2HI6A

Solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
VKFACRAITRGRAEGEALVTKEYISFLGGIDKETGIVKEDCEIKGESVAGRILVFPGGKGSTVGSYVLLNLRKNGVAPKAIINKKTETIIAVGAAMAEIPLVEVRDEKFFEAVKTGDRVVVNADEGYVELIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of UPF0107 protein AF_0055, Northeast Structural Genomics Consortium Target GR101 (CASP Target)
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords UPF0107 protein AF0055
total genus 36
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01989 DUF126 Aconitase X swivel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.10 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Phosphohistidine domain 2hi6A00
1JDEA 3EZBA 3T05A 5JVLA 2OLSA 1EZBA 1ZYMA 2E28A 2MP0A 1DIKA 1VBHA 2HROA 3EZAA 1VBGA 2EZBA 2FM4A 2DIKA 1KC7A 2X0SA 3T07A 3EZEA 2HWGA 1EZAA 2EZCA 2EZAA 3T0TA 2HI6A 1GGOA 1KBLA 2R82A
chains in the Genus database with same CATH superfamily
1Q5XA 4C84A 4CZ1A 5F9MA 4P4IA 3C8OA 4MCPA 4X3RA 3T05A 5JVLA 3TLGA 1EZBA 1ZYMA 2C6PA 2GP4A 2OOTA 4EYSA 4C8CA 3TLZA 4P4FA 3S9LA 2FM4A 4LQGA 3FF3A 3IIBA 1XF1A 2DIKA 4NGSA 1KC7A 4NGMA 5IR2A 4MI1A 4C8PA 5D29A 5JYBA 3EZEA 2HWGA 4E94A 4P45A 3U1BA 3I6SA 2OR4A 3FEDA 3D7HA 2EK8A 3KRVA 4NGPA 1GGOA 1JDBC 4OC1A 4OC3A 2R82A 3EZBA 3BHXA 4INJA 4M8DA 2D0OA 4P4EA 1DIKA 1NBWA 2E28A 2MP0A 1VBHA 4TJXA 3SJFA 1NXJA 4CDKA 4OC5A 3SR3A 4C8AA 1C3OB 1V6CA 4JYWA 1WVMA 3S9MA 4MCQA 3NOJA 3TLBA 2JBJA 4W9YA 3IWWA 3T07A 2C6GA 2XEFA 1ZRSA 3K9TA 2PVVA 3KASA 4C9RA 1DE4C 2YJVA 3G23A 4KNGE 4C99A 2YJTA 3FECA 4NGQA 3TLYA 4NGTA 4P44A 2C5QA 2PCNA 3FEEA 1KBLA 4C8FA 1R61A 3BXMA 1CX8A 1JDEA 4P4JA 4E5SA 4NGNA 1Y9ZA 2OLSA 3EZAA 4MCRA 1VBGA 3I74A 2EZBA 2JBKA 5K99A 1A9XB 4JZ0A 4P4BA 1KEEB 3BI1A 4OC4A 4CO9A 4OC0A 4OC2A 4COGA 4P4DA 3S9NA 2CIJA 4C9EA 1CS0B 2C6CA 3TLGB 4J0NA 2EZAA 4MCSA 4TJVA 4H1HA 4MJXA 1BXRB 2XEGA 4C85A 4C9VA 5IB9A 4C8UA 1CE8B 3SJEA 1J3LA 3GJZA 3TLEA 4C8TA 2D0PA 4TWEA 3ICUA 1Z8LA 3SJXA 2XEJA 3TYXA 2HROA 5ELYA 1M6VB 3RBUA 3T5MA 4IIXA 3D7DA 4NGRA 4IIYA 4YN3A 3TLCA 2AUNA 3VTAA 5F5XA 3EIFA 3TLAA 2EK9A 2X0SA 4C9AA 1ZL0A 1T36B 3D7GA 1C30B 2B0AA 4C9UA 5F09A 1EZAA 2EZCA 3SJGA 3T0TA 4CDJA 3K4IA 3BI0A 1VI4A 5F1YA 4JVOA 4COBA 2PVWA 5FD8A 4OMEA 2AUMA 4C86A 2HI6A 3D7FA 2XEIA
chains in the Genus database with same CATH topology
1JDEA 3EZBA 3T05A 5JVLA 2OLSA 1EZBA 1ZYMA 2E28A 2MP0A 1DIKA 1VBHA 2HROA 3EZAA 1VBGA 2EZBA 2FM4A 2DIKA 1KC7A 2X0SA 3T07A 3EZEA 2HWGA 1EZAA 2EZCA 2EZAA 3T0TA 2HI6A 1GGOA 1KBLA 2R82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JDE A;  3EZB A;  3T05 A;  5JVL A;  2OLS A;  1EZB A;  1ZYM A;  2E28 A;  2MP0 A;  1DIK A;  1VBH A;  2HRO A;  3EZA A;  1VBG A;  2EZB A;  2FM4 A;  2DIK A;  1KC7 A;  2X0S A;  3T07 A;  3EZE A;  2HWG A;  1EZA A;  2EZC A;  2EZA A;  3T0T A;  2HI6 A;  1GGO A;  1KBL A;  2R82 A; 
#chains in the Genus database with same CATH topology
 1Q5X A;  4C84 A;  4CZ1 A;  5F9M A;  4P4I A;  3C8O A;  4MCP A;  4X3R A;  3T05 A;  5JVL A;  3TLG A;  1EZB A;  1ZYM A;  2C6P A;  2GP4 A;  2OOT A;  4EYS A;  4C8C A;  3TLZ A;  4P4F A;  3S9L A;  2FM4 A;  4LQG A;  3FF3 A;  3IIB A;  1XF1 A;  2DIK A;  4NGS A;  1KC7 A;  4NGM A;  5IR2 A;  4MI1 A;  4C8P A;  5D29 A;  5JYB A;  3EZE A;  2HWG A;  4E94 A;  4P45 A;  3U1B A;  3I6S A;  2OR4 A;  3FED A;  3D7H A;  2EK8 A;  3KRV A;  4NGP A;  1GGO A;  1JDB C;  4OC1 A;  4OC3 A;  2R82 A;  3EZB A;  3BHX A;  4INJ A;  4M8D A;  2D0O A;  4P4E A;  1DIK A;  1NBW A;  2E28 A;  2MP0 A;  1VBH A;  4TJX A;  3SJF A;  1NXJ A;  4CDK A;  4OC5 A;  3SR3 A;  4C8A A;  1C3O B;  1V6C A;  4JYW A;  1WVM A;  3S9M A;  4MCQ A;  3NOJ A;  3TLB A;  2JBJ A;  4W9Y A;  3IWW A;  3T07 A;  2C6G A;  2XEF A;  1ZRS A;  3K9T A;  2PVV A;  3KAS A;  4C9R A;  1DE4 C;  2YJV A;  3G23 A;  4KNG E;  4C99 A;  2YJT A;  3FEC A;  4NGQ A;  3TLY A;  4NGT A;  4P44 A;  2C5Q A;  2PCN A;  3FEE A;  1KBL A;  4C8F A;  1R61 A;  3BXM A;  1CX8 A;  1JDE A;  4P4J A;  4E5S A;  4NGN A;  1Y9Z A;  2OLS A;  3EZA A;  4MCR A;  1VBG A;  3I74 A;  2EZB A;  2JBK A;  5K99 A;  1A9X B;  4JZ0 A;  4P4B A;  1KEE B;  3BI1 A;  4OC4 A;  4CO9 A;  4OC0 A;  4OC2 A;  4COG A;  4P4D A;  3S9N A;  2CIJ A;  4C9E A;  1CS0 B;  2C6C A;  3TLG B;  4J0N A;  2EZA A;  4MCS A;  4TJV A;  4H1H A;  4MJX A;  1BXR B;  2XEG A;  4C85 A;  4C9V A;  5IB9 A;  4C8U A;  1CE8 B;  3SJE A;  1J3L A;  3GJZ A;  3TLE A;  4C8T A;  2D0P A;  4TWE A;  3ICU A;  1Z8L A;  3SJX A;  2XEJ A;  3TYX A;  2HRO A;  5ELY A;  1M6V B;  3RBU A;  3T5M A;  4IIX A;  3D7D A;  4NGR A;  4IIY A;  4YN3 A;  3TLC A;  2AUN A;  3VTA A;  5F5X A;  3EIF A;  3TLA A;  2EK9 A;  2X0S A;  4C9A A;  1ZL0 A;  1T36 B;  3D7G A;  1C30 B;  2B0A A;  4C9U A;  5F09 A;  1EZA A;  2EZC A;  3SJG A;  3T0T A;  4CDJ A;  3K4I A;  3BI0 A;  1VI4 A;  5F1Y A;  4JVO A;  4COB A;  2PVW A;  5FD8 A;  4OME A;  2AUM A;  4C86 A;  2HI6 A;  3D7F A;  2XEI A; 
#chains in the Genus database with same CATH homology
 1JDE A;  3EZB A;  3T05 A;  5JVL A;  2OLS A;  1EZB A;  1ZYM A;  2E28 A;  2MP0 A;  1DIK A;  1VBH A;  2HRO A;  3EZA A;  1VBG A;  2EZB A;  2FM4 A;  2DIK A;  1KC7 A;  2X0S A;  3T07 A;  3EZE A;  2HWG A;  1EZA A;  2EZC A;  2EZA A;  3T0T A;  2HI6 A;  1GGO A;  1KBL A;  2R82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...