2HHIA

The solution structure of antigen mpt64 from mycobacterium tuberculosis defines a novel class of beta-grasp proteins
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
204
structure length
204
Chain Sequence
PKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of Antigen MPT64 from Mycobacterium tuberculosis Defines a New Family of Beta-Grasp Proteins.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Immunogenic protein MPT64
total genus 25
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 2hhiA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 2hhiA02
4E72A 2HHIA 3CYGA 3S5TA 5JENA
chains in the Genus database with same CATH superfamily
1NGGA 3FZHA 3D2EA 4AM6A 5F5RA 3EHJA 4M63C 4QPKA 1NGFA 4V26A 1Z5CA 3T2SA 5FPEA 2XDXA 1AM1A 5AQQA 4H5RA 4U7OA 3S5TA 1UYGA 4URNA 2WERA 2XDSA 3A0ZA 4CE3A 1NGHA 3EHFA 1YESA 2YKBA 3HYZA 1D4XA 3OWBA 4ZKIA 2C1IA 2IWUA 1Y8NA 3RSEA 3K97A 3T0ZA 4EFTA 1H1VA 4CZKA 4HY1A 2HKJA 2XDUA 3EKOA 4B6CA 4FMTA 1H7SA 1US7A 1TYQA 3O0IA 1IXMA 2ZKJA 5JENA 1BKNA 2WI6A 1HX1A 2FF3B 4K41A 4LPBA 5CE3A 4X9LA 3ZXQA 1QZRA 5AR0A 5AQGA 5JLHA 4O05A 2QF6A 5BPMA 4YKXA 1HLUA 3CQXA 2KHOA 2IWXA 4H5WA 2BU7A 2QXLA 5F2RA 4HWIA 3Q5KA 2VWCA 4EGHA 3ZKDA 4B7PA 5M4MA 2XCMA 4RWTA 2IOQA 2HHIA 4GCZA 4R1FA 4CZJA 3B26A 5BODA 3J8AA 3UKRA 2W00A 4NH8A 2QWRA 3EKSA 3GIGB 3HYYA 1EQYA 2PAVA 1BA0A 4U93A 4EAHD 1I58A 4PKHA 1IJJA 3QTFA 3CHWA 2YJWA 4RTFD 3QFPA 4I5SA 2YI7A 4BECA 5AQKA 5BN9A 4U7NA 2K5BA 4XITA 2IOPA 5C93A 1BXDA 5AQMA 4H0VB 5CTXA 1UYIA 4GGLA 1RGIA 3TUHA 1AJ6A 2YE6A 4HZ0A 2ASMA 2YKCA 2YKJA 3OPDA 1NM1A 1RFQA 2YJFA 4MBCA 3A5OC 5EXWA 4HXZA 3TZ4A 2ZDXA 4XCLA 1NGAA 3U67A 1UYCA 1Y8OA 2XABA 5D7CA 3M6GA 4KTNA 1UY9A 4E01A 3CI5A 4HYPA 2V52B 2EXLA 3TZ5A 3BMYA 2A40A 1UYFA 4JN4A 5FPNA 4CZFA 4MP2A 1YETA 4CBWA 4H5VA 1TC0A 2YEHA 2YE3A 5M4NA 4XTJA 4FCPA 3RSEB 1YVNA 1GJVA 4H03B 2A41A 5EY4A 5AFUH 2P9LB 5M4HA 3INWA 4B1ZA 2YE7A 2ZWHA 2WEPA 2QW9A 3GIFA 5CTYA 1TYQB 1JCFA 3CRLA 3H80A 3DGEA 1PVGA 3MN5A 4ASGA 2UWDA 4GY2B 5AQXA 1LCUA 2FXUA 1YSRA 1GKXA 3RLQA 3FZLA 3D2RA 4LWEA 3INXA 2YJXA 4XE2A 5FNDA 5BOCA 4QPJA 5IDJA 1K8KA 4JAUA 2YGEA 2WI2A 3A0RA 4MPCA 4EEHA 1E4GT 1ZWHA 1ATNA 2ASPA 4MB9A 4JD2A 2YE2A 4YKUA 4CWQA 4XJXA 4HZ5A 1UYKA 3A5LC 4L93A 3FT5A 1I5DA 4URMA 3UB5A 4XKAA 1S22A 5FPDA 3CWVA 5J6AA 5CTUA 2O1WA 5F0XA 4J8FA 2BT0A 1KXPA 2XJXA 3VHCA 3R91A 4XKKA 1Y64A 1OSFA 3JZ3A 4HYMA 4CWTA 1NGDA 4L8ZA 4AWOA 5AQRA 3WQ9A 2YJEA 3WEEB 2YEBA 4XC0A 4CZEA 5AQHA 1TC6A 1Z5AA 5L3JA 1H7UA 1QZ5A 2QWMA 3TZ0A 2WI5A 4H81A 5BPLA 1B62A 4KSHA 2A42A 1F51A 3LDPA 3NMQA 1BGQA 2FF6A 2QWLA 1NGEA 4H7QA 3EL2A 1C0FA 3B28A 4CE1A 3CGYA 4B1VA 4HXWA 4XEIA 4PKGA 4I3HA 4CZIA 2WI1A 1DEJA 4L91A 4EGKA 1Z5BA 1I5AA 5IN9A 2PBDA 2H55A 2YEFA 3RKZA 2XHRA 3HZ5A 2YGFA 2Q8HA 3WEEA 3I33A 3MN9A 4CE2A 1QQOA 1TILA 2BREA 4FCQA 1U2VB 1EI1A 2O1VA 3MNRP 2P9UA 3ZXOA 4H5TA 4YKZA 4PL8A 4YKTA 2HCHA 1Y4SA 3SL2A 1Y8PA 4MP7A 4BIZA 3KE6A 1ZW9A 4B1WB 5BPNA 2XK2A 3FFKB 3FZKA 3CYGA 4K42A 5FWKA 4ZVIA 2YEIA 4XD8A 4CZLA 3TTZA 2QG2A 3U2DA 4LP0A 3DXKA 4KSGA 3LDLA 3T1KA 3A0TA 1UYLA 3O6OA 4MOTA 1KAXA 4AWQA 4CWNA 3DAWA 2JJCA 3FT8A 2ASOA 4PL9A 4I6MB 5BN8A 2YI5A 1YUWA 2QG0A 2YEGA 5AQLA 3A5NC 4GQTA 4JHDA 2H8MA 5D6QA 3UKRB 4B9QA 4EGIA 5EX5A 2Q8GA 2O1UA 3UE5A 2HG1A 4BIUA 5M4EA 1YT2A 2YGAA 3GIEA 4BEBA 1ATRA 4FO0A 3EKRA 4O04A 5AQZA 3Q5LA 2CH4A 2QWOA 2XDLA 4XDMA 2P9NB 2CG9A 4JAVA 1P8ZA 2VYPA 2P9IB 2Q1NA 4BQGA 4BQJA 1UYMA 4BAEA 2V7ZA 2PNRA 3BUZB 4YKQA 2QWNA 1RDWX 3SJHA 4IO8A 2VW5A 2XX5A 1MA9B 2YECA 2XHTA 3LNUA 2E8AA 1S16A 1MX0A 3OWDA 4H5NA 1MU5A 1HJOA 1NGIA 2YEAA 1YC1A 2YEJA 4LWGA 4CZMA 2HF4A 5D7RA 1DKGD 4CZGA 2FYPA 4MPEA 4V25A 4WUCA 3VHAA 3OW6A 3L4IA 1KAZA 4O07A 4K4OA 2YK2A 2P9UB 3TU5A 4ASAA 2P9IA 3K98A 3A8YA 3B24A 2P9LA 5IDMA 4H0TB 5EVZA 4YKRA 2Q8FA 3T0HA 1BUPA 4P7AA 4EFHA 1JM6A 5D6PA 2XD6A 4JHDB 2P9SA 5AQVA 3G7EA 1AH8A 3L6QA 3U4LA 5FNCA 5CF0A 4KP4A 4CWPA 2XJGA 2GQPA 2E0AA 2WI3A 2E88A 3C7NB 3DXKB 3RLPA 3LDNA 2C2AA 5E84A 1NWKA 2WI4A 3HSCA 3UKUA 3H4LA 5F3KA 3WHAA 3AY9A 5D7DA 1KIJA 3PEJA 4GT8A 4ASFA 3IUCA 2YEDA 3HBTA 3U9ZA 1WUAA 4LWHA 3C7NA 2WEQA 2BU8A 2YKEA 3CJBA 1YC4A 1HPMA 2BTFA 3A0WA 1U2VA 3D36A 2Q97A 3O2FA 3M3ZA 4H0YB 4B1XB 2C1GA 2CCUA 2XX2A 5CPHA 4WUBA 4ASBA 1YT0A 2P9NA 5AQJA 1ATSA 5AQNA 5AQTA 2GFDA 5CTWA 4PRVA 1BYQA 4L94A 3GIGA 1NLVA 3KVGA 1B3QA 3A0XA 4FSVA 3JXUA 1I59A 3T10A 3R4MA 4JQLA 1YC3A 1ZXMA 2VCIA 3QDDA 3ZKBA 4Q20A 4AWPA 4URLA 1J6ZA 2QFOA 4MPNA 4XCJA 4WYBA 5JLFA 3R4PA 1Y4UA 4PRXA 4GFNA 4PL7A 3LDQA 3CJCA 4PKIA 5ADXH 4NH7A 3GDQA 2YKIA 4FL9A 4I6MA 4AM7A 3DWLA 1NHIA 1AMWA 4CWFA 1U0ZA 3DXMB 4XIQA 4K43A 2BYIA 1GKZA 3D2FA 3R4NA 2Q0UA 4BXIA 4CZHA 1NMDA 5F1XA 2YE5A 4EMVA 1TBWA 1L0OA 2IORA 3G75A 3MN6A 3B27A 3HEKA 5AQUA 3FV5A 5J71A 1S3XA 4HY6A 1U2OA 2YEEA 3K60A 3R92A 3DXMA 2YE8A 2P9SB 3U8XA 3GL1A 3EKUA 1YSZA 5GGZA 2BU5A 2Q8IA 4EM7A 1JCEA 2WI7A 4GNIA 4AS9A 4E02A 5AFUA 3W3DA 4R3MA 2GWJA 1YS3A 2Q0RA 3ATUA 3ULEA 4CI6A 5ADXA 4FPPA 3D2EB 3QFUA 3B25A 5I9EB 4CWSA 3C11A 4E00A 2ZBKB 4XIPA 3VADA 5FPMA 4CBUA 4L90A 3EHGA 5M4KA 1NGBA 4E72A 4H0XB 4O0BA 1THNA 4DUHA 5FNFA 4CWOA 2BU6A 2A5XA 3ULEB 1K8KB 2Q36A 3CIPA 2V51B 1S14A 2FWYA 4KBOA 3BM9A 4A2AA 1TH8A 4LWIA 2QWPA 1YAGA 1QY8A 2BRCA 2Q2EB 3M1FA 2FXSA 2BTZA 4W7TA 1QQNA 1ID0A 2JKIA 4GEEA 1A4HA 3QMLA 5AQWA 3QB0A 3C0EA 5AQPA 5M4PA 2GWKA 1TIDA 4Z94A 4H85A 2CGFA 4O09A 1YERA 3D0BA 5AQSA 3Q5JA 1LOTB 1NGJA 1QQMA 2QWQA 3TPQA 3K99A 2VCJA 4PU9A 1NGCA 3FE1A 4JASA 2HF3A 1KZNA 2FWZA 4FCRA 2HMPA 1ESVA 4JNEA 3UKUB 2YI6A 3HZ1A 1I5CA 1Z59A 1ZXNA 4NH9A 4LWFA 3MMVA 3D2FB 1UY7A 2P9PA 1UY8A 1R62A 4KQVA 4KFGA 3A5MC 1YXQA 4UROA 2XHXA 3ATVA 2AKPA 2BUPA 3HHUA 3CGZA 2CCTA 3PEHA 2BZ5A 2P9KA 2OANA 2ZDYA 1EA6A 2BU2A 3U2KA 4JD2B 5AQOA 4A2BA 3IEDA 3RLRA 1UYHA 2V7YA 2Q31A 1UY6A 3A0YA 5TKYA 1QZ6A 3R4OA 3FZMA 4BE7B 3U9DA 4B1UB 1T44A 4XIRA 1MDUB 1KAYA 2YE9A 4YKWA 3MN7A 1SQKA 3LPSA 2BSMA 2P9KB 1B63A 5AQYA 1NHJA 3OMUA 3CRKA 4WUDA 1QYEA 2BYHA 3ZM7A 1E4FT 2P9PB 4R3AA 3EHHA 4P8OA 2XX4A 1YT1A 4DZYA 2YE4A 1XQSC 3LMMA 2YK9A 4B1YB 3LDOA 2WUSA 1JCGA 2D1KA 2XJJA 1UYEA 2A3ZA 3TZ2A 5AQFA 4CBXA 1AH6A 1NHHA 1C0GA 4YKYA 3VHDA 3G7BA 1BA1A 5AQIA 2ESAA 2FTKA 1I5BA 4XKOA 2YI0A 4CWRA 2CCSA 2IWSA 1UYDA 2VCPA 3FZFA 2XDKA 4EFUA
chains in the Genus database with same CATH topology
4E72A 2HHIA 3CYGA 3S5TA 5JENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E72 A;  2HHI A;  3CYG A;  3S5T A;  5JEN A; 
#chains in the Genus database with same CATH topology
 1NGG A;  3FZH A;  3D2E A;  4AM6 A;  5F5R A;  3EHJ A;  4M63 C;  4QPK A;  1NGF A;  4V26 A;  1Z5C A;  3T2S A;  5FPE A;  2XDX A;  1AM1 A;  5AQQ A;  4H5R A;  4U7O A;  3S5T A;  1UYG A;  4URN A;  2WER A;  2XDS A;  3A0Z A;  4CE3 A;  1NGH A;  3EHF A;  1YES A;  2YKB A;  3HYZ A;  1D4X A;  3OWB A;  4ZKI A;  2C1I A;  2IWU A;  1Y8N A;  3RSE A;  3K97 A;  3T0Z A;  4EFT A;  1H1V A;  4CZK A;  4HY1 A;  2HKJ A;  2XDU A;  3EKO A;  4B6C A;  4FMT A;  1H7S A;  1US7 A;  1TYQ A;  3O0I A;  1IXM A;  2ZKJ A;  5JEN A;  1BKN A;  2WI6 A;  1HX1 A;  2FF3 B;  4K41 A;  4LPB A;  5CE3 A;  4X9L A;  3ZXQ A;  1QZR A;  5AR0 A;  5AQG A;  5JLH A;  4O05 A;  2QF6 A;  5BPM A;  4YKX A;  1HLU A;  3CQX A;  2KHO A;  2IWX A;  4H5W A;  2BU7 A;  2QXL A;  5F2R A;  4HWI A;  3Q5K A;  2VWC A;  4EGH A;  3ZKD A;  4B7P A;  5M4M A;  2XCM A;  4RWT A;  2IOQ A;  2HHI A;  4GCZ A;  4R1F A;  4CZJ A;  3B26 A;  5BOD A;  3J8A A;  3UKR A;  2W00 A;  4NH8 A;  2QWR A;  3EKS A;  3GIG B;  3HYY A;  1EQY A;  2PAV A;  1BA0 A;  4U93 A;  4EAH D;  1I58 A;  4PKH A;  1IJJ A;  3QTF A;  3CHW A;  2YJW A;  4RTF D;  3QFP A;  4I5S A;  2YI7 A;  4BEC A;  5AQK A;  5BN9 A;  4U7N A;  2K5B A;  4XIT A;  2IOP A;  5C93 A;  1BXD A;  5AQM A;  4H0V B;  5CTX A;  1UYI A;  4GGL A;  1RGI A;  3TUH A;  1AJ6 A;  2YE6 A;  4HZ0 A;  2ASM A;  2YKC A;  2YKJ A;  3OPD A;  1NM1 A;  1RFQ A;  2YJF A;  4MBC A;  3A5O C;  5EXW A;  4HXZ A;  3TZ4 A;  2ZDX A;  4XCL A;  1NGA A;  3U67 A;  1UYC A;  1Y8O A;  2XAB A;  5D7C A;  3M6G A;  4KTN A;  1UY9 A;  4E01 A;  3CI5 A;  4HYP A;  2V52 B;  2EXL A;  3TZ5 A;  3BMY A;  2A40 A;  1UYF A;  4JN4 A;  5FPN A;  4CZF A;  4MP2 A;  1YET A;  4CBW A;  4H5V A;  1TC0 A;  2YEH A;  2YE3 A;  5M4N A;  4XTJ A;  4FCP A;  3RSE B;  1YVN A;  1GJV A;  4H03 B;  2A41 A;  5EY4 A;  5AFU H;  2P9L B;  5M4H A;  3INW A;  4B1Z A;  2YE7 A;  2ZWH A;  2WEP A;  2QW9 A;  3GIF A;  5CTY A;  1TYQ B;  1JCF A;  3CRL A;  3H80 A;  3DGE A;  1PVG A;  3MN5 A;  4ASG A;  2UWD A;  4GY2 B;  5AQX A;  1LCU A;  2FXU A;  1YSR A;  1GKX A;  3RLQ A;  3FZL A;  3D2R A;  4LWE A;  3INX A;  2YJX A;  4XE2 A;  5FND A;  5BOC A;  4QPJ A;  5IDJ A;  1K8K A;  4JAU A;  2YGE A;  2WI2 A;  3A0R A;  4MPC A;  4EEH A;  1E4G T;  1ZWH A;  1ATN A;  2ASP A;  4MB9 A;  4JD2 A;  2YE2 A;  4YKU A;  4CWQ A;  4XJX A;  4HZ5 A;  1UYK A;  3A5L C;  4L93 A;  3FT5 A;  1I5D A;  4URM A;  3UB5 A;  4XKA A;  1S22 A;  5FPD A;  3CWV A;  5J6A A;  5CTU A;  2O1W A;  5F0X A;  4J8F A;  2BT0 A;  1KXP A;  2XJX A;  3VHC A;  3R91 A;  4XKK A;  1Y64 A;  1OSF A;  3JZ3 A;  4HYM A;  4CWT A;  1NGD A;  4L8Z A;  4AWO A;  5AQR A;  3WQ9 A;  2YJE A;  3WEE B;  2YEB A;  4XC0 A;  4CZE A;  5AQH A;  1TC6 A;  1Z5A A;  5L3J A;  1H7U A;  1QZ5 A;  2QWM A;  3TZ0 A;  2WI5 A;  4H81 A;  5BPL A;  1B62 A;  4KSH A;  2A42 A;  1F51 A;  3LDP A;  3NMQ A;  1BGQ A;  2FF6 A;  2QWL A;  1NGE A;  4H7Q A;  3EL2 A;  1C0F A;  3B28 A;  4CE1 A;  3CGY A;  4B1V A;  4HXW A;  4XEI A;  4PKG A;  4I3H A;  4CZI A;  2WI1 A;  1DEJ A;  4L91 A;  4EGK A;  1Z5B A;  1I5A A;  5IN9 A;  2PBD A;  2H55 A;  2YEF A;  3RKZ A;  2XHR A;  3HZ5 A;  2YGF A;  2Q8H A;  3WEE A;  3I33 A;  3MN9 A;  4CE2 A;  1QQO A;  1TIL A;  2BRE A;  4FCQ A;  1U2V B;  1EI1 A;  2O1V A;  3MNR P;  2P9U A;  3ZXO A;  4H5T A;  4YKZ A;  4PL8 A;  4YKT A;  2HCH A;  1Y4S A;  3SL2 A;  1Y8P A;  4MP7 A;  4BIZ A;  3KE6 A;  1ZW9 A;  4B1W B;  5BPN A;  2XK2 A;  3FFK B;  3FZK A;  3CYG A;  4K42 A;  5FWK A;  4ZVI A;  2YEI A;  4XD8 A;  4CZL A;  3TTZ A;  2QG2 A;  3U2D A;  4LP0 A;  3DXK A;  4KSG A;  3LDL A;  3T1K A;  3A0T A;  1UYL A;  3O6O A;  4MOT A;  1KAX A;  4AWQ A;  4CWN A;  3DAW A;  2JJC A;  3FT8 A;  2ASO A;  4PL9 A;  4I6M B;  5BN8 A;  2YI5 A;  1YUW A;  2QG0 A;  2YEG A;  5AQL A;  3A5N C;  4GQT A;  4JHD A;  2H8M A;  5D6Q A;  3UKR B;  4B9Q A;  4EGI A;  5EX5 A;  2Q8G A;  2O1U A;  3UE5 A;  2HG1 A;  4BIU A;  5M4E A;  1YT2 A;  2YGA A;  3GIE A;  4BEB A;  1ATR A;  4FO0 A;  3EKR A;  4O04 A;  5AQZ A;  3Q5L A;  2CH4 A;  2QWO A;  2XDL A;  4XDM A;  2P9N B;  2CG9 A;  4JAV A;  1P8Z A;  2VYP A;  2P9I B;  2Q1N A;  4BQG A;  4BQJ A;  1UYM A;  4BAE A;  2V7Z A;  2PNR A;  3BUZ B;  4YKQ A;  2QWN A;  1RDW X;  3SJH A;  4IO8 A;  2VW5 A;  2XX5 A;  1MA9 B;  2YEC A;  2XHT A;  3LNU A;  2E8A A;  1S16 A;  1MX0 A;  3OWD A;  4H5N A;  1MU5 A;  1HJO A;  1NGI A;  2YEA A;  1YC1 A;  2YEJ A;  4LWG A;  4CZM A;  2HF4 A;  5D7R A;  1DKG D;  4CZG A;  2FYP A;  4MPE A;  4V25 A;  4WUC A;  3VHA A;  3OW6 A;  3L4I A;  1KAZ A;  4O07 A;  4K4O A;  2YK2 A;  2P9U B;  3TU5 A;  4ASA A;  2P9I A;  3K98 A;  3A8Y A;  3B24 A;  2P9L A;  5IDM A;  4H0T B;  5EVZ A;  4YKR A;  2Q8F A;  3T0H A;  1BUP A;  4P7A A;  4EFH A;  1JM6 A;  5D6P A;  2XD6 A;  4JHD B;  2P9S A;  5AQV A;  3G7E A;  1AH8 A;  3L6Q A;  3U4L A;  5FNC A;  5CF0 A;  4KP4 A;  4CWP A;  2XJG A;  2GQP A;  2E0A A;  2WI3 A;  2E88 A;  3C7N B;  3DXK B;  3RLP A;  3LDN A;  2C2A A;  5E84 A;  1NWK A;  2WI4 A;  3HSC A;  3UKU A;  3H4L A;  5F3K A;  3WHA A;  3AY9 A;  5D7D A;  1KIJ A;  3PEJ A;  4GT8 A;  4ASF A;  3IUC A;  2YED A;  3HBT A;  3U9Z A;  1WUA A;  4LWH A;  3C7N A;  2WEQ A;  2BU8 A;  2YKE A;  3CJB A;  1YC4 A;  1HPM A;  2BTF A;  3A0W A;  1U2V A;  3D36 A;  2Q97 A;  3O2F A;  3M3Z A;  4H0Y B;  4B1X B;  2C1G A;  2CCU A;  2XX2 A;  5CPH A;  4WUB A;  4ASB A;  1YT0 A;  2P9N A;  5AQJ A;  1ATS A;  5AQN A;  5AQT A;  2GFD A;  5CTW A;  4PRV A;  1BYQ A;  4L94 A;  3GIG A;  1NLV A;  3KVG A;  1B3Q A;  3A0X A;  4FSV A;  3JXU A;  1I59 A;  3T10 A;  3R4M A;  4JQL A;  1YC3 A;  1ZXM A;  2VCI A;  3QDD A;  3ZKB A;  4Q20 A;  4AWP A;  4URL A;  1J6Z A;  2QFO A;  4MPN A;  4XCJ A;  4WYB A;  5JLF A;  3R4P A;  1Y4U A;  4PRX A;  4GFN A;  4PL7 A;  3LDQ A;  3CJC A;  4PKI A;  5ADX H;  4NH7 A;  3GDQ A;  2YKI A;  4FL9 A;  4I6M A;  4AM7 A;  3DWL A;  1NHI A;  1AMW A;  4CWF A;  1U0Z A;  3DXM B;  4XIQ A;  4K43 A;  2BYI A;  1GKZ A;  3D2F A;  3R4N A;  2Q0U A;  4BXI A;  4CZH A;  1NMD A;  5F1X A;  2YE5 A;  4EMV A;  1TBW A;  1L0O A;  2IOR A;  3G75 A;  3MN6 A;  3B27 A;  3HEK A;  5AQU A;  3FV5 A;  5J71 A;  1S3X A;  4HY6 A;  1U2O A;  2YEE A;  3K60 A;  3R92 A;  3DXM A;  2YE8 A;  2P9S B;  3U8X A;  3GL1 A;  3EKU A;  1YSZ A;  5GGZ A;  2BU5 A;  2Q8I A;  4EM7 A;  1JCE A;  2WI7 A;  4GNI A;  4AS9 A;  4E02 A;  5AFU A;  3W3D A;  4R3M A;  2GWJ A;  1YS3 A;  2Q0R A;  3ATU A;  3ULE A;  4CI6 A;  5ADX A;  4FPP A;  3D2E B;  3QFU A;  3B25 A;  5I9E B;  4CWS A;  3C11 A;  4E00 A;  2ZBK B;  4XIP A;  3VAD A;  5FPM A;  4CBU A;  4L90 A;  3EHG A;  5M4K A;  1NGB A;  4E72 A;  4H0X B;  4O0B A;  1THN A;  4DUH A;  5FNF A;  4CWO A;  2BU6 A;  2A5X A;  3ULE B;  1K8K B;  2Q36 A;  3CIP A;  2V51 B;  1S14 A;  2FWY A;  4KBO A;  3BM9 A;  4A2A A;  1TH8 A;  4LWI A;  2QWP A;  1YAG A;  1QY8 A;  2BRC A;  2Q2E B;  3M1F A;  2FXS A;  2BTZ A;  4W7T A;  1QQN A;  1ID0 A;  2JKI A;  4GEE A;  1A4H A;  3QML A;  5AQW A;  3QB0 A;  3C0E A;  5AQP A;  5M4P A;  2GWK A;  1TID A;  4Z94 A;  4H85 A;  2CGF A;  4O09 A;  1YER A;  3D0B A;  5AQS A;  3Q5J A;  1LOT B;  1NGJ A;  1QQM A;  2QWQ A;  3TPQ A;  3K99 A;  2VCJ A;  4PU9 A;  1NGC A;  3FE1 A;  4JAS A;  2HF3 A;  1KZN A;  2FWZ A;  4FCR A;  2HMP A;  1ESV A;  4JNE A;  3UKU B;  2YI6 A;  3HZ1 A;  1I5C A;  1Z59 A;  1ZXN A;  4NH9 A;  4LWF A;  3MMV A;  3D2F B;  1UY7 A;  2P9P A;  1UY8 A;  1R62 A;  4KQV A;  4KFG A;  3A5M C;  1YXQ A;  4URO A;  2XHX A;  3ATV A;  2AKP A;  2BUP A;  3HHU A;  3CGZ A;  2CCT A;  3PEH A;  2BZ5 A;  2P9K A;  2OAN A;  2ZDY A;  1EA6 A;  2BU2 A;  3U2K A;  4JD2 B;  5AQO A;  4A2B A;  3IED A;  3RLR A;  1UYH A;  2V7Y A;  2Q31 A;  1UY6 A;  3A0Y A;  5TKY A;  1QZ6 A;  3R4O A;  3FZM A;  4BE7 B;  3U9D A;  4B1U B;  1T44 A;  4XIR A;  1MDU B;  1KAY A;  2YE9 A;  4YKW A;  3MN7 A;  1SQK A;  3LPS A;  2BSM A;  2P9K B;  1B63 A;  5AQY A;  1NHJ A;  3OMU A;  3CRK A;  4WUD A;  1QYE A;  2BYH A;  3ZM7 A;  1E4F T;  2P9P B;  4R3A A;  3EHH A;  4P8O A;  2XX4 A;  1YT1 A;  4DZY A;  2YE4 A;  1XQS C;  3LMM A;  2YK9 A;  4B1Y B;  3LDO A;  2WUS A;  1JCG A;  2D1K A;  2XJJ A;  1UYE A;  2A3Z A;  3TZ2 A;  5AQF A;  4CBX A;  1AH6 A;  1NHH A;  1C0G A;  4YKY A;  3VHD A;  3G7B A;  1BA1 A;  5AQI A;  2ESA A;  2FTK A;  1I5B A;  4XKO A;  2YI0 A;  4CWR A;  2CCS A;  2IWS A;  1UYD A;  2VCP A;  3FZF A;  2XDK A;  4EFU A; 
#chains in the Genus database with same CATH homology
 4E72 A;  2HHI A;  3CYG A;  3S5T A;  5JEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...