2HHIA

The solution structure of antigen mpt64 from mycobacterium tuberculosis defines a novel class of beta-grasp proteins
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
204
structure length
204
Chain Sequence
b'PKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunogenic protein MPT64
publication title The Solution Structure of Antigen MPT64 from Mycobacterium tuberculosis Defines a New Family of Beta-Grasp Proteins.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
total genus 25
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 2hhiA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 2hhiA02
5JENA 2HHIA 3S5TA 3CYGA 4E72A
chains in the Genus database with same CATH superfamily
1PVGA 3ZXQA 3MNRP 2A40A 2A5XA 4RWTA 2YEIA 3FT5A 5AQPA 1UYMA 4WYBA 2YEBA 1KAXA 2BRCA 4PRVA 5AQVA 3PEHA 1A4HA 4K42A 1NM1A 1AMWA 5AQRA 4LWEA 1YT2A 2XDXA 5M4MA 2BU7A 1AM1A 1EA6A 4L90A 4LWIA 4YKUA 4O07A 3DXKA 4H5NA 3TZ5A 2OANA 2YE7A 3KE6A 2AKPA 2ESAA 2IOPA 3U9ZA 3VHAA 5FNCA 4WUDA 4CWQA 3CJBA 4IO8A 3WEEB 2QG2A 3K98A 2V51B 4JHDB 2PAVA 4YKQA 4GT8A 2C1GA 1MA9B 1B63A 2PBDA 3FE1A 4U7NA 1I5AA 1S16A 1KAZA 2HF4A 1C0GA 4HY1A 1RGIA 1S22A 2QWLA 3K97A 4ASAA 2WI2A 4H81A 5AFUH 5AQUA 3Q5KA 3R4OA 2E8AA 5CE3A 5E84A 4GCZA 5AQYA 3MN6A 2IOQA 5AQQA 1Y8PA 2YEEA 2Q31A 4ASGA 4JASA 3A0YA 3B28A 3ATVA 2P9NB 4JAUA 2KHOA 2QWMA 1Y64A 5FPNA 3M1FA 4FL9A 2YKEA 2VWCA 1AH8A 4Z94A 2QWPA 3JXUA 5AQJA 1YSRA 3U2KA 1YT1A 1NGBA 4KBOA 3HYYA 4HZ0A 3OPDA 2P9PB 4L8ZA 4O0BA 4K41A 3TZ4A 4CZJA 4M63C 2A42A 3D36A 1NGEA 2FXUA 1Y4SA 2P9SA 3TU5A 2GWJA 2IWUA 4GGLA 4B6CA 3QTFA 2P9IA 4EMVA 1B3QA 4H0TB 4MOTA 4W7TA 4KTNA 4KSGA 2XX2A 2XHRA 1NHHA 4LWHA 4UROA 4CZEA 3J8AA 1RDWX 4H0VB 4AM7A 4R1FA 3R91A 3LDNA 3ZKBA 1GJVA 1MDUB 3OW6A 4NH7A 4I6MA 2BTZA 2YK2A 4FCQA 3D2EB 4CWRA 2O1UA 1J6ZA 3GIFA 5AQOA 1H7SA 5M4KA 2XJXA 3QDDA 1BGQA 2IORA 4E02A 2YI7A 1T44A 3LDPA 4JNEA 1LCUA 4B9QA 1TC6A 4XCJA 2HG1A 2V7ZA 5AFUA 4P7AA 5F3KA 4EM7A 5CTUA 3DGEA 3INXA 1K8KB 2A3ZA 3QFUA 4JN4A 1SQKA 1ID0A 3WHAA 3GIGA 1YSZA 2XDLA 4HXWA 2YE9A 2BREA 2YKIA 2ZBKB 4WUCA 2WI6A 3DXKB 4ZKIA 5D7RA 4V26A 2CG9A 4H03B 1YVNA 2QXLA 1TILA 3FZKA 3HBTA 4URNA 4HWIA 3BMYA 4B1VA 4HZ5A 4MPNA 1NGJA 3QMLA 5D7CA 4BQGA 1I59A 1IJJA 3MMVA 4FSVA 1UYDA 4I3HA 4GEEA 3EHFA 1UYCA 4LP0A 4EGKA 3CRLA 3LDLA 4NH9A 1ESVA 1U0ZA 2P9KA 3CIPA 4JD2B 4XTJA 1Y8OA 4BE7B 1UYEA 2WI3A 2BTFA 4XKKA 1RFQA 4BAEA 4EAHD 2FF3B 3FT8A 1ZXMA 2YE4A 3EKOA 3R4NA 4L91A 1AH6A 2VW5A 3A5NC 5CTXA 4FMTA 3H4LA 4CE2A 4B1WB 2YE8A 3M3ZA 3ULEA 1UYIA 3A0ZA 4YKXA 1EQYA 3I33A 1Y8NA 4H5VA 5F5RA 3LNUA 1KXPA 1UY9A 4MPCA 3R4PA 1KAYA 4PRXA 1XQSC 1Z5CA 2YK9A 3HZ5A 2WI1A 2P9SB 4XD8A 5AQKA 5AQZA 2XD6A 2WEQA 3TUHA 1NGCA 2CCUA 4K43A 4EFUA 3UB5A 1D4XA 2YI0A 2P9IB 3FZFA 1R62A 1LOTB 1QYEA 2BU6A 3T2SA 1TC0A 1ATSA 5AQIA 4CWSA 5IN9A 1YETA 2BSMA 4KFGA 3EKSA 4L94A 4H85A 3R4MA 5F2RA 4PL7A 4PKGA 4MPEA 4L93A 3FZLA 2Q2EB 4ZVIA 1NLVA 2Q0UA 3LDQA 2XDSA 4CWPA 5IDMA 1NGDA 4PL9A 4HXZA 4XITA 2BYIA 4K4OA 2XK2A 3DXMA 2QWOA 3HZ1A 5AQFA 1U2VA 5AQGA 4P8OA 1YXQA 2PNRA 5FPMA 4XKOA 3L6QA 5CTWA 3B27A 4U7OA 4XJXA 2BU8A 3A0RA 3RKZA 2C2AA 3CI5A 5EVZA 1DEJA 2JKIA 2XCMA 1BA0A 1NWKA 3U8XA 3GIGB 3B25A 4XC0A 3U9DA 3INWA 2V52B 3KVGA 4BIUA 4XEIA 2WUSA 2YGFA 2A41A 3U2DA 2ASPA 4R3AA 3TZ2A 4EFHA 3ZXOA 4AWPA 4BQJA 1BUPA 5F0XA 4H0XB 4GFNA 2XHTA 5GGZA 1MU5A 1UYLA 3A0XA 4E00A 5J6AA 4CZMA 2XX5A 1YESA 2YKBA 4MBCA 2YEHA 1ZXNA 1YAGA 1BA1A 4CZIA 4CZGA 2P9KB 5BPLA 4LWFA 1QZ5A 1TYQA 1I5CA 4KP4A 3UKRA 4FO0A 3K60A 4X9LA 2CGFA 1GKZA 4WUBA 4B1UB 2YE5A 2VYPA 4H5WA 5D7DA 1P8ZA 3G7BA 4CZHA 4EGHA 1ZWHA 2H55A 2VCPA 3ULEB 3D2RA 4QPKA 3CQXA 3FZHA 2GWKA 2GQPA 4LWGA 2K5BA 1DKGD 2P9LA 4KQVA 5AQHA 1UYHA 4JHDA 3OWBA 1NGIA 2D1KA 3C7NA 4BECA 3HEKA 2YEDA 4B1XB 4O09A 2BU5A 1NGAA 2GFDA 3D2FA 4CE3A 1IXMA 3DAWA 1I5DA 2JJCA 3O2FA 1UY8A 4AWOA 3A0TA 5M4EA 3EHHA 4HY6A 3TPQA 1AJ6A 4CBWA 1JCEA 3M6GA 3ATUA 1TBWA 2EXLA 4YKZA 1THNA 4U93A 4YKTA 5D6QA 1YS3A 3TTZA 3LPSA 3A5MC 3BUZB 4XIQA 2Q8FA 3ZKDA 2ASOA 4DUHA 3VHCA 4H0YB 3T1KA 2HKJA 2XHXA 1E4GT 3FZMA 4XE2A 2QG0A 3SL2A 1YC1A 2BT0A 4ASFA 3JZ3A 4EFTA 2YEGA 2VCIA 3HYZA 5ADXH 1JM6A 1HPMA 5F1XA 2BU2A 5CF0A 3Q5JA 4ASBA 2XDUA 3A8YA 1YC3A 4MB9A 4CE1A 1GKXA 1NGHA 3HHUA 4NH8A 2YE2A 4XCLA 4CWFA 4A2BA 4B1YB 3G7EA 3SJHA 5BN8A 5EY4A 3RLPA 3H80A 1I58A 2HF3A 4B1ZA 1HJOA 3GDQA 2FWYA 2H8MA 3CGYA 2YGAA 1EI1A 4CWTA 2QF6A 1E4FT 4J8FA 3UKUA 3EKRA 1JCGA 1UYFA 4QPJA 4B7PA 3D2EA 2WI4A 2O1WA 2YI5A 2BYHA 1QY8A 2YE6A 4YKRA 2HHIA 4HYPA 1ATNA 2FF6A 2FYPA 3RLRA 2QWNA 2P9UA 2XABA 1TYQB 2YE3A 2WI5A 3O0IA 5FNFA 5FPEA 3UKRB 2Q0RA 4I6MB 4BEBA 5M4NA 5CTYA 1K8KA 3CHWA 4A2AA 5FNDA 3HSCA 4FCRA 1OSFA 1YT0A 3QB0A 3MN7A 5BPNA 5BPMA 4AM6A 4XIRA 3TZ0A 1YUWA 1U2OA 4O04A 2V7YA 4H5TA 4BXIA 4EGIA 4URLA 4R3MA 2P9LB 4AWQA 1BKNA 1ZW9A 4FCPA 5TKYA 4CBUA 4CZKA 4PKIA 2Q97A 2YJEA 3GL1A 2WEPA 2FTKA 3T0ZA 3EHJA 2WI7A 1NGFA 3C7NB 5JENA 1NMDA 1Z5AA 4XKAA 3R92A 2ZWHA 3CWVA 5EX5A 2IWXA 5AR0A 2YGEA 3D2FB 4PU9A 2QW9A 3MN9A 4E01A 2ZKJA 4AS9A 4YKYA 3L4IA 5AQWA 5ADXA 4JD2A 1UYGA 1S3XA 1KZNA 4MP7A 5BN9A 2E0AA 1YERA 1QZ6A 1QQOA 1L0OA 2ZDYA 4GQTA 3C0EA 3FV5A 3RSEA 3OWDA 3FFKB 5FWKA 3LDOA 2CCSA 2XX4A 2YECA 2Q8GA 1UY6A 1QQMA 3RLQA 3O6OA 1NHJA 3B24A 2YJFA 3GIEA 2QFOA 4JQLA 3ZM7A 4FPPA 1UYKA 5AQSA 4CBXA 4O05A 2XJGA 2QWQA 4CZFA 4E72A 3A5LC 3LMMA 1JCFA 3K99A 4MP2A 5AQLA 2ZDXA 4URMA 2ASMA 2E88A 2Q8HA 1H1VA 3U67A 1C0FA 3CRKA 3EKUA 3WEEA 5AQXA 1MX0A 3IUCA 3T10A 2O1VA 2W00A 3MN5A 3UE5A 4Q20A 1H7UA 3T0HA 3CGZA 5M4HA 5D6PA 3S5TA 3Q5LA 4I5SA 3QFPA 2IWSA 5JLFA 1BYQA 2YEFA 3VHDA 1UY7A 1B62A 2C1IA 3UKUB 4H5RA 2YKJA 4LPBA 5FPDA 4XIPA 3G75A 1QQNA 4DZYA 2XDKA 5IDJA 5AQMA 1I5BA 4CWNA 1F51A 4JAVA 1TH8A 4BIZA 1HX1A 3NMQA 2Q8IA 2P9UB 2VCJA 3U4LA 3WQ9A 2P9NA 2YI6A 3OMUA 4GY2B 2Q36A 2FXSA 4HYMA 1Z5BA 1QZRA 3BM9A 2QWRA 3EL2A 1YC4A 5J71A 4PL8A 3W3DA 5C93A 1TIDA 3PEJA 5BOCA 1ATRA 1HLUA 4RTFD 3CJCA 1NHIA 3DXMB 2P9PA 3D0BA 2WERA 5AQNA 2Q1NA 1U2VB 4YKWA 2XJJA 2YJXA 3EHGA 5AQTA 4CZLA 2UWDA 1BXDA 3IEDA 1WUAA 2HCHA 4V25A 3AY9A 3DWLA 3CYGA 2CCTA 5L3JA 4XDMA 2BUPA 3A5OC 5BODA 4PKHA 4CI6A 2CH4A 4EEHA 2FWZA 1NGGA 5M4PA 2YJWA 1Y4UA 1KIJA 2BZ5A 3C11A 3B26A 1S14A 4CWOA 5EXWA 3A0WA 3VADA 1US7A 2YEJA 3RSEB 1Z59A 2HMPA 2YEAA 4GNIA 5I9EB 4KSHA 5JLHA 4H7QA 5CPHA 2YKCA
chains in the Genus database with same CATH topology
5JENA 2HHIA 3S5TA 3CYGA 4E72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEN A;  2HHI A;  3S5T A;  3CYG A;  4E72 A; 
#chains in the Genus database with same CATH topology
 1PVG A;  3ZXQ A;  3MNR P;  2A40 A;  2A5X A;  4RWT A;  2YEI A;  3FT5 A;  5AQP A;  1UYM A;  4WYB A;  2YEB A;  1KAX A;  2BRC A;  4PRV A;  5AQV A;  3PEH A;  1A4H A;  4K42 A;  1NM1 A;  1AMW A;  5AQR A;  4LWE A;  1YT2 A;  2XDX A;  5M4M A;  2BU7 A;  1AM1 A;  1EA6 A;  4L90 A;  4LWI A;  4YKU A;  4O07 A;  3DXK A;  4H5N A;  3TZ5 A;  2OAN A;  2YE7 A;  3KE6 A;  2AKP A;  2ESA A;  2IOP A;  3U9Z A;  3VHA A;  5FNC A;  4WUD A;  4CWQ A;  3CJB A;  4IO8 A;  3WEE B;  2QG2 A;  3K98 A;  2V51 B;  4JHD B;  2PAV A;  4YKQ A;  4GT8 A;  2C1G A;  1MA9 B;  1B63 A;  2PBD A;  3FE1 A;  4U7N A;  1I5A A;  1S16 A;  1KAZ A;  2HF4 A;  1C0G A;  4HY1 A;  1RGI A;  1S22 A;  2QWL A;  3K97 A;  4ASA A;  2WI2 A;  4H81 A;  5AFU H;  5AQU A;  3Q5K A;  3R4O A;  2E8A A;  5CE3 A;  5E84 A;  4GCZ A;  5AQY A;  3MN6 A;  2IOQ A;  5AQQ A;  1Y8P A;  2YEE A;  2Q31 A;  4ASG A;  4JAS A;  3A0Y A;  3B28 A;  3ATV A;  2P9N B;  4JAU A;  2KHO A;  2QWM A;  1Y64 A;  5FPN A;  3M1F A;  4FL9 A;  2YKE A;  2VWC A;  1AH8 A;  4Z94 A;  2QWP A;  3JXU A;  5AQJ A;  1YSR A;  3U2K A;  1YT1 A;  1NGB A;  4KBO A;  3HYY A;  4HZ0 A;  3OPD A;  2P9P B;  4L8Z A;  4O0B A;  4K41 A;  3TZ4 A;  4CZJ A;  4M63 C;  2A42 A;  3D36 A;  1NGE A;  2FXU A;  1Y4S A;  2P9S A;  3TU5 A;  2GWJ A;  2IWU A;  4GGL A;  4B6C A;  3QTF A;  2P9I A;  4EMV A;  1B3Q A;  4H0T B;  4MOT A;  4W7T A;  4KTN A;  4KSG A;  2XX2 A;  2XHR A;  1NHH A;  4LWH A;  4URO A;  4CZE A;  3J8A A;  1RDW X;  4H0V B;  4AM7 A;  4R1F A;  3R91 A;  3LDN A;  3ZKB A;  1GJV A;  1MDU B;  3OW6 A;  4NH7 A;  4I6M A;  2BTZ A;  2YK2 A;  4FCQ A;  3D2E B;  4CWR A;  2O1U A;  1J6Z A;  3GIF A;  5AQO A;  1H7S A;  5M4K A;  2XJX A;  3QDD A;  1BGQ A;  2IOR A;  4E02 A;  2YI7 A;  1T44 A;  3LDP A;  4JNE A;  1LCU A;  4B9Q A;  1TC6 A;  4XCJ A;  2HG1 A;  2V7Z A;  5AFU A;  4P7A A;  5F3K A;  4EM7 A;  5CTU A;  3DGE A;  3INX A;  1K8K B;  2A3Z A;  3QFU A;  4JN4 A;  1SQK A;  1ID0 A;  3WHA A;  3GIG A;  1YSZ A;  2XDL A;  4HXW A;  2YE9 A;  2BRE A;  2YKI A;  2ZBK B;  4WUC A;  2WI6 A;  3DXK B;  4ZKI A;  5D7R A;  4V26 A;  2CG9 A;  4H03 B;  1YVN A;  2QXL A;  1TIL A;  3FZK A;  3HBT A;  4URN A;  4HWI A;  3BMY A;  4B1V A;  4HZ5 A;  4MPN A;  1NGJ A;  3QML A;  5D7C A;  4BQG A;  1I59 A;  1IJJ A;  3MMV A;  4FSV A;  1UYD A;  4I3H A;  4GEE A;  3EHF A;  1UYC A;  4LP0 A;  4EGK A;  3CRL A;  3LDL A;  4NH9 A;  1ESV A;  1U0Z A;  2P9K A;  3CIP A;  4JD2 B;  4XTJ A;  1Y8O A;  4BE7 B;  1UYE A;  2WI3 A;  2BTF A;  4XKK A;  1RFQ A;  4BAE A;  4EAH D;  2FF3 B;  3FT8 A;  1ZXM A;  2YE4 A;  3EKO A;  3R4N A;  4L91 A;  1AH6 A;  2VW5 A;  3A5N C;  5CTX A;  4FMT A;  3H4L A;  4CE2 A;  4B1W B;  2YE8 A;  3M3Z A;  3ULE A;  1UYI A;  3A0Z A;  4YKX A;  1EQY A;  3I33 A;  1Y8N A;  4H5V A;  5F5R A;  3LNU A;  1KXP A;  1UY9 A;  4MPC A;  3R4P A;  1KAY A;  4PRX A;  1XQS C;  1Z5C A;  2YK9 A;  3HZ5 A;  2WI1 A;  2P9S B;  4XD8 A;  5AQK A;  5AQZ A;  2XD6 A;  2WEQ A;  3TUH A;  1NGC A;  2CCU A;  4K43 A;  4EFU A;  3UB5 A;  1D4X A;  2YI0 A;  2P9I B;  3FZF A;  1R62 A;  1LOT B;  1QYE A;  2BU6 A;  3T2S A;  1TC0 A;  1ATS A;  5AQI A;  4CWS A;  5IN9 A;  1YET A;  2BSM A;  4KFG A;  3EKS A;  4L94 A;  4H85 A;  3R4M A;  5F2R A;  4PL7 A;  4PKG A;  4MPE A;  4L93 A;  3FZL A;  2Q2E B;  4ZVI A;  1NLV A;  2Q0U A;  3LDQ A;  2XDS A;  4CWP A;  5IDM A;  1NGD A;  4PL9 A;  4HXZ A;  4XIT A;  2BYI A;  4K4O A;  2XK2 A;  3DXM A;  2QWO A;  3HZ1 A;  5AQF A;  1U2V A;  5AQG A;  4P8O A;  1YXQ A;  2PNR A;  5FPM A;  4XKO A;  3L6Q A;  5CTW A;  3B27 A;  4U7O A;  4XJX A;  2BU8 A;  3A0R A;  3RKZ A;  2C2A A;  3CI5 A;  5EVZ A;  1DEJ A;  2JKI A;  2XCM A;  1BA0 A;  1NWK A;  3U8X A;  3GIG B;  3B25 A;  4XC0 A;  3U9D A;  3INW A;  2V52 B;  3KVG A;  4BIU A;  4XEI A;  2WUS A;  2YGF A;  2A41 A;  3U2D A;  2ASP A;  4R3A A;  3TZ2 A;  4EFH A;  3ZXO A;  4AWP A;  4BQJ A;  1BUP A;  5F0X A;  4H0X B;  4GFN A;  2XHT A;  5GGZ A;  1MU5 A;  1UYL A;  3A0X A;  4E00 A;  5J6A A;  4CZM A;  2XX5 A;  1YES A;  2YKB A;  4MBC A;  2YEH A;  1ZXN A;  1YAG A;  1BA1 A;  4CZI A;  4CZG A;  2P9K B;  5BPL A;  4LWF A;  1QZ5 A;  1TYQ A;  1I5C A;  4KP4 A;  3UKR A;  4FO0 A;  3K60 A;  4X9L A;  2CGF A;  1GKZ A;  4WUB A;  4B1U B;  2YE5 A;  2VYP A;  4H5W A;  5D7D A;  1P8Z A;  3G7B A;  4CZH A;  4EGH A;  1ZWH A;  2H55 A;  2VCP A;  3ULE B;  3D2R A;  4QPK A;  3CQX A;  3FZH A;  2GWK A;  2GQP A;  4LWG A;  2K5B A;  1DKG D;  2P9L A;  4KQV A;  5AQH A;  1UYH A;  4JHD A;  3OWB A;  1NGI A;  2D1K A;  3C7N A;  4BEC A;  3HEK A;  2YED A;  4B1X B;  4O09 A;  2BU5 A;  1NGA A;  2GFD A;  3D2F A;  4CE3 A;  1IXM A;  3DAW A;  1I5D A;  2JJC A;  3O2F A;  1UY8 A;  4AWO A;  3A0T A;  5M4E A;  3EHH A;  4HY6 A;  3TPQ A;  1AJ6 A;  4CBW A;  1JCE A;  3M6G A;  3ATU A;  1TBW A;  2EXL A;  4YKZ A;  1THN A;  4U93 A;  4YKT A;  5D6Q A;  1YS3 A;  3TTZ A;  3LPS A;  3A5M C;  3BUZ B;  4XIQ A;  2Q8F A;  3ZKD A;  2ASO A;  4DUH A;  3VHC A;  4H0Y B;  3T1K A;  2HKJ A;  2XHX A;  1E4G T;  3FZM A;  4XE2 A;  2QG0 A;  3SL2 A;  1YC1 A;  2BT0 A;  4ASF A;  3JZ3 A;  4EFT A;  2YEG A;  2VCI A;  3HYZ A;  5ADX H;  1JM6 A;  1HPM A;  5F1X A;  2BU2 A;  5CF0 A;  3Q5J A;  4ASB A;  2XDU A;  3A8Y A;  1YC3 A;  4MB9 A;  4CE1 A;  1GKX A;  1NGH A;  3HHU A;  4NH8 A;  2YE2 A;  4XCL A;  4CWF A;  4A2B A;  4B1Y B;  3G7E A;  3SJH A;  5BN8 A;  5EY4 A;  3RLP A;  3H80 A;  1I58 A;  2HF3 A;  4B1Z A;  1HJO A;  3GDQ A;  2FWY A;  2H8M A;  3CGY A;  2YGA A;  1EI1 A;  4CWT A;  2QF6 A;  1E4F T;  4J8F A;  3UKU A;  3EKR A;  1JCG A;  1UYF A;  4QPJ A;  4B7P A;  3D2E A;  2WI4 A;  2O1W A;  2YI5 A;  2BYH A;  1QY8 A;  2YE6 A;  4YKR A;  2HHI A;  4HYP A;  1ATN A;  2FF6 A;  2FYP A;  3RLR A;  2QWN A;  2P9U A;  2XAB A;  1TYQ B;  2YE3 A;  2WI5 A;  3O0I A;  5FNF A;  5FPE A;  3UKR B;  2Q0R A;  4I6M B;  4BEB A;  5M4N A;  5CTY A;  1K8K A;  3CHW A;  4A2A A;  5FND A;  3HSC A;  4FCR A;  1OSF A;  1YT0 A;  3QB0 A;  3MN7 A;  5BPN A;  5BPM A;  4AM6 A;  4XIR A;  3TZ0 A;  1YUW A;  1U2O A;  4O04 A;  2V7Y A;  4H5T A;  4BXI A;  4EGI A;  4URL A;  4R3M A;  2P9L B;  4AWQ A;  1BKN A;  1ZW9 A;  4FCP A;  5TKY A;  4CBU A;  4CZK A;  4PKI A;  2Q97 A;  2YJE A;  3GL1 A;  2WEP A;  2FTK A;  3T0Z A;  3EHJ A;  2WI7 A;  1NGF A;  3C7N B;  5JEN A;  1NMD A;  1Z5A A;  4XKA A;  3R92 A;  2ZWH A;  3CWV A;  5EX5 A;  2IWX A;  5AR0 A;  2YGE A;  3D2F B;  4PU9 A;  2QW9 A;  3MN9 A;  4E01 A;  2ZKJ A;  4AS9 A;  4YKY A;  3L4I A;  5AQW A;  5ADX A;  4JD2 A;  1UYG A;  1S3X A;  1KZN A;  4MP7 A;  5BN9 A;  2E0A A;  1YER A;  1QZ6 A;  1QQO A;  1L0O A;  2ZDY A;  4GQT A;  3C0E A;  3FV5 A;  3RSE A;  3OWD A;  3FFK B;  5FWK A;  3LDO A;  2CCS A;  2XX4 A;  2YEC A;  2Q8G A;  1UY6 A;  1QQM A;  3RLQ A;  3O6O A;  1NHJ A;  3B24 A;  2YJF A;  3GIE A;  2QFO A;  4JQL A;  3ZM7 A;  4FPP A;  1UYK A;  5AQS A;  4CBX A;  4O05 A;  2XJG A;  2QWQ A;  4CZF A;  4E72 A;  3A5L C;  3LMM A;  1JCF A;  3K99 A;  4MP2 A;  5AQL A;  2ZDX A;  4URM A;  2ASM A;  2E88 A;  2Q8H A;  1H1V A;  3U67 A;  1C0F A;  3CRK A;  3EKU A;  3WEE A;  5AQX A;  1MX0 A;  3IUC A;  3T10 A;  2O1V A;  2W00 A;  3MN5 A;  3UE5 A;  4Q20 A;  1H7U A;  3T0H A;  3CGZ A;  5M4H A;  5D6P A;  3S5T A;  3Q5L A;  4I5S A;  3QFP A;  2IWS A;  5JLF A;  1BYQ A;  2YEF A;  3VHD A;  1UY7 A;  1B62 A;  2C1I A;  3UKU B;  4H5R A;  2YKJ A;  4LPB A;  5FPD A;  4XIP A;  3G75 A;  1QQN A;  4DZY A;  2XDK A;  5IDJ A;  5AQM A;  1I5B A;  4CWN A;  1F51 A;  4JAV A;  1TH8 A;  4BIZ A;  1HX1 A;  3NMQ A;  2Q8I A;  2P9U B;  2VCJ A;  3U4L A;  3WQ9 A;  2P9N A;  2YI6 A;  3OMU A;  4GY2 B;  2Q36 A;  2FXS A;  4HYM A;  1Z5B A;  1QZR A;  3BM9 A;  2QWR A;  3EL2 A;  1YC4 A;  5J71 A;  4PL8 A;  3W3D A;  5C93 A;  1TID A;  3PEJ A;  5BOC A;  1ATR A;  1HLU A;  4RTF D;  3CJC A;  1NHI A;  3DXM B;  2P9P A;  3D0B A;  2WER A;  5AQN A;  2Q1N A;  1U2V B;  4YKW A;  2XJJ A;  2YJX A;  3EHG A;  5AQT A;  4CZL A;  2UWD A;  1BXD A;  3IED A;  1WUA A;  2HCH A;  4V25 A;  3AY9 A;  3DWL A;  3CYG A;  2CCT A;  5L3J A;  4XDM A;  2BUP A;  3A5O C;  5BOD A;  4PKH A;  4CI6 A;  2CH4 A;  4EEH A;  2FWZ A;  1NGG A;  5M4P A;  2YJW A;  1Y4U A;  1KIJ A;  2BZ5 A;  3C11 A;  3B26 A;  1S14 A;  4CWO A;  5EXW A;  3A0W A;  3VAD A;  1US7 A;  2YEJ A;  3RSE B;  1Z59 A;  2HMP A;  2YEA A;  4GNI A;  5I9E B;  4KSH A;  5JLH A;  4H7Q A;  5CPH A;  2YKC A; 
#chains in the Genus database with same CATH homology
 5JEN A;  2HHI A;  3S5T A;  3CYG A;  4E72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...