2HHIA

The solution structure of antigen mpt64 from mycobacterium tuberculosis defines a novel class of beta-grasp proteins
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
204
structure length
204
Chain Sequence
PKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of Antigen MPT64 from Mycobacterium tuberculosis Defines a New Family of Beta-Grasp Proteins.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Unknown function
molecule keywords Immunogenic protein MPT64
total genus 25
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 2hhiA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 2hhiA02
3CYGA 3S5TA 2HHIA 4E72A 5JENA
chains in the Genus database with same CATH superfamily
3L6QA 5M4HA 3FZHA 4EMVA 3OMUA 4GY2B 2XABA 4LP0A 1UYIA 4FCRA 1YVNA 2BZ5A 1U2VA 4MPNA 1ZXMA 4PKHA 3CJBA 3UKUB 2BRCA 1EA6A 2HKJA 4H0YB 1TIDA 2ESAA 4CBXA 5AQSA 3U8XA 2WEPA 4Q20A 2Q0RA 2VW5A 2P9NA 3ATVA 2FXUA 1NHIA 3U67A 3EKSA 1YSRA 3IEDA 2AKPA 1Z5CA 2P9LA 4CZJA 4ZVIA 3TZ4A 4K41A 4MOTA 3Q5JA 4CZMA 4BIZA 5EVZA 4I5SA 4MPEA 2WI1A 3C7NB 4PRVA 3QFUA 2YE4A 3G7EA 1MDUB 2V52B 2Q8GA 4MP7A 2C1GA 3TZ0A 1NHJA 2PBDA 2UWDA 3CIPA 5AQYA 5AQZA 4BXIA 2XX5A 3ULEB 4DUHA 4P7AA 3OPDA 2GQPA 2Q31A 2YKEA 1MU5A 1UYLA 2XDLA 3D2EA 3U2KA 3EKUA 4JD2B 4B1VA 3GIGA 1S14A 4O05A 4WUBA 1AH6A 4PKGA 4QPJA 3AY9A 1LCUA 4CZEA 1TH8A 2QWLA 2E8AA 3HBTA 2XJGA 3OWDA 4EEHA 2Q97A 4MBCA 3A5MC 1QY8A 4CZHA 3CI5A 1TBWA 4CWNA 4KSHA 4EM7A 3EL2A 4JAUA 3A5OC 3ZKBA 1QYEA 3D2FA 4CZLA 2P9IA 4CWTA 4I3HA 2IORA 1U2VB 2Q0UA 5AQTA 5F2RA 2ASOA 5F3KA 1EI1A 1ATNA 3GDQA 4HXZA 1NGGA 2A41A 4HWIA 3TZ2A 3T0ZA 4U7NA 5D6PA 4QPKA 5CTYA 1HX1A 4GEEA 4CE2A 4WUCA 1TYQA 3EKOA 3BM9A 3Q5LA 2WI7A 2HMPA 2XDSA 2FWZA 5CPHA 3EHJA 1NM1A 3D36A 1AH8A 3O6OA 3PEHA 3S5TA 2ASPA 2XDXA 3DAWA 2P9PA 2Q8FA 4KQVA 1DEJA 4CWSA 5FNDA 4FMTA 3HHUA 1NGAA 3D2RA 2QWMA 1R62A 2YJFA 5CF0A 4URLA 4EGKA 3LMMA 3QFPA 4NH9A 4MP2A 3EHGA 1HJOA 2Q1NA 4KTNA 3TTZA 4H5WA 3W3DA 3GIGB 1TC0A 1GKZA 1YT0A 3UE5A 4HZ0A 5M4PA 2QW9A 1I58A 1UYGA 3O0IA 3DXMA 2BU7A 4EFHA 1Y4SA 2XJJA 3J8AA 3PEJA 3ATUA 5F5RA 3CGYA 5J71A 1BUPA 1NGIA 4JHDA 2GFDA 1NHHA 2ZDYA 5JLFA 3SL2A 1ZXNA 3C0EA 3NMQA 1NGCA 3TU5A 1NLVA 5AQMA 3M6GA 4HY1A 4BQJA 4O09A 4CWRA 4BEBA 3MMVA 5AQQA 3DXMB 3CQXA 4H0TB 1IJJA 3A0TA 4ZKIA 3JZ3A 1TYQB 2P9NB 4V25A 4E00A 3KVGA 4LWEA 3R4OA 4BE7B 1NGDA 1JCGA 1NMDA 3G7BA 4BQGA 2YE7A 1KAZA 2ZWHA 2C2AA 2BT0A 2W00A 2YE6A 1QZ6A 3JXUA 1GJVA 4XE2A 1B63A 4R3AA 4XIPA 1S22A 5FNFA 3T10A 4R3MA 3B24A 2HF4A 5JENA 3C7NA 3GL1A 1NGHA 2JKIA 5IDMA 3QDDA 1I5AA 3A0RA 2VWCA 2IWSA 4XKKA 2YKBA 1XQSC 1C0GA 3FZLA 2IWUA 5D6QA 3OW6A 3CWVA 1AM1A 2H8MA 1BGQA 2ZDXA 4K4OA 4K42A 5AQOA 2YEEA 3FZKA 3HSCA 2WEQA 2Q8HA 4H03B 4JD2A 3HYZA 2CCSA 4HZ5A 4YKXA 2P9SA 4PKIA 4YKWA 2OANA 2QG0A 1RGIA 4BAEA 2YEHA 3A5NC 5BN8A 2KHOA 2GWKA 2QFOA 2YEBA 4HY6A 3WHAA 4AWOA 4DZYA 3LNUA 4B1UB 3QB0A 2HF3A 3I33A 5FPNA 4LWGA 5M4KA 2BSMA 2XHTA 4YKRA 4LWFA 4FSVA 1UY7A 3RSEA 2O1WA 3R91A 1RFQA 4HXWA 2BREA 1HPMA 2A3ZA 3FZFA 4B1XB 3L4IA 1Y8OA 2VCJA 2XCMA 1K8KB 4L94A 4CWPA 4YKYA 4ASBA 3A5LC 5BN9A 4ASFA 4KBOA 3K98A 4XIRA 4U93A 4B1ZA 2YK2A 1AJ6A 2YKIA 1BA0A 2YE8A 4XKOA 4H7QA 4CBUA 4AWPA 4UROA 3VADA 5BPLA 3ULEA 2XD6A 4CWFA 2Q2EB 2PAVA 1US7A 4JHDB 3H80A 2FYPA 3CGZA 3R4PA 4RWTA 1SQKA 1NGFA 4XD8A 4CBWA 1P8ZA 3EHFA 2P9KA 3U2DA 4LPBA 2P9PB 1NGJA 5BOCA 4H5VA 2YE5A 4XCLA 3TZ5A 2VYPA 5AQIA 4L90A 4RTFD 4JN4A 4O07A 4GFNA 4XEIA 2D1KA 3LDOA 2BTZA 3HEKA 3SJHA 2WI4A 1Y8NA 4V26A 5AQHA 1ID0A 2YEAA 1GKXA 2CGFA 2YECA 4H0VB 1MA9B 4CZGA 1I5DA 4B9QA 2YJWA 2YEJA 4X9LA 3INWA 5ADXH 4XDMA 3MN6A 3G75A 5AR0A 3UKUA 3CYGA 1ZWHA 5EY4A 1UY8A 2GWJA 1DKGD 1QZRA 4URMA 4MPCA 4O0BA 2QF6A 4B1WB 4CWOA 3A0XA 3HZ1A 3ZM7A 2IOPA 2P9UB 4GNIA 2XX2A 3DGEA 5FWKA 2A42A 3C11A 3GIFA 1YSZA 4H81A 1NWKA 4FL9A 2XDKA 2YI0A 3KE6A 1UYCA 5M4EA 2WUSA 3IUCA 3OWBA 1A4HA 1BYQA 2YI6A 4O04A 3RLRA 5AFUA 5AQGA 2FTKA 2EXLA 3TPQA 3B26A 1THNA 4JQLA 5IN9A 4H0XB 3H4LA 2IWXA 3DXKB 3M1FA 4P8OA 2YJXA 2O1UA 3K99A 2YJEA 4B7PA 4CI6A 2O1VA 1E4GT 5J6AA 2WI2A 4PRXA 4BIUA 1KAXA 1QQNA 2BU8A 2XJXA 4I6MA 4EFUA 3T0HA 3DWLA 5AQXA 3LPSA 2Q8IA 1WUAA 1OSFA 2K5BA 3INXA 3A0ZA 3RKZA 1BKNA 1YC4A 4GGLA 3R92A 3D2EB 3MN7A 3FT5A 3RLQA 1S16A 3RLPA 4YKUA 2BUPA 3EHHA 2BYHA 4FO0A 4PL7A 1MX0A 4B6CA 3D0BA 5FPDA 1EQYA 2FWYA 1E4FT 1H7UA 5C93A 1Y4UA 2JJCA 4GQTA 4Z94A 2CCUA 5M4NA 4JAVA 1IXMA 2YI7A 5TKYA 3R4MA 5D7RA 3BUZB 1KAYA 2QWNA 4PU9A 2BU5A 2QWOA 2WI3A 3FZMA 5CTXA 2V7YA 3HYYA 1ZW9A 4GT8A 4U7OA 3GIEA 1F51A 4JASA 1UY9A 3FE1A 3MNRP 5AQUA 4H85A 3K97A 4PL8A 1H1VA 2C1IA 4NH7A 3CHWA 5AQPA 5AQVA 2BYIA 1Y64A 2YE9A 2YEGA 4XITA 2YEIA 2HHIA 3O2FA 1T44A 2YE2A 3FFKB 2YI5A 2YGEA 4MB9A 3VHDA 4XKAA 4H5RA 4WUDA 5AQNA 1I59A 4PL9A 5BPMA 3FV5A 5FPEA 2P9SB 5D7DA 1U2OA 4XCJA 2QXLA 3A0YA 1QQMA 5BODA 4I6MB 2P9KB 2FF6A 1RDWX 5F0XA 1NGEA 1KIJA 4W7TA 5AQRA 4B1YB 5AFUH 2QG2A 4YKQA 1Z5AA 4L91A 4GCZA 2XHXA 4XJXA 5F1XA 3VHCA 4XTJA 2WI5A 4CE1A 4AM6A 3ZKDA 1Y8PA 4HYPA 1I5CA 3T1KA 3Q5KA 1YXQA 4H5TA 5AQWA 3UKRA 4E01A 1UYMA 4IO8A 4H5NA 1YERA 3ZXQA 4ASGA 3D2FB 4EAHD 5L3JA 1I5BA 3ZXOA 2ZKJA 4BECA 5BPNA 1D4XA 2YEDA 1KXPA 1L0OA 4R1FA 2WI6A 5JLHA 2CCTA 1JCEA 3R4NA 3K60A 2BU6A 2YK9A 2E88A 2FF3B 2CH4A 3U9DA 1PVGA 5M4MA 3LDQA 3WEEA 2IOQA 1B3QA 1C0FA 2QWQA 3U4LA 5AQKA 1HLUA 2E0AA 3CRKA 5E84A 5FPMA 4K43A 4EGIA 1YAGA 2ASMA 3MN9A 4YKTA 4KSGA 2YE3A 2A40A 4AM7A 1YC3A 2VCIA 4HYMA 4FPPA 1JM6A 5ADXA 2QWRA 1YS3A 4FCPA 4KP4A 4URNA 2P9LB 3A8YA 3LDLA 5I9EB 4A2AA 2H55A 3B28A 1UYDA 1UYFA 1UYHA 2WERA 4YKZA 4FCQA 3T2SA 4AS9A 1LOTB 1J6ZA 5EXWA 1ATSA 2V51B 1AMWA 3BMYA 1S3XA 5FNCA 2BTFA 3LDPA 5EX5A 4XC0A 2YKCA 1YT2A 3LDNA 4LWIA 3RSEB 1Z5BA 5CTUA 1BXDA 4JNEA 3EKRA 1UYKA 4CE3A 4LWHA 3WQ9A 4A2BA 2YGAA 4AWQA 4E72A 1Z59A 4EFTA 4CZKA 3M3ZA 5D7CA 2XDUA 4E02A 1NGBA 3MN5A 2HG1A 4ASAA 1K8KA 2PNRA 5AQJA 3QTFA 4L93A 2XX4A 1QQOA 4J8FA 4M63C 1ATRA 3CRLA 1U0ZA 2V7ZA 1B62A 1ESVA 3QMLA 3U9ZA 1YETA 3DXKA 1UY6A 4WYBA 3CJCA 2P9IB 2FXSA 1JCFA 1YESA 5GGZA 1YUWA 4EGHA 2XK2A 3WEEB 2YKJA 3B25A 3HZ5A 3UKRB 5CE3A 2BU2A 5IDJA 4KFGA 2YGFA 2ZBKB 1BA1A 1H7SA 1TILA 3TUHA 2P9UA 4NH8A 1TC6A 5CTWA 1KZNA 1YT1A 3A0WA 2A5XA 2VCPA 3UB5A 2XHRA 1YC1A 2Q36A 5AQFA 4CZIA 3B27A 1QZ5A 2HCHA 5AQLA 4CWQA 2CG9A 4XIQA 2QWPA 4L8ZA 2YEFA 1UYEA 4CZFA 3FT8A 3VHAA
chains in the Genus database with same CATH topology
3CYGA 3S5TA 2HHIA 4E72A 5JENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYG A;  3S5T A;  2HHI A;  4E72 A;  5JEN A; 
#chains in the Genus database with same CATH topology
 3L6Q A;  5M4H A;  3FZH A;  4EMV A;  3OMU A;  4GY2 B;  2XAB A;  4LP0 A;  1UYI A;  4FCR A;  1YVN A;  2BZ5 A;  1U2V A;  4MPN A;  1ZXM A;  4PKH A;  3CJB A;  3UKU B;  2BRC A;  1EA6 A;  2HKJ A;  4H0Y B;  1TID A;  2ESA A;  4CBX A;  5AQS A;  3U8X A;  2WEP A;  4Q20 A;  2Q0R A;  2VW5 A;  2P9N A;  3ATV A;  2FXU A;  1NHI A;  3U67 A;  3EKS A;  1YSR A;  3IED A;  2AKP A;  1Z5C A;  2P9L A;  4CZJ A;  4ZVI A;  3TZ4 A;  4K41 A;  4MOT A;  3Q5J A;  4CZM A;  4BIZ A;  5EVZ A;  4I5S A;  4MPE A;  2WI1 A;  3C7N B;  4PRV A;  3QFU A;  2YE4 A;  3G7E A;  1MDU B;  2V52 B;  2Q8G A;  4MP7 A;  2C1G A;  3TZ0 A;  1NHJ A;  2PBD A;  2UWD A;  3CIP A;  5AQY A;  5AQZ A;  4BXI A;  2XX5 A;  3ULE B;  4DUH A;  4P7A A;  3OPD A;  2GQP A;  2Q31 A;  2YKE A;  1MU5 A;  1UYL A;  2XDL A;  3D2E A;  3U2K A;  3EKU A;  4JD2 B;  4B1V A;  3GIG A;  1S14 A;  4O05 A;  4WUB A;  1AH6 A;  4PKG A;  4QPJ A;  3AY9 A;  1LCU A;  4CZE A;  1TH8 A;  2QWL A;  2E8A A;  3HBT A;  2XJG A;  3OWD A;  4EEH A;  2Q97 A;  4MBC A;  3A5M C;  1QY8 A;  4CZH A;  3CI5 A;  1TBW A;  4CWN A;  4KSH A;  4EM7 A;  3EL2 A;  4JAU A;  3A5O C;  3ZKB A;  1QYE A;  3D2F A;  4CZL A;  2P9I A;  4CWT A;  4I3H A;  2IOR A;  1U2V B;  2Q0U A;  5AQT A;  5F2R A;  2ASO A;  5F3K A;  1EI1 A;  1ATN A;  3GDQ A;  4HXZ A;  1NGG A;  2A41 A;  4HWI A;  3TZ2 A;  3T0Z A;  4U7N A;  5D6P A;  4QPK A;  5CTY A;  1HX1 A;  4GEE A;  4CE2 A;  4WUC A;  1TYQ A;  3EKO A;  3BM9 A;  3Q5L A;  2WI7 A;  2HMP A;  2XDS A;  2FWZ A;  5CPH A;  3EHJ A;  1NM1 A;  3D36 A;  1AH8 A;  3O6O A;  3PEH A;  3S5T A;  2ASP A;  2XDX A;  3DAW A;  2P9P A;  2Q8F A;  4KQV A;  1DEJ A;  4CWS A;  5FND A;  4FMT A;  3HHU A;  1NGA A;  3D2R A;  2QWM A;  1R62 A;  2YJF A;  5CF0 A;  4URL A;  4EGK A;  3LMM A;  3QFP A;  4NH9 A;  4MP2 A;  3EHG A;  1HJO A;  2Q1N A;  4KTN A;  3TTZ A;  4H5W A;  3W3D A;  3GIG B;  1TC0 A;  1GKZ A;  1YT0 A;  3UE5 A;  4HZ0 A;  5M4P A;  2QW9 A;  1I58 A;  1UYG A;  3O0I A;  3DXM A;  2BU7 A;  4EFH A;  1Y4S A;  2XJJ A;  3J8A A;  3PEJ A;  3ATU A;  5F5R A;  3CGY A;  5J71 A;  1BUP A;  1NGI A;  4JHD A;  2GFD A;  1NHH A;  2ZDY A;  5JLF A;  3SL2 A;  1ZXN A;  3C0E A;  3NMQ A;  1NGC A;  3TU5 A;  1NLV A;  5AQM A;  3M6G A;  4HY1 A;  4BQJ A;  4O09 A;  4CWR A;  4BEB A;  3MMV A;  5AQQ A;  3DXM B;  3CQX A;  4H0T B;  1IJJ A;  3A0T A;  4ZKI A;  3JZ3 A;  1TYQ B;  2P9N B;  4V25 A;  4E00 A;  3KVG A;  4LWE A;  3R4O A;  4BE7 B;  1NGD A;  1JCG A;  1NMD A;  3G7B A;  4BQG A;  2YE7 A;  1KAZ A;  2ZWH A;  2C2A A;  2BT0 A;  2W00 A;  2YE6 A;  1QZ6 A;  3JXU A;  1GJV A;  4XE2 A;  1B63 A;  4R3A A;  4XIP A;  1S22 A;  5FNF A;  3T10 A;  4R3M A;  3B24 A;  2HF4 A;  5JEN A;  3C7N A;  3GL1 A;  1NGH A;  2JKI A;  5IDM A;  3QDD A;  1I5A A;  3A0R A;  2VWC A;  2IWS A;  4XKK A;  2YKB A;  1XQS C;  1C0G A;  3FZL A;  2IWU A;  5D6Q A;  3OW6 A;  3CWV A;  1AM1 A;  2H8M A;  1BGQ A;  2ZDX A;  4K4O A;  4K42 A;  5AQO A;  2YEE A;  3FZK A;  3HSC A;  2WEQ A;  2Q8H A;  4H03 B;  4JD2 A;  3HYZ A;  2CCS A;  4HZ5 A;  4YKX A;  2P9S A;  4PKI A;  4YKW A;  2OAN A;  2QG0 A;  1RGI A;  4BAE A;  2YEH A;  3A5N C;  5BN8 A;  2KHO A;  2GWK A;  2QFO A;  2YEB A;  4HY6 A;  3WHA A;  4AWO A;  4DZY A;  3LNU A;  4B1U B;  3QB0 A;  2HF3 A;  3I33 A;  5FPN A;  4LWG A;  5M4K A;  2BSM A;  2XHT A;  4YKR A;  4LWF A;  4FSV A;  1UY7 A;  3RSE A;  2O1W A;  3R91 A;  1RFQ A;  4HXW A;  2BRE A;  1HPM A;  2A3Z A;  3FZF A;  4B1X B;  3L4I A;  1Y8O A;  2VCJ A;  2XCM A;  1K8K B;  4L94 A;  4CWP A;  4YKY A;  4ASB A;  3A5L C;  5BN9 A;  4ASF A;  4KBO A;  3K98 A;  4XIR A;  4U93 A;  4B1Z A;  2YK2 A;  1AJ6 A;  2YKI A;  1BA0 A;  2YE8 A;  4XKO A;  4H7Q A;  4CBU A;  4AWP A;  4URO A;  3VAD A;  5BPL A;  3ULE A;  2XD6 A;  4CWF A;  2Q2E B;  2PAV A;  1US7 A;  4JHD B;  3H80 A;  2FYP A;  3CGZ A;  3R4P A;  4RWT A;  1SQK A;  1NGF A;  4XD8 A;  4CBW A;  1P8Z A;  3EHF A;  2P9K A;  3U2D A;  4LPB A;  2P9P B;  1NGJ A;  5BOC A;  4H5V A;  2YE5 A;  4XCL A;  3TZ5 A;  2VYP A;  5AQI A;  4L90 A;  4RTF D;  4JN4 A;  4O07 A;  4GFN A;  4XEI A;  2D1K A;  3LDO A;  2BTZ A;  3HEK A;  3SJH A;  2WI4 A;  1Y8N A;  4V26 A;  5AQH A;  1ID0 A;  2YEA A;  1GKX A;  2CGF A;  2YEC A;  4H0V B;  1MA9 B;  4CZG A;  1I5D A;  4B9Q A;  2YJW A;  2YEJ A;  4X9L A;  3INW A;  5ADX H;  4XDM A;  3MN6 A;  3G75 A;  5AR0 A;  3UKU A;  3CYG A;  1ZWH A;  5EY4 A;  1UY8 A;  2GWJ A;  1DKG D;  1QZR A;  4URM A;  4MPC A;  4O0B A;  2QF6 A;  4B1W B;  4CWO A;  3A0X A;  3HZ1 A;  3ZM7 A;  2IOP A;  2P9U B;  4GNI A;  2XX2 A;  3DGE A;  5FWK A;  2A42 A;  3C11 A;  3GIF A;  1YSZ A;  4H81 A;  1NWK A;  4FL9 A;  2XDK A;  2YI0 A;  3KE6 A;  1UYC A;  5M4E A;  2WUS A;  3IUC A;  3OWB A;  1A4H A;  1BYQ A;  2YI6 A;  4O04 A;  3RLR A;  5AFU A;  5AQG A;  2FTK A;  2EXL A;  3TPQ A;  3B26 A;  1THN A;  4JQL A;  5IN9 A;  4H0X B;  3H4L A;  2IWX A;  3DXK B;  3M1F A;  4P8O A;  2YJX A;  2O1U A;  3K99 A;  2YJE A;  4B7P A;  4CI6 A;  2O1V A;  1E4G T;  5J6A A;  2WI2 A;  4PRX A;  4BIU A;  1KAX A;  1QQN A;  2BU8 A;  2XJX A;  4I6M A;  4EFU A;  3T0H A;  3DWL A;  5AQX A;  3LPS A;  2Q8I A;  1WUA A;  1OSF A;  2K5B A;  3INX A;  3A0Z A;  3RKZ A;  1BKN A;  1YC4 A;  4GGL A;  3R92 A;  3D2E B;  3MN7 A;  3FT5 A;  3RLQ A;  1S16 A;  3RLP A;  4YKU A;  2BUP A;  3EHH A;  2BYH A;  4FO0 A;  4PL7 A;  1MX0 A;  4B6C A;  3D0B A;  5FPD A;  1EQY A;  2FWY A;  1E4F T;  1H7U A;  5C93 A;  1Y4U A;  2JJC A;  4GQT A;  4Z94 A;  2CCU A;  5M4N A;  4JAV A;  1IXM A;  2YI7 A;  5TKY A;  3R4M A;  5D7R A;  3BUZ B;  1KAY A;  2QWN A;  4PU9 A;  2BU5 A;  2QWO A;  2WI3 A;  3FZM A;  5CTX A;  2V7Y A;  3HYY A;  1ZW9 A;  4GT8 A;  4U7O A;  3GIE A;  1F51 A;  4JAS A;  1UY9 A;  3FE1 A;  3MNR P;  5AQU A;  4H85 A;  3K97 A;  4PL8 A;  1H1V A;  2C1I A;  4NH7 A;  3CHW A;  5AQP A;  5AQV A;  2BYI A;  1Y64 A;  2YE9 A;  2YEG A;  4XIT A;  2YEI A;  2HHI A;  3O2F A;  1T44 A;  2YE2 A;  3FFK B;  2YI5 A;  2YGE A;  4MB9 A;  3VHD A;  4XKA A;  4H5R A;  4WUD A;  5AQN A;  1I59 A;  4PL9 A;  5BPM A;  3FV5 A;  5FPE A;  2P9S B;  5D7D A;  1U2O A;  4XCJ A;  2QXL A;  3A0Y A;  1QQM A;  5BOD A;  4I6M B;  2P9K B;  2FF6 A;  1RDW X;  5F0X A;  1NGE A;  1KIJ A;  4W7T A;  5AQR A;  4B1Y B;  5AFU H;  2QG2 A;  4YKQ A;  1Z5A A;  4L91 A;  4GCZ A;  2XHX A;  4XJX A;  5F1X A;  3VHC A;  4XTJ A;  2WI5 A;  4CE1 A;  4AM6 A;  3ZKD A;  1Y8P A;  4HYP A;  1I5C A;  3T1K A;  3Q5K A;  1YXQ A;  4H5T A;  5AQW A;  3UKR A;  4E01 A;  1UYM A;  4IO8 A;  4H5N A;  1YER A;  3ZXQ A;  4ASG A;  3D2F B;  4EAH D;  5L3J A;  1I5B A;  3ZXO A;  2ZKJ A;  4BEC A;  5BPN A;  1D4X A;  2YED A;  1KXP A;  1L0O A;  4R1F A;  2WI6 A;  5JLH A;  2CCT A;  1JCE A;  3R4N A;  3K60 A;  2BU6 A;  2YK9 A;  2E88 A;  2FF3 B;  2CH4 A;  3U9D A;  1PVG A;  5M4M A;  3LDQ A;  3WEE A;  2IOQ A;  1B3Q A;  1C0F A;  2QWQ A;  3U4L A;  5AQK A;  1HLU A;  2E0A A;  3CRK A;  5E84 A;  5FPM A;  4K43 A;  4EGI A;  1YAG A;  2ASM A;  3MN9 A;  4YKT A;  4KSG A;  2YE3 A;  2A40 A;  4AM7 A;  1YC3 A;  2VCI A;  4HYM A;  4FPP A;  1JM6 A;  5ADX A;  2QWR A;  1YS3 A;  4FCP A;  4KP4 A;  4URN A;  2P9L B;  3A8Y A;  3LDL A;  5I9E B;  4A2A A;  2H55 A;  3B28 A;  1UYD A;  1UYF A;  1UYH A;  2WER A;  4YKZ A;  4FCQ A;  3T2S A;  4AS9 A;  1LOT B;  1J6Z A;  5EXW A;  1ATS A;  2V51 B;  1AMW A;  3BMY A;  1S3X A;  5FNC A;  2BTF A;  3LDP A;  5EX5 A;  4XC0 A;  2YKC A;  1YT2 A;  3LDN A;  4LWI A;  3RSE B;  1Z5B A;  5CTU A;  1BXD A;  4JNE A;  3EKR A;  1UYK A;  4CE3 A;  4LWH A;  3WQ9 A;  4A2B A;  2YGA A;  4AWQ A;  4E72 A;  1Z59 A;  4EFT A;  4CZK A;  3M3Z A;  5D7C A;  2XDU A;  4E02 A;  1NGB A;  3MN5 A;  2HG1 A;  4ASA A;  1K8K A;  2PNR A;  5AQJ A;  3QTF A;  4L93 A;  2XX4 A;  1QQO A;  4J8F A;  4M63 C;  1ATR A;  3CRL A;  1U0Z A;  2V7Z A;  1B62 A;  1ESV A;  3QML A;  3U9Z A;  1YET A;  3DXK A;  1UY6 A;  4WYB A;  3CJC A;  2P9I B;  2FXS A;  1JCF A;  1YES A;  5GGZ A;  1YUW A;  4EGH A;  2XK2 A;  3WEE B;  2YKJ A;  3B25 A;  3HZ5 A;  3UKR B;  5CE3 A;  2BU2 A;  5IDJ A;  4KFG A;  2YGF A;  2ZBK B;  1BA1 A;  1H7S A;  1TIL A;  3TUH A;  2P9U A;  4NH8 A;  1TC6 A;  5CTW A;  1KZN A;  1YT1 A;  3A0W A;  2A5X A;  2VCP A;  3UB5 A;  2XHR A;  1YC1 A;  2Q36 A;  5AQF A;  4CZI A;  3B27 A;  1QZ5 A;  2HCH A;  5AQL A;  4CWQ A;  2CG9 A;  4XIQ A;  2QWP A;  4L8Z A;  2YEF A;  1UYE A;  4CZF A;  3FT8 A;  3VHA A; 
#chains in the Genus database with same CATH homology
 3CYG A;  3S5T A;  2HHI A;  4E72 A;  5JEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...