9A 4HZ5A 4B6CA 2QWRA 4H7QA 2GFDA 2P9IB 3GL1A 4EM7A 4B1UB 4Z94A 4V25A 2XX4A 2E88A 1BYQA 2JKIA 3R4NA 5GGZA 4P7AA 1I5AA 3D2FB 1PVGA 1F51A 2C2AA 1WUAA 1UYEA 3DXKA 3MNRP 4E02A 1ESVA 5EXWA 3A0WA 2A3ZA 2VCPA 2FXUA 4GNIA 4CWPA 5M4HA 3IEDA 2ASPA 4H0TB 4CZJA 4CWTA 4FO0A 1BXDA 1IXMA 2HCHA 3TZ5A 1UY9A 1YT0A 5FNCA 2YGFA 2CCSA 5D6PA 5E84A 3LDNA 3A0TA 2V52B 1U0ZA 2XX2A 3MN9A 3C7NA 4B1VA 1ZXMA 2YE3A 2ZDYA 3ZXOA 4RTFD
chains in the Genus database with same CATH topology
4E72A 3S5TA 3CYGA 5JENA 2HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E72 A;  3S5T A;  3CYG A;  5JEN A;  2HHI A; 
#chains in the Genus database with same CATH topology
 4YKU A;  4JN4 A;  2OAN A;  3TZ0 A;  2BYI A;  4R1F A;  4LWG A;  4CBW A;  1TYQ B;  3G7B A;  5M4P A;  4EMV A;  3QFP A;  1Y4U A;  1KZN A;  1GKX A;  2WEP A;  3EKR A;  1YET A;  4CZF A;  3D36 A;  3HZ1 A;  1E4F T;  4W7T A;  1AJ6 A;  3GDQ A;  5F0X A;  1RDW X;  2KHO A;  1D4X A;  1QQO A;  3ATV A;  5AFU H;  4A2B A;  2P9P A;  4XDM A;  4EGK A;  1S14 A;  2Q8H A;  2H55 A;  3T0Z A;  2YJX A;  2V7Y A;  3ATU A;  3HZ5 A;  3WHA A;  3MN5 A;  2IOQ A;  3K98 A;  3ZKD A;  5J71 A;  1H1V A;  3U9Z A;  3ULE B;  1AH8 A;  4PL8 A;  5J6A A;  3CIP A;  1R62 A;  1YC3 A;  4JD2 B;  4JHD B;  2FF3 B;  5F3K A;  4GCZ A;  3D2F A;  5JLF A;  3M3Z A;  3IUC A;  5AQU A;  4MPE A;  2YJF A;  5D7R A;  3MN6 A;  4I6M B;  4WUB A;  1UYF A;  3UKR A;  1IJJ A;  4B1X B;  4GT8 A;  4YKW A;  2HMP A;  1U2V B;  2WUS A;  4O04 A;  5JLH A;  2WI2 A;  2VCJ A;  3EHG A;  3H80 A;  1I5B A;  1K8K B;  3A5M C;  1UYH A;  1KXP A;  4HYP A;  2XDK A;  1UY7 A;  2ESA A;  4EGH A;  3FFK B;  3NMQ A;  4XTJ A;  3EHF A;  3TTZ A;  3HYZ A;  4YKY A;  1ZWH A;  2BTZ A;  1NWK A;  2FWY A;  2QW9 A;  1MU5 A;  2QFO A;  4NH8 A;  5I9E B;  2BU7 A;  1MX0 A;  4JAU A;  3JZ3 A;  4O07 A;  4CZG A;  1UYG A;  4L8Z A;  5FPN A;  5AQQ A;  2HG1 A;  4BE7 B;  5F1X A;  2Q8F A;  5D7C A;  5C93 A;  4XIQ A;  2FXS A;  2IWX A;  4URL A;  4CWO A;  4JQL A;  4L94 A;  3WQ9 A;  2QWL A;  3T10 A;  3UB5 A;  3CYG A;  3DGE A;  3INW A;  3FZF A;  2FWZ A;  4WUD A;  2Q36 A;  1LCU A;  2XHT A;  2YK9 A;  3ULE A;  3FE1 A;  3U8X A;  1UYK A;  4JD2 A;  1BUP A;  1ATS A;  3QFU A;  5FPD A;  3SL2 A;  3M6G A;  5EX5 A;  2YGA A;  2H8M A;  1NGJ A;  1Y64 A;  2YEA A;  1NGG A;  4PRV A;  1NGD A;  3ZKB A;  2XAB A;  1ATN A;  3R91 A;  1I59 A;  5AQW A;  3FT8 A;  2XJG A;  3CRK A;  4AWO A;  1EI1 A;  1L0O A;  4FMT A;  1OSF A;  2XJX A;  3A8Y A;  5AQO A;  4XCJ A;  3D2E B;  1QZ5 A;  5FND A;  4GGL A;  5M4N A;  3I33 A;  2O1W A;  3C0E A;  1YT2 A;  3JXU A;  1QQM A;  4PU9 A;  2A40 A;  4K42 A;  3T1K A;  1UYM A;  4GQT A;  3D2R A;  3GIG B;  5CTY A;  5AQH A;  3UE5 A;  3EKU A;  4A2A A;  3K99 A;  4B1W B;  2Q0R A;  3HHU A;  4FPP A;  4PKI A;  5CTX A;  4I3H A;  3LDQ A;  4KFG A;  1S16 A;  2ASO A;  3GIE A;  2XDX A;  1ATR A;  3OWB A;  2P9K A;  5BOC A;  1UYC A;  3DXM A;  3LDL A;  3INX A;  4LWE A;  1TH8 A;  4K43 A;  2VW5 A;  1EQY A;  4URO A;  2E8A A;  1DEJ A;  1QYE A;  5F5R A;  4HXW A;  2CGF A;  2Q0U A;  2XJJ A;  3QDD A;  1P8Z A;  4PKG A;  1Y4S A;  5AQR A;  4PL7 A;  3RSE B;  3WEE A;  2YGE A;  4O05 A;  3R4M A;  4CZL A;  2WER A;  1JCG A;  5M4K A;  2CG9 A;  1TC0 A;  1Z5C A;  3CQX A;  1YS3 A;  4DUH A;  3EL2 A;  2FYP A;  3TZ4 A;  4KBO A;  4FCP A;  2CCT A;  4ASA A;  1MA9 B;  1C0F A;  1YC1 A;  1AMW A;  3RLR A;  1H7S A;  3A0Z A;  1RFQ A;  2CCU A;  1AH6 A;  2YE4 A;  5D7D A;  1H7U A;  4NH9 A;  4E72 A;  4EFU A;  2XCM A;  4KP4 A;  4H03 B;  2Q2E B;  1C0G A;  2P9N A;  1YXQ A;  2V7Z A;  5EVZ A;  4XIT A;  1UY6 A;  4B7P A;  2UWD A;  5M4M A;  4FL9 A;  2BZ5 A;  4LP0 A;  5AQK A;  4H0Y B;  4H5W A;  4GY2 B;  4P8O A;  2PBD A;  4CZE A;  4H0X B;  3VAD A;  4BXI A;  4U93 A;  2ZDX A;  3ZM7 A;  2P9L A;  1QY8 A;  2XHR A;  1B62 A;  4MB9 A;  1HX1 A;  2W00 A;  4GEE A;  3O2F A;  3G7E A;  4HZ0 A;  1A4H A;  3D2E A;  4CBX A;  2WI7 A;  4MPC A;  1UY8 A;  1YUW A;  2P9I A;  2VCI A;  4V26 A;  2YE2 A;  2YEF A;  2QWM A;  3J8A A;  2YKI A;  1AM1 A;  3A0R A;  3TUH A;  4CBU A;  4MPN A;  3BM9 A;  5BN9 A;  3EHJ A;  2P9S B;  3MN7 A;  5AQL A;  2WI5 A;  4YKX A;  4PKH A;  3H4L A;  1JCE A;  3B24 A;  3CGY A;  4FSV A;  4XE2 A;  5AQJ A;  3HSC A;  2HF3 A;  1SQK A;  1GJV A;  2BU6 A;  4YKR A;  1B3Q A;  3B28 A;  5CTU A;  5M4E A;  1BA1 A;  1U2O A;  1S22 A;  2Q31 A;  4HXZ A;  4K4O A;  1UYI A;  2WI1 A;  4EGI A;  4NH7 A;  2WEQ A;  5AQT A;  5BPN A;  3A5N C;  4CWN A;  1J6Z A;  4HYM A;  4J8F A;  3A5L C;  2BRE A;  1THN A;  5AQN A;  3OWD A;  4B1Y B;  5ADX A;  5TKY A;  4HY6 A;  1HPM A;  5FPE A;  3QB0 A;  5AQS A;  4YKT A;  3U67 A;  1TYQ A;  4KSH A;  2PAV A;  1Y8O A;  2XDL A;  4H81 A;  4JAV A;  2QXL A;  3A5O C;  2BYH A;  3U4L A;  2XDS A;  2XX5 A;  3U2D A;  1BGQ A;  3K97 A;  4CE1 A;  4EFH A;  3UKU B;  4ASF A;  2PNR A;  2YE7 A;  5AQY A;  3SJH A;  4XIP A;  4ASG A;  2Q1N A;  2QWO A;  3M1F A;  1KIJ A;  3FZL A;  3W3D A;  1DKG D;  2YEI A;  3DXK B;  1YC4 A;  1NGH A;  4WUC A;  2IWS A;  1Z59 A;  4B9Q A;  1HJO A;  2K5B A;  3LMM A;  4BQJ A;  1ZXN A;  4BQG A;  3FZM A;  4CZM A;  4JHD A;  1QZ6 A;  4Q20 A;  3Q5L A;  5CPH A;  3QML A;  5F2R A;  4CZH A;  2YEH A;  1YT1 A;  5CF0 A;  2V51 B;  5BN8 A;  3FZH A;  4XCL A;  3B26 A;  2D1K A;  4FCQ A;  4I6M A;  5D6Q A;  1KAZ A;  3AY9 A;  3C7N B;  2YEJ A;  4YKZ A;  3KVG A;  2HKJ A;  3HYY A;  5L3J A;  3EKS A;  3DWL A;  4BEB A;  5EY4 A;  1I58 A;  1U2V A;  3C11 A;  2XK2 A;  2GQP A;  1E4G T;  5AQP A;  5JEN A;  3EKO A;  4CWS A;  1K8K A;  4YKQ A;  1QZR A;  4CWQ A;  1I5C A;  4EFT A;  4XEI A;  4H5V A;  3OPD A;  3CWV A;  4IO8 A;  4L91 A;  4KSG A;  1T44 A;  2VWC A;  2YI7 A;  4HWI A;  4XC0 A;  4XD8 A;  3DAW A;  4ZKI A;  4URN A;  4X9L A;  3LPS A;  3CHW A;  1NLV A;  2YKE A;  2A5X A;  2ZBK B;  4URM A;  3L6Q A;  4KQV A;  4JNE A;  2QWN A;  2ZKJ A;  4U7O A;  1B63 A;  1GKZ A;  1NHJ A;  2HF4 A;  3O0I A;  4H5R A;  2P9U B;  4BIU A;  1YSR A;  4R3A A;  2GWK A;  3UKU A;  2ASM A;  5ADX H;  3O6O A;  2YJE A;  1NHI A;  3G75 A;  2HHI A;  5IDM A;  1TID A;  4CWF A;  3VHD A;  3FT5 A;  4O0B A;  5AQZ A;  3UKR B;  4XKK A;  4MBC A;  2XHX A;  1Z5B A;  2YKJ A;  4O09 A;  1XQS C;  2O1U A;  2YE8 A;  2YEE A;  3EHH A;  3FZK A;  3BMY A;  2Q8I A;  2AKP A;  1NGI A;  1YAG A;  4R3M A;  5BPM A;  2Q8G A;  1S3X A;  2WI4 A;  4H85 A;  4LWF A;  2YI0 A;  4QPK A;  2YE9 A;  2QG0 A;  2C1G A;  5AQI A;  4AM7 A;  2JJC A;  4QPJ A;  3QTF A;  4XJX A;  1TIL A;  2YE6 A;  3OMU A;  1NGF A;  4KTN A;  4U7N A;  1HLU A;  3LDO A;  4AM6 A;  1NM1 A;  1Z5A A;  3HBT A;  1BKN A;  3U9D A;  4XKA A;  2QG2 A;  3TZ2 A;  2YK2 A;  1NGA A;  2BTF A;  2YED A;  2YI5 A;  1NGB A;  3GIG A;  4HY1 A;  4EAH D;  3K60 A;  1NMD A;  2YKC A;  3B27 A;  3CJC A;  2QF6 A;  2YEB A;  2QWP A;  4CE2 A;  3CI5 A;  3RLQ A;  2BU2 A;  1RGI A;  2WI3 A;  1JCF A;  4FCR A;  5AQX A;  3GIF A;  2BUP A;  1Y8P A;  3VHC A;  4BEC A;  4MP2 A;  4PRX A;  5BOD A;  2P9U A;  1BA0 A;  4BIZ A;  4CWR A;  2YKB A;  1US7 A;  3RSE A;  5AR0 A;  1YVN A;  1NGE A;  4H0V B;  4CE3 A;  1JM6 A;  4H5N A;  3KE6 A;  3A0X A;  3TPQ A;  2EXL A;  5FWK A;  2VYP A;  4B1Z A;  1ZW9 A;  1YER A;  1Y8N A;  3PEH A;  2BRC A;  2IWU A;  1UYD A;  4GFN A;  4LPB A;  3T0H A;  4RWT A;  3VHA A;  5CE3 A;  2FTK A;  4JAS A;  3LDP A;  2E0A A;  2WI6 A;  4ASB A;  2A41 A;  4H5T A;  4AWQ A;  1MDU B;  3LNU A;  2YI6 A;  4E01 A;  3FV5 A;  5FPM A;  1KAX A;  3HEK A;  3D0B A;  3CJB A;  3Q5K A;  3L4I A;  2XDU A;  4L93 A;  4E00 A;  2YJW A;  5AQF A;  2XD6 A;  3CRL A;  1TC6 A;  4CI6 A;  4BAE A;  2FF6 A;  3R92 A;  2P9K B;  5AQV A;  3DXM B;  4MP7 A;  3T2S A;  5IDJ A;  2A42 A;  4ZVI A;  2O1V A;  4WYB A;  3MMV A;  2CH4 A;  2P9S A;  2YEC A;  3U2K A;  4AS9 A;  2BT0 A;  3ZXQ A;  4I5S A;  3PEJ A;  3WEE B;  2YEG A;  2BU8 A;  2IOR A;  3R4P A;  1UYL A;  4LWI A;  4M63 C;  3CGZ A;  4XIR A;  3S5T A;  1ID0 A;  1QQN A;  3OW6 A;  2IOP A;  5FNF A;  3RKZ A;  1I5D A;  3B25 A;  1TBW A;  2YE5 A;  4MOT A;  3BUZ B;  1EA6 A;  2BU5 A;  5AFU A;  4PL9 A;  2GWJ A;  2Q97 A;  4CZI A;  3R4O A;  1KAY A;  3A0Y A;  3TU5 A;  2P9N B;  1YSZ A;  5BPL A;  3Q5J A;  4XKO A;  4EEH A;  4DZY A;  1YES A;  2C1I A;  4K41 A;  1NGC A;  1NHH A;  1LOT B;  2P9P B;  2QWQ A;  2P9L B;  2ZWH A;  3RLP A;  5CTW A;  5AQG A;  4L90 A;  2BSM A;  4AWP A;  4CZK A;  5AQM A;  4LWH A;  5IN9 A;  4HZ5 A;  4B6C A;  2QWR A;  4H7Q A;  2GFD A;  2P9I B;  3GL1 A;  4EM7 A;  4B1U B;  4Z94 A;  4V25 A;  2XX4 A;  2E88 A;  1BYQ A;  2JKI A;  3R4N A;  5GGZ A;  4P7A A;  1I5A A;  3D2F B;  1PVG A;  1F51 A;  2C2A A;  1WUA A;  1UYE A;  3DXK A;  3MNR P;  4E02 A;  1ESV A;  5EXW A;  3A0W A;  2A3Z A;  2VCP A;  2FXU A;  4GNI A;  4CWP A;  5M4H A;  3IED A;  2ASP A;  4H0T B;  4CZJ A;  4CWT A;  4FO0 A;  1BXD A;  1IXM A;  2HCH A;  3TZ5 A;  1UY9 A;  1YT0 A;  5FNC A;  2YGF A;  2CCS A;  5D6P A;  5E84 A;  3LDN A;  3A0T A;  2V52 B;  1U0Z A;  2XX2 A;  3MN9 A;  3C7N A;  4B1V A;  1ZXM A;  2YE3 A;  2ZDY A;  3ZXO A;  4RTF D; 
#chains in the Genus database with same CATH homology
 4E72 A;  3S5T A;  3CYG A;  5JEN A;  2HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...