2HHMA

Structure of inositol monophosphatase, the putative target of lithium therapy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
272
structure length
266
Chain Sequence
WQECMDYAVTLARQAGVVEAIKNEMNVMLKSSPVDLVTATDQKVEKLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLTELGSSRTPETVRVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structure of inositol monophosphatase, the putative target of lithium therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 266
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1992-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2hhmA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hhmA02
1NI9A 1YXIA 1K9YA 3KC0A 2OWZA 1FRPA 2FIEA 1RDXA 1LBVA 1IMFA 2R8TA 3IFCA 4GWWA 2WBDA 1RDYA 1NV3A 1RDZA 5IZ3A 1NV2A 1INPA 2FBPA 3KC1A 2CZIA 1FPLA 5LDZA 5FBPA 4H45A 3T0JA 2QVRA 4KXPA 3IFAA 2PCRA 5T3JA 1AWBA 1NV7A 1K9ZA 1LEVA 2QVUA 1EYKA 4AS5A 1NV4A 5ET8A 1KZ8A 5ET7A 1FBEA 2WEFA 1NV0A 1XI6A 1FBGA 1IMEA 3RPLA 1QGXA 1FJ9A 1YZ0A 2CZHA 4AS4A 2QVVA 2Y5KA 4H46A 5EQ8A 2Y5LA 1LBZA 3B8BA 4HE2A 4N81A 4PTKA 5F24A 1KA1A 4GBVA 2BJIA 4O7IA 1FPJA 4GX4A 3LV0A 3BIGA 4GWSA 4I3EA 1IMAA 1FBPA 2FVZA 2F3DA 5ET6A 5EQAA 5IZ1A 5J16A 5ESYA 1LBXA 4FBPA 2OX3A 4GWUA 2F3BA 1Q9DA 1FPEA 1EYJA 2FHYA 2P3NA 1FPGA 1VDWA 1YYZA 4GBWA 1IMBA 1NV5A 2VT5A 1NUWA 1JP4A 1SPIA 2CZKA 3ROJA 4I3YA 1NV1A 5EYGA 1FBFA 1KA0A 4GWXA 5EYHA 1IMCA 5IZ3B 1IMDA 3D1RA 2QFLA 2DDKA 1DCUA 2Q8MA 1FBDA 1FJ6A 3A29A 3FBPA 4HE0A 1D9QA 1DBZA 1NUZA 1NUYA 2FIXA 4G61A 5EQ9A 4IR8A 1CNQA 2WBBA 4GWZA 3QMFA 2Q74A 4GX6A 1LBYA 4HE1A 4QXDA 3RYDA 2GQ1A 3KBZA 1FPDA 5A5LA 5ET5A 4GX3A 1FPBA 2JJKA 2HHMA 1LBWA 1G0IA 4I40A 3BIHA 5EQ7A 3RPLB 5I3SA 1FPIA 1BK4A 1FBHA 1FPFA 1NV6A 3LUZA 4HXVA 1FPKA 1DK4A 1EYIA 4MJOA 1FSAA 1G0HA 1NUXA 1FBCA 1FTAA 5DW8A 2P3VA 4GWYA
chains in the Genus database with same CATH superfamily
2G93A 4PBHA 1P1NA 5FTHA 5M2VA 1INPA 3OSQA 4AB6A 2O84X 3K6VA 5LDZA 1GTKA 1SW1A 4KFQA 1AIVA 3C9HA 3VXBA 3K01A 3ZSFA 1JVYA 1B6HA 2HEUA 4WKMA 4TLLB 5FHMA 1M5EA 3MVXA 5K2XA 3FJGA 1CE2A 3LC8A 2R9JA 4F31B 3O2AA 3OEMA 5HBCA 2RCBA 2H25A 5L8DA 1MXZA 4PQJA 1R9QA 4OVTA 3K6UA 3U72A 4OVJA 1TFDA 3K1PA 2B3FA 1A40A 5ESYA 3MSTA 3EPEA 4RPNA 4XXUA 2MKZA 4DDDA 4G8NA 1LAXA 5AA2B 3UN6A 2NVUB 1SPIA 5ICTA 1Z7NE 2I58A 4EF1A 5I56A 1GVCA 4H8IA 4HW8A 4GVOA 3VVDA 2ZYMA 3H6VA 4GXAA 2Q74A 4MLVA 2UVIA 2HHMA 1US4A 3B6TA 1Y4CA 1A8EA 4EXKA 2H99A 4JSDA 3ZKKA 2HZLA 1AOVA 3TUSA 2VP1A 3KZGA 3TZAA 5EYFA 1PB9A 3DELB 1LBBA 1NI9A 4E0WA 2OWZA 1LBVA 2Q2CA 2OPEA 4P8BA 3VLUA 2Q89A 4RA1A 1EU8A 3CG3A 2UXAA 1NNKA 4U23A 2CEYA 2I4BA 1UTBB 3H6WA 4G68A 2V3TA 4M1VA 2OPDA 1GGGA 2DP8A 1USYE 1LGBC 4H0WA 2XXUA 1YPNA 1AMFA 3UP9A 2BJJX 1WDNA 3QSLA 4ZZAA 3B50A 5KCJA 1QGXA 2RC8A 4PAKA 3PGFA 3G3HA 1D4NA 4RY1A 1MDP1 1Q35A 5F24A 5H8FA 2CEXA 3TAJA 4DLDA 3OOAA 4GX4A 2V25A 4NF4B 1O63A 1HSLA 1MRPA 4R9GA 4RNSA 1I6BA 4GLIA 3U8QA 2P3NA 3O6IA 1ZJLA 3TTRA 1RYOA 3V83A 4DI3D 1NH7A 1MQHA 3R26A 1O64A 3O9PA 1ELJA 5AA4A 5TP9B 4YAHX 3DP6A 2QRYA 4R6YA 4KYSA 4ESWA 3N6TA 3TQLA 4NE4A 1FQCA 4HE1A 1L5TA 3K0VA 5K2YA 5ET5A 2KR0A 2VGQA 1SW5A 3RUMA 2NWJA 5TU0A 4OZ9A 4MAGA 3SEWA 3Q26A 2V84A 3C35A 3T9HB 4LP2B 4XKQA 2QS3A 4IO5A 2WBDA 1Y20A 4KHZE 3KC1A 5FBPA 3IJOB 5T3JA 2XXPA 3O6GA 4Q5TA 5DYHA 3T93B 1ZU0A 2WEFA 2PVUA 2XXIA 1BIYA 3FVKA 4P9KA 1IXHA 4GOTA 3IB1A 3KN8A 2FYIA 5I58B 4P11A 1UIVA 1Y4TA 3N5LA 2X7QA 3IR1A 1EZ9A 2XX8A 2VPOA 1MXXA 1B3GA 3G3GA 3KJ7A 4E0XA 5DEXA 5ITOA 1ZBMA 3GBBA 2GRVA 2OBGA 2HAUA 4BDMA 5LTCA 3MP1A 2AIXA 1DCUA 1B1XA 1FJ6A 1XVXA 3MWBA 1JW4A 1M5BA 4IR8A 4R6HA 1A7LA 3CI8A 1DMBA 1A99A 4PCDA 2XHDA 4EDPA 3H06B 2QL3A 1OIBA 3UIFA 4QFPA 4X48A 3KOTA 4ZEIA 5IKBA 2D21A 2PX1A 4XTCQ 1EYIA 4OWDA 3MBPA 4YB7A 1ZTYA 2DOJA 3A3CA 4GL8A 1FQAA 3MZBA 2V3QA 4YKJA 2CZIA 4NN3A 2M8CA 4ESXA 2QVRA 3N6UA 3K00A 1FQFA 5H8NB 2I49A 4Z7EA 3QK6A 3UORA 1B0HA 4QFLA 3VVEA 1KZ8A 3F11A 5I2NB 1N04A 3IL1B 1LFIA 1YZ0A 2DWJA 1OVTA 2XXQA 3SEUA 4JXIA 1JW1A 4N81A 1JNFA 4GBVA 2BJIA 2Y7KA 1FPJA 3FVGA 4IO6A 2AL4A 2DXRA 3EN3A 1Y1MA 4K3FA 1DTZA 3ZS6A 3LSWA 1N0TA 1XHYA 5A5XA 5B7DA 4QF9A 4ZE9A 3MPLA 1Z7ME 1N3WA 2OWTA 3KG2A 4H67A 5H8QB 3SESA 4U22A 2DS9A 3RGYA 4FECA 3UGWA 4ZECA 3IB0A 5EYGA 1MXWA 3FIRA 1A54A 2QFLA 1B7ZA 1MQIA 4GWZA 4G8MA 4QHQA 3MPKA 2F78A 3RYDA 3PMWA 1AL3A 3G7WA 1D9VA 4N17A 1QVSA 4EXLA 3RTWB 1Y3QA 3QUFA 1FPFA 1NV6A 4NMYA 1FPKA 2XWVA 2DE3A 3KFMA 4QFNA 4XKNA 4GWWA 1IMFA 3VDFA 4PDDA 1RDZA 4DZ1A 5KZTA 1FQEA 4DIGA 5H8HA 1Q1KA 3VLVA 4XFEA 4YKIA 2OJTA 1N7XA 5DT6A 3FATA 1FBGA 3W15C 1JW5A 4O3CA 2HCAA 2UVJA 3IX1A 4F3SA 5HM4B 2O1MA 1B3HA 3I5OA 1M5CA 1SW2A 4O7IA 4DXBA 4F1VA 4G77A 4N8YA 1B46A 1HSEA 3LSLA 3M3FA 1LBXA 2O51A 4N13A 3CG1A 4TQUQ 3D4GA 2DWHA 3T9VA 2OK2A 1PDAA 2Q9TA 4P0IA 2XD2A 2VT5A 1B58A 2I0CA 4YKKA 3H7MA 4L17A 2ABHA 2QMWA 4NWDA 4ELRA 3JV9A 2REJA 4G68B 3PU5A 2XWIA 4X8RA 1ZIUA 4GX3A 2NOOA 3A09A 5I59A 1JVXA 2HAVA 2O7UA 1M5FA 5L9OA 1FPIA 1FBHA 4POWA 3MQ9A 1VE4A 1DK4A 4KCDA 3T66A 5H8FB 1FQBA 4FEBA 3RN8A 2FNCA 4U4XA 3W9WA 2Y7IA 5IZ3A 4XF5A 3FASA 1FTMA 3K2DA 2ZZVA 1FTLA 3THIA 4PE3A 4R2FA 4JB7A 2QS2A 5AA4B 1LEVA 1UTHA 3IJXB 1NV4A 4BDQA 1II5A 1QUIA 2XXXA 3FZVA 3ONMA 2PBWA 4O3BA 1B52A 2Y5KA 3TCHA 2Y5LA 1LBZA 3B8BA 4I62A 3K1MA 4PP0A 5B70A 3OXNA 1ANFA 3G3KA 4AQ4A 4I3EA 3FV1A 3U65A 5J16A 3IK6B 5DVIA 3SEXA 3OMBA 3FXRA 4MNPA 4F29A 4O3AA 2YJPA 1P1QA 3R7XA 2PYYA 3PMVA 4F1YA 2QPQA 2ZNUA 3MP6A 4LQ5A 2ZXTA 4O8MA 2DWAA 4FAJA 1IMCA 1USYH 4OETA 2L5VA 3H4ZA 3S9NC 3A29A 1MXYA 5AA2D 1KWHA 1PC3A 5EQ9A 3CHGA 2O7IA 2Y84A 4F19A 3QUJA 4XIGQ 3P7IA 5HPQA 1B05A 3N26A 1TT1A 3B6QA 1MG1A 2XXVA 3UA8A 3KOSA 1OLAA 4NF6A 1MXVA 1FSAA 1G0HA 1NUXA 3WAEA 1FTAA 4ISUA 3EHUA 1N76A 2QS4A 3KN7A 2XX7A 1H3DA 3FXQA 1MDQA 3LSXA 1OLCA 1Y1ZA 1NNPA 3MZ9A 4G4PA 4WEPA 4XKRA 5DEXB 2ESNA 3TMGA 1DSNA 4LQ2A 1MPBA 4OQOA 3TDJA 5F7VA 4U1ZA 2E1SA 2X7PA 4ECFA 4N6PA 4QRZA 3VLWA 1B1HA 5DVJA 1SQYA 4C0RA 5DTBA 1IMAA 2XWKA 1B5HA 2F3DA 4FE8A 4MMPA 3MJNA 2F7BA 3IOWA 3TTLA 1FPGA 1SI1A 1EH3A 4QFKA 5FHOA 4F2OA 5IGAA 5EYHA 2CMOA 3O28A 1FTOA 3U93A 2RCAA 4OVPA 3VXCA 4LUBA 1NUYA 2FIXA 2ZYNA 2X26A 3PPRA 1OQGA 3FGSA 1WVJA 3E78A 1H45A 5ICQA 3M8UA 3VFJA 4OFLA 3C32A 4OEVA 3KJTA 3PPNA 1BK4A 1DPEA 1PBQA 4YU0A 4HXVA 1SI0A 4IGTA 4MCOA 3O6HA 4GL0A 4YB6A 4MJOA 5CMMA 1Y3PA 3HO7A 4JVDA 4P47A 2DE4A 3JZJA 4G68C 4KYDA 4N91A 1A55A 5AA1A 1OVBA 2A5TA 4PFWA 3IO4A 2PCRA 1NNTA 3LBSA 3NOHA 5I5PA 1IXIA 4ZEFA 3T22A 1IIWA 3DP4A 4ND9A 3OENA 3TCGA 5DVFA 1ZKBA 1NV0A 3OO8A 4Q8RA 1P1WA 3C34A 4AS4A 1B40A 2QVVA 3BFUA 3JYRA 2DVZA 4HE2A 2I3WA 2VPNA 1H44A 3G3JA 4EF2A 3FVOA 1MQDA 4MHFA 2XXRA 1H43A 5BUUA 1B7UA 3U1OA 3TFLA 2UYEA 2I4CA 4GWUA 2I48A 1EYJA 2E0SA 5CBSA 5IAIA 3ISPA 3ZKLA 3LSFB 4YKPA 4GFRA 4M4GA 4MBPA 1LAGE 4ZEDA 4NG7A 3QIMA 3OEKA 1O7TA 2F35A 5H8HB 3G3IA 4KD5A 3GZGA 2NXOA 3K02A 3RT8A 2PFZA 4NTLA 4LONB 1IUDA 4I9DA 4OVQA 2Q8JA 3KGCA 4JSOA 4GD5A 2F6GA 3OO9A 4OANA 4ELQA 3T9UA 5DW8A 3TTNA 3UK4A 5IM2A 3KSJA 5LOMA 3K6WA 5EHSA 2HPGA 2R8TA 4RK9A 3IOUA 2ZNSA 3SETA 1IXGA 3I3VA 3EKIA 2Y7WA 4LZ8A 1B2HA 4Q30B 4PE5B 1H76A 5ET8A 2H98A 3PPQA 4P1LA 2Z8EA 4YMAA 3VE1B 4MF3A 4U2RA 1TFAA 4H46A 1MH3A 4OXVA 1S7YA 1QKBA 1XOCA 2KQZA 4EQBA 1N84A 5I84A 5I59B 3M3KA 3E9XA 4IO7A 3H6UA 1B5IA 2FA7A 4ELOA 3CSGA 3G3FA 4FJPA 1I6QA 1VDWA 1BLFA 4IO2A 4GBWA 2HQ0A 1NUWA 1EZOA 2P2AA 4RYAA 5JTYA 1NV1A 3C31A 1MY3A 4KYEA 5IZ3B 4H5FA 1MH4A 1A8FA 3CVGA 2UYFA 3T1BA 2WBBA 4PGPA 1B5JA 5CC2A 4NEDA 3CFXA 1VFEA 1UTHB 3KSXA 3CIJA 2B3BA 4GXSB 4O94A 4PC9A 4QFOA 2D5WA 3A3UA 1B32A 1XS5A 3VV5A 1SBPA 1MQJA 3E13X 1BKAA 1P1OA 4PFIA 3FJ7A 2F6PA 1IEJA 4NGUA 3T0JA 1DTGA 4F3BA 3I6VA 2V93A 1LCFA 1LAFE 1VFDA 5EHMA 2OWSA 4NAPA 1IXCA 3RPLA 3ILTB 3OO7A 3RNNA 4LZ5A 2RC9A 3CFLA 5FTIA 5EQAA 5IZ1A 2ANJA 1POTA 4KQPA 5L9SA 1SW4A 3RTFB 3DM0A 4O7MA 2OX3A 1B51A 3SERA 5I56B 3FV2A 1LBCA 5I2KA 2DE2A 1YYZA 1ZLQA 2Z8FA 1J1NA 1TXFA 2GHBA 1JP4A 2QSXA 4UABA 4YICA 2WYKA 4GQOA 4PFBA 4MLQA 3IO6A 4ONYA 3H3GA 1I6AA 4R73A 3R6UA 2A5SA 5CI5A 3MC2A 4I1DA 3MYUA 3QAXA 2OZZA 4HE0A 4G2ZA 1NL5A 1P99A 1CNQA 1VSOA 4KR5A 1MY2A 2DWIA 1SYHA 4LVQA 3GBAA 4OTEA 3KBZA 2QJEA 4H1XA 4YZZA 1FPBA 3MVWA 2F8DA 3MAMA 2IA4A 4DXUA 1LB9A 1XT8A 2B4LA 3MZ1A 2B4MA 3PUYE 2B65A 4NF5A 4QSEA 4THIA 1K9YA 1FRPA 1RDXA 3SEVA 2HXRA 1DPPA 2RC7A 1MXUA 1FPLA 3LUYA 4ZE8A 4C1TA 1M5DA 3RT6B 1FCKA 5KCJB 1QULA 1NH8A 2LAOA 4BDLA 3OD7A 2VHAA 2REGA 4OMBA 3O66A 4OFOA 4OYVA 4DI4B 5I57A 3HFUA 4OVRA 1XVYA 2PT2A 2O6AA 1YCJA 3LV0A 1GV8A 3OELA 3CRBA 2VD3A 2QMXA 3Q27A 3K1NA 5JK4A 3S9LC 4IY5A 1ATGA 1B4ZA 4N6DA 3EHSA 1IMBA 4NHBA 3S9EA 2ALUA 3CR9A 3FJMA 1JEVA 2GH9A 4IO3A 2CZKA 3BBRA 4UA8A 2A5TB 2DYXA 1KA0A 1B3FA 3HCQA 3O97A 2Z8DA 2H5YA 2ONKE 2W7YA 1SDXA 3EQ1A 3CFZA 3Q29A 4LATA 4MH5A 2THIA 3C4MA 4OA4A 1URSA 3QMFA 3TKDA 4GX6A 2ZYKA 4OESA 3OO6A 4F39A 3D4CA 3HN0A 2O69A 3GLBA 3SKPA 4OFJA 4OENA 2WX9A 2XXWA 4F22A 1FQDA 3HHFA 2O68A 2OLBA 4BLAA 1NNFA 1FBCA 2P3VA 1LFGA 3C33A 2VOZA 3E4RA 1NFTA 2UVGA 4EUOA 3HHGA 2D3IA 3FXBA 1B7HA 4R74A 2R71A 2OCUA 4PGNA 4U4SA 4H45A 4MNIA 2Q2AA 4KXPA 1MPCA 1MY4A 3IFAA 2RKMA 3TPAA 2RF1A 4FATA 4AS5A 5CM6A 4QSCA 2VD2A 5ET7A 3HPIA 2F7CA 4BDOA 5EQ8A 4H5GA 1KA1A 4MIJA 2DXYA 4I8CA 5CMKA 2FVZA 5ELVA 2XWOA 4JVCA 4FEDA 3ODBA 4WXJA 4BDNA 5CMCA 5JEIA 1FPEA 3TELA 2CZLA 3RQTA 4X1DA 3IB2A 1UQWA 1LLSA 2ZYOA 1JETA 5H8SA 1POY1 4JWXA 1VR5A 4F3PA 3C36A 4NF8A 4AB5A 1TWYA 2NUVA 1T0KA 2XXKA 3TEPA 4OHNA 3Q28A 3CSBA 3FBPA 3O29A 1D9QA 1BP5A 1WODA 3USDA 2IEEA 4X9TA 4PETA 5AE4A 1LBYA 5A5LA 1FPDA 1B3EA 2WKYA 4H65A 2JJKA 3PD8A 4JBZA 4I40A 5I3SA 2HZKA 4GIZA 3AXFA 1OMPA 3QXMA 4NF0A 3MW0A 4GWYA 4POXA 3IAZA 1QJMA 3FUZA 2FIEA 3IFCA 3LR1A 1RDYA 1NV3A 3IOTA 3PTYA 5ISUA 1FW0A 2AL5A 5KDTA 1URDA 3PUZE 4IO4A 2ONRA 5TPAA 1SD3A 3K6XA 4DXCA 5JTYB 2PMSA 2F34A 1XI6A 5L9MA 1IMEA 2P1SA 1FJ9A 5CRYA 1IQ7A 3HV1A 5A5XB 4PTKA 5ET6A 1QUJA 3S4UA 3S2VA 4FBPA 4F18A 1NMUA 3MUQA 2F3BA 4PF6A 2Y7RA 4H6DA 4PFUA 1NV5A 4PFTA 1YAEA 4P56A 3FVNA 3TODA 1FBFA 4GWXA 3QYTA 4N4UA 2R6GE 4ZEBA 3VVFA 1RYXA 1MM7A 3V8XB 3RY3A 2XA5A 3H03A 2Q8MA 3W9VA 1MM6A 4X04A 1NUZA 1MPDA 2XXYA 3Q25A 3L6HA 2KLFA 4LA9A 3SZPA 4QBAA 2GHAA 1LBWA 3GYYA 1G0IA 2F7AA 4OERA 4BDRA 4F1UA 4LZ7A 3RPLB 1GR2A 3KN3A 5J1DA 4P1EA 1N3XA 3KEIA 1FTJA 1MY0A 5AA2A 3IORA 4N07A 3TQWA 2YLNA 2UVHA 2P0SA 2RINA 3SEYA 2Y7PA 5I2KB 4MNCA 4P0GA 2YPNA 1HSJA 1N7WA 3PUVE 2V3UA 1SYIA 1I69A 4ZS9A 4U1OA 3KBRA 5FHNA 2ONSA 4MEVA 4PDHA 3TCFA 3M3LA 4DE8A 4ZZEA 4GWSA 1FBPA 1LB8A 4PFYA 1R1NA 4GWOA 3U92A 1UTBA 4JWOA 2HXWA 4NF5B 1IZ1A 3V5AA 2PFYA 1PEBA 1B3LA 1B9JA 3OSRA 1IMDA 3D1RA 2DDKA 2H4IA 1FBDA 4U21A 3TTKA 4G61A 2AYSA 5CBRA 2I3VA 2XD3A 1US5A 1R6ZA 1PB8A 2F36A 1F9BA 1CB6A 4NF4A 4HCYA 1B0LA 5I57B 4HS7A 4XEQA 2XXHA 1R9LA 1FTKA 4YMBA 3DLNA 4ELPA 4G8HA 4IY6A 1S50A 5TP9A 3KC0A 1NKXA 3E79A 1LCTA 4PFRA 4RJZA 1NV2A 2FBPA 4IB2A 4Q0CA 4OVSA 2DQVA 2WYPA 3SDFA 1SVXB 4JDFA 1XC1A 3ILUB 1K9ZA 2ZMBA 2QVUA 1EYKA 3PD9A 2ZZWA 4WEDA 4FORA 1JEUA 4MX6A 4JWYA 1ZMGA 4RK2A 1B4HA 4PF8A 2F5XA 4R2BA 4Z0IA 4XKPA 3T96B 3K4UA 1AH5A 4ZEKA 4R6KA 3FD3A 1BTJA 1JQFA 2DSFA 4R72A 2Z23A 1Q9DA 3BFTA 2FHYA 3E3KA 3DP8A 4GF8A 3GXAA 2Q88A 1MQGA 3MVYA 3ROJA 1D9YA 4I3YA 5IZZA 3IOVA 2QS1A 4QSDA 5CMBA 4OEUA 5I58A 4NF6B 4HCWA 4QXDA 2Z22A 4N6KA 2G29A 2H9BA 3EHTA 3PMXA 4YB5A 3PPPA 3ECRA 4ZDMA 3BIHA 2PT1A 1QKAA 3PUXE 4UACA 2HFBA 1QW0A 3RPWA 1PBPA 2V4CA 4PAIA 4PBQA 1YXIA 1P1UA 1QUKA 2I6EA 4JVIA 4NWCA 4KCCA 4TOZA 5ITPA 2XXTA 2GFEA 3L6GA 3TTMA 4N15A 3T9XB 4HTGA 1UIUA 4F3GA 1AWBA 1NV7A 4NF8B 1LSTA 3B7DA 4RPOA 4MFIA 3U94A 1Y3NA 4EQ7A 3FXUA 3RLFE 4DCYA 2XX9A 3BKIB 1FBEA 4R75A 4R9FA 4IGRA 3S9MC 2CZHA 2F97A 1URGA 5I7IA 1LAHE 3TYHA 4C1UA 4EQ9A 3PUWE 1Y9UA 3BIGA 1EZPA 4FIMA 1DOTA 3EF7A 4TLMB 5F1QA 1IITA 4LN5A 5BWJA 4H8JA 4N8GA 1RKMA 5H8NA 4PAFA 3H6TA 2ZZXA 1PB7A 3WAFA 3V89B 1MY1A 2DVCA 4GRKA 3MVZA 2ZNTA 1MS7A 4NQ8A 3PV0E 1D3KA 4F2QA 3PPOA 5I2NA 1DBZA 5KDTB 4X1BA 3HSTA 2O1LA 5TPAB 1OQHA 2GQ1A 5AA3A 1YTVA 3N94A 3MP8A 5EQ7A 3B6WA 1LFHA 4KPTA 3LUZA 2I0BA 4NX1A 4DCXA 4KI0E 5H8QA 1S9TA 4RXLA 4P3LA
chains in the Genus database with same CATH topology
5IM2A 4PBHA 2HPGA 2FIEA 2R8TA 3IFCA 1IMFA 4GWWA 1RDYA 1NV3A 4PDDA 1RDZA 1INPA 3PTYA 5LDZA 3EKIA 4XFEA 5ET8A 4P1LA 1XI6A 1FBGA 1IMEA 1FJ9A 4H46A 4PTKA 4O7IA 2KQZA 4F1VA 4OVTA 4N8YA 5ET6A 5ESYA 1LBXA 3MSTA 4FBPA 4F18A 2F3BA 2MKZA 4PF6A 1VDWA 2Q9TA 4GBWA 1NV5A 2VT5A 1NUWA 1SPIA 4P56A 1NV1A 1FBFA 4GWXA 5IZ3B 4N4UA 2XA5A 2Q8MA 3W9VA 4X04A 1NUZA 3T1BA 2WBBA 2XWIA 4PGPA 4X8RA 2Q74A 3SZPA 4QBAA 4GX3A 2HHMA 1LBWA 3GYYA 4O94A 1G0IA 4PC9A 4F1UA 3RPLB 1FPIA 1FBHA 2HZLA 5J1DA 1DK4A 4P1EA 1NI9A 4PFIA 2OWZA 1LBVA 4P8BA 3W9WA 5IZ3A 4XF5A 2CEYA 4MNCA 4NGUA 3T0JA 2ZZVA 4M1VA 4PE3A 1LEVA 1NV4A 4NAPA 3B50A 3RPLA 1QGXA 4PAKA 2Y5KA 4MEVA 4PDHA 2Y5LA 1LBZA 3B8BA 5F24A 2CEXA 4GX4A 4I3EA 4GWSA 3U65A 1FBPA 5EQAA 5IZ1A 5J16A 4MNPA 4O7MA 2OX3A 2DE2A 2P3NA 1YYZA 2QPQA 4DI3D 1JP4A 4UABA 4YICA 2WYKA 4PFBA 4O8MA 2PFYA 1IMCA 1IMDA 3D1RA 2L5VA 2DDKA 3MYUA 1FBDA 3A29A 4HE0A 4G61A 5EQ9A 3CHGA 1CNQA 4F19A 4HE1A 3KBZA 5ET5A 2KR0A 4YZZA 1FPBA 4HCYA 4MAGA 4XEQA 2B4LA 2B4MA 1FSAA 1G0HA 1NUXA 1FTAA 1K9YA 3KC0A 1FRPA 1RDXA 2WBDA 3E79A 2HXRA 4PFRA 1NV2A 2FBPA 3KC1A 1FPLA 4OVSA 5FBPA 2WYPA 5T3JA 1K9ZA 2QVUA 1EYKA 2ZZWA 2WEFA 4MX6A 4DI4B 4P9KA 4PF8A 3HFUA 2F5XA 4OVRA 3LV0A 1IMAA 2XWKA 2F3DA 2VPOA 4MMPA 5JK4A 1Q9DA 2FHYA 4N6DA 1FPGA 1IMBA 4NHBA 5IGAA 2CZKA 3ROJA 4I3YA 5IZZA 1KA0A 5EYHA 4OVPA 5LTCA 1DCUA 1FJ6A 1NUYA 4OA4A 2FIXA 4IR8A 3QMFA 4PCDA 3E78A 4GX6A 4HCWA 4QXDA 4N6KA 3BIHA 1BK4A 2WX9A 4HXVA 4MCOA 1EYIA 4MJOA 2V4CA 1FBCA 2P3VA 4PAIA 4JVDA 4PBQA 1YXIA 4P47A 4JVIA 2DE4A 4N91A 3FXBA 2V3QA 2CZIA 4NN3A 4PGNA 4H45A 4MNIA 2QVRA 4KXPA 4N15A 3IFAA 2PCRA 3NOHA 1AWBA 1NV7A 5I5PA 4AS5A 5CM6A 1KZ8A 5ET7A 1FBEA 1NV0A 1YZ0A 2CZHA 4AS4A 2QVVA 2DVZA 5EQ8A 4HE2A 5I7IA 4N81A 1KA1A 4MIJA 4GBVA 2BJIA 2VPNA 1FPJA 3BIGA 2FVZA 4MHFA 2XWOA 4JVCA 4GWUA 4LN5A 1FPEA 1EYJA 4N8GA 3ISPA 4PAFA 2ZZXA 5EYGA 2XXKA 4NQ8A 4NG7A 2QFLA 3FBPA 1D9QA 1DBZA 4GWZA 4X9TA 4PETA 1LBYA 3RYDA 2GQ1A 5A5LA 1FPDA 2PFZA 2JJKA 4N17A 4I40A 5EQ7A 5I3SA 2HZKA 1FPFA 4OVQA 1NV6A 3LUZA 4NX1A 1FPKA 4NF0A 4OANA 2XWVA 2DE3A 5DW8A 4P3LA 4GWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI9 A;  1YXI A;  1K9Y A;  3KC0 A;  2OWZ A;  1FRP A;  2FIE A;  1RDX A;  1LBV A;  1IMF A;  2R8T A;  3IFC A;  4GWW A;  2WBD A;  1RDY A;  1NV3 A;  1RDZ A;  5IZ3 A;  1NV2 A;  1INP A;  2FBP A;  3KC1 A;  2CZI A;  1FPL A;  5LDZ A;  5FBP A;  4H45 A;  3T0J A;  2QVR A;  4KXP A;  3IFA A;  2PCR A;  5T3J A;  1AWB A;  1NV7 A;  1K9Z A;  1LEV A;  2QVU A;  1EYK A;  4AS5 A;  1NV4 A;  5ET8 A;  1KZ8 A;  5ET7 A;  1FBE A;  2WEF A;  1NV0 A;  1XI6 A;  1FBG A;  1IME A;  3RPL A;  1QGX A;  1FJ9 A;  1YZ0 A;  2CZH A;  4AS4 A;  2QVV A;  2Y5K A;  4H46 A;  5EQ8 A;  2Y5L A;  1LBZ A;  3B8B A;  4HE2 A;  4N81 A;  4PTK A;  5F24 A;  1KA1 A;  4GBV A;  2BJI A;  4O7I A;  1FPJ A;  4GX4 A;  3LV0 A;  3BIG A;  4GWS A;  4I3E A;  1IMA A;  1FBP A;  2FVZ A;  2F3D A;  5ET6 A;  5EQA A;  5IZ1 A;  5J16 A;  5ESY A;  1LBX A;  4FBP A;  2OX3 A;  4GWU A;  2F3B A;  1Q9D A;  1FPE A;  1EYJ A;  2FHY A;  2P3N A;  1FPG A;  1VDW A;  1YYZ A;  4GBW A;  1IMB A;  1NV5 A;  2VT5 A;  1NUW A;  1JP4 A;  1SPI A;  2CZK A;  3ROJ A;  4I3Y A;  1NV1 A;  5EYG A;  1FBF A;  1KA0 A;  4GWX A;  5EYH A;  1IMC A;  5IZ3 B;  1IMD A;  3D1R A;  2QFL A;  2DDK A;  1DCU A;  2Q8M A;  1FBD A;  1FJ6 A;  3A29 A;  3FBP A;  4HE0 A;  1D9Q A;  1DBZ A;  1NUZ A;  1NUY A;  2FIX A;  4G61 A;  5EQ9 A;  4IR8 A;  1CNQ A;  2WBB A;  4GWZ A;  3QMF A;  2Q74 A;  4GX6 A;  1LBY A;  4HE1 A;  4QXD A;  3RYD A;  2GQ1 A;  3KBZ A;  1FPD A;  5A5L A;  5ET5 A;  4GX3 A;  1FPB A;  2JJK A;  2HHM A;  1LBW A;  1G0I A;  4I40 A;  3BIH A;  5EQ7 A;  3RPL B;  5I3S A;  1FPI A;  1BK4 A;  1FBH A;  1FPF A;  1NV6 A;  3LUZ A;  4HXV A;  1FPK A;  1DK4 A;  1EYI A;  4MJO A;  1FSA A;  1G0H A;  1NUX A;  1FBC A;  1FTA A;  5DW8 A;  2P3V A;  4GWY A; 
#chains in the Genus database with same CATH topology
 2G93 A;  4PBH A;  1P1N A;  5FTH A;  5M2V A;  1INP A;  3OSQ A;  4AB6 A;  2O84 X;  3K6V A;  5LDZ A;  1GTK A;  1SW1 A;  4KFQ A;  1AIV A;  3C9H A;  3VXB A;  3K01 A;  3ZSF A;  1JVY A;  1B6H A;  2HEU A;  4WKM A;  4TLL B;  5FHM A;  1M5E A;  3MVX A;  5K2X A;  3FJG A;  1CE2 A;  3LC8 A;  2R9J A;  4F31 B;  3O2A A;  3OEM A;  5HBC A;  2RCB A;  2H25 A;  5L8D A;  1MXZ A;  4PQJ A;  1R9Q A;  4OVT A;  3K6U A;  3U72 A;  4OVJ A;  1TFD A;  3K1P A;  2B3F A;  1A40 A;  5ESY A;  3MST A;  3EPE A;  4RPN A;  4XXU A;  2MKZ A;  4DDD A;  4G8N A;  1LAX A;  5AA2 B;  3UN6 A;  2NVU B;  1SPI A;  5ICT A;  1Z7N E;  2I58 A;  4EF1 A;  5I56 A;  1GVC A;  4H8I A;  4HW8 A;  4GVO A;  3VVD A;  2ZYM A;  3H6V A;  4GXA A;  2Q74 A;  4MLV A;  2UVI A;  2HHM A;  1US4 A;  3B6T A;  1Y4C A;  1A8E A;  4EXK A;  2H99 A;  4JSD A;  3ZKK A;  2HZL A;  1AOV A;  3TUS A;  2VP1 A;  3KZG A;  3TZA A;  5EYF A;  1PB9 A;  3DEL B;  1LBB A;  1NI9 A;  4E0W A;  2OWZ A;  1LBV A;  2Q2C A;  2OPE A;  4P8B A;  3VLU A;  2Q89 A;  4RA1 A;  1EU8 A;  3CG3 A;  2UXA A;  1NNK A;  4U23 A;  2CEY A;  2I4B A;  1UTB B;  3H6W A;  4G68 A;  2V3T A;  4M1V A;  2OPD A;  1GGG A;  2DP8 A;  1USY E;  1LGB C;  4H0W A;  2XXU A;  1YPN A;  1AMF A;  3UP9 A;  2BJJ X;  1WDN A;  3QSL A;  4ZZA A;  3B50 A;  5KCJ A;  1QGX A;  2RC8 A;  4PAK A;  3PGF A;  3G3H A;  1D4N A;  4RY1 A;  1MDP 1;  1Q35 A;  5F24 A;  5H8F A;  2CEX A;  3TAJ A;  4DLD A;  3OOA A;  4GX4 A;  2V25 A;  4NF4 B;  1O63 A;  1HSL A;  1MRP A;  4R9G A;  4RNS A;  1I6B A;  4GLI A;  3U8Q A;  2P3N A;  3O6I A;  1ZJL A;  3TTR A;  1RYO A;  3V83 A;  4DI3 D;  1NH7 A;  1MQH A;  3R26 A;  1O64 A;  3O9P A;  1ELJ A;  5AA4 A;  5TP9 B;  4YAH X;  3DP6 A;  2QRY A;  4R6Y A;  4KYS A;  4ESW A;  3N6T A;  3TQL A;  4NE4 A;  1FQC A;  4HE1 A;  1L5T A;  3K0V A;  5K2Y A;  5ET5 A;  2KR0 A;  2VGQ A;  1SW5 A;  3RUM A;  2NWJ A;  5TU0 A;  4OZ9 A;  4MAG A;  3SEW A;  3Q26 A;  2V84 A;  3C35 A;  3T9H B;  4LP2 B;  4XKQ A;  2QS3 A;  4IO5 A;  2WBD A;  1Y20 A;  4KHZ E;  3KC1 A;  5FBP A;  3IJO B;  5T3J A;  2XXP A;  3O6G A;  4Q5T A;  5DYH A;  3T93 B;  1ZU0 A;  2WEF A;  2PVU A;  2XXI A;  1BIY A;  3FVK A;  4P9K A;  1IXH A;  4GOT A;  3IB1 A;  3KN8 A;  2FYI A;  5I58 B;  4P11 A;  1UIV A;  1Y4T A;  3N5L A;  2X7Q A;  3IR1 A;  1EZ9 A;  2XX8 A;  2VPO A;  1MXX A;  1B3G A;  3G3G A;  3KJ7 A;  4E0X A;  5DEX A;  5ITO A;  1ZBM A;  3GBB A;  2GRV A;  2OBG A;  2HAU A;  4BDM A;  5LTC A;  3MP1 A;  2AIX A;  1DCU A;  1B1X A;  1FJ6 A;  1XVX A;  3MWB A;  1JW4 A;  1M5B A;  4IR8 A;  4R6H A;  1A7L A;  3CI8 A;  1DMB A;  1A99 A;  4PCD A;  2XHD A;  4EDP A;  3H06 B;  2QL3 A;  1OIB A;  3UIF A;  4QFP A;  4X48 A;  3KOT A;  4ZEI A;  5IKB A;  2D21 A;  2PX1 A;  4XTC Q;  1EYI A;  4OWD A;  3MBP A;  4YB7 A;  1ZTY A;  2DOJ A;  3A3C A;  4GL8 A;  1FQA A;  3MZB A;  2V3Q A;  4YKJ A;  2CZI A;  4NN3 A;  2M8C A;  4ESX A;  2QVR A;  3N6U A;  3K00 A;  1FQF A;  5H8N B;  2I49 A;  4Z7E A;  3QK6 A;  3UOR A;  1B0H A;  4QFL A;  3VVE A;  1KZ8 A;  3F11 A;  5I2N B;  1N04 A;  3IL1 B;  1LFI A;  1YZ0 A;  2DWJ A;  1OVT A;  2XXQ A;  3SEU A;  4JXI A;  1JW1 A;  4N81 A;  1JNF A;  4GBV A;  2BJI A;  2Y7K A;  1FPJ A;  3FVG A;  4IO6 A;  2AL4 A;  2DXR A;  3EN3 A;  1Y1M A;  4K3F A;  1DTZ A;  3ZS6 A;  3LSW A;  1N0T A;  1XHY A;  5A5X A;  5B7D A;  4QF9 A;  4ZE9 A;  3MPL A;  1Z7M E;  1N3W A;  2OWT A;  3KG2 A;  4H67 A;  5H8Q B;  3SES A;  4U22 A;  2DS9 A;  3RGY A;  4FEC A;  3UGW A;  4ZEC A;  3IB0 A;  5EYG A;  1MXW A;  3FIR A;  1A54 A;  2QFL A;  1B7Z A;  1MQI A;  4GWZ A;  4G8M A;  4QHQ A;  3MPK A;  2F78 A;  3RYD A;  3PMW A;  1AL3 A;  3G7W A;  1D9V A;  4N17 A;  1QVS A;  4EXL A;  3RTW B;  1Y3Q A;  3QUF A;  1FPF A;  1NV6 A;  4NMY A;  1FPK A;  2XWV A;  2DE3 A;  3KFM A;  4QFN A;  4XKN A;  4GWW A;  1IMF A;  3VDF A;  4PDD A;  1RDZ A;  4DZ1 A;  5KZT A;  1FQE A;  4DIG A;  5H8H A;  1Q1K A;  3VLV A;  4XFE A;  4YKI A;  2OJT A;  1N7X A;  5DT6 A;  3FAT A;  1FBG A;  3W15 C;  1JW5 A;  4O3C A;  2HCA A;  2UVJ A;  3IX1 A;  4F3S A;  5HM4 B;  2O1M A;  1B3H A;  3I5O A;  1M5C A;  1SW2 A;  4O7I A;  4DXB A;  4F1V A;  4G77 A;  4N8Y A;  1B46 A;  1HSE A;  3LSL A;  3M3F A;  1LBX A;  2O51 A;  4N13 A;  3CG1 A;  4TQU Q;  3D4G A;  2DWH A;  3T9V A;  2OK2 A;  1PDA A;  2Q9T A;  4P0I A;  2XD2 A;  2VT5 A;  1B58 A;  2I0C A;  4YKK A;  3H7M A;  4L17 A;  2ABH A;  2QMW A;  4NWD A;  4ELR A;  3JV9 A;  2REJ A;  4G68 B;  3PU5 A;  2XWI A;  4X8R A;  1ZIU A;  4GX3 A;  2NOO A;  3A09 A;  5I59 A;  1JVX A;  2HAV A;  2O7U A;  1M5F A;  5L9O A;  1FPI A;  1FBH A;  4POW A;  3MQ9 A;  1VE4 A;  1DK4 A;  4KCD A;  3T66 A;  5H8F B;  1FQB A;  4FEB A;  3RN8 A;  2FNC A;  4U4X A;  3W9W A;  2Y7I A;  5IZ3 A;  4XF5 A;  3FAS A;  1FTM A;  3K2D A;  2ZZV A;  1FTL A;  3THI A;  4PE3 A;  4R2F A;  4JB7 A;  2QS2 A;  5AA4 B;  1LEV A;  1UTH A;  3IJX B;  1NV4 A;  4BDQ A;  1II5 A;  1QUI A;  2XXX A;  3FZV A;  3ONM A;  2PBW A;  4O3B A;  1B52 A;  2Y5K A;  3TCH A;  2Y5L A;  1LBZ A;  3B8B A;  4I62 A;  3K1M A;  4PP0 A;  5B70 A;  3OXN A;  1ANF A;  3G3K A;  4AQ4 A;  4I3E A;  3FV1 A;  3U65 A;  5J16 A;  3IK6 B;  5DVI A;  3SEX A;  3OMB A;  3FXR A;  4MNP A;  4F29 A;  4O3A A;  2YJP A;  1P1Q A;  3R7X A;  2PYY A;  3PMV A;  4F1Y A;  2QPQ A;  2ZNU A;  3MP6 A;  4LQ5 A;  2ZXT A;  4O8M A;  2DWA A;  4FAJ A;  1IMC A;  1USY H;  4OET A;  2L5V A;  3H4Z A;  3S9N C;  3A29 A;  1MXY A;  5AA2 D;  1KWH A;  1PC3 A;  5EQ9 A;  3CHG A;  2O7I A;  2Y84 A;  4F19 A;  3QUJ A;  4XIG Q;  3P7I A;  5HPQ A;  1B05 A;  3N26 A;  1TT1 A;  3B6Q A;  1MG1 A;  2XXV A;  3UA8 A;  3KOS A;  1OLA A;  4NF6 A;  1MXV A;  1FSA A;  1G0H A;  1NUX A;  3WAE A;  1FTA A;  4ISU A;  3EHU A;  1N76 A;  2QS4 A;  3KN7 A;  2XX7 A;  1H3D A;  3FXQ A;  1MDQ A;  3LSX A;  1OLC A;  1Y1Z A;  1NNP A;  3MZ9 A;  4G4P A;  4WEP A;  4XKR A;  5DEX B;  2ESN A;  3TMG A;  1DSN A;  4LQ2 A;  1MPB A;  4OQO A;  3TDJ A;  5F7V A;  4U1Z A;  2E1S A;  2X7P A;  4ECF A;  4N6P A;  4QRZ A;  3VLW A;  1B1H A;  5DVJ A;  1SQY A;  4C0R A;  5DTB A;  1IMA A;  2XWK A;  1B5H A;  2F3D A;  4FE8 A;  4MMP A;  3MJN A;  2F7B A;  3IOW A;  3TTL A;  1FPG A;  1SI1 A;  1EH3 A;  4QFK A;  5FHO A;  4F2O A;  5IGA A;  5EYH A;  2CMO A;  3O28 A;  1FTO A;  3U93 A;  2RCA A;  4OVP A;  3VXC A;  4LUB A;  1NUY A;  2FIX A;  2ZYN A;  2X26 A;  3PPR A;  1OQG A;  3FGS A;  1WVJ A;  3E78 A;  1H45 A;  5ICQ A;  3M8U A;  3VFJ A;  4OFL A;  3C32 A;  4OEV A;  3KJT A;  3PPN A;  1BK4 A;  1DPE A;  1PBQ A;  4YU0 A;  4HXV A;  1SI0 A;  4IGT A;  4MCO A;  3O6H A;  4GL0 A;  4YB6 A;  4MJO A;  5CMM A;  1Y3P A;  3HO7 A;  4JVD A;  4P47 A;  2DE4 A;  3JZJ A;  4G68 C;  4KYD A;  4N91 A;  1A55 A;  5AA1 A;  1OVB A;  2A5T A;  4PFW A;  3IO4 A;  2PCR A;  1NNT A;  3LBS A;  3NOH A;  5I5P A;  1IXI A;  4ZEF A;  3T22 A;  1IIW A;  3DP4 A;  4ND9 A;  3OEN A;  3TCG A;  5DVF A;  1ZKB A;  1NV0 A;  3OO8 A;  4Q8R A;  1P1W A;  3C34 A;  4AS4 A;  1B40 A;  2QVV A;  3BFU A;  3JYR A;  2DVZ A;  4HE2 A;  2I3W A;  2VPN A;  1H44 A;  3G3J A;  4EF2 A;  3FVO A;  1MQD A;  4MHF A;  2XXR A;  1H43 A;  5BUU A;  1B7U A;  3U1O A;  3TFL A;  2UYE A;  2I4C A;  4GWU A;  2I48 A;  1EYJ A;  2E0S A;  5CBS A;  5IAI A;  3ISP A;  3ZKL A;  3LSF B;  4YKP A;  4GFR A;  4M4G A;  4MBP A;  1LAG E;  4ZED A;  4NG7 A;  3QIM A;  3OEK A;  1O7T A;  2F35 A;  5H8H B;  3G3I A;  4KD5 A;  3GZG A;  2NXO A;  3K02 A;  3RT8 A;  2PFZ A;  4NTL A;  4LON B;  1IUD A;  4I9D A;  4OVQ A;  2Q8J A;  3KGC A;  4JSO A;  4GD5 A;  2F6G A;  3OO9 A;  4OAN A;  4ELQ A;  3T9U A;  5DW8 A;  3TTN A;  3UK4 A;  5IM2 A;  3KSJ A;  5LOM A;  3K6W A;  5EHS A;  2HPG A;  2R8T A;  4RK9 A;  3IOU A;  2ZNS A;  3SET A;  1IXG A;  3I3V A;  3EKI A;  2Y7W A;  4LZ8 A;  1B2H A;  4Q30 B;  4PE5 B;  1H76 A;  5ET8 A;  2H98 A;  3PPQ A;  4P1L A;  2Z8E A;  4YMA A;  3VE1 B;  4MF3 A;  4U2R A;  1TFA A;  4H46 A;  1MH3 A;  4OXV A;  1S7Y A;  1QKB A;  1XOC A;  2KQZ A;  4EQB A;  1N84 A;  5I84 A;  5I59 B;  3M3K A;  3E9X A;  4IO7 A;  3H6U A;  1B5I A;  2FA7 A;  4ELO A;  3CSG A;  3G3F A;  4FJP A;  1I6Q A;  1VDW A;  1BLF A;  4IO2 A;  4GBW A;  2HQ0 A;  1NUW A;  1EZO A;  2P2A A;  4RYA A;  5JTY A;  1NV1 A;  3C31 A;  1MY3 A;  4KYE A;  5IZ3 B;  4H5F A;  1MH4 A;  1A8F A;  3CVG A;  2UYF A;  3T1B A;  2WBB A;  4PGP A;  1B5J A;  5CC2 A;  4NED A;  3CFX A;  1VFE A;  1UTH B;  3KSX A;  3CIJ A;  2B3B A;  4GXS B;  4O94 A;  4PC9 A;  4QFO A;  2D5W A;  3A3U A;  1B32 A;  1XS5 A;  3VV5 A;  1SBP A;  1MQJ A;  3E13 X;  1BKA A;  1P1O A;  4PFI A;  3FJ7 A;  2F6P A;  1IEJ A;  4NGU A;  3T0J A;  1DTG A;  4F3B A;  3I6V A;  2V93 A;  1LCF A;  1LAF E;  1VFD A;  5EHM A;  2OWS A;  4NAP A;  1IXC A;  3RPL A;  3ILT B;  3OO7 A;  3RNN A;  4LZ5 A;  2RC9 A;  3CFL A;  5FTI A;  5EQA A;  5IZ1 A;  2ANJ A;  1POT A;  4KQP A;  5L9S A;  1SW4 A;  3RTF B;  3DM0 A;  4O7M A;  2OX3 A;  1B51 A;  3SER A;  5I56 B;  3FV2 A;  1LBC A;  5I2K A;  2DE2 A;  1YYZ A;  1ZLQ A;  2Z8F A;  1J1N A;  1TXF A;  2GHB A;  1JP4 A;  2QSX A;  4UAB A;  4YIC A;  2WYK A;  4GQO A;  4PFB A;  4MLQ A;  3IO6 A;  4ONY A;  3H3G A;  1I6A A;  4R73 A;  3R6U A;  2A5S A;  5CI5 A;  3MC2 A;  4I1D A;  3MYU A;  3QAX A;  2OZZ A;  4HE0 A;  4G2Z A;  1NL5 A;  1P99 A;  1CNQ A;  1VSO A;  4KR5 A;  1MY2 A;  2DWI A;  1SYH A;  4LVQ A;  3GBA A;  4OTE A;  3KBZ A;  2QJE A;  4H1X A;  4YZZ A;  1FPB A;  3MVW A;  2F8D A;  3MAM A;  2IA4 A;  4DXU A;  1LB9 A;  1XT8 A;  2B4L A;  3MZ1 A;  2B4M A;  3PUY E;  2B65 A;  4NF5 A;  4QSE A;  4THI A;  1K9Y A;  1FRP A;  1RDX A;  3SEV A;  2HXR A;  1DPP A;  2RC7 A;  1MXU A;  1FPL A;  3LUY A;  4ZE8 A;  4C1T A;  1M5D A;  3RT6 B;  1FCK A;  5KCJ B;  1QUL A;  1NH8 A;  2LAO A;  4BDL A;  3OD7 A;  2VHA A;  2REG A;  4OMB A;  3O66 A;  4OFO A;  4OYV A;  4DI4 B;  5I57 A;  3HFU A;  4OVR A;  1XVY A;  2PT2 A;  2O6A A;  1YCJ A;  3LV0 A;  1GV8 A;  3OEL A;  3CRB A;  2VD3 A;  2QMX A;  3Q27 A;  3K1N A;  5JK4 A;  3S9L C;  4IY5 A;  1ATG A;  1B4Z A;  4N6D A;  3EHS A;  1IMB A;  4NHB A;  3S9E A;  2ALU A;  3CR9 A;  3FJM A;  1JEV A;  2GH9 A;  4IO3 A;  2CZK A;  3BBR A;  4UA8 A;  2A5T B;  2DYX A;  1KA0 A;  1B3F A;  3HCQ A;  3O97 A;  2Z8D A;  2H5Y A;  2ONK E;  2W7Y A;  1SDX A;  3EQ1 A;  3CFZ A;  3Q29 A;  4LAT A;  4MH5 A;  2THI A;  3C4M A;  4OA4 A;  1URS A;  3QMF A;  3TKD A;  4GX6 A;  2ZYK A;  4OES A;  3OO6 A;  4F39 A;  3D4C A;  3HN0 A;  2O69 A;  3GLB A;  3SKP A;  4OFJ A;  4OEN A;  2WX9 A;  2XXW A;  4F22 A;  1FQD A;  3HHF A;  2O68 A;  2OLB A;  4BLA A;  1NNF A;  1FBC A;  2P3V A;  1LFG A;  3C33 A;  2VOZ A;  3E4R A;  1NFT A;  2UVG A;  4EUO A;  3HHG A;  2D3I A;  3FXB A;  1B7H A;  4R74 A;  2R71 A;  2OCU A;  4PGN A;  4U4S A;  4H45 A;  4MNI A;  2Q2A A;  4KXP A;  1MPC A;  1MY4 A;  3IFA A;  2RKM A;  3TPA A;  2RF1 A;  4FAT A;  4AS5 A;  5CM6 A;  4QSC A;  2VD2 A;  5ET7 A;  3HPI A;  2F7C A;  4BDO A;  5EQ8 A;  4H5G A;  1KA1 A;  4MIJ A;  2DXY A;  4I8C A;  5CMK A;  2FVZ A;  5ELV A;  2XWO A;  4JVC A;  4FED A;  3ODB A;  4WXJ A;  4BDN A;  5CMC A;  5JEI A;  1FPE A;  3TEL A;  2CZL A;  3RQT A;  4X1D A;  3IB2 A;  1UQW A;  1LLS A;  2ZYO A;  1JET A;  5H8S A;  1POY 1;  4JWX A;  1VR5 A;  4F3P A;  3C36 A;  4NF8 A;  4AB5 A;  1TWY A;  2NUV A;  1T0K A;  2XXK A;  3TEP A;  4OHN A;  3Q28 A;  3CSB A;  3FBP A;  3O29 A;  1D9Q A;  1BP5 A;  1WOD A;  3USD A;  2IEE A;  4X9T A;  4PET A;  5AE4 A;  1LBY A;  5A5L A;  1FPD A;  1B3E A;  2WKY A;  4H65 A;  2JJK A;  3PD8 A;  4JBZ A;  4I40 A;  5I3S A;  2HZK A;  4GIZ A;  3AXF A;  1OMP A;  3QXM A;  4NF0 A;  3MW0 A;  4GWY A;  4POX A;  3IAZ A;  1QJM A;  3FUZ A;  2FIE A;  3IFC A;  3LR1 A;  1RDY A;  1NV3 A;  3IOT A;  3PTY A;  5ISU A;  1FW0 A;  2AL5 A;  5KDT A;  1URD A;  3PUZ E;  4IO4 A;  2ONR A;  5TPA A;  1SD3 A;  3K6X A;  4DXC A;  5JTY B;  2PMS A;  2F34 A;  1XI6 A;  5L9M A;  1IME A;  2P1S A;  1FJ9 A;  5CRY A;  1IQ7 A;  3HV1 A;  5A5X B;  4PTK A;  5ET6 A;  1QUJ A;  3S4U A;  3S2V A;  4FBP A;  4F18 A;  1NMU A;  3MUQ A;  2F3B A;  4PF6 A;  2Y7R A;  4H6D A;  4PFU A;  1NV5 A;  4PFT A;  1YAE A;  4P56 A;  3FVN A;  3TOD A;  1FBF A;  4GWX A;  3QYT A;  4N4U A;  2R6G E;  4ZEB A;  3VVF A;  1RYX A;  1MM7 A;  3V8X B;  3RY3 A;  2XA5 A;  3H03 A;  2Q8M A;  3W9V A;  1MM6 A;  4X04 A;  1NUZ A;  1MPD A;  2XXY A;  3Q25 A;  3L6H A;  2KLF A;  4LA9 A;  3SZP A;  4QBA A;  2GHA A;  1LBW A;  3GYY A;  1G0I A;  2F7A A;  4OER A;  4BDR A;  4F1U A;  4LZ7 A;  3RPL B;  1GR2 A;  3KN3 A;  5J1D A;  4P1E A;  1N3X A;  3KEI A;  1FTJ A;  1MY0 A;  5AA2 A;  3IOR A;  4N07 A;  3TQW A;  2YLN A;  2UVH A;  2P0S A;  2RIN A;  3SEY A;  2Y7P A;  5I2K B;  4MNC A;  4P0G A;  2YPN A;  1HSJ A;  1N7W A;  3PUV E;  2V3U A;  1SYI A;  1I69 A;  4ZS9 A;  4U1O A;  3KBR A;  5FHN A;  2ONS A;  4MEV A;  4PDH A;  3TCF A;  3M3L A;  4DE8 A;  4ZZE A;  4GWS A;  1FBP A;  1LB8 A;  4PFY A;  1R1N A;  4GWO A;  3U92 A;  1UTB A;  4JWO A;  2HXW A;  4NF5 B;  1IZ1 A;  3V5A A;  2PFY A;  1PEB A;  1B3L A;  1B9J A;  3OSR A;  1IMD A;  3D1R A;  2DDK A;  2H4I A;  1FBD A;  4U21 A;  3TTK A;  4G61 A;  2AYS A;  5CBR A;  2I3V A;  2XD3 A;  1US5 A;  1R6Z A;  1PB8 A;  2F36 A;  1F9B A;  1CB6 A;  4NF4 A;  4HCY A;  1B0L A;  5I57 B;  4HS7 A;  4XEQ A;  2XXH A;  1R9L A;  1FTK A;  4YMB A;  3DLN A;  4ELP A;  4G8H A;  4IY6 A;  1S50 A;  5TP9 A;  3KC0 A;  1NKX A;  3E79 A;  1LCT A;  4PFR A;  4RJZ A;  1NV2 A;  2FBP A;  4IB2 A;  4Q0C A;  4OVS A;  2DQV A;  2WYP A;  3SDF A;  1SVX B;  4JDF A;  1XC1 A;  3ILU B;  1K9Z A;  2ZMB A;  2QVU A;  1EYK A;  3PD9 A;  2ZZW A;  4WED A;  4FOR A;  1JEU A;  4MX6 A;  4JWY A;  1ZMG A;  4RK2 A;  1B4H A;  4PF8 A;  2F5X A;  4R2B A;  4Z0I A;  4XKP A;  3T96 B;  3K4U A;  1AH5 A;  4ZEK A;  4R6K A;  3FD3 A;  1BTJ A;  1JQF A;  2DSF A;  4R72 A;  2Z23 A;  1Q9D A;  3BFT A;  2FHY A;  3E3K A;  3DP8 A;  4GF8 A;  3GXA A;  2Q88 A;  1MQG A;  3MVY A;  3ROJ A;  1D9Y A;  4I3Y A;  5IZZ A;  3IOV A;  2QS1 A;  4QSD A;  5CMB A;  4OEU A;  5I58 A;  4NF6 B;  4HCW A;  4QXD A;  2Z22 A;  4N6K A;  2G29 A;  2H9B A;  3EHT A;  3PMX A;  4YB5 A;  3PPP A;  3ECR A;  4ZDM A;  3BIH A;  2PT1 A;  1QKA A;  3PUX E;  4UAC A;  2HFB A;  1QW0 A;  3RPW A;  1PBP A;  2V4C A;  4PAI A;  4PBQ A;  1YXI A;  1P1U A;  1QUK A;  2I6E A;  4JVI A;  4NWC A;  4KCC A;  4TOZ A;  5ITP A;  2XXT A;  2GFE A;  3L6G A;  3TTM A;  4N15 A;  3T9X B;  4HTG A;  1UIU A;  4F3G A;  1AWB A;  1NV7 A;  4NF8 B;  1LST A;  3B7D A;  4RPO A;  4MFI A;  3U94 A;  1Y3N A;  4EQ7 A;  3FXU A;  3RLF E;  4DCY A;  2XX9 A;  3BKI B;  1FBE A;  4R75 A;  4R9F A;  4IGR A;  3S9M C;  2CZH A;  2F97 A;  1URG A;  5I7I A;  1LAH E;  3TYH A;  4C1U A;  4EQ9 A;  3PUW E;  1Y9U A;  3BIG A;  1EZP A;  4FIM A;  1DOT A;  3EF7 A;  4TLM B;  5F1Q A;  1IIT A;  4LN5 A;  5BWJ A;  4H8J A;  4N8G A;  1RKM A;  5H8N A;  4PAF A;  3H6T A;  2ZZX A;  1PB7 A;  3WAF A;  3V89 B;  1MY1 A;  2DVC A;  4GRK A;  3MVZ A;  2ZNT A;  1MS7 A;  4NQ8 A;  3PV0 E;  1D3K A;  4F2Q A;  3PPO A;  5I2N A;  1DBZ A;  5KDT B;  4X1B A;  3HST A;  2O1L A;  5TPA B;  1OQH A;  2GQ1 A;  5AA3 A;  1YTV A;  3N94 A;  3MP8 A;  5EQ7 A;  3B6W A;  1LFH A;  4KPT A;  3LUZ A;  2I0B A;  4NX1 A;  4DCX A;  4KI0 E;  5H8Q A;  1S9T A;  4RXL A;  4P3L A; 
#chains in the Genus database with same CATH homology
 5IM2 A;  4PBH A;  2HPG A;  2FIE A;  2R8T A;  3IFC A;  1IMF A;  4GWW A;  1RDY A;  1NV3 A;  4PDD A;  1RDZ A;  1INP A;  3PTY A;  5LDZ A;  3EKI A;  4XFE A;  5ET8 A;  4P1L A;  1XI6 A;  1FBG A;  1IME A;  1FJ9 A;  4H46 A;  4PTK A;  4O7I A;  2KQZ A;  4F1V A;  4OVT A;  4N8Y A;  5ET6 A;  5ESY A;  1LBX A;  3MST A;  4FBP A;  4F18 A;  2F3B A;  2MKZ A;  4PF6 A;  1VDW A;  2Q9T A;  4GBW A;  1NV5 A;  2VT5 A;  1NUW A;  1SPI A;  4P56 A;  1NV1 A;  1FBF A;  4GWX A;  5IZ3 B;  4N4U A;  2XA5 A;  2Q8M A;  3W9V A;  4X04 A;  1NUZ A;  3T1B A;  2WBB A;  2XWI A;  4PGP A;  4X8R A;  2Q74 A;  3SZP A;  4QBA A;  4GX3 A;  2HHM A;  1LBW A;  3GYY A;  4O94 A;  1G0I A;  4PC9 A;  4F1U A;  3RPL B;  1FPI A;  1FBH A;  2HZL A;  5J1D A;  1DK4 A;  4P1E A;  1NI9 A;  4PFI A;  2OWZ A;  1LBV A;  4P8B A;  3W9W A;  5IZ3 A;  4XF5 A;  2CEY A;  4MNC A;  4NGU A;  3T0J A;  2ZZV A;  4M1V A;  4PE3 A;  1LEV A;  1NV4 A;  4NAP A;  3B50 A;  3RPL A;  1QGX A;  4PAK A;  2Y5K A;  4MEV A;  4PDH A;  2Y5L A;  1LBZ A;  3B8B A;  5F24 A;  2CEX A;  4GX4 A;  4I3E A;  4GWS A;  3U65 A;  1FBP A;  5EQA A;  5IZ1 A;  5J16 A;  4MNP A;  4O7M A;  2OX3 A;  2DE2 A;  2P3N A;  1YYZ A;  2QPQ A;  4DI3 D;  1JP4 A;  4UAB A;  4YIC A;  2WYK A;  4PFB A;  4O8M A;  2PFY A;  1IMC A;  1IMD A;  3D1R A;  2L5V A;  2DDK A;  3MYU A;  1FBD A;  3A29 A;  4HE0 A;  4G61 A;  5EQ9 A;  3CHG A;  1CNQ A;  4F19 A;  4HE1 A;  3KBZ A;  5ET5 A;  2KR0 A;  4YZZ A;  1FPB A;  4HCY A;  4MAG A;  4XEQ A;  2B4L A;  2B4M A;  1FSA A;  1G0H A;  1NUX A;  1FTA A;  1K9Y A;  3KC0 A;  1FRP A;  1RDX A;  2WBD A;  3E79 A;  2HXR A;  4PFR A;  1NV2 A;  2FBP A;  3KC1 A;  1FPL A;  4OVS A;  5FBP A;  2WYP A;  5T3J A;  1K9Z A;  2QVU A;  1EYK A;  2ZZW A;  2WEF A;  4MX6 A;  4DI4 B;  4P9K A;  4PF8 A;  3HFU A;  2F5X A;  4OVR A;  3LV0 A;  1IMA A;  2XWK A;  2F3D A;  2VPO A;  4MMP A;  5JK4 A;  1Q9D A;  2FHY A;  4N6D A;  1FPG A;  1IMB A;  4NHB A;  5IGA A;  2CZK A;  3ROJ A;  4I3Y A;  5IZZ A;  1KA0 A;  5EYH A;  4OVP A;  5LTC A;  1DCU A;  1FJ6 A;  1NUY A;  4OA4 A;  2FIX A;  4IR8 A;  3QMF A;  4PCD A;  3E78 A;  4GX6 A;  4HCW A;  4QXD A;  4N6K A;  3BIH A;  1BK4 A;  2WX9 A;  4HXV A;  4MCO A;  1EYI A;  4MJO A;  2V4C A;  1FBC A;  2P3V A;  4PAI A;  4JVD A;  4PBQ A;  1YXI A;  4P47 A;  4JVI A;  2DE4 A;  4N91 A;  3FXB A;  2V3Q A;  2CZI A;  4NN3 A;  4PGN A;  4H45 A;  4MNI A;  2QVR A;  4KXP A;  4N15 A;  3IFA A;  2PCR A;  3NOH A;  1AWB A;  1NV7 A;  5I5P A;  4AS5 A;  5CM6 A;  1KZ8 A;  5ET7 A;  1FBE A;  1NV0 A;  1YZ0 A;  2CZH A;  4AS4 A;  2QVV A;  2DVZ A;  5EQ8 A;  4HE2 A;  5I7I A;  4N81 A;  1KA1 A;  4MIJ A;  4GBV A;  2BJI A;  2VPN A;  1FPJ A;  3BIG A;  2FVZ A;  4MHF A;  2XWO A;  4JVC A;  4GWU A;  4LN5 A;  1FPE A;  1EYJ A;  4N8G A;  3ISP A;  4PAF A;  2ZZX A;  5EYG A;  2XXK A;  4NQ8 A;  4NG7 A;  2QFL A;  3FBP A;  1D9Q A;  1DBZ A;  4GWZ A;  4X9T A;  4PET A;  1LBY A;  3RYD A;  2GQ1 A;  5A5L A;  1FPD A;  2PFZ A;  2JJK A;  4N17 A;  4I40 A;  5EQ7 A;  5I3S A;  2HZK A;  1FPF A;  4OVQ A;  1NV6 A;  3LUZ A;  4NX1 A;  1FPK A;  4NF0 A;  4OAN A;  2XWV A;  2DE3 A;  5DW8 A;  4P3L A;  4GWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...