2HHMA

Structure of inositol monophosphatase, the putative target of lithium therapy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
272
structure length
266
Chain Sequence
WQECMDYAVTLARQAGVVEAIKNEMNVMLKSSPVDLVTATDQKVEKLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLTELGSSRTPETVRVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSITOL MONOPHOSPHATASE
publication title Structure of inositol monophosphatase, the putative target of lithium therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 266
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1992-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2hhmA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hhmA02
2VT5A 1EYIA 5FBPA 2WBBA 1NUYA 3LUZA 1NV0A 4H45A 1KA0A 2F3BA 1FPDA 2CZKA 1FJ9A 1K9YA 1BK4A 2CZHA 2FBPA 4H46A 5ESYA 1IMEA 1IMBA 1SPIA 5EYGA 1NV2A 1NV3A 1CNQA 3FBPA 1D9QA 2FHYA 1EYKA 1FPIA 2DDKA 2QFLA 4GX4A 4HE2A 4I3YA 4HE0A 4GWZA 1DBZA 4GBWA 3RPLB 1LBVA 1FJ6A 5IZ3B 1RDZA 2PCRA 2FIEA 1LEVA 1YYZA 2OWZA 2P3NA 5EQ8A 1YXIA 3LV0A 1KZ8A 1NUZA 1FBFA 3A29A 4I3EA 1NI9A 2CZIA 3KC1A 1DK4A 5IZ1A 2QVVA 1NV6A 1NUWA 4GWXA 2Y5KA 4GBVA 2JJKA 5F24A 1FPJA 1IMDA 4GWWA 1NV4A 1RDYA 1FPGA 1Q9DA 3QMFA 1NV7A 5T3JA 1LBXA 5ET7A 4GWYA 1LBYA 3D1RA 2R8TA 1IMCA 4QXDA 5I3SA 3BIGA 5A5LA 1FBCA 1FPFA 2Q74A 1FBHA 5ET8A 4KXPA 1RDXA 1FPKA 1FTAA 4N81A 2F3DA 2P3VA 1FBPA 3RPLA 1IMFA 2FIXA 5IZ3A 3KBZA 3ROJA 1NUXA 1QGXA 1EYJA 1KA1A 2BJIA 4G61A 3RYDA 2FVZA 4I40A 4MJOA 5ET5A 1LBZA 4PTKA 4HXVA 4HE1A 1K9ZA 1FBDA 4GX3A 1XI6A 1DCUA 1YZ0A 4IR8A 2QVRA 3IFCA 1IMAA 1FBEA 1FRPA 3T0JA 1JP4A 4GWUA 5DW8A 4AS4A 1NV5A 1FPLA 1G0IA 1NV1A 5ET6A 1AWBA 5J16A 4FBPA 2QVUA 1FPBA 2WBDA 5EQ9A 3B8BA 1FSAA 2WEFA 5EQ7A 5EYHA 3BIHA 3KC0A 2Y5LA 1G0HA 2HHMA 4GX6A 3IFAA 4AS5A 2OX3A 1VDWA 1INPA 4GWSA 4O7IA 2Q8MA 1LBWA 5LDZA 1FBGA 5EQAA 1FPEA 2GQ1A
chains in the Genus database with same CATH superfamily
4MLVA 4IO4A 2OBGA 4OVQA 2CZKA 5AA4A 4PFWA 1FQCA 2V84A 3ISPA 4ZS9A 2QFLA 1QUJA 3JYRA 2VPNA 3TZAA 5B7DA 1LEVA 5I5PA 3ILTB 5AA1A 3O97A 3R7XA 4IO3A 4PFIA 1R9QA 4G8NA 5TP9A 4JSOA 1A8EA 4LQ5A 2H5YA 4C0RA 5CMBA 3VLUA 3IOTA 5F24A 4WEPA 4NF4B 3MZ1A 1Q9DA 1NV7A 1HSEA 1LB9A 3EN3A 4ONYA 4QXDA 2NXOA 1FBCA 4XXUA 4YKPA 5DYHA 3RTWB 2O7UA 2V3QA 4R75A 3SEWA 3TEPA 5TU0A 4F22A 2E0SA 4KI0E 1UTBA 4C1UA 4G61A 3CIJA 2RKMA 4POWA 3HHGA 4ZDMA 4MX6A 1QKAA 4IO6A 1FCKA 4FE8A 4RXLA 1FPLA 1Z7ME 3K00A 4P11A 4AB5A 2QVUA 1FPBA 3U65A 4NWCA 3A3CA 1JEUA 1FTKA 3OOAA 4EF2A 2RCBA 1ZIUA 4ELPA 4U4XA 3OD7A 3PUZE 4LN5A 4ELQA 1A54A 1XVYA 3EHSA 2QJEA 1NV2A 2XXWA 4LATA 3O29A 1Y3NA 2ZYKA 2O6AA 1PEBA 5AA2B 1B7UA 3VXCA 1YXIA 1SW1A 4MLQA 4O3AA 3PPRA 1XVXA 1NI9A 2DE2A 1PBQA 1IEJA 1GV8A 4GWXA 4R72A 1AOVA 3FJMA 5H8QB 3QUJA 3FJGA 3IL1B 3KOSA 4ZE8A 4OERA 2DQVA 1D9YA 4PFBA 3M8UA 3HSTA 3TPAA 3GXAA 4MEVA 3MPKA 1NL5A 1DMBA 1MQDA 1P99A 5H8NA 3TQWA 4ZEKA 3G3IA 2HQ0A 2XXVA 4GVOA 2O7IA 1EU8A 1OLCA 3ROJA 4NF6B 4NG7A 3FD3A 2PMSA 1QW0A 3EF7A 2NOOA 3MSTA 2ESNA 1L5TA 5DVJA 3FVOA 3LSWA 1FQDA 3H6VA 1B40A 3OMBA 1WVJA 3S9NC 5I58A 2IA4A 4GRKA 4G2ZA 4DCYA 3CFLA 5HBCA 2L5VA 3N26A 1H44A 4O7IA 1P1QA 1A7LA 1H45A 4PF6A 5FTHA 4NF4A 3MAMA 3IO6A 4RA1A 5TPAB 3IB1A 1B0LA 3TTKA 5KZTA 1FPIA 2P0SA 4GD5A 1S7YA 3T93B 3ODBA 2PFYA 4XKPA 2DSFA 5FTIA 1B7HA 2WX9A 3H6TA 1LFIA 3A3UA 3E78A 1URSA 4ZEDA 3CFZA 2P1SA 3OO9A 1NV4A 3V83A 4LP2B 4PE5B 4PC9A 3D1RA 4G8HA 3LSXA 2UXAA 3I3VA 3LSLA 4EQBA 2R6GE 4ESWA 2Q2AA 3S4UA 1MM6A 4F1YA 4OVRA 2R71A 1N3WA 1FPKA 5CI5A 2Y7IA 2E1SA 3HFUA 4F31B 5B70A 3OEKA 3MWBA 4F1VA 3GYYA 1ATGA 5IZ3A 3SKPA 1AMFA 4HW8A 4POXA 5BUUA 3K6XA 4OFOA 5F7VA 4KYDA 3PTYA 2AIXA 3S2VA 4P0GA 3A09A 1B5IA 3VDFA 1AL3A 4HCYA 2V3TA 2Y7WA 1MDQA 3TCFA 3IR1A 4QFLA 1VE4A 3GZGA 4MNIA 1OMPA 1YAEA 3KC0A 1B1HA 5I2NB 3ZKLA 5H8FA 5DT6A 1OVTA 1O64A 4R6HA 1FQAA 1ZU0A 4FEBA 1H43A 2FA7A 5F1QA 2FBPA 4H46A 5ISUA 3RY3A 4NEDA 4HCWA 3TKDA 1IQ7A 1MXXA 1TWYA 3T66A 5I84A 1EYKA 2DVZA 3KN8A 2F97A 3DP6A 1P1WA 2OK2A 1RDZA 4TOZA 2P3NA 3E9XA 2ZZWA 1URDA 1M5FA 4F3SA 1SVXB 1ZLQA 2F7CA 1GR2A 4OVPA 3PMWA 1N76A 2UVIA 4U23A 4XKQA 4ELRA 3CSGA 4FIMA 2D5WA 3BIGA 2HXRA 2XXHA 2XXKA 5I57A 5A5LA 2Q89A 1WODA 4PP0A 1NNKA 1POY1 1B1XA 3QSLA 2DXRA 1BLFA 2RC7A 5L8DA 2RC8A 2O1LA 1B3EA 2FVZA 2H99A 3N6UA 3M3LA 4LA9A 4P9KA 3EKIA 4O7MA 2I6EA 4ZECA 1NH7A 1BTJA 1PB8A 2B3FA 5CMCA 2Q2CA 3MVXA 3U1OA 5CC2A 3MC2A 5CBRA 4GLIA 3MP1A 3FVKA 5TP9B 4XKNA 2P2AA 2F34A 2I58A 1GVCA 4NF8A 4G77A 4QSDA 1MH3A 3C4MA 1MQGA 4OFLA 5EQAA 3HO7A 3IOUA 4R6KA 1JVXA 2VT5A 4C1TA 1ELJA 1KA0A 2HEUA 3VVFA 5DEXA 1FJ9A 2CZHA 2PT1A 3HHFA 4PGPA 4GFRA 2XX9A 3O66A 2R9JA 4GWZA 2PBWA 3JV9A 3MVZA 3SEVA 1LCFA 3H06B 2H25A 1UTBB 3RUMA 1N0TA 3L6HA 3PPQA 1DK4A 4JVIA 1QVSA 1SW2A 4FATA 4ISUA 4NN3A 4NF5A 2XX8A 2XWOA 3QYTA 2DE4A 3TTLA 5IAIA 2XXUA 4EDPA 2WYPA 4ELOA 1B4ZA 2KR0A 3LSFB 3FXQA 4LZ7A 3S9LC 2Q9TA 2DS9A 2DYXA 3O9PA 1OQGA 2OPDA 2VD3A 1Y1MA 4EQ9A 3KBZA 3FGSA 4DDDA 4P56A 2GHAA 1LAFE 4L17A 2I49A 4PTKA 4HXVA 1B6HA 4F1UA 1YZ0A 5H8HA 5IKBA 3S9EA 4NF0A 4GWUA 1MPDA 4H5GA 3FXUA 1G0IA 1MH4A 4PQJA 2Y7KA 1F9BA 4HTGA 2Y7PA 3PUYE 3EPEA 2I0BA 2RCAA 4QFKA 2Y5LA 1M5CA 1DTGA 1SW4A 4WKMA 4ZZEA 4NWDA 2VHAA 2H98A 1FPEA 1GTKA 1B3GA 5IGAA 3E3KA 1NKXA 4BDLA 1J1NA 3MJNA 1NV0A 1II5A 4QFOA 4RY1A 1K9YA 3C9HA 1QUKA 1LAHE 1AH5A 1SYIA 5H8NB 1QUIA 5EHSA 4I3YA 2DDKA 3P7IA 4ZEBA 4H65A 3HCQA 1DBZA 1MXYA 3CG1A 1UQWA 4DI4B 4PE3A 3A29A 3C33A 3PGFA 3OO8A 3C34A 1CB6A 1POTA 2HFBA 1LFGA 3PD8A 2DWIA 3H4ZA 4MAGA 3RN8A 1VFEA 2Z8DA 3FJ7A 1B3HA 4XIGQ 4MNCA 5I58B 3SEYA 1O7TA 4JXIA 2PX1A 3RT6B 5AA3A 3CR9A 3IAZA 4H6DA 5CMKA 1JW5A 4RJZA 2XD2A 5I7IA 3TMGA 3ZKKA 3IORA 2VP1A 1PC3A 3TELA 3VV5A 3SETA 3IOWA 5JTYB 4JVCA 5M2VA 3FXRA 2VPOA 2QS3A 2FNCA 4OTEA 1EYJA 3TCGA 4H0WA 4PDDA 3QUFA 3EHUA 1SQYA 4UABA 3B6QA 3UA8A 3V5AA 1FRPA 3PPOA 2QL3A 3BBRA 1RYXA 4RPOA 4F2QA 2B65A 1TFDA 2F78A 4ZEFA 3K01A 3RLFE 5ITPA 1LAGE 2REJA 1JQFA 1MRPA 3Q28A 4GWSA 1LBWA 2V93A 3V89B 3FXBA 3C36A 3E13X 2H9BA 3S9MC 2GQ1A 1NUYA 3FIRA 4IY6A 4MMPA 4NE4A 3U93A 5ELVA 5L9OA 2MKZA 1D9QA 1B9JA 1Y9UA 4OVJA 1YPNA 2FYIA 1NNTA 1XC1A 1DTZA 3R26A 4OEUA 3VVDA 5IZ3B 4RK9A 4YKIA 3IJXB 3DLNA 4JWXA 5IM2A 3DELB 4N8YA 4GBVA 2PT2A 4Q0CA 3KN7A 1TFAA 3FV1A 4OWDA 4KD5A 3G3JA 3VLWA 3SERA 3SESA 3UP9A 2DXYA 5H8FB 2F3DA 1AIVA 3RPLA 2QMWA 3K02A 1LAXA 2ABHA 1I6AA 3VE1B 1LBCA 3L6GA 4H1XA 3VFJA 2REGA 3N6TA 2G29A 1Q1KA 4NX1A 4DXUA 3DP8A 3QXMA 4O3BA 4F18A 5DW8A 5IZZA 1OLAA 1US5A 3KG2A 3KGCA 1FQBA 2O84X 1Y4TA 2WYKA 3ZS6A 2QSXA 1H76A 1N7XA 3PPNA 4X8RA 2OX3A 4ND9A 1O63A 2I3VA 1A99A 3TQLA 2D21A 3B6WA 1B52A 3OENA 4MCOA 2DP8A 1S50A 3TTNA 4KQPA 5I57B 3KZGA 1PBPA 2PVUA 2ZYMA 4ZE9A 1BK4A 2RC9A 3ILUB 3PUWE 1SW5A 1NV3A 4YAHX 2OZZA 1MM7A 2FIEA 4THIA 4U4SA 3LV0A 2CZIA 3QIMA 2ZZXA 3OO6A 5JTYA 2XXXA 4OA4A 4KHZE 4IGTA 4XTCQ 1LLSA 1B05A 1FTOA 2HAVA 1FTMA 4I9DA 4BDOA 2ZNTA 4TLMB 4F2OA 4F3GA 4F3BA 1B5HA 5I56A 3H6WA 4DI3D 1FQFA 5I59A 4GQOA 4GIZA 2Z8FA 2GRVA 4NF8B 4N6DA 1NNFA 4UACA 3T9UA 4YB7A 1FTAA 3RTFB 3USDA 1DOTA 3Q26A 3C31A 4O94A 2PYYA 4FORA 3FVNA 4ZZAA 5DEXB 4JSDA 1B58A 2XX7A 1LBZA 4PBQA 4U22A 4IR8A 4YMAA 4MBPA 3OO7A 2OCUA 2CEYA 2XWVA 4KYSA 4H8IA 1B5JA 4LQ2A 4NQ8A 3IFAA 4AS5A 1TT1A 4X1BA 4GF8A 4BDRA 5LDZA 1MPCA 1IIWA 3I5OA 4WXJA 4X9TA 2F7BA 4NF5B 1YTVA 4YB5A 1I6BA 4EF1A 1DPEA 4WEDA 5KDTA 1IMEA 1IMBA 2Q88A 1ZMGA 4GX4A 4MF3A 3KSJA 4IO7A 4N13A 4R2FA 1IITA 5FHOA 4U1ZA 3CG3A 1M5BA 5J1DA 3DM0A 2H4IA 5H8HB 4EUOA 4DE8A 1MG1A 2QRYA 2ZYOA 3MBPA 3SDFA 3T9HB 2AYSA 5T3JA 2DWAA 2DE3A 4O8MA 2GFEA 2A5TA 1FBHA 4JVDA 4KCCA 4NAPA 4F3PA 5AA2D 1JNFA 2ZXTA 2F35A 4NGUA 1IMFA 5H8SA 3CI8A 3T1BA 4R6YA 3WAEA 1SBPA 4IY5A 5K2YA 1N3XA 4R73A 4RYAA 1B46A 3IB2A 1DCUA 3U94A 4XKRA 3TUSA 4P8BA 4QHQA 2ONSA 1NV5A 1B0HA 4OETA 4Q5TA 2UVHA 2HXWA 1QJMA 3Q27A 3HN0A 2ALUA 4GX6A 4YKJA 4NHBA 2A5SA 2THIA 3THIA 4GXAA 1RKMA 4F39A 2I4BA 3QK6A 1Z7NE 3OSRA 2QMXA 4XF5A 4FEDA 2FHYA 4R74A 4HE0A 3WAFA 2HAUA 3BFTA 2G93A 1MDP1 3VVEA 4H67A 1MXZA 3LC8A 3IO4A 1B7ZA 2Y5KA 1R9LA 3MZBA 2JJKA 1SDXA 2XXYA 3W9WA 1JW4A 4E0WA 5JK4A 4GWYA 1DPPA 1XT8A 4YMBA 2R8TA 4G68B 1JVYA 1A40A 4N6PA 1USYH 3R6UA 3O2AA 1VR5A 4R2BA 2O68A 5EHMA 3KBRA 2F7AA 4F29A 4JDFA 4O3CA 2CZLA 4AB6A 3RPWA 1D9VA 2XXTA 1QGXA 1KA1A 2BJIA 3KSXA 1FW0A 4IO5A 1IXIA 3MQ9A 3RQTA 1XI6A 3H03A 4EXLA 1IXHA 2B3BA 1MXUA 1JP4A 4PBHA 4OVTA 5I2KB 4OANA 3IJOB 4FAJA 3H7MA 3TTRA 2WBDA 1HSJA 1FSAA 5JEIA 4BDNA 5EQ7A 2O69A 4KFQA 1BKAA 1G0HA 2ONRA 3N5LA 4TLLB 4P1EA 4Q30B 1MY0A 4MIJA 2OLBA 2GHBA 1BIYA 2ZNUA 5EYGA 5CMMA 3T22A 1XS5A 4N91A 3MP8A 5A5XA 3BFUA 3MW0A 2XWKA 3RPLB 2I3WA 2PCRA 5EQ8A 3VXBA 4P47A 3PD9A 1FBFA 3T9VA 3SEXA 1D3KA 1IXGA 3B6TA 4G4PA 2XWIA 3LR1A 1LBXA 3MP6A 3PUXE 1LBYA 2W7YA 2Z8EA 3MVWA 4XEQA 3SEUA 4JWOA 4X04A 5ET8A 4G8MA 2QS1A 1FTLA 2P3VA 4FJPA 2X7QA 3OXNA 2X26A 4GL0A 1UTHA 4N17A 2Y7RA 1XOCA 3K6VA 1LB8A 2BJJX 5ET5A 1M5DA 3HV1A 1NFTA 1FBDA 1MQJA 2QVRA 3N94A 1N84A 3T0JA 4MH5A 1LBBA 4NTLA 2XXRA 1NV1A 2RINA 5EYFA 1MY1A 3K6UA 3TYHA 3UIFA 3HPIA 1MY4A 3RT8A 5EQ9A 4G68C 4DCXA 4I62A 1Y3QA 3F11A 5FHNA 2I0CA 2XXPA 4PAFA 2Y84A 2F6GA 1ZJLA 5I56B 4U21A 4H8JA 5I59B 2B4LA 3FBPA 1YCJA 4MFIA 2V4CA 4G68A 3K4UA 3TTMA 4Z0IA 1P1OA 2OWZA 4RPNA 5CRYA 4K3FA 2VD2A 3KC1A 3FASA 1QULA 3T9XB 3RNNA 3CRBA 3U8QA 1MPBA 2QVVA 3TODA 1LFHA 5CBSA 4RNSA 4LZ8A 1FPJA 2KQZA 1US4A 3KJ7A 5ICQA 4UA8A 1IMCA 1MQIA 4PFUA 5I2KA 1JEVA 5FHMA 1MY3A 2HZLA 1WDNA 4JBZA 3RGYA 5KDTB 4I40A 4MJOA 2O51A 5L9SA 1K9ZA 1B3LA 3NOHA 2GH9A 3FATA 4OHNA 3GLBA 1IXCA 4GXSB 1D4NA 3O6HA 1ZKBA 2F8DA 5J16A 4FBPA 2XHDA 1MY2A 4ECFA 3BIHA 2YJPA 3KOTA 1XHYA 2D3IA 1VDWA 2Q8MA 4KPTA 4KCDA 4OXVA 4LUBA 1EYIA 2WBBA 3JZJA 3LUZA 3BKIB 2A5TB 5ESYA 2PFZA 1SPIA 3W15C 1CNQA 4TQUQ 4Q8RA 4BLAA 4ZEIA 4GBWA 1UIUA 1YYZA 1NUZA 1NMUA 1T0KA 1EH3A 5HPQA 2ANJA 2DVCA 1LSTA 5KCJA 4GL8A 4GWWA 4X48A 3IK6B 3PV0E 4AQ4A 4IB2A 2XXIA 1DSNA 1IZ1A 1QKBA 2KLFA 4OFJA 5I3SA 1M5EA 2AL4A 3TCHA 4OZ9A 3C35A 3PU5A 3Q29A 2I48A 3T96B 4BDMA 2OJTA 4I1DA 1NUXA 1I6QA 1ZTYA 3M3FA 3RYDA 4QFPA 3PMVA 4DLDA 4P3LA 3IFCA 1IMAA 4PCDA 4N15A 3LBSA 4QSCA 4YU0A 2LAOA 4HS7A 4DZ1A 4DXCA 4LZ5A 3E4RA 2OPEA 2VOZA 2CEXA 4QFNA 4ESXA 4PDHA 1B4HA 1EZ9A 1UIVA 2F36A 1ZBMA 1TXFA 3MPLA 1NNPA 2HZKA 5FBPA 2ZYNA 3AXFA 4H45A 4M4GA 3FVGA 4IGRA 4YKKA 2O1MA 5HM4B 1OQHA 1R6ZA 4OMBA 4M1VA 3FV2A 1LCTA 2UYFA 1LBVA 4N4UA 4YZZA 1EZPA 5DTBA 1B3FA 4I8CA 3CFXA 3E79A 3W9VA 1NV6A 4N07A 2DOJA 3EHTA 1FQEA 3SZPA 4P1LA 1P1NA 4FECA 4U2RA 1B51A 3U92A 4LVQA 2NUVA 3CVGA 2CMOA 3ZSFA 1FPFA 2Q74A 3CSBA 4KXPA 4R9GA 3K1NA 4N81A 4F19A 3Q25A 4N8GA 3MYUA 3V8XB 4LONB 5AA2A 1N7WA 3O6GA 4EXKA 4JWYA 3D4GA 4MNPA 1VSOA 3TDJA 4BDQA 4NMYA 5A5XB 3PPPA 4OVSA 4YB6A 1FBEA 1MS7A 1A55A 1SD3A 1FTJA 4DXBA 5DVFA 3PUVE 4U1OA 5H8QA 3TAJA 2XXQA 3UGWA 1AWBA 4RK2A 2F5XA 2ZZVA 3DP4A 1GGGA 1USYE 3OEMA 1B2HA 1BP5A 1KWHA 3GBBA 4OENA 3UK4A 4GWOA 3B7DA 1INPA 2ZMBA 3QAXA 5LOMA 4GOTA 2V25A 1PB9A 4DIGA 1PDAA 2OWSA 2F3BA 1FPDA 1SYHA 3LUYA 4X1DA 4NF6A 4N6KA 3K2DA 2I4CA 2DWJA 2ZNSA 1MXVA 2DWHA 1FJ6A 4PFTA 5CM6A 1MXWA 1UTHB 1HSLA 3UORA 2QS4A 4OEVA 1IUDA 3ONMA 4OESA 5IZ1A 2UYEA 1NUWA 2B4MA 4YICA 2HCAA 3U72A 2XA5A 4KR5A 3MUQA 3O6IA 1FPGA 4P0IA 5AA4B 2IEEA 3I6VA 2UVJA 1EZOA 3KJTA 4QF9A 3VLVA 5ICTA 3K1PA 1A8FA 3KEIA 2QPQA 3G7WA 5TPAA 1RDXA 2YPNA 1PB7A 3UN6A 1FBPA 1SI0A 3C32A 3GBAA 2FIXA 1RYOA 2YLNA 2X7PA 1OVBA 1VFDA 1LGBC 4GX3A 2XD3A 4QSEA 3G3GA 4AS4A 3OSQA 2RF1A 4XFEA 2F6PA 1S9TA 1JETA 3FUZA 4QRZA 3MZ9A 3PMXA 2V3UA 4PETA 5BWJA 5EYHA 1CE2A 2ONKE 4E0XA 3G3HA 5K2XA 3MVYA 5AE4A 1FBGA 1SI1A 3KFMA 1Y3PA 2AL5A 1ANFA 4OQOA 4R9FA 4PFRA 1I69A 2WKYA 4HE2A 3H3GA 2VGQA 3B50A 5L9MA 2Z22A 2HPGA 4PAKA 3K0VA 3IX1A 1KZ8A 4I3EA 2Z23A 4Z7EA 4H5FA 3FZVA 1URGA 1MQHA 2UVGA 5I2NA 4EQ7A 4OYVA 1IMDA 1RDYA 3QMFA 1P1UA 3M3KA 5ET7A 3G3KA 4PFYA 2OWTA 3K1MA 4QBAA 4KYEA 2Q8JA 3EQ1A 4PF8A 3G3FA 2M8CA 2NVUB 4JB7A 4PGNA 1Y1ZA 4IO2A 3IOVA 2NWJA 5ITOA 3ECRA 4PAIA 3TFLA 4HE1A 1JW1A 3O28A 1B32A 5ET6A 3D4CA 3H6UA 5DVIA 1Y20A 3B8BA 1N04A 3OELA 1NH8A 3CHGA 2WEFA 1H3DA 1R1NA 3KN3A 5KCJB 2HHMA 5LTCA 1Q35A 4MHFA 2QS2A 1OIBA 1Y4CA 3K6WA 3IB0A
chains in the Genus database with same CATH topology
2VT5A 1EYIA 2WBBA 3LUZA 1KA0A 4OVQA 2CZKA 1FJ9A 2CZHA 5ESYA 1IMEA 1IMBA 2PFZA 1SPIA 1CNQA 3ISPA 4PGPA 2QFLA 4GX4A 4GWZA 4GBWA 2VPNA 1LEVA 1YYZA 5I5PA 1NUZA 4PFIA 1DK4A 4JVIA 5J1DA 5F24A 4GWWA 1Q9DA 4NN3A 1NV7A 5T3JA 2XWOA 2DE3A 4QXDA 5I3SA 2DE4A 4O8MA 1FBCA 1FBHA 2WYPA 2KR0A 4JVDA 4NAPA 2V3QA 2Q9TA 4NGUA 1IMFA 3T1BA 3KBZA 1NUXA 4P56A 4G61A 3RYDA 4PTKA 4HXVA 4F1UA 1YZ0A 1DCUA 4P3LA 3IFCA 1IMAA 4MX6A 4PCDA 4P8BA 4NF0A 4N15A 4GWUA 1NV5A 1FPLA 1G0IA 2QVUA 1FPBA 3U65A 2CEXA 4PDHA 2Y5LA 4GX6A 4NHBA 1FPEA 4LN5A 5IGAA 2HZKA 5FBPA 1NV0A 4H45A 1K9YA 1NV2A 4XF5A 2FHYA 4I3YA 2DDKA 4HE0A 4M1VA 1DBZA 1LBVA 4N4UA 4YZZA 1YXIA 4DI4B 4PE3A 3A29A 1NI9A 2DE2A 3E79A 3W9VA 1NV6A 4GWXA 2Y5KA 3SZPA 4MAGA 2JJKA 3W9WA 4P1LA 5JK4A 4PFBA 4GWYA 4MNCA 2R8TA 4MEVA 1FPFA 2Q74A 4KXPA 5I7IA 4F19A 4N81A 4N8GA 3MYUA 4JVCA 3ROJA 2VPOA 1QGXA 1EYJA 1KA1A 2BJIA 4PDDA 4MNPA 4NG7A 4UABA 1XI6A 4OVSA 3MSTA 1FBEA 1FRPA 4PBHA 1JP4A 4OVTA 4OANA 1AWBA 2F5XA 2ZZVA 2WBDA 1FSAA 5EQ7A 2L5VA 1G0HA 1INPA 4GWSA 4O7IA 1LBWA 4P1EA 3FXBA 4PF6A 4MIJA 2GQ1A 1NUYA 2F3BA 1FPDA 4MMPA 4N6KA 5EYGA 2MKZA 1D9QA 4N91A 1FPIA 2XWKA 3RPLB 1FJ6A 5CM6A 5IZ3B 2PFYA 2PCRA 5EQ8A 2WX9A 4P47A 1FBFA 3E78A 5IZ1A 5IM2A 1NUWA 4N8YA 2B4MA 4YICA 4GBVA 2XA5A 1NV4A 2XWIA 1FPGA 1LBXA 4PC9A 1LBYA 3D1RA 2QPQA 4XEQA 4X04A 5ET8A 4OVRA 1RDXA 1FPKA 2F3DA 2P3VA 3HFUA 1FBPA 3RPLA 4F1VA 3GYYA 2FIXA 5IZ3A 4N17A 5ET5A 1FBDA 4GX3A 2QVRA 3PTYA 4NX1A 3T0JA 4F18A 5DW8A 4AS4A 4HCYA 5IZZA 4XFEA 1NV1A 5EQ9A 2WYKA 4MNIA 4PETA 5EYHA 3KC0A 4X8RA 2OX3A 4PAFA 4MCOA 1FBGA 1BK4A 2FBPA 4H46A 2B4LA 4PFRA 1NV3A 3FBPA 4HCWA 2V4CA 1EYKA 4HE2A 2DVZA 3B50A 1RDZA 2HPGA 4PAKA 2FIEA 2OWZA 2P3NA 3LV0A 1KZ8A 2ZZWA 4I3EA 2CZIA 3KC1A 2ZZXA 4OA4A 2QVVA 4OVPA 1FPJA 1IMDA 1RDYA 2KQZA 3QMFA 5ET7A 4DI3D 4QBAA 1IMCA 3BIGA 2HXRA 2XXKA 4PF8A 5A5LA 4N6DA 4PGNA 1FTAA 2HZLA 4O94A 4PAIA 2FVZA 4I40A 4MJOA 1LBZA 4HE1A 4PBQA 4P9KA 1K9ZA 3NOHA 3EKIA 4O7MA 4IR8A 5ET6A 2CEYA 5J16A 4FBPA 2XWVA 3B8BA 4NQ8A 3CHGA 2WEFA 3BIHA 2HHMA 3IFAA 4AS5A 5LTCA 1VDWA 4MHFA 2Q8MA 5LDZA 4X9TA 5EQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VT5 A;  1EYI A;  5FBP A;  2WBB A;  1NUY A;  3LUZ A;  1NV0 A;  4H45 A;  1KA0 A;  2F3B A;  1FPD A;  2CZK A;  1FJ9 A;  1K9Y A;  1BK4 A;  2CZH A;  2FBP A;  4H46 A;  5ESY A;  1IME A;  1IMB A;  1SPI A;  5EYG A;  1NV2 A;  1NV3 A;  1CNQ A;  3FBP A;  1D9Q A;  2FHY A;  1EYK A;  1FPI A;  2DDK A;  2QFL A;  4GX4 A;  4HE2 A;  4I3Y A;  4HE0 A;  4GWZ A;  1DBZ A;  4GBW A;  3RPL B;  1LBV A;  1FJ6 A;  5IZ3 B;  1RDZ A;  2PCR A;  2FIE A;  1LEV A;  1YYZ A;  2OWZ A;  2P3N A;  5EQ8 A;  1YXI A;  3LV0 A;  1KZ8 A;  1NUZ A;  1FBF A;  3A29 A;  4I3E A;  1NI9 A;  2CZI A;  3KC1 A;  1DK4 A;  5IZ1 A;  2QVV A;  1NV6 A;  1NUW A;  4GWX A;  2Y5K A;  4GBV A;  2JJK A;  5F24 A;  1FPJ A;  1IMD A;  4GWW A;  1NV4 A;  1RDY A;  1FPG A;  1Q9D A;  3QMF A;  1NV7 A;  5T3J A;  1LBX A;  5ET7 A;  4GWY A;  1LBY A;  3D1R A;  2R8T A;  1IMC A;  4QXD A;  5I3S A;  3BIG A;  5A5L A;  1FBC A;  1FPF A;  2Q74 A;  1FBH A;  5ET8 A;  4KXP A;  1RDX A;  1FPK A;  1FTA A;  4N81 A;  2F3D A;  2P3V A;  1FBP A;  3RPL A;  1IMF A;  2FIX A;  5IZ3 A;  3KBZ A;  3ROJ A;  1NUX A;  1QGX A;  1EYJ A;  1KA1 A;  2BJI A;  4G61 A;  3RYD A;  2FVZ A;  4I40 A;  4MJO A;  5ET5 A;  1LBZ A;  4PTK A;  4HXV A;  4HE1 A;  1K9Z A;  1FBD A;  4GX3 A;  1XI6 A;  1DCU A;  1YZ0 A;  4IR8 A;  2QVR A;  3IFC A;  1IMA A;  1FBE A;  1FRP A;  3T0J A;  1JP4 A;  4GWU A;  5DW8 A;  4AS4 A;  1NV5 A;  1FPL A;  1G0I A;  1NV1 A;  5ET6 A;  1AWB A;  5J16 A;  4FBP A;  2QVU A;  1FPB A;  2WBD A;  5EQ9 A;  3B8B A;  1FSA A;  2WEF A;  5EQ7 A;  5EYH A;  3BIH A;  3KC0 A;  2Y5L A;  1G0H A;  2HHM A;  4GX6 A;  3IFA A;  4AS5 A;  2OX3 A;  1VDW A;  1INP A;  4GWS A;  4O7I A;  2Q8M A;  1LBW A;  5LDZ A;  1FBG A;  5EQA A;  1FPE A;  2GQ1 A; 
#chains in the Genus database with same CATH topology
 4MLV A;  4IO4 A;  2OBG A;  4OVQ A;  2CZK A;  5AA4 A;  4PFW A;  1FQC A;  2V84 A;  3ISP A;  4ZS9 A;  2QFL A;  1QUJ A;  3JYR A;  2VPN A;  3TZA A;  5B7D A;  1LEV A;  5I5P A;  3ILT B;  5AA1 A;  3O97 A;  3R7X A;  4IO3 A;  4PFI A;  1R9Q A;  4G8N A;  5TP9 A;  4JSO A;  1A8E A;  4LQ5 A;  2H5Y A;  4C0R A;  5CMB A;  3VLU A;  3IOT A;  5F24 A;  4WEP A;  4NF4 B;  3MZ1 A;  1Q9D A;  1NV7 A;  1HSE A;  1LB9 A;  3EN3 A;  4ONY A;  4QXD A;  2NXO A;  1FBC A;  4XXU A;  4YKP A;  5DYH A;  3RTW B;  2O7U A;  2V3Q A;  4R75 A;  3SEW A;  3TEP A;  5TU0 A;  4F22 A;  2E0S A;  4KI0 E;  1UTB A;  4C1U A;  4G61 A;  3CIJ A;  2RKM A;  4POW A;  3HHG A;  4ZDM A;  4MX6 A;  1QKA A;  4IO6 A;  1FCK A;  4FE8 A;  4RXL A;  1FPL A;  1Z7M E;  3K00 A;  4P11 A;  4AB5 A;  2QVU A;  1FPB A;  3U65 A;  4NWC A;  3A3C A;  1JEU A;  1FTK A;  3OOA A;  4EF2 A;  2RCB A;  1ZIU A;  4ELP A;  4U4X A;  3OD7 A;  3PUZ E;  4LN5 A;  4ELQ A;  1A54 A;  1XVY A;  3EHS A;  2QJE A;  1NV2 A;  2XXW A;  4LAT A;  3O29 A;  1Y3N A;  2ZYK A;  2O6A A;  1PEB A;  5AA2 B;  1B7U A;  3VXC A;  1YXI A;  1SW1 A;  4MLQ A;  4O3A A;  3PPR A;  1XVX A;  1NI9 A;  2DE2 A;  1PBQ A;  1IEJ A;  1GV8 A;  4GWX A;  4R72 A;  1AOV A;  3FJM A;  5H8Q B;  3QUJ A;  3FJG A;  3IL1 B;  3KOS A;  4ZE8 A;  4OER A;  2DQV A;  1D9Y A;  4PFB A;  3M8U A;  3HST A;  3TPA A;  3GXA A;  4MEV A;  3MPK A;  1NL5 A;  1DMB A;  1MQD A;  1P99 A;  5H8N A;  3TQW A;  4ZEK A;  3G3I A;  2HQ0 A;  2XXV A;  4GVO A;  2O7I A;  1EU8 A;  1OLC A;  3ROJ A;  4NF6 B;  4NG7 A;  3FD3 A;  2PMS A;  1QW0 A;  3EF7 A;  2NOO A;  3MST A;  2ESN A;  1L5T A;  5DVJ A;  3FVO A;  3LSW A;  1FQD A;  3H6V A;  1B40 A;  3OMB A;  1WVJ A;  3S9N C;  5I58 A;  2IA4 A;  4GRK A;  4G2Z A;  4DCY A;  3CFL A;  5HBC A;  2L5V A;  3N26 A;  1H44 A;  4O7I A;  1P1Q A;  1A7L A;  1H45 A;  4PF6 A;  5FTH A;  4NF4 A;  3MAM A;  3IO6 A;  4RA1 A;  5TPA B;  3IB1 A;  1B0L A;  3TTK A;  5KZT A;  1FPI A;  2P0S A;  4GD5 A;  1S7Y A;  3T93 B;  3ODB A;  2PFY A;  4XKP A;  2DSF A;  5FTI A;  1B7H A;  2WX9 A;  3H6T A;  1LFI A;  3A3U A;  3E78 A;  1URS A;  4ZED A;  3CFZ A;  2P1S A;  3OO9 A;  1NV4 A;  3V83 A;  4LP2 B;  4PE5 B;  4PC9 A;  3D1R A;  4G8H A;  3LSX A;  2UXA A;  3I3V A;  3LSL A;  4EQB A;  2R6G E;  4ESW A;  2Q2A A;  3S4U A;  1MM6 A;  4F1Y A;  4OVR A;  2R71 A;  1N3W A;  1FPK A;  5CI5 A;  2Y7I A;  2E1S A;  3HFU A;  4F31 B;  5B70 A;  3OEK A;  3MWB A;  4F1V A;  3GYY A;  1ATG A;  5IZ3 A;  3SKP A;  1AMF A;  4HW8 A;  4POX A;  5BUU A;  3K6X A;  4OFO A;  5F7V A;  4KYD A;  3PTY A;  2AIX A;  3S2V A;  4P0G A;  3A09 A;  1B5I A;  3VDF A;  1AL3 A;  4HCY A;  2V3T A;  2Y7W A;  1MDQ A;  3TCF A;  3IR1 A;  4QFL A;  1VE4 A;  3GZG A;  4MNI A;  1OMP A;  1YAE A;  3KC0 A;  1B1H A;  5I2N B;  3ZKL A;  5H8F A;  5DT6 A;  1OVT A;  1O64 A;  4R6H A;  1FQA A;  1ZU0 A;  4FEB A;  1H43 A;  2FA7 A;  5F1Q A;  2FBP A;  4H46 A;  5ISU A;  3RY3 A;  4NED A;  4HCW A;  3TKD A;  1IQ7 A;  1MXX A;  1TWY A;  3T66 A;  5I84 A;  1EYK A;  2DVZ A;  3KN8 A;  2F97 A;  3DP6 A;  1P1W A;  2OK2 A;  1RDZ A;  4TOZ A;  2P3N A;  3E9X A;  2ZZW A;  1URD A;  1M5F A;  4F3S A;  1SVX B;  1ZLQ A;  2F7C A;  1GR2 A;  4OVP A;  3PMW A;  1N76 A;  2UVI A;  4U23 A;  4XKQ A;  4ELR A;  3CSG A;  4FIM A;  2D5W A;  3BIG A;  2HXR A;  2XXH A;  2XXK A;  5I57 A;  5A5L A;  2Q89 A;  1WOD A;  4PP0 A;  1NNK A;  1POY 1;  1B1X A;  3QSL A;  2DXR A;  1BLF A;  2RC7 A;  5L8D A;  2RC8 A;  2O1L A;  1B3E A;  2FVZ A;  2H99 A;  3N6U A;  3M3L A;  4LA9 A;  4P9K A;  3EKI A;  4O7M A;  2I6E A;  4ZEC A;  1NH7 A;  1BTJ A;  1PB8 A;  2B3F A;  5CMC A;  2Q2C A;  3MVX A;  3U1O A;  5CC2 A;  3MC2 A;  5CBR A;  4GLI A;  3MP1 A;  3FVK A;  5TP9 B;  4XKN A;  2P2A A;  2F34 A;  2I58 A;  1GVC A;  4NF8 A;  4G77 A;  4QSD A;  1MH3 A;  3C4M A;  1MQG A;  4OFL A;  5EQA A;  3HO7 A;  3IOU A;  4R6K A;  1JVX A;  2VT5 A;  4C1T A;  1ELJ A;  1KA0 A;  2HEU A;  3VVF A;  5DEX A;  1FJ9 A;  2CZH A;  2PT1 A;  3HHF A;  4PGP A;  4GFR A;  2XX9 A;  3O66 A;  2R9J A;  4GWZ A;  2PBW A;  3JV9 A;  3MVZ A;  3SEV A;  1LCF A;  3H06 B;  2H25 A;  1UTB B;  3RUM A;  1N0T A;  3L6H A;  3PPQ A;  1DK4 A;  4JVI A;  1QVS A;  1SW2 A;  4FAT A;  4ISU A;  4NN3 A;  4NF5 A;  2XX8 A;  2XWO A;  3QYT A;  2DE4 A;  3TTL A;  5IAI A;  2XXU A;  4EDP A;  2WYP A;  4ELO A;  1B4Z A;  2KR0 A;  3LSF B;  3FXQ A;  4LZ7 A;  3S9L C;  2Q9T A;  2DS9 A;  2DYX A;  3O9P A;  1OQG A;  2OPD A;  2VD3 A;  1Y1M A;  4EQ9 A;  3KBZ A;  3FGS A;  4DDD A;  4P56 A;  2GHA A;  1LAF E;  4L17 A;  2I49 A;  4PTK A;  4HXV A;  1B6H A;  4F1U A;  1YZ0 A;  5H8H A;  5IKB A;  3S9E A;  4NF0 A;  4GWU A;  1MPD A;  4H5G A;  3FXU A;  1G0I A;  1MH4 A;  4PQJ A;  2Y7K A;  1F9B A;  4HTG A;  2Y7P A;  3PUY E;  3EPE A;  2I0B A;  2RCA A;  4QFK A;  2Y5L A;  1M5C A;  1DTG A;  1SW4 A;  4WKM A;  4ZZE A;  4NWD A;  2VHA A;  2H98 A;  1FPE A;  1GTK A;  1B3G A;  5IGA A;  3E3K A;  1NKX A;  4BDL A;  1J1N A;  3MJN A;  1NV0 A;  1II5 A;  4QFO A;  4RY1 A;  1K9Y A;  3C9H A;  1QUK A;  1LAH E;  1AH5 A;  1SYI A;  5H8N B;  1QUI A;  5EHS A;  4I3Y A;  2DDK A;  3P7I A;  4ZEB A;  4H65 A;  3HCQ A;  1DBZ A;  1MXY A;  3CG1 A;  1UQW A;  4DI4 B;  4PE3 A;  3A29 A;  3C33 A;  3PGF A;  3OO8 A;  3C34 A;  1CB6 A;  1POT A;  2HFB A;  1LFG A;  3PD8 A;  2DWI A;  3H4Z A;  4MAG A;  3RN8 A;  1VFE A;  2Z8D A;  3FJ7 A;  1B3H A;  4XIG Q;  4MNC A;  5I58 B;  3SEY A;  1O7T A;  4JXI A;  2PX1 A;  3RT6 B;  5AA3 A;  3CR9 A;  3IAZ A;  4H6D A;  5CMK A;  1JW5 A;  4RJZ A;  2XD2 A;  5I7I A;  3TMG A;  3ZKK A;  3IOR A;  2VP1 A;  1PC3 A;  3TEL A;  3VV5 A;  3SET A;  3IOW A;  5JTY B;  4JVC A;  5M2V A;  3FXR A;  2VPO A;  2QS3 A;  2FNC A;  4OTE A;  1EYJ A;  3TCG A;  4H0W A;  4PDD A;  3QUF A;  3EHU A;  1SQY A;  4UAB A;  3B6Q A;  3UA8 A;  3V5A A;  1FRP A;  3PPO A;  2QL3 A;  3BBR A;  1RYX A;  4RPO A;  4F2Q A;  2B65 A;  1TFD A;  2F78 A;  4ZEF A;  3K01 A;  3RLF E;  5ITP A;  1LAG E;  2REJ A;  1JQF A;  1MRP A;  3Q28 A;  4GWS A;  1LBW A;  2V93 A;  3V89 B;  3FXB A;  3C36 A;  3E13 X;  2H9B A;  3S9M C;  2GQ1 A;  1NUY A;  3FIR A;  4IY6 A;  4MMP A;  4NE4 A;  3U93 A;  5ELV A;  5L9O A;  2MKZ A;  1D9Q A;  1B9J A;  1Y9U A;  4OVJ A;  1YPN A;  2FYI A;  1NNT A;  1XC1 A;  1DTZ A;  3R26 A;  4OEU A;  3VVD A;  5IZ3 B;  4RK9 A;  4YKI A;  3IJX B;  3DLN A;  4JWX A;  5IM2 A;  3DEL B;  4N8Y A;  4GBV A;  2PT2 A;  4Q0C A;  3KN7 A;  1TFA A;  3FV1 A;  4OWD A;  4KD5 A;  3G3J A;  3VLW A;  3SER A;  3SES A;  3UP9 A;  2DXY A;  5H8F B;  2F3D A;  1AIV A;  3RPL A;  2QMW A;  3K02 A;  1LAX A;  2ABH A;  1I6A A;  3VE1 B;  1LBC A;  3L6G A;  4H1X A;  3VFJ A;  2REG A;  3N6T A;  2G29 A;  1Q1K A;  4NX1 A;  4DXU A;  3DP8 A;  3QXM A;  4O3B A;  4F18 A;  5DW8 A;  5IZZ A;  1OLA A;  1US5 A;  3KG2 A;  3KGC A;  1FQB A;  2O84 X;  1Y4T A;  2WYK A;  3ZS6 A;  2QSX A;  1H76 A;  1N7X A;  3PPN A;  4X8R A;  2OX3 A;  4ND9 A;  1O63 A;  2I3V A;  1A99 A;  3TQL A;  2D21 A;  3B6W A;  1B52 A;  3OEN A;  4MCO A;  2DP8 A;  1S50 A;  3TTN A;  4KQP A;  5I57 B;  3KZG A;  1PBP A;  2PVU A;  2ZYM A;  4ZE9 A;  1BK4 A;  2RC9 A;  3ILU B;  3PUW E;  1SW5 A;  1NV3 A;  4YAH X;  2OZZ A;  1MM7 A;  2FIE A;  4THI A;  4U4S A;  3LV0 A;  2CZI A;  3QIM A;  2ZZX A;  3OO6 A;  5JTY A;  2XXX A;  4OA4 A;  4KHZ E;  4IGT A;  4XTC Q;  1LLS A;  1B05 A;  1FTO A;  2HAV A;  1FTM A;  4I9D A;  4BDO A;  2ZNT A;  4TLM B;  4F2O A;  4F3G A;  4F3B A;  1B5H A;  5I56 A;  3H6W A;  4DI3 D;  1FQF A;  5I59 A;  4GQO A;  4GIZ A;  2Z8F A;  2GRV A;  4NF8 B;  4N6D A;  1NNF A;  4UAC A;  3T9U A;  4YB7 A;  1FTA A;  3RTF B;  3USD A;  1DOT A;  3Q26 A;  3C31 A;  4O94 A;  2PYY A;  4FOR A;  3FVN A;  4ZZA A;  5DEX B;  4JSD A;  1B58 A;  2XX7 A;  1LBZ A;  4PBQ A;  4U22 A;  4IR8 A;  4YMA A;  4MBP A;  3OO7 A;  2OCU A;  2CEY A;  2XWV A;  4KYS A;  4H8I A;  1B5J A;  4LQ2 A;  4NQ8 A;  3IFA A;  4AS5 A;  1TT1 A;  4X1B A;  4GF8 A;  4BDR A;  5LDZ A;  1MPC A;  1IIW A;  3I5O A;  4WXJ A;  4X9T A;  2F7B A;  4NF5 B;  1YTV A;  4YB5 A;  1I6B A;  4EF1 A;  1DPE A;  4WED A;  5KDT A;  1IME A;  1IMB A;  2Q88 A;  1ZMG A;  4GX4 A;  4MF3 A;  3KSJ A;  4IO7 A;  4N13 A;  4R2F A;  1IIT A;  5FHO A;  4U1Z A;  3CG3 A;  1M5B A;  5J1D A;  3DM0 A;  2H4I A;  5H8H B;  4EUO A;  4DE8 A;  1MG1 A;  2QRY A;  2ZYO A;  3MBP A;  3SDF A;  3T9H B;  2AYS A;  5T3J A;  2DWA A;  2DE3 A;  4O8M A;  2GFE A;  2A5T A;  1FBH A;  4JVD A;  4KCC A;  4NAP A;  4F3P A;  5AA2 D;  1JNF A;  2ZXT A;  2F35 A;  4NGU A;  1IMF A;  5H8S A;  3CI8 A;  3T1B A;  4R6Y A;  3WAE A;  1SBP A;  4IY5 A;  5K2Y A;  1N3X A;  4R73 A;  4RYA A;  1B46 A;  3IB2 A;  1DCU A;  3U94 A;  4XKR A;  3TUS A;  4P8B A;  4QHQ A;  2ONS A;  1NV5 A;  1B0H A;  4OET A;  4Q5T A;  2UVH A;  2HXW A;  1QJM A;  3Q27 A;  3HN0 A;  2ALU A;  4GX6 A;  4YKJ A;  4NHB A;  2A5S A;  2THI A;  3THI A;  4GXA A;  1RKM A;  4F39 A;  2I4B A;  3QK6 A;  1Z7N E;  3OSR A;  2QMX A;  4XF5 A;  4FED A;  2FHY A;  4R74 A;  4HE0 A;  3WAF A;  2HAU A;  3BFT A;  2G93 A;  1MDP 1;  3VVE A;  4H67 A;  1MXZ A;  3LC8 A;  3IO4 A;  1B7Z A;  2Y5K A;  1R9L A;  3MZB A;  2JJK A;  1SDX A;  2XXY A;  3W9W A;  1JW4 A;  4E0W A;  5JK4 A;  4GWY A;  1DPP A;  1XT8 A;  4YMB A;  2R8T A;  4G68 B;  1JVY A;  1A40 A;  4N6P A;  1USY H;  3R6U A;  3O2A A;  1VR5 A;  4R2B A;  2O68 A;  5EHM A;  3KBR A;  2F7A A;  4F29 A;  4JDF A;  4O3C A;  2CZL A;  4AB6 A;  3RPW A;  1D9V A;  2XXT A;  1QGX A;  1KA1 A;  2BJI A;  3KSX A;  1FW0 A;  4IO5 A;  1IXI A;  3MQ9 A;  3RQT A;  1XI6 A;  3H03 A;  4EXL A;  1IXH A;  2B3B A;  1MXU A;  1JP4 A;  4PBH A;  4OVT A;  5I2K B;  4OAN A;  3IJO B;  4FAJ A;  3H7M A;  3TTR A;  2WBD A;  1HSJ A;  1FSA A;  5JEI A;  4BDN A;  5EQ7 A;  2O69 A;  4KFQ A;  1BKA A;  1G0H A;  2ONR A;  3N5L A;  4TLL B;  4P1E A;  4Q30 B;  1MY0 A;  4MIJ A;  2OLB A;  2GHB A;  1BIY A;  2ZNU A;  5EYG A;  5CMM A;  3T22 A;  1XS5 A;  4N91 A;  3MP8 A;  5A5X A;  3BFU A;  3MW0 A;  2XWK A;  3RPL B;  2I3W A;  2PCR A;  5EQ8 A;  3VXB A;  4P47 A;  3PD9 A;  1FBF A;  3T9V A;  3SEX A;  1D3K A;  1IXG A;  3B6T A;  4G4P A;  2XWI A;  3LR1 A;  1LBX A;  3MP6 A;  3PUX E;  1LBY A;  2W7Y A;  2Z8E A;  3MVW A;  4XEQ A;  3SEU A;  4JWO A;  4X04 A;  5ET8 A;  4G8M A;  2QS1 A;  1FTL A;  2P3V A;  4FJP A;  2X7Q A;  3OXN A;  2X26 A;  4GL0 A;  1UTH A;  4N17 A;  2Y7R A;  1XOC A;  3K6V A;  1LB8 A;  2BJJ X;  5ET5 A;  1M5D A;  3HV1 A;  1NFT A;  1FBD A;  1MQJ A;  2QVR A;  3N94 A;  1N84 A;  3T0J A;  4MH5 A;  1LBB A;  4NTL A;  2XXR A;  1NV1 A;  2RIN A;  5EYF A;  1MY1 A;  3K6U A;  3TYH A;  3UIF A;  3HPI A;  1MY4 A;  3RT8 A;  5EQ9 A;  4G68 C;  4DCX A;  4I62 A;  1Y3Q A;  3F11 A;  5FHN A;  2I0C A;  2XXP A;  4PAF A;  2Y84 A;  2F6G A;  1ZJL A;  5I56 B;  4U21 A;  4H8J A;  5I59 B;  2B4L A;  3FBP A;  1YCJ A;  4MFI A;  2V4C A;  4G68 A;  3K4U A;  3TTM A;  4Z0I A;  1P1O A;  2OWZ A;  4RPN A;  5CRY A;  4K3F A;  2VD2 A;  3KC1 A;  3FAS A;  1QUL A;  3T9X B;  3RNN A;  3CRB A;  3U8Q A;  1MPB A;  2QVV A;  3TOD A;  1LFH A;  5CBS A;  4RNS A;  4LZ8 A;  1FPJ A;  2KQZ A;  1US4 A;  3KJ7 A;  5ICQ A;  4UA8 A;  1IMC A;  1MQI A;  4PFU A;  5I2K A;  1JEV A;  5FHM A;  1MY3 A;  2HZL A;  1WDN A;  4JBZ A;  3RGY A;  5KDT B;  4I40 A;  4MJO A;  2O51 A;  5L9S A;  1K9Z A;  1B3L A;  3NOH A;  2GH9 A;  3FAT A;  4OHN A;  3GLB A;  1IXC A;  4GXS B;  1D4N A;  3O6H A;  1ZKB A;  2F8D A;  5J16 A;  4FBP A;  2XHD A;  1MY2 A;  4ECF A;  3BIH A;  2YJP A;  3KOT A;  1XHY A;  2D3I A;  1VDW A;  2Q8M A;  4KPT A;  4KCD A;  4OXV A;  4LUB A;  1EYI A;  2WBB A;  3JZJ A;  3LUZ A;  3BKI B;  2A5T B;  5ESY A;  2PFZ A;  1SPI A;  3W15 C;  1CNQ A;  4TQU Q;  4Q8R A;  4BLA A;  4ZEI A;  4GBW A;  1UIU A;  1YYZ A;  1NUZ A;  1NMU A;  1T0K A;  1EH3 A;  5HPQ A;  2ANJ A;  2DVC A;  1LST A;  5KCJ A;  4GL8 A;  4GWW A;  4X48 A;  3IK6 B;  3PV0 E;  4AQ4 A;  4IB2 A;  2XXI A;  1DSN A;  1IZ1 A;  1QKB A;  2KLF A;  4OFJ A;  5I3S A;  1M5E A;  2AL4 A;  3TCH A;  4OZ9 A;  3C35 A;  3PU5 A;  3Q29 A;  2I48 A;  3T96 B;  4BDM A;  2OJT A;  4I1D A;  1NUX A;  1I6Q A;  1ZTY A;  3M3F A;  3RYD A;  4QFP A;  3PMV A;  4DLD A;  4P3L A;  3IFC A;  1IMA A;  4PCD A;  4N15 A;  3LBS A;  4QSC A;  4YU0 A;  2LAO A;  4HS7 A;  4DZ1 A;  4DXC A;  4LZ5 A;  3E4R A;  2OPE A;  2VOZ A;  2CEX A;  4QFN A;  4ESX A;  4PDH A;  1B4H A;  1EZ9 A;  1UIV A;  2F36 A;  1ZBM A;  1TXF A;  3MPL A;  1NNP A;  2HZK A;  5FBP A;  2ZYN A;  3AXF A;  4H45 A;  4M4G A;  3FVG A;  4IGR A;  4YKK A;  2O1M A;  5HM4 B;  1OQH A;  1R6Z A;  4OMB A;  4M1V A;  3FV2 A;  1LCT A;  2UYF A;  1LBV A;  4N4U A;  4YZZ A;  1EZP A;  5DTB A;  1B3F A;  4I8C A;  3CFX A;  3E79 A;  3W9V A;  1NV6 A;  4N07 A;  2DOJ A;  3EHT A;  1FQE A;  3SZP A;  4P1L A;  1P1N A;  4FEC A;  4U2R A;  1B51 A;  3U92 A;  4LVQ A;  2NUV A;  3CVG A;  2CMO A;  3ZSF A;  1FPF A;  2Q74 A;  3CSB A;  4KXP A;  4R9G A;  3K1N A;  4N81 A;  4F19 A;  3Q25 A;  4N8G A;  3MYU A;  3V8X B;  4LON B;  5AA2 A;  1N7W A;  3O6G A;  4EXK A;  4JWY A;  3D4G A;  4MNP A;  1VSO A;  3TDJ A;  4BDQ A;  4NMY A;  5A5X B;  3PPP A;  4OVS A;  4YB6 A;  1FBE A;  1MS7 A;  1A55 A;  1SD3 A;  1FTJ A;  4DXB A;  5DVF A;  3PUV E;  4U1O A;  5H8Q A;  3TAJ A;  2XXQ A;  3UGW A;  1AWB A;  4RK2 A;  2F5X A;  2ZZV A;  3DP4 A;  1GGG A;  1USY E;  3OEM A;  1B2H A;  1BP5 A;  1KWH A;  3GBB A;  4OEN A;  3UK4 A;  4GWO A;  3B7D A;  1INP A;  2ZMB A;  3QAX A;  5LOM A;  4GOT A;  2V25 A;  1PB9 A;  4DIG A;  1PDA A;  2OWS A;  2F3B A;  1FPD A;  1SYH A;  3LUY A;  4X1D A;  4NF6 A;  4N6K A;  3K2D A;  2I4C A;  2DWJ A;  2ZNS A;  1MXV A;  2DWH A;  1FJ6 A;  4PFT A;  5CM6 A;  1MXW A;  1UTH B;  1HSL A;  3UOR A;  2QS4 A;  4OEV A;  1IUD A;  3ONM A;  4OES A;  5IZ1 A;  2UYE A;  1NUW A;  2B4M A;  4YIC A;  2HCA A;  3U72 A;  2XA5 A;  4KR5 A;  3MUQ A;  3O6I A;  1FPG A;  4P0I A;  5AA4 B;  2IEE A;  3I6V A;  2UVJ A;  1EZO A;  3KJT A;  4QF9 A;  3VLV A;  5ICT A;  3K1P A;  1A8F A;  3KEI A;  2QPQ A;  3G7W A;  5TPA A;  1RDX A;  2YPN A;  1PB7 A;  3UN6 A;  1FBP A;  1SI0 A;  3C32 A;  3GBA A;  2FIX A;  1RYO A;  2YLN A;  2X7P A;  1OVB A;  1VFD A;  1LGB C;  4GX3 A;  2XD3 A;  4QSE A;  3G3G A;  4AS4 A;  3OSQ A;  2RF1 A;  4XFE A;  2F6P A;  1S9T A;  1JET A;  3FUZ A;  4QRZ A;  3MZ9 A;  3PMX A;  2V3U A;  4PET A;  5BWJ A;  5EYH A;  1CE2 A;  2ONK E;  4E0X A;  3G3H A;  5K2X A;  3MVY A;  5AE4 A;  1FBG A;  1SI1 A;  3KFM A;  1Y3P A;  2AL5 A;  1ANF A;  4OQO A;  4R9F A;  4PFR A;  1I69 A;  2WKY A;  4HE2 A;  3H3G A;  2VGQ A;  3B50 A;  5L9M A;  2Z22 A;  2HPG A;  4PAK A;  3K0V A;  3IX1 A;  1KZ8 A;  4I3E A;  2Z23 A;  4Z7E A;  4H5F A;  3FZV A;  1URG A;  1MQH A;  2UVG A;  5I2N A;  4EQ7 A;  4OYV A;  1IMD A;  1RDY A;  3QMF A;  1P1U A;  3M3K A;  5ET7 A;  3G3K A;  4PFY A;  2OWT A;  3K1M A;  4QBA A;  4KYE A;  2Q8J A;  3EQ1 A;  4PF8 A;  3G3F A;  2M8C A;  2NVU B;  4JB7 A;  4PGN A;  1Y1Z A;  4IO2 A;  3IOV A;  2NWJ A;  5ITO A;  3ECR A;  4PAI A;  3TFL A;  4HE1 A;  1JW1 A;  3O28 A;  1B32 A;  5ET6 A;  3D4C A;  3H6U A;  5DVI A;  1Y20 A;  3B8B A;  1N04 A;  3OEL A;  1NH8 A;  3CHG A;  2WEF A;  1H3D A;  1R1N A;  3KN3 A;  5KCJ B;  2HHM A;  5LTC A;  1Q35 A;  4MHF A;  2QS2 A;  1OIB A;  1Y4C A;  3K6W A;  3IB0 A; 
#chains in the Genus database with same CATH homology
 2VT5 A;  1EYI A;  2WBB A;  3LUZ A;  1KA0 A;  4OVQ A;  2CZK A;  1FJ9 A;  2CZH A;  5ESY A;  1IME A;  1IMB A;  2PFZ A;  1SPI A;  1CNQ A;  3ISP A;  4PGP A;  2QFL A;  4GX4 A;  4GWZ A;  4GBW A;  2VPN A;  1LEV A;  1YYZ A;  5I5P A;  1NUZ A;  4PFI A;  1DK4 A;  4JVI A;  5J1D A;  5F24 A;  4GWW A;  1Q9D A;  4NN3 A;  1NV7 A;  5T3J A;  2XWO A;  2DE3 A;  4QXD A;  5I3S A;  2DE4 A;  4O8M A;  1FBC A;  1FBH A;  2WYP A;  2KR0 A;  4JVD A;  4NAP A;  2V3Q A;  2Q9T A;  4NGU A;  1IMF A;  3T1B A;  3KBZ A;  1NUX A;  4P56 A;  4G61 A;  3RYD A;  4PTK A;  4HXV A;  4F1U A;  1YZ0 A;  1DCU A;  4P3L A;  3IFC A;  1IMA A;  4MX6 A;  4PCD A;  4P8B A;  4NF0 A;  4N15 A;  4GWU A;  1NV5 A;  1FPL A;  1G0I A;  2QVU A;  1FPB A;  3U65 A;  2CEX A;  4PDH A;  2Y5L A;  4GX6 A;  4NHB A;  1FPE A;  4LN5 A;  5IGA A;  2HZK A;  5FBP A;  1NV0 A;  4H45 A;  1K9Y A;  1NV2 A;  4XF5 A;  2FHY A;  4I3Y A;  2DDK A;  4HE0 A;  4M1V A;  1DBZ A;  1LBV A;  4N4U A;  4YZZ A;  1YXI A;  4DI4 B;  4PE3 A;  3A29 A;  1NI9 A;  2DE2 A;  3E79 A;  3W9V A;  1NV6 A;  4GWX A;  2Y5K A;  3SZP A;  4MAG A;  2JJK A;  3W9W A;  4P1L A;  5JK4 A;  4PFB A;  4GWY A;  4MNC A;  2R8T A;  4MEV A;  1FPF A;  2Q74 A;  4KXP A;  5I7I A;  4F19 A;  4N81 A;  4N8G A;  3MYU A;  4JVC A;  3ROJ A;  2VPO A;  1QGX A;  1EYJ A;  1KA1 A;  2BJI A;  4PDD A;  4MNP A;  4NG7 A;  4UAB A;  1XI6 A;  4OVS A;  3MST A;  1FBE A;  1FRP A;  4PBH A;  1JP4 A;  4OVT A;  4OAN A;  1AWB A;  2F5X A;  2ZZV A;  2WBD A;  1FSA A;  5EQ7 A;  2L5V A;  1G0H A;  1INP A;  4GWS A;  4O7I A;  1LBW A;  4P1E A;  3FXB A;  4PF6 A;  4MIJ A;  2GQ1 A;  1NUY A;  2F3B A;  1FPD A;  4MMP A;  4N6K A;  5EYG A;  2MKZ A;  1D9Q A;  4N91 A;  1FPI A;  2XWK A;  3RPL B;  1FJ6 A;  5CM6 A;  5IZ3 B;  2PFY A;  2PCR A;  5EQ8 A;  2WX9 A;  4P47 A;  1FBF A;  3E78 A;  5IZ1 A;  5IM2 A;  1NUW A;  4N8Y A;  2B4M A;  4YIC A;  4GBV A;  2XA5 A;  1NV4 A;  2XWI A;  1FPG A;  1LBX A;  4PC9 A;  1LBY A;  3D1R A;  2QPQ A;  4XEQ A;  4X04 A;  5ET8 A;  4OVR A;  1RDX A;  1FPK A;  2F3D A;  2P3V A;  3HFU A;  1FBP A;  3RPL A;  4F1V A;  3GYY A;  2FIX A;  5IZ3 A;  4N17 A;  5ET5 A;  1FBD A;  4GX3 A;  2QVR A;  3PTY A;  4NX1 A;  3T0J A;  4F18 A;  5DW8 A;  4AS4 A;  4HCY A;  5IZZ A;  4XFE A;  1NV1 A;  5EQ9 A;  2WYK A;  4MNI A;  4PET A;  5EYH A;  3KC0 A;  4X8R A;  2OX3 A;  4PAF A;  4MCO A;  1FBG A;  1BK4 A;  2FBP A;  4H46 A;  2B4L A;  4PFR A;  1NV3 A;  3FBP A;  4HCW A;  2V4C A;  1EYK A;  4HE2 A;  2DVZ A;  3B50 A;  1RDZ A;  2HPG A;  4PAK A;  2FIE A;  2OWZ A;  2P3N A;  3LV0 A;  1KZ8 A;  2ZZW A;  4I3E A;  2CZI A;  3KC1 A;  2ZZX A;  4OA4 A;  2QVV A;  4OVP A;  1FPJ A;  1IMD A;  1RDY A;  2KQZ A;  3QMF A;  5ET7 A;  4DI3 D;  4QBA A;  1IMC A;  3BIG A;  2HXR A;  2XXK A;  4PF8 A;  5A5L A;  4N6D A;  4PGN A;  1FTA A;  2HZL A;  4O94 A;  4PAI A;  2FVZ A;  4I40 A;  4MJO A;  1LBZ A;  4HE1 A;  4PBQ A;  4P9K A;  1K9Z A;  3NOH A;  3EKI A;  4O7M A;  4IR8 A;  5ET6 A;  2CEY A;  5J16 A;  4FBP A;  2XWV A;  3B8B A;  4NQ8 A;  3CHG A;  2WEF A;  3BIH A;  2HHM A;  3IFA A;  4AS5 A;  5LTC A;  1VDW A;  4MHF A;  2Q8M A;  5LDZ A;  4X9T A;  5EQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...