2HHMA

Structure of inositol monophosphatase, the putative target of lithium therapy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
272
structure length
266
Chain Sequence
WQECMDYAVTLARQAGVVEAIKNEMNVMLKSSPVDLVTATDQKVEKLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLTELGSSRTPETVRVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of inositol monophosphatase, the putative target of lithium therapy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE
total genus 92
structure length 266
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 1992-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2hhmA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hhmA02
2HHMA 1NV6A 1YXIA 1NUYA 4PTKA 2P3NA 5EYGA 5IZ3B 1FBGA 2QVRA 4QXDA 1BK4A 2F3DA 2FVZA 1NUZA 4GWWA 4IR8A 3B8BA 1FPLA 2WEFA 1NI9A 3LV0A 1LEVA 1EYIA 1FBCA 1Q9DA 1FPEA 2QFLA 2FIEA 2FIXA 1DK4A 2WBBA 4I3EA 1FBPA 2Y5KA 5ESYA 4GX4A 5FBPA 1IMAA 2DDKA 5EQ7A 3A29A 1G0IA 4GWYA 1FBHA 5ET5A 4FBPA 2P3VA 3ROJA 4GWZA 2GQ1A 5J16A 4AS4A 2WBDA 1NV2A 2VT5A 2CZIA 4GBWA 1YYZA 2QVUA 1FBEA 5IZ1A 4AS5A 1LBYA 4I3YA 1LBXA 1NV5A 1D9QA 4I40A 3QMFA 1FRPA 5EQAA 1FSAA 1FPFA 1NV0A 3RPLB 1RDZA 4GX3A 5ET7A 1FPDA 1KZ8A 1NV1A 1QGXA 2FHYA 1NUXA 2CZHA 3BIHA 1FPIA 1K9ZA 5I3SA 4HE0A 3T0JA 4HE2A 1IMBA 1IMDA 1NV4A 2JJKA 3RPLA 1SPIA 1FJ9A 2FBPA 4GBVA 5DW8A 1EYKA 1NV7A 1YZ0A 2OX3A 5LDZA 1RDXA 3KC0A 5A5LA 1EYJA 1FPJA 1LBVA 1NV3A 1K9YA 2F3BA 5T3JA 2OWZA 4G61A 4H46A 1CNQA 1INPA 2Q74A 1DCUA 1FPBA 4HXVA 3LUZA 1XI6A 4O7IA 5ET8A 4KXPA 4GWUA 2R8TA 1FPGA 1IMEA 3FBPA 2Y5LA 1FBDA 5EYHA 5EQ9A 3KBZA 1FJ6A 5IZ3A 5ET6A 3BIGA 1FBFA 1IMCA 1AWBA 2CZKA 1FTAA 2PCRA 4MJOA 1G0HA 2Q8MA 4HE1A 1DBZA 2QVVA 1KA0A 1NUWA 3D1RA 5F24A 5EQ8A 1JP4A 1FPKA 3KC1A 4H45A 1LBZA 3RYDA 4N81A 1RDYA 1IMFA 3IFAA 1KA1A 4GWSA 1LBWA 1VDWA 3IFCA 2BJIA 4GWXA 4GX6A
chains in the Genus database with same CATH superfamily
5IZ3B 3GYYA 1VE4A 4NGUA 1DPPA 2XX7A 2DP8A 3MVWA 3W15C 4G77A 4I3EA 1N7WA 3W9WA 2QRYA 3BBRA 3ILTB 3KN7A 3T9HB 1NNPA 3R7XA 4F3SA 5I58A 3DP8A 3TKDA 1LCTA 1OMPA 1P1QA 1PB9A 3RY3A 2CZLA 1DTGA 5TP9B 1FBEA 4BDRA 3PPRA 4NEDA 2ZNUA 1EU8A 1FQBA 2PT1A 2UVIA 4DZ1A 1XS5A 2ZYNA 2DQVA 3IL1B 4R2FA 3T22A 2FHYA 4HE0A 5TP9A 3U72A 5CBRA 3K6UA 3I5OA 3K6XA 5DW8A 4GFRA 1NV7A 3P7IA 2OCUA 2DWIA 3PD8A 2OZZA 4DXBA 1FTJA 3MWBA 3G3IA 1A40A 3ISPA 3FUZA 3FBPA 4KD5A 1S9TA 3HSTA 4KYSA 5KDTA 3H6VA 1JP4A 5IKBA 2PYYA 2YPNA 5H8NB 1B3FA 3GBBA 3KC1A 2O1MA 1FQDA 3SZPA 1XT8A 3SESA 2B4MA 1TWYA 4Q30B 4M1VA 1J1NA 3ZKLA 2X26A 3OSRA 5DVIA 3USDA 3SEUA 4RXLA 1SW4A 4ZEFA 3MP6A 3KBRA 5DT6A 3ONMA 2REGA 1PB7A 4PGPA 4QSDA 5EQ7A 3QYTA 4GWYA 3U93A 2LAOA 2GQ1A 4U2RA 2QVUA 4AS5A 3RTWB 2QS2A 1B46A 1B5HA 1Y1ZA 1H45A 3FVKA 5EYFA 3C36A 3RUMA 3QMFA 3LBSA 2KR0A 4GWOA 3PTYA 5L9OA 1FPFA 3IO4A 1A99A 1A55A 2QPQA 2RC9A 1KZ8A 3FIRA 4WEPA 4HCYA 4KCCA 4YKJA 4GBVA 1YZ0A 1AH5A 3KC0A 1O63A 3IB1A 2AIXA 4EXKA 1MY3A 3G3HA 3SERA 3T96B 1O7TA 3PMVA 1MG1A 4U4SA 1NH8A 3LUZA 5J1DA 3K01A 4GWUA 2DWAA 1MXUA 4H5FA 2Y7RA 3T93B 1B0LA 2XHDA 5ET6A 3KOSA 1IIWA 3W9VA 3BFUA 4F3PA 4PE5B 4C1UA 5CI5A 3E4RA 4JWOA 2O51A 4MLQA 4JWYA 3EHTA 2ABHA 2GH9A 3D4CA 3CG3A 2XXIA 4GWXA 1I6QA 1YXIA 3O2AA 1GTKA 2I4CA 1FCKA 3FZVA 3LUYA 5AA2B 1LEVA 3PMWA 2I58A 3TEPA 4OMBA 3OO8A 4L17A 4X04A 1PDAA 4P8BA 3CVGA 1M5DA 3C31A 2FYIA 1D4NA 4OANA 4U1ZA 3K6VA 4N13A 4U4XA 4F31B 1LFIA 4YB5A 1OLCA 4XIGQ 2G93A 1SW2A 4P56A 1IXGA 1A8FA 2Y7IA 3S9NC 1P1OA 4N17A 4RJZA 3T9VA 1Y3PA 1B7UA 3CFZA 1IXCA 3H4ZA 1LSTA 4QF9A 2Z8EA 4OFOA 1BLFA 4H46A 1I6AA 1A7LA 5DYHA 2DXYA 2ZYMA 4IGRA 4WXJA 1MXVA 1FJ6A 1B5JA 3IAZA 3U8QA 4QSCA 1KA0A 2OPDA 2F6PA 4YKPA 1S50A 2V4CA 4TLLB 1LB9A 3MVYA 1ELJA 2ESNA 3H6WA 3PPNA 3UA8A 3JZJA 1KA1A 3KOTA 5AA2D 4NE4A 4GX6A 3H6UA 3PPOA 4O3CA 4YB7A 3RN8A 5AE4A 4F1UA 4THIA 4F19A 1FW0A 5CM6A 4QXDA 1BK4A 1MXWA 1JVYA 4GWWA 4ESXA 1DOTA 5KZTA 3FVOA 4PFIA 2PFZA 2V25A 4MF3A 3T9UA 4H1XA 5I2NA 1LCFA 5ISUA 4GF8A 2V3TA 2XXUA 3VVEA 2DE3A 3TTKA 3EQ1A 4PBQA 3KSJA 3LSLA 2F7CA 5M2VA 1MDQA 4C1TA 3Q26A 4MH5A 3PUWE 1ATGA 4P1EA 1LBXA 1D9QA 4GD5A 2Z8DA 1B4HA 2HQ0A 2F36A 4GIZA 4YKIA 3BFTA 3O6GA 1NV1A 2IEEA 2XXQA 4BDMA 3H03A 4XKQA 1Y3QA 3FXUA 4ONYA 2OX3A 5LDZA 2ZZVA 3CI8A 1FPJA 1N0TA 3S9LC 4RK2A 4H5GA 2OWZA 2I3WA 1JEUA 4DXCA 2DWHA 3F11A 4ZEDA 2R71A 3QUJA 1IUDA 3KBZA 1B3HA 1EH3A 1I69A 3IOWA 4MMPA 1H44A 4FEDA 1GV8A 3TQWA 3N94A 3PV0E 1FPKA 1FQEA 3UGWA 4OESA 3VFJA 4P0IA 2RCBA 1N3WA 1B6HA 4N91A 3MZBA 2Z8FA 1OQHA 3C33A 3H3GA 2P3NA 3O28A 2OWTA 1VR5A 4IR8A 2REJA 4H0WA 1P1UA 3G3JA 1BTJA 1PBPA 5AA3A 3PUVE 1FBPA 1D9YA 3QIMA 1Y1MA 3EKIA 5ICQA 2F97A 1NNTA 1MY1A 3B50A 4ELQA 2ZYKA 4FBPA 1SYIA 1B4ZA 1FTLA 1YYZA 3TFLA 1CE2A 1SW5A 3SEVA 2R9JA 4X1DA 4PQJA 1SYHA 2XWOA 3RPLB 4ZZEA 4DCYA 1A54A 4PFRA 3KJ7A 2PVUA 4N4UA 3S4UA 5ICTA 1B7HA 1IMBA 2PFYA 4E0XA 2JJKA 4NAPA 1SW1A 2XXHA 4NG7A 4PE3A 1Q35A 3IK6B 5FHOA 1B7ZA 1MH4A 2H98A 3SKPA 2F5XA 2XXTA 2VGQA 4OHNA 3KEIA 4BDOA 2RCAA 4MLVA 2H4IA 2F78A 2X7QA 4FEBA 4Q5TA 4FATA 4DDDA 4TOZA 3U1OA 3K1MA 2WYKA 4FECA 4GQOA 4P47A 1NH7A 5DVJA 1FBFA 2CZKA 5IAIA 4MJOA 4JB7A 4LQ5A 3MPLA 1RKMA 3IOTA 2Y84A 1URSA 1ANFA 2F35A 4OVJA 5H8HA 4ESWA 1VSOA 4N8GA 1LAGE 4AB6A 4EUOA 4F39A 1GVCA 4PTKA 1FBGA 4OVQA 3FJMA 1DPEA 4H8JA 1MXYA 2A5SA 2THIA 4QHQA 1ZKBA 3OEMA 2E1SA 2Y5KA 1UIVA 2A5TA 3IB2A 3OMBA 2MKZA 5DTBA 2UYFA 4AS4A 2WBDA 4U1OA 5I2NB 4PF6A 1FTMA 5IGAA 4OEUA 3T1BA 4RPNA 3TCGA 1LAFE 5CC2A 4XXUA 4IO4A 3HV1A 1FSAA 1B2HA 1YPNA 4JVCA 1XVXA 3KFMA 1KWHA 1FQFA 3BIHA 4ELRA 3S9EA 1PC3A 1SPIA 1EZ9A 4NF5A 5JEIA 3H7MA 1F9BA 5I57A 1MH3A 5LOMA 4XF5A 1K9YA 4TQUQ 3G3KA 1NMUA 2O1LA 4QFNA 4MAGA 1JW5A 4G68A 2V84A 1MPDA 3RPWA 1USYE 2ALUA 3FASA 4OENA 2ZNSA 2NXOA 4YKKA 3I3VA 2PCRA 3FVGA 1G0HA 4NF0A 2XXWA 5AA4B 3MVZA 4XEQA 5EQ8A 4DI4B 2I0CA 1USYH 5IZZA 1MQJA 4IB2A 3TTRA 2M8CA 2ZZWA 3TUSA 5I2KB 2B3BA 4PFWA 2HHMA 3JYRA 2HAVA 5I56A 5I58B 1RYOA 4IO2A 3LV0A 4PAKA 3GBAA 1MRPA 2WBBA 2XXKA 2I0BA 2QS4A 5FBPA 3TTLA 1QULA 3G3GA 1D9VA 3U65A 4IY6A 5AA2A 1B5IA 2XX9A 4RA1A 3HHFA 2P0SA 3ECRA 1FQCA 4F1VA 3GLBA 3EF7A 2DVZA 4DI3D 1FRPA 5EQAA 3THIA 4U22A 3I6VA 4XKNA 2D3IA 1EZPA 4GL0A 4AQ4A 3V8XB 4OVRA 1WODA 3RPLA 2CEXA 3U92A 1LAXA 3VLVA 4G68C 1EYJA 2Q2CA 1LAHE 1XC1A 3C9HA 4DIGA 3O9PA 5L9MA 3TTMA 1POY1 4O7IA 3MAMA 1AIVA 1IMEA 4WEDA 2XXVA 4PAFA 1HSLA 1LGBC 4F3GA 1AWBA 1FTAA 4R9GA 4GL8A 4U21A 4F29A 5HBCA 5F24A 5DEXB 5HPQA 3GZGA 3CIJA 4KI0E 1LFHA 4ZZAA 4N81A 2Q2AA 3TMGA 1Y4CA 4LVQA 2BJIA 4OQOA 1MDP1 4EDPA 2I49A 3Q29A 3PGFA 5EYGA 2B3FA 3H6TA 4OFLA 1JETA 3QUFA 1XHYA 1NUZA 4NHBA 4ELOA 4KR5A 3QAXA 2FIXA 2WKYA 5FTIA 4ZEIA 2XWKA 3A29A 1FBHA 1POTA 2QL3A 3CSGA 2O7UA 4GWZA 1MXXA 3TQLA 4NF8A 1TT1A 4PDHA 3FV1A 4O8MA 4F2QA 3MYUA 1IZ1A 4RK9A 2Q9TA 3RLFE 1WDNA 4MNIA 3MSTA 2OWSA 4HCWA 4OEVA 4R9FA 4NWCA 2OPEA 1NUXA 1FPIA 4NF6B 4HE2A 1QJMA 1B40A 3CR9A 1MY2A 3SETA 3LC8A 1UTBA 3IB0A 4R6KA 4JSDA 4POWA 3T9XB 3OO6A 4G61A 1OQGA 1Z7NE 2Q74A 1FPBA 4OZ9A 2VPOA 1FTKA 4UABA 1CB6A 1B0HA 4N6KA 1LFGA 2F6GA 1FQAA 1R9LA 4RNSA 4NF4A 3E78A 5JK4A 5KCJB 3PD9A 1B51A 1LBZA 3FGSA 1LBBA 1MXZA 4G8HA 2PX1A 3MZ9A 1M5CA 2NOOA 1LLSA 2NWJA 3MBPA 3HO7A 3KZGA 1TFDA 4IO3A 2HPGA 1PBQA 4R6YA 1MPCA 3HFUA 3RQTA 2QSXA 2P3VA 4N6DA 5TPAB 2RF1A 1PEBA 1BP5A 2KLFA 5I56B 4OFJA 5IZ1A 4POXA 4YZZA 4P1LA 4OXVA 4H65A 1QGXA 4ELPA 3UORA 2VOZA 1ZU0A 1YCJA 3VE1B 2GHAA 1I6BA 3DLNA 3C4MA 4KQPA 3TZAA 1RDXA 2DS9A 1JEVA 1CNQA 1OVBA 3ODBA 3QK6A 3PPPA 5EQ9A 2UVHA 4JXIA 1OIBA 1HSEA 1B32A 3MP8A 1MPBA 2H25A 4GVOA 3JV9A 4YB6A 3SEXA 4H45A 4QFKA 3TYHA 3UP9A 4XFEA 1MY0A 3IFAA 4QSEA 4O3AA 3HN0A 3K1PA 4JDFA 1UTBB 3EHUA 5JTYB 3MQ9A 3B8BA 2HCAA 3E3KA 1EYIA 2PMSA 4NF6A 4PFYA 2QMXA 1B05A 4DLDA 1JW4A 3ZSFA 2BJJX 2DDKA 2PBWA 2Y7WA 1RYXA 2XXXA 3ROJA 4N07A 5K2YA 3RTFB 1B9JA 2RC8A 1NV2A 4OETA 2XXPA 4O3BA 5EHMA 3HCQA 4I3YA 2YJPA 2AL4A 1Y4TA 1QVSA 4NX1A 1SQYA 1II5A 4LZ8A 4GX3A 2ONSA 4R2BA 4OA4A 1EYKA 2H99A 1M5BA 4EQ7A 4QRZA 2F3BA 5CMCA 4OVTA 4LATA 3N26A 2ZNTA 4OTEA 1XI6A 4KXPA 4G2ZA 5H8SA 4P11A 5EYHA 4MX6A 1B3LA 4FORA 5I84A 1N7XA 4AB5A 2HAUA 4PFTA 1NUWA 1B3EA 2QJEA 3UN6A 1IXIA 2HXRA 3K1NA 3SDFA 3LSWA 1A8EA 4QFOA 2P1SA 3G7WA 2DOJA 2AL5A 3QXMA 3PPQA 2H9BA 4Z0IA 4MHFA 1NL5A 2VPNA 1NKXA 2O84X 5H8QA 1VFEA 4OVPA 2FIEA 5FTHA 4YU0A 3E79A 3O6IA 4DE8A 1NNFA 3U94A 3OO9A 5LTCA 5FHMA 4EXLA 4NN3A 4G8NA 5CBSA 3OEKA 2FNCA 2O7IA 4E0WA 3OOAA 3KG2A 2YLNA 5A5XB 3LSFB 1B58A 3RT6B 1MY4A 4P3LA 4R6HA 3MPKA 4X1BA 2IA4A 2X7PA 1UTHA 1SI0A 1Y20A 4G4PA 1JW1A 3QSLA 4IO5A 1N76A 3HHGA 4N8YA 1ZLQA 4YMBA 5ITPA 5CMMA 1QUIA 5F7VA 3ZKKA 1QKAA 3OD7A 3O29A 1MQHA 1P1NA 3PMXA 1LBVA 4UA8A 1JQFA 3DELB 5B7DA 3V5AA 4MIJA 1P1WA 3VDFA 2R8TA 1QW0A 2Y5LA 3VVFA 2CEYA 3ZS6A 1ZMGA 3ILUB 3FV2A 3M3FA 2KQZA 3M8UA 3C34A 2F34A 1HSJA 4F22A 4G68B 3TELA 4EQBA 5AA4A 5I59A 2V93A 1IMFA 4QBAA 2HZKA 4ZDMA 4P0GA 5AA1A 2FVZA 1FPLA 3IOUA 4O94A 1DK4A 4NMYA 3UIFA 1N84A 1IMAA 3OO7A 5BWJA 3KJTA 1QUKA 2V3UA 3VLUA 2PT2A 5ET5A 4M4GA 4NF4B 1SDXA 5J16A 4XKRA 1NFTA 2VT5A 1IXHA 2DSFA 4GBWA 4KPTA 4IO6A 4KCDA 3MP1A 1D3KA 3V89B 4BDNA 3MVXA 1UTHB 3IR1A 1RDZA 1FPDA 3B6QA 4ISUA 2CZHA 2DWJA 5BUUA 4F3BA 4R72A 4OWDA 2ONRA 2ONKE 2Y7PA 2F8DA 3K00A 2R6GE 1YAEA 1INPA 1ZJLA 1SD3A 3L6GA 4PF8A 5H8FA 3CFLA 4JSOA 5I7IA 4LZ5A 3CHGA 1YTVA 1BIYA 4PC9A 4ECFA 3E9XA 4ND9A 4RYAA 4YICA 2OK2A 1IEJA 2HZLA 2D5WA 5FHNA 3R26A 4R73A 1N04A 2RC7A 4N15A 3VXBA 4ZS9A 2G29A 5CRYA 3E13X 2AYSA 2WEFA 2UYEA 2P2AA 2QS1A 1FBCA 1FPEA 2QFLA 2DE2A 1DSNA 2CMOA 2VD3A 1SBPA 4GX4A 3NOHA 1VFDA 3KGCA 1G0IA 2RKMA 3Q27A 3Q28A 1MM6A 4N6PA 3FXRA 4R75A 2ZXTA 3IORA 3MZ1A 4FE8A 1JNFA 3TPAA 2Z22A 4XKPA 3S9MC 4H6DA 1MQIA 4HW8A 2UVGA 4I40A 3IJOB 4MEVA 2A5TB 2GFEA 2I3VA 3IX1A 5TU0A 1LB8A 3MJNA 1ZIUA 5I2KA 3DM0A 4EQ9A 1NV4A 4NQ8A 5A5XA 1NNKA 1TXFA 5H8FB 2V3QA 2XWIA 3A09A 4C0RA 2OJTA 4EF2A 5T3JA 4MBPA 2B4LA 3CRBA 1ZBMA 4DXUA 3RGYA 2NUVA 3B6TA 3RT8A 1FBDA 5ELVA 4PFBA 3MC2A 3N5LA 2Q8MA 1IMCA 4MNPA 3Q25A 4IO7A 3KN3A 2ZZXA 1PB8A 4PP0A 2RINA 5JTYA 4HTGA 4ZE8A 4G8MA 3SEWA 3MUQA 3KN8A 2QVRA 4NF8B 1O64A 1IQ7A 2F3DA 2DE4A 2NVUB 1NI9A 3M3LA 3EHSA 2FA7A 4LA9A 4I62A 2OBGA 2UVJA 4LONB 1TFAA 4X48A 4YAHX 1Y3NA 3G3FA 4BDLA 3TAJA 3V83A 4LZ7A 3H06B 3FD3A 3S2VA 4BLAA 4ZEBA 2XWVA 3VLWA 5TPAA 4ZE9A 1BKAA 3MW0A 1QUJA 5DVFA 5F1QA 1H76A 2UXAA 1OLAA 4PFUA 1MM7A 1Y9UA 2XXRA 2VP1A 1B1XA 3CFXA 4LN5A 4I8CA 1FJ9A 4LP2B 4GLIA 1T0KA 2F7AA 2F7BA 3OENA 4JWXA 2OLBA 4NWDA 4O7MA 5A5LA 3TCFA 1NV3A 4H8IA 2I4BA 1L5TA 4Z7EA 3KSXA 1S7YA 4LQ2A 3L6HA 4KYEA 1QKBA 3EN3A 4PETA 3PU5A 3PUYE 2Z23A 4X8RA 4YMAA 3FJ7A 3EPEA 3K2DA 4I9DA 3FVNA 4PDDA 3O97A 3BIGA 1ZTYA 2Q89A 4PAIA 2GRVA 2QVVA 2H5YA 1SVXB 3IO6A 5DEXA 3A3CA 4RY1A 3K02A 4RPOA 5KCJA 1UIUA 3CG1A 2O69A 4JBZA 3RYDA 1P99A 4OERA 1RDYA 4Q8RA 3K6WA 1LBWA 4QFPA 4X9TA 4LUBA 4HS7A 1Q1KA 4F1YA 5I5PA 2I48A 3R6UA 1LBCA 3B6WA 5B70A 1Q9DA 3VV5A 1B1HA 3FXQA 1R9QA 3OSQA 1GGGA 4UACA 3TDJA 3TODA 1GR2A 4TLMB 5H8QB 3A3UA 3OXNA 5L9SA 2VHAA 4PBHA 3C32A 1AOVA 2O68A 4Q0CA 1LBYA 1NV5A 2I6EA 2WYPA 2WX9A 4GXSB 3UK4A 4FAJA 1DMBA 2HEUA 2ZMBA 2GHBA 3IJXB 2XA5A 5ET7A 2ANJA 2E0SA 3K0VA 3T0JA 1K9ZA 5I3SA 1N3XA 2B65A 2XX8A 3N6TA 3PUXE 4R74A 2DXRA 4ZEKA 2QS3A 3GXAA 2FBPA 5CMBA 4K3FA 5KDTB 2Q88A 4KYDA 2Y7KA 3O6HA 3B7DA 4IGTA 4IY5A 1WVJA 3TTNA 5HM4B 5H8NA 5ITOA 4GXAA 4HXVA 3HPIA 2O6AA 4KHZE 5ET8A 3WAEA 1FPGA 1DTZA 4FJPA 1OVTA 3FATA 4MFIA 2XD3A 1DBZA 1B52A 4PCDA 3D1RA 1M5EA 4GOTA 1MQDA 1Z7ME 3LR1A 5IM2A 3N6UA 1B3GA 1VDWA 1US5A 2QMWA 3FJGA 1NV6A 1NUYA 3AXFA 3FXBA 4XTCQ 3BKIB 3O66A 1IITA 5L8DA 5I59B 4GRKA 3DP4A 4NF5B 3OELA 1MS7A 1AL3A 3IOVA 1R6ZA 3M3KA 3D4GA 4U23A 3PUZE 3VXCA 2DVCA 5ESYA 1US4A 1M5FA 4PGNA 5I57B 1SI1A 1JVXA 3VVDA 4H67A 2CZIA 2DYXA 4FIMA 3DP6A 3K4UA 4I1DA 1NV0A 4JVDA 1R1NA 5EHSA 1FTOA 3SEYA 1H43A 2ZYOA 3T66A 4ZECA 1IMDA 1UQWA 2XXYA 4OYVA 1URGA 4KFQA 4P9KA 4BDQA 3WAFA 4NTLA 3TCHA 2W7YA 5CMKA 1URDA 1DCUA 2D21A 4QFLA 5H8HB 4EF1A 4F18A 2VD2A 5IZ3A 1XOCA 3LSXA 4HE1A 1XVYA 4WKMA 2XD2A 2Q8JA 4OVSA 5K2XA 1MQGA 3CSBA 2HFBA 3C35A 4DCXA 1H3DA 3RNNA 2HXWA 2L5VA 4F2OA 4MNCA 4MCOA 4GWSA 4JVIA 3IFCA 1EZOA 1AMFA
chains in the Genus database with same CATH topology
2HHMA 1NV6A 1YXIA 1NUYA 4PTKA 2VPNA 2P3NA 4M1VA 5EYGA 3FXBA 5IZ3B 4F1UA 3GYYA 4F19A 1FBGA 5I5PA 2QVRA 4N15A 4QXDA 4N91A 5CM6A 4OVQA 1BK4A 4NGUA 2F3DA 2FVZA 1NUZA 4GWWA 4IR8A 2DE4A 3B8BA 1FPLA 2WEFA 1NI9A 3LV0A 4NHBA 1LEVA 1EYIA 1FBCA 1Q9DA 1FPEA 2QFLA 2FIEA 2DE2A 2HPGA 2PFZA 4OVPA 4PAKA 4PFIA 4O94A 2FIXA 1DK4A 2WBBA 4I3EA 2XXKA 3E79A 3W9WA 1FBPA 4X04A 2Y5KA 5ESYA 4GX4A 5FBPA 1IMAA 2DDKA 4P8BA 4PGPA 3NOHA 2XWKA 3EKIA 5EQ7A 4PGNA 3A29A 1G0IA 2MKZA 4GWYA 1FBHA 3B50A 3HFUA 5LTCA 3U65A 5ET5A 4FBPA 2DE3A 2P3VA 4OANA 4N6DA 3ROJA 4PBQA 4GWZA 2GQ1A 5J16A 4NN3A 4PBHA 4AS4A 2WBDA 1NV2A 2VT5A 2CZIA 4PDHA 4GBWA 1YYZA 2QVUA 1FBEA 5IZ1A 4AS5A 4PF6A 2XWVA 4O8MA 1LBYA 3MYUA 5IGAA 3T1BA 4I3YA 2Q9TA 1LBXA 1NV5A 4P1EA 1D9QA 4P3LA 4F1VA 4I40A 4YZZA 2WYPA 4MNIA 2WX9A 4MEVA 4NX1A 4DI3D 3QMFA 2DVZA 1FRPA 5EQAA 4P1LA 4P56A 2KR0A 3PTYA 1FSAA 2XWOA 1FPFA 3MSTA 4PAIA 1NV0A 3RPLB 4JVDA 4HCWA 4JVCA 4PFRA 4N8YA 1RDZA 4GX3A 2QPQA 5ET7A 1FPDA 1KZ8A 1NV1A 1QGXA 2XA5A 4N4UA 2FHYA 1NUXA 2CZHA 3BIHA 1FPIA 1K9ZA 5I3SA 4HE0A 3T0JA 4OA4A 4OVRA 4HE2A 4HCYA 1IMBA 2PFYA 1IMDA 1NV4A 2JJKA 3RPLA 4LN5A 4N17A 2CEXA 1SPIA 1FJ9A 4NAPA 4NQ8A 2FBPA 4GBVA 5DW8A 1EYKA 1NV7A 1YZ0A 2OX3A 5LDZA 4NG7A 1RDXA 4P9KA 3KC0A 4PE3A 4XF5A 2ZZVA 4O7MA 5A5LA 1EYJA 2V3QA 1FPJA 1LBVA 1NV3A 2XWIA 1K9YA 2F3BA 5T3JA 4OVTA 2OWZA 4G61A 4H46A 1CNQA 4MIJA 4MAGA 1INPA 2B4LA 2F5XA 4N6KA 2Q74A 1DCUA 1FPBA 4HXVA 3LUZA 2VPOA 4PETA 5J1DA 1XI6A 4O7IA 5ET8A 4KXPA 4GWUA 4PF8A 2R8TA 3ISPA 4UABA 1FPGA 1IMEA 3W9VA 3FBPA 2Y5LA 4PAFA 4X8RA 2WYKA 1FBDA 5EYHA 5EQ9A 4MX6A 3KBZA 4F18A 4P47A 1FJ6A 4PFBA 5IZ3A 5ET6A 5I7IA 4PDDA 4MHFA 2CEYA 4MMPA 3BIGA 1FBFA 1IMCA 1AWBA 2CZKA 1FTAA 2PCRA 4MJOA 1G0HA 2Q8MA 4HE1A 4MNPA 1DBZA 4NF0A 4PCDA 2QVVA 1KA0A 3CHGA 4OVSA 1NUWA 3D1RA 4XEQA 2ZZXA 5F24A 5EQ8A 2KQZA 1JP4A 2V4CA 1FPKA 4PC9A 4DI4B 3E78A 4YICA 5JK4A 2HXRA 5IZZA 3KC1A 4H45A 2L5VA 3SZPA 4N8GA 5IM2A 4MNCA 2HZLA 4XFEA 1LBZA 2ZZWA 3RYDA 4N81A 1RDYA 1IMFA 3IFAA 4QBAA 1KA1A 4GWSA 1LBWA 2B4MA 1VDWA 4JVIA 4MCOA 3IFCA 4X9TA 2HZKA 2BJIA 4GWXA 4GX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHM A;  1NV6 A;  1YXI A;  1NUY A;  4PTK A;  2P3N A;  5EYG A;  5IZ3 B;  1FBG A;  2QVR A;  4QXD A;  1BK4 A;  2F3D A;  2FVZ A;  1NUZ A;  4GWW A;  4IR8 A;  3B8B A;  1FPL A;  2WEF A;  1NI9 A;  3LV0 A;  1LEV A;  1EYI A;  1FBC A;  1Q9D A;  1FPE A;  2QFL A;  2FIE A;  2FIX A;  1DK4 A;  2WBB A;  4I3E A;  1FBP A;  2Y5K A;  5ESY A;  4GX4 A;  5FBP A;  1IMA A;  2DDK A;  5EQ7 A;  3A29 A;  1G0I A;  4GWY A;  1FBH A;  5ET5 A;  4FBP A;  2P3V A;  3ROJ A;  4GWZ A;  2GQ1 A;  5J16 A;  4AS4 A;  2WBD A;  1NV2 A;  2VT5 A;  2CZI A;  4GBW A;  1YYZ A;  2QVU A;  1FBE A;  5IZ1 A;  4AS5 A;  1LBY A;  4I3Y A;  1LBX A;  1NV5 A;  1D9Q A;  4I40 A;  3QMF A;  1FRP A;  5EQA A;  1FSA A;  1FPF A;  1NV0 A;  3RPL B;  1RDZ A;  4GX3 A;  5ET7 A;  1FPD A;  1KZ8 A;  1NV1 A;  1QGX A;  2FHY A;  1NUX A;  2CZH A;  3BIH A;  1FPI A;  1K9Z A;  5I3S A;  4HE0 A;  3T0J A;  4HE2 A;  1IMB A;  1IMD A;  1NV4 A;  2JJK A;  3RPL A;  1SPI A;  1FJ9 A;  2FBP A;  4GBV A;  5DW8 A;  1EYK A;  1NV7 A;  1YZ0 A;  2OX3 A;  5LDZ A;  1RDX A;  3KC0 A;  5A5L A;  1EYJ A;  1FPJ A;  1LBV A;  1NV3 A;  1K9Y A;  2F3B A;  5T3J A;  2OWZ A;  4G61 A;  4H46 A;  1CNQ A;  1INP A;  2Q74 A;  1DCU A;  1FPB A;  4HXV A;  3LUZ A;  1XI6 A;  4O7I A;  5ET8 A;  4KXP A;  4GWU A;  2R8T A;  1FPG A;  1IME A;  3FBP A;  2Y5L A;  1FBD A;  5EYH A;  5EQ9 A;  3KBZ A;  1FJ6 A;  5IZ3 A;  5ET6 A;  3BIG A;  1FBF A;  1IMC A;  1AWB A;  2CZK A;  1FTA A;  2PCR A;  4MJO A;  1G0H A;  2Q8M A;  4HE1 A;  1DBZ A;  2QVV A;  1KA0 A;  1NUW A;  3D1R A;  5F24 A;  5EQ8 A;  1JP4 A;  1FPK A;  3KC1 A;  4H45 A;  1LBZ A;  3RYD A;  4N81 A;  1RDY A;  1IMF A;  3IFA A;  1KA1 A;  4GWS A;  1LBW A;  1VDW A;  3IFC A;  2BJI A;  4GWX A;  4GX6 A; 
#chains in the Genus database with same CATH topology
 5IZ3 B;  3GYY A;  1VE4 A;  4NGU A;  1DPP A;  2XX7 A;  2DP8 A;  3MVW A;  3W15 C;  4G77 A;  4I3E A;  1N7W A;  3W9W A;  2QRY A;  3BBR A;  3ILT B;  3KN7 A;  3T9H B;  1NNP A;  3R7X A;  4F3S A;  5I58 A;  3DP8 A;  3TKD A;  1LCT A;  1OMP A;  1P1Q A;  1PB9 A;  3RY3 A;  2CZL A;  1DTG A;  5TP9 B;  1FBE A;  4BDR A;  3PPR A;  4NED A;  2ZNU A;  1EU8 A;  1FQB A;  2PT1 A;  2UVI A;  4DZ1 A;  1XS5 A;  2ZYN A;  2DQV A;  3IL1 B;  4R2F A;  3T22 A;  2FHY A;  4HE0 A;  5TP9 A;  3U72 A;  5CBR A;  3K6U A;  3I5O A;  3K6X A;  5DW8 A;  4GFR A;  1NV7 A;  3P7I A;  2OCU A;  2DWI A;  3PD8 A;  2OZZ A;  4DXB A;  1FTJ A;  3MWB A;  3G3I A;  1A40 A;  3ISP A;  3FUZ A;  3FBP A;  4KD5 A;  1S9T A;  3HST A;  4KYS A;  5KDT A;  3H6V A;  1JP4 A;  5IKB A;  2PYY A;  2YPN A;  5H8N B;  1B3F A;  3GBB A;  3KC1 A;  2O1M A;  1FQD A;  3SZP A;  1XT8 A;  3SES A;  2B4M A;  1TWY A;  4Q30 B;  4M1V A;  1J1N A;  3ZKL A;  2X26 A;  3OSR A;  5DVI A;  3USD A;  3SEU A;  4RXL A;  1SW4 A;  4ZEF A;  3MP6 A;  3KBR A;  5DT6 A;  3ONM A;  2REG A;  1PB7 A;  4PGP A;  4QSD A;  5EQ7 A;  3QYT A;  4GWY A;  3U93 A;  2LAO A;  2GQ1 A;  4U2R A;  2QVU A;  4AS5 A;  3RTW B;  2QS2 A;  1B46 A;  1B5H A;  1Y1Z A;  1H45 A;  3FVK A;  5EYF A;  3C36 A;  3RUM A;  3QMF A;  3LBS A;  2KR0 A;  4GWO A;  3PTY A;  5L9O A;  1FPF A;  3IO4 A;  1A99 A;  1A55 A;  2QPQ A;  2RC9 A;  1KZ8 A;  3FIR A;  4WEP A;  4HCY A;  4KCC A;  4YKJ A;  4GBV A;  1YZ0 A;  1AH5 A;  3KC0 A;  1O63 A;  3IB1 A;  2AIX A;  4EXK A;  1MY3 A;  3G3H A;  3SER A;  3T96 B;  1O7T A;  3PMV A;  1MG1 A;  4U4S A;  1NH8 A;  3LUZ A;  5J1D A;  3K01 A;  4GWU A;  2DWA A;  1MXU A;  4H5F A;  2Y7R A;  3T93 B;  1B0L A;  2XHD A;  5ET6 A;  3KOS A;  1IIW A;  3W9V A;  3BFU A;  4F3P A;  4PE5 B;  4C1U A;  5CI5 A;  3E4R A;  4JWO A;  2O51 A;  4MLQ A;  4JWY A;  3EHT A;  2ABH A;  2GH9 A;  3D4C A;  3CG3 A;  2XXI A;  4GWX A;  1I6Q A;  1YXI A;  3O2A A;  1GTK A;  2I4C A;  1FCK A;  3FZV A;  3LUY A;  5AA2 B;  1LEV A;  3PMW A;  2I58 A;  3TEP A;  4OMB A;  3OO8 A;  4L17 A;  4X04 A;  1PDA A;  4P8B A;  3CVG A;  1M5D A;  3C31 A;  2FYI A;  1D4N A;  4OAN A;  4U1Z A;  3K6V A;  4N13 A;  4U4X A;  4F31 B;  1LFI A;  4YB5 A;  1OLC A;  4XIG Q;  2G93 A;  1SW2 A;  4P56 A;  1IXG A;  1A8F A;  2Y7I A;  3S9N C;  1P1O A;  4N17 A;  4RJZ A;  3T9V A;  1Y3P A;  1B7U A;  3CFZ A;  1IXC A;  3H4Z A;  1LST A;  4QF9 A;  2Z8E A;  4OFO A;  1BLF A;  4H46 A;  1I6A A;  1A7L A;  5DYH A;  2DXY A;  2ZYM A;  4IGR A;  4WXJ A;  1MXV A;  1FJ6 A;  1B5J A;  3IAZ A;  3U8Q A;  4QSC A;  1KA0 A;  2OPD A;  2F6P A;  4YKP A;  1S50 A;  2V4C A;  4TLL B;  1LB9 A;  3MVY A;  1ELJ A;  2ESN A;  3H6W A;  3PPN A;  3UA8 A;  3JZJ A;  1KA1 A;  3KOT A;  5AA2 D;  4NE4 A;  4GX6 A;  3H6U A;  3PPO A;  4O3C A;  4YB7 A;  3RN8 A;  5AE4 A;  4F1U A;  4THI A;  4F19 A;  1FW0 A;  5CM6 A;  4QXD A;  1BK4 A;  1MXW A;  1JVY A;  4GWW A;  4ESX A;  1DOT A;  5KZT A;  3FVO A;  4PFI A;  2PFZ A;  2V25 A;  4MF3 A;  3T9U A;  4H1X A;  5I2N A;  1LCF A;  5ISU A;  4GF8 A;  2V3T A;  2XXU A;  3VVE A;  2DE3 A;  3TTK A;  3EQ1 A;  4PBQ A;  3KSJ A;  3LSL A;  2F7C A;  5M2V A;  1MDQ A;  4C1T A;  3Q26 A;  4MH5 A;  3PUW E;  1ATG A;  4P1E A;  1LBX A;  1D9Q A;  4GD5 A;  2Z8D A;  1B4H A;  2HQ0 A;  2F36 A;  4GIZ A;  4YKI A;  3BFT A;  3O6G A;  1NV1 A;  2IEE A;  2XXQ A;  4BDM A;  3H03 A;  4XKQ A;  1Y3Q A;  3FXU A;  4ONY A;  2OX3 A;  5LDZ A;  2ZZV A;  3CI8 A;  1FPJ A;  1N0T A;  3S9L C;  4RK2 A;  4H5G A;  2OWZ A;  2I3W A;  1JEU A;  4DXC A;  2DWH A;  3F11 A;  4ZED A;  2R71 A;  3QUJ A;  1IUD A;  3KBZ A;  1B3H A;  1EH3 A;  1I69 A;  3IOW A;  4MMP A;  1H44 A;  4FED A;  1GV8 A;  3TQW A;  3N94 A;  3PV0 E;  1FPK A;  1FQE A;  3UGW A;  4OES A;  3VFJ A;  4P0I A;  2RCB A;  1N3W A;  1B6H A;  4N91 A;  3MZB A;  2Z8F A;  1OQH A;  3C33 A;  3H3G A;  2P3N A;  3O28 A;  2OWT A;  1VR5 A;  4IR8 A;  2REJ A;  4H0W A;  1P1U A;  3G3J A;  1BTJ A;  1PBP A;  5AA3 A;  3PUV E;  1FBP A;  1D9Y A;  3QIM A;  1Y1M A;  3EKI A;  5ICQ A;  2F97 A;  1NNT A;  1MY1 A;  3B50 A;  4ELQ A;  2ZYK A;  4FBP A;  1SYI A;  1B4Z A;  1FTL A;  1YYZ A;  3TFL A;  1CE2 A;  1SW5 A;  3SEV A;  2R9J A;  4X1D A;  4PQJ A;  1SYH A;  2XWO A;  3RPL B;  4ZZE A;  4DCY A;  1A54 A;  4PFR A;  3KJ7 A;  2PVU A;  4N4U A;  3S4U A;  5ICT A;  1B7H A;  1IMB A;  2PFY A;  4E0X A;  2JJK A;  4NAP A;  1SW1 A;  2XXH A;  4NG7 A;  4PE3 A;  1Q35 A;  3IK6 B;  5FHO A;  1B7Z A;  1MH4 A;  2H98 A;  3SKP A;  2F5X A;  2XXT A;  2VGQ A;  4OHN A;  3KEI A;  4BDO A;  2RCA A;  4MLV A;  2H4I A;  2F78 A;  2X7Q A;  4FEB A;  4Q5T A;  4FAT A;  4DDD A;  4TOZ A;  3U1O A;  3K1M A;  2WYK A;  4FEC A;  4GQO A;  4P47 A;  1NH7 A;  5DVJ A;  1FBF A;  2CZK A;  5IAI A;  4MJO A;  4JB7 A;  4LQ5 A;  3MPL A;  1RKM A;  3IOT A;  2Y84 A;  1URS A;  1ANF A;  2F35 A;  4OVJ A;  5H8H A;  4ESW A;  1VSO A;  4N8G A;  1LAG E;  4AB6 A;  4EUO A;  4F39 A;  1GVC A;  4PTK A;  1FBG A;  4OVQ A;  3FJM A;  1DPE A;  4H8J A;  1MXY A;  2A5S A;  2THI A;  4QHQ A;  1ZKB A;  3OEM A;  2E1S A;  2Y5K A;  1UIV A;  2A5T A;  3IB2 A;  3OMB A;  2MKZ A;  5DTB A;  2UYF A;  4AS4 A;  2WBD A;  4U1O A;  5I2N B;  4PF6 A;  1FTM A;  5IGA A;  4OEU A;  3T1B A;  4RPN A;  3TCG A;  1LAF E;  5CC2 A;  4XXU A;  4IO4 A;  3HV1 A;  1FSA A;  1B2H A;  1YPN A;  4JVC A;  1XVX A;  3KFM A;  1KWH A;  1FQF A;  3BIH A;  4ELR A;  3S9E A;  1PC3 A;  1SPI A;  1EZ9 A;  4NF5 A;  5JEI A;  3H7M A;  1F9B A;  5I57 A;  1MH3 A;  5LOM A;  4XF5 A;  1K9Y A;  4TQU Q;  3G3K A;  1NMU A;  2O1L A;  4QFN A;  4MAG A;  1JW5 A;  4G68 A;  2V84 A;  1MPD A;  3RPW A;  1USY E;  2ALU A;  3FAS A;  4OEN A;  2ZNS A;  2NXO A;  4YKK A;  3I3V A;  2PCR A;  3FVG A;  1G0H A;  4NF0 A;  2XXW A;  5AA4 B;  3MVZ A;  4XEQ A;  5EQ8 A;  4DI4 B;  2I0C A;  1USY H;  5IZZ A;  1MQJ A;  4IB2 A;  3TTR A;  2M8C A;  2ZZW A;  3TUS A;  5I2K B;  2B3B A;  4PFW A;  2HHM A;  3JYR A;  2HAV A;  5I56 A;  5I58 B;  1RYO A;  4IO2 A;  3LV0 A;  4PAK A;  3GBA A;  1MRP A;  2WBB A;  2XXK A;  2I0B A;  2QS4 A;  5FBP A;  3TTL A;  1QUL A;  3G3G A;  1D9V A;  3U65 A;  4IY6 A;  5AA2 A;  1B5I A;  2XX9 A;  4RA1 A;  3HHF A;  2P0S A;  3ECR A;  1FQC A;  4F1V A;  3GLB A;  3EF7 A;  2DVZ A;  4DI3 D;  1FRP A;  5EQA A;  3THI A;  4U22 A;  3I6V A;  4XKN A;  2D3I A;  1EZP A;  4GL0 A;  4AQ4 A;  3V8X B;  4OVR A;  1WOD A;  3RPL A;  2CEX A;  3U92 A;  1LAX A;  3VLV A;  4G68 C;  1EYJ A;  2Q2C A;  1LAH E;  1XC1 A;  3C9H A;  4DIG A;  3O9P A;  5L9M A;  3TTM A;  1POY 1;  4O7I A;  3MAM A;  1AIV A;  1IME A;  4WED A;  2XXV A;  4PAF A;  1HSL A;  1LGB C;  4F3G A;  1AWB A;  1FTA A;  4R9G A;  4GL8 A;  4U21 A;  4F29 A;  5HBC A;  5F24 A;  5DEX B;  5HPQ A;  3GZG A;  3CIJ A;  4KI0 E;  1LFH A;  4ZZA A;  4N81 A;  2Q2A A;  3TMG A;  1Y4C A;  4LVQ A;  2BJI A;  4OQO A;  1MDP 1;  4EDP A;  2I49 A;  3Q29 A;  3PGF A;  5EYG A;  2B3F A;  3H6T A;  4OFL A;  1JET A;  3QUF A;  1XHY A;  1NUZ A;  4NHB A;  4ELO A;  4KR5 A;  3QAX A;  2FIX A;  2WKY A;  5FTI A;  4ZEI A;  2XWK A;  3A29 A;  1FBH A;  1POT A;  2QL3 A;  3CSG A;  2O7U A;  4GWZ A;  1MXX A;  3TQL A;  4NF8 A;  1TT1 A;  4PDH A;  3FV1 A;  4O8M A;  4F2Q A;  3MYU A;  1IZ1 A;  4RK9 A;  2Q9T A;  3RLF E;  1WDN A;  4MNI A;  3MST A;  2OWS A;  4HCW A;  4OEV A;  4R9F A;  4NWC A;  2OPE A;  1NUX A;  1FPI A;  4NF6 B;  4HE2 A;  1QJM A;  1B40 A;  3CR9 A;  1MY2 A;  3SET A;  3LC8 A;  1UTB A;  3IB0 A;  4R6K A;  4JSD A;  4POW A;  3T9X B;  3OO6 A;  4G61 A;  1OQG A;  1Z7N E;  2Q74 A;  1FPB A;  4OZ9 A;  2VPO A;  1FTK A;  4UAB A;  1CB6 A;  1B0H A;  4N6K A;  1LFG A;  2F6G A;  1FQA A;  1R9L A;  4RNS A;  4NF4 A;  3E78 A;  5JK4 A;  5KCJ B;  3PD9 A;  1B51 A;  1LBZ A;  3FGS A;  1LBB A;  1MXZ A;  4G8H A;  2PX1 A;  3MZ9 A;  1M5C A;  2NOO A;  1LLS A;  2NWJ A;  3MBP A;  3HO7 A;  3KZG A;  1TFD A;  4IO3 A;  2HPG A;  1PBQ A;  4R6Y A;  1MPC A;  3HFU A;  3RQT A;  2QSX A;  2P3V A;  4N6D A;  5TPA B;  2RF1 A;  1PEB A;  1BP5 A;  2KLF A;  5I56 B;  4OFJ A;  5IZ1 A;  4POX A;  4YZZ A;  4P1L A;  4OXV A;  4H65 A;  1QGX A;  4ELP A;  3UOR A;  2VOZ A;  1ZU0 A;  1YCJ A;  3VE1 B;  2GHA A;  1I6B A;  3DLN A;  3C4M A;  4KQP A;  3TZA A;  1RDX A;  2DS9 A;  1JEV A;  1CNQ A;  1OVB A;  3ODB A;  3QK6 A;  3PPP A;  5EQ9 A;  2UVH A;  4JXI A;  1OIB A;  1HSE A;  1B32 A;  3MP8 A;  1MPB A;  2H25 A;  4GVO A;  3JV9 A;  4YB6 A;  3SEX A;  4H45 A;  4QFK A;  3TYH A;  3UP9 A;  4XFE A;  1MY0 A;  3IFA A;  4QSE A;  4O3A A;  3HN0 A;  3K1P A;  4JDF A;  1UTB B;  3EHU A;  5JTY B;  3MQ9 A;  3B8B A;  2HCA A;  3E3K A;  1EYI A;  2PMS A;  4NF6 A;  4PFY A;  2QMX A;  1B05 A;  4DLD A;  1JW4 A;  3ZSF A;  2BJJ X;  2DDK A;  2PBW A;  2Y7W A;  1RYX A;  2XXX A;  3ROJ A;  4N07 A;  5K2Y A;  3RTF B;  1B9J A;  2RC8 A;  1NV2 A;  4OET A;  2XXP A;  4O3B A;  5EHM A;  3HCQ A;  4I3Y A;  2YJP A;  2AL4 A;  1Y4T A;  1QVS A;  4NX1 A;  1SQY A;  1II5 A;  4LZ8 A;  4GX3 A;  2ONS A;  4R2B A;  4OA4 A;  1EYK A;  2H99 A;  1M5B A;  4EQ7 A;  4QRZ A;  2F3B A;  5CMC A;  4OVT A;  4LAT A;  3N26 A;  2ZNT A;  4OTE A;  1XI6 A;  4KXP A;  4G2Z A;  5H8S A;  4P11 A;  5EYH A;  4MX6 A;  1B3L A;  4FOR A;  5I84 A;  1N7X A;  4AB5 A;  2HAU A;  4PFT A;  1NUW A;  1B3E A;  2QJE A;  3UN6 A;  1IXI A;  2HXR A;  3K1N A;  3SDF A;  3LSW A;  1A8E A;  4QFO A;  2P1S A;  3G7W A;  2DOJ A;  2AL5 A;  3QXM A;  3PPQ A;  2H9B A;  4Z0I A;  4MHF A;  1NL5 A;  2VPN A;  1NKX A;  2O84 X;  5H8Q A;  1VFE A;  4OVP A;  2FIE A;  5FTH A;  4YU0 A;  3E79 A;  3O6I A;  4DE8 A;  1NNF A;  3U94 A;  3OO9 A;  5LTC A;  5FHM A;  4EXL A;  4NN3 A;  4G8N A;  5CBS A;  3OEK A;  2FNC A;  2O7I A;  4E0W A;  3OOA A;  3KG2 A;  2YLN A;  5A5X B;  3LSF B;  1B58 A;  3RT6 B;  1MY4 A;  4P3L A;  4R6H A;  3MPK A;  4X1B A;  2IA4 A;  2X7P A;  1UTH A;  1SI0 A;  1Y20 A;  4G4P A;  1JW1 A;  3QSL A;  4IO5 A;  1N76 A;  3HHG A;  4N8Y A;  1ZLQ A;  4YMB A;  5ITP A;  5CMM A;  1QUI A;  5F7V A;  3ZKK A;  1QKA A;  3OD7 A;  3O29 A;  1MQH A;  1P1N A;  3PMX A;  1LBV A;  4UA8 A;  1JQF A;  3DEL B;  5B7D A;  3V5A A;  4MIJ A;  1P1W A;  3VDF A;  2R8T A;  1QW0 A;  2Y5L A;  3VVF A;  2CEY A;  3ZS6 A;  1ZMG A;  3ILU B;  3FV2 A;  3M3F A;  2KQZ A;  3M8U A;  3C34 A;  2F34 A;  1HSJ A;  4F22 A;  4G68 B;  3TEL A;  4EQB A;  5AA4 A;  5I59 A;  2V93 A;  1IMF A;  4QBA A;  2HZK A;  4ZDM A;  4P0G A;  5AA1 A;  2FVZ A;  1FPL A;  3IOU A;  4O94 A;  1DK4 A;  4NMY A;  3UIF A;  1N84 A;  1IMA A;  3OO7 A;  5BWJ A;  3KJT A;  1QUK A;  2V3U A;  3VLU A;  2PT2 A;  5ET5 A;  4M4G A;  4NF4 B;  1SDX A;  5J16 A;  4XKR A;  1NFT A;  2VT5 A;  1IXH A;  2DSF A;  4GBW A;  4KPT A;  4IO6 A;  4KCD A;  3MP1 A;  1D3K A;  3V89 B;  4BDN A;  3MVX A;  1UTH B;  3IR1 A;  1RDZ A;  1FPD A;  3B6Q A;  4ISU A;  2CZH A;  2DWJ A;  5BUU A;  4F3B A;  4R72 A;  4OWD A;  2ONR A;  2ONK E;  2Y7P A;  2F8D A;  3K00 A;  2R6G E;  1YAE A;  1INP A;  1ZJL A;  1SD3 A;  3L6G A;  4PF8 A;  5H8F A;  3CFL A;  4JSO A;  5I7I A;  4LZ5 A;  3CHG A;  1YTV A;  1BIY A;  4PC9 A;  4ECF A;  3E9X A;  4ND9 A;  4RYA A;  4YIC A;  2OK2 A;  1IEJ A;  2HZL A;  2D5W A;  5FHN A;  3R26 A;  4R73 A;  1N04 A;  2RC7 A;  4N15 A;  3VXB A;  4ZS9 A;  2G29 A;  5CRY A;  3E13 X;  2AYS A;  2WEF A;  2UYE A;  2P2A A;  2QS1 A;  1FBC A;  1FPE A;  2QFL A;  2DE2 A;  1DSN A;  2CMO A;  2VD3 A;  1SBP A;  4GX4 A;  3NOH A;  1VFD A;  3KGC A;  1G0I A;  2RKM A;  3Q27 A;  3Q28 A;  1MM6 A;  4N6P A;  3FXR A;  4R75 A;  2ZXT A;  3IOR A;  3MZ1 A;  4FE8 A;  1JNF A;  3TPA A;  2Z22 A;  4XKP A;  3S9M C;  4H6D A;  1MQI A;  4HW8 A;  2UVG A;  4I40 A;  3IJO B;  4MEV A;  2A5T B;  2GFE A;  2I3V A;  3IX1 A;  5TU0 A;  1LB8 A;  3MJN A;  1ZIU A;  5I2K A;  3DM0 A;  4EQ9 A;  1NV4 A;  4NQ8 A;  5A5X A;  1NNK A;  1TXF A;  5H8F B;  2V3Q A;  2XWI A;  3A09 A;  4C0R A;  2OJT A;  4EF2 A;  5T3J A;  4MBP A;  2B4L A;  3CRB A;  1ZBM A;  4DXU A;  3RGY A;  2NUV A;  3B6T A;  3RT8 A;  1FBD A;  5ELV A;  4PFB A;  3MC2 A;  3N5L A;  2Q8M A;  1IMC A;  4MNP A;  3Q25 A;  4IO7 A;  3KN3 A;  2ZZX A;  1PB8 A;  4PP0 A;  2RIN A;  5JTY A;  4HTG A;  4ZE8 A;  4G8M A;  3SEW A;  3MUQ A;  3KN8 A;  2QVR A;  4NF8 B;  1O64 A;  1IQ7 A;  2F3D A;  2DE4 A;  2NVU B;  1NI9 A;  3M3L A;  3EHS A;  2FA7 A;  4LA9 A;  4I62 A;  2OBG A;  2UVJ A;  4LON B;  1TFA A;  4X48 A;  4YAH X;  1Y3N A;  3G3F A;  4BDL A;  3TAJ A;  3V83 A;  4LZ7 A;  3H06 B;  3FD3 A;  3S2V A;  4BLA A;  4ZEB A;  2XWV A;  3VLW A;  5TPA A;  4ZE9 A;  1BKA A;  3MW0 A;  1QUJ A;  5DVF A;  5F1Q A;  1H76 A;  2UXA A;  1OLA A;  4PFU A;  1MM7 A;  1Y9U A;  2XXR A;  2VP1 A;  1B1X A;  3CFX A;  4LN5 A;  4I8C A;  1FJ9 A;  4LP2 B;  4GLI A;  1T0K A;  2F7A A;  2F7B A;  3OEN A;  4JWX A;  2OLB A;  4NWD A;  4O7M A;  5A5L A;  3TCF A;  1NV3 A;  4H8I A;  2I4B A;  1L5T A;  4Z7E A;  3KSX A;  1S7Y A;  4LQ2 A;  3L6H A;  4KYE A;  1QKB A;  3EN3 A;  4PET A;  3PU5 A;  3PUY E;  2Z23 A;  4X8R A;  4YMA A;  3FJ7 A;  3EPE A;  3K2D A;  4I9D A;  3FVN A;  4PDD A;  3O97 A;  3BIG A;  1ZTY A;  2Q89 A;  4PAI A;  2GRV A;  2QVV A;  2H5Y A;  1SVX B;  3IO6 A;  5DEX A;  3A3C A;  4RY1 A;  3K02 A;  4RPO A;  5KCJ A;  1UIU A;  3CG1 A;  2O69 A;  4JBZ A;  3RYD A;  1P99 A;  4OER A;  1RDY A;  4Q8R A;  3K6W A;  1LBW A;  4QFP A;  4X9T A;  4LUB A;  4HS7 A;  1Q1K A;  4F1Y A;  5I5P A;  2I48 A;  3R6U A;  1LBC A;  3B6W A;  5B70 A;  1Q9D A;  3VV5 A;  1B1H A;  3FXQ A;  1R9Q A;  3OSQ A;  1GGG A;  4UAC A;  3TDJ A;  3TOD A;  1GR2 A;  4TLM B;  5H8Q B;  3A3U A;  3OXN A;  5L9S A;  2VHA A;  4PBH A;  3C32 A;  1AOV A;  2O68 A;  4Q0C A;  1LBY A;  1NV5 A;  2I6E A;  2WYP A;  2WX9 A;  4GXS B;  3UK4 A;  4FAJ A;  1DMB A;  2HEU A;  2ZMB A;  2GHB A;  3IJX B;  2XA5 A;  5ET7 A;  2ANJ A;  2E0S A;  3K0V A;  3T0J A;  1K9Z A;  5I3S A;  1N3X A;  2B65 A;  2XX8 A;  3N6T A;  3PUX E;  4R74 A;  2DXR A;  4ZEK A;  2QS3 A;  3GXA A;  2FBP A;  5CMB A;  4K3F A;  5KDT B;  2Q88 A;  4KYD A;  2Y7K A;  3O6H A;  3B7D A;  4IGT A;  4IY5 A;  1WVJ A;  3TTN A;  5HM4 B;  5H8N A;  5ITO A;  4GXA A;  4HXV A;  3HPI A;  2O6A A;  4KHZ E;  5ET8 A;  3WAE A;  1FPG A;  1DTZ A;  4FJP A;  1OVT A;  3FAT A;  4MFI A;  2XD3 A;  1DBZ A;  1B52 A;  4PCD A;  3D1R A;  1M5E A;  4GOT A;  1MQD A;  1Z7M E;  3LR1 A;  5IM2 A;  3N6U A;  1B3G A;  1VDW A;  1US5 A;  2QMW A;  3FJG A;  1NV6 A;  1NUY A;  3AXF A;  3FXB A;  4XTC Q;  3BKI B;  3O66 A;  1IIT A;  5L8D A;  5I59 B;  4GRK A;  3DP4 A;  4NF5 B;  3OEL A;  1MS7 A;  1AL3 A;  3IOV A;  1R6Z A;  3M3K A;  3D4G A;  4U23 A;  3PUZ E;  3VXC A;  2DVC A;  5ESY A;  1US4 A;  1M5F A;  4PGN A;  5I57 B;  1SI1 A;  1JVX A;  3VVD A;  4H67 A;  2CZI A;  2DYX A;  4FIM A;  3DP6 A;  3K4U A;  4I1D A;  1NV0 A;  4JVD A;  1R1N A;  5EHS A;  1FTO A;  3SEY A;  1H43 A;  2ZYO A;  3T66 A;  4ZEC A;  1IMD A;  1UQW A;  2XXY A;  4OYV A;  1URG A;  4KFQ A;  4P9K A;  4BDQ A;  3WAF A;  4NTL A;  3TCH A;  2W7Y A;  5CMK A;  1URD A;  1DCU A;  2D21 A;  4QFL A;  5H8H B;  4EF1 A;  4F18 A;  2VD2 A;  5IZ3 A;  1XOC A;  3LSX A;  4HE1 A;  1XVY A;  4WKM A;  2XD2 A;  2Q8J A;  4OVS A;  5K2X A;  1MQG A;  3CSB A;  2HFB A;  3C35 A;  4DCX A;  1H3D A;  3RNN A;  2HXW A;  2L5V A;  4F2O A;  4MNC A;  4MCO A;  4GWS A;  4JVI A;  3IFC A;  1EZO A;  1AMF A; 
#chains in the Genus database with same CATH homology
 2HHM A;  1NV6 A;  1YXI A;  1NUY A;  4PTK A;  2VPN A;  2P3N A;  4M1V A;  5EYG A;  3FXB A;  5IZ3 B;  4F1U A;  3GYY A;  4F19 A;  1FBG A;  5I5P A;  2QVR A;  4N15 A;  4QXD A;  4N91 A;  5CM6 A;  4OVQ A;  1BK4 A;  4NGU A;  2F3D A;  2FVZ A;  1NUZ A;  4GWW A;  4IR8 A;  2DE4 A;  3B8B A;  1FPL A;  2WEF A;  1NI9 A;  3LV0 A;  4NHB A;  1LEV A;  1EYI A;  1FBC A;  1Q9D A;  1FPE A;  2QFL A;  2FIE A;  2DE2 A;  2HPG A;  2PFZ A;  4OVP A;  4PAK A;  4PFI A;  4O94 A;  2FIX A;  1DK4 A;  2WBB A;  4I3E A;  2XXK A;  3E79 A;  3W9W A;  1FBP A;  4X04 A;  2Y5K A;  5ESY A;  4GX4 A;  5FBP A;  1IMA A;  2DDK A;  4P8B A;  4PGP A;  3NOH A;  2XWK A;  3EKI A;  5EQ7 A;  4PGN A;  3A29 A;  1G0I A;  2MKZ A;  4GWY A;  1FBH A;  3B50 A;  3HFU A;  5LTC A;  3U65 A;  5ET5 A;  4FBP A;  2DE3 A;  2P3V A;  4OAN A;  4N6D A;  3ROJ A;  4PBQ A;  4GWZ A;  2GQ1 A;  5J16 A;  4NN3 A;  4PBH A;  4AS4 A;  2WBD A;  1NV2 A;  2VT5 A;  2CZI A;  4PDH A;  4GBW A;  1YYZ A;  2QVU A;  1FBE A;  5IZ1 A;  4AS5 A;  4PF6 A;  2XWV A;  4O8M A;  1LBY A;  3MYU A;  5IGA A;  3T1B A;  4I3Y A;  2Q9T A;  1LBX A;  1NV5 A;  4P1E A;  1D9Q A;  4P3L A;  4F1V A;  4I40 A;  4YZZ A;  2WYP A;  4MNI A;  2WX9 A;  4MEV A;  4NX1 A;  4DI3 D;  3QMF A;  2DVZ A;  1FRP A;  5EQA A;  4P1L A;  4P56 A;  2KR0 A;  3PTY A;  1FSA A;  2XWO A;  1FPF A;  3MST A;  4PAI A;  1NV0 A;  3RPL B;  4JVD A;  4HCW A;  4JVC A;  4PFR A;  4N8Y A;  1RDZ A;  4GX3 A;  2QPQ A;  5ET7 A;  1FPD A;  1KZ8 A;  1NV1 A;  1QGX A;  2XA5 A;  4N4U A;  2FHY A;  1NUX A;  2CZH A;  3BIH A;  1FPI A;  1K9Z A;  5I3S A;  4HE0 A;  3T0J A;  4OA4 A;  4OVR A;  4HE2 A;  4HCY A;  1IMB A;  2PFY A;  1IMD A;  1NV4 A;  2JJK A;  3RPL A;  4LN5 A;  4N17 A;  2CEX A;  1SPI A;  1FJ9 A;  4NAP A;  4NQ8 A;  2FBP A;  4GBV A;  5DW8 A;  1EYK A;  1NV7 A;  1YZ0 A;  2OX3 A;  5LDZ A;  4NG7 A;  1RDX A;  4P9K A;  3KC0 A;  4PE3 A;  4XF5 A;  2ZZV A;  4O7M A;  5A5L A;  1EYJ A;  2V3Q A;  1FPJ A;  1LBV A;  1NV3 A;  2XWI A;  1K9Y A;  2F3B A;  5T3J A;  4OVT A;  2OWZ A;  4G61 A;  4H46 A;  1CNQ A;  4MIJ A;  4MAG A;  1INP A;  2B4L A;  2F5X A;  4N6K A;  2Q74 A;  1DCU A;  1FPB A;  4HXV A;  3LUZ A;  2VPO A;  4PET A;  5J1D A;  1XI6 A;  4O7I A;  5ET8 A;  4KXP A;  4GWU A;  4PF8 A;  2R8T A;  3ISP A;  4UAB A;  1FPG A;  1IME A;  3W9V A;  3FBP A;  2Y5L A;  4PAF A;  4X8R A;  2WYK A;  1FBD A;  5EYH A;  5EQ9 A;  4MX6 A;  3KBZ A;  4F18 A;  4P47 A;  1FJ6 A;  4PFB A;  5IZ3 A;  5ET6 A;  5I7I A;  4PDD A;  4MHF A;  2CEY A;  4MMP A;  3BIG A;  1FBF A;  1IMC A;  1AWB A;  2CZK A;  1FTA A;  2PCR A;  4MJO A;  1G0H A;  2Q8M A;  4HE1 A;  4MNP A;  1DBZ A;  4NF0 A;  4PCD A;  2QVV A;  1KA0 A;  3CHG A;  4OVS A;  1NUW A;  3D1R A;  4XEQ A;  2ZZX A;  5F24 A;  5EQ8 A;  2KQZ A;  1JP4 A;  2V4C A;  1FPK A;  4PC9 A;  4DI4 B;  3E78 A;  4YIC A;  5JK4 A;  2HXR A;  5IZZ A;  3KC1 A;  4H45 A;  2L5V A;  3SZP A;  4N8G A;  5IM2 A;  4MNC A;  2HZL A;  4XFE A;  1LBZ A;  2ZZW A;  3RYD A;  4N81 A;  1RDY A;  1IMF A;  3IFA A;  4QBA A;  1KA1 A;  4GWS A;  1LBW A;  2B4M A;  1VDW A;  4JVI A;  4MCO A;  3IFC A;  4X9T A;  2HZK A;  2BJI A;  4GWX A;  4GX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...