2HI6A

Solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
b'VKFACRAITRGRAEGEALVTKEYISFLGGIDKETGIVKEDCEIKGESVAGRILVFPGGKGSTVGSYVLLNLRKNGVAPKAIINKKTETIIAVGAAMAEIPLVEVRDEKFFEAVKTGDRVVVNADEGYVELIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0107 protein AF0055
publication title Solution NMR structure of UPF0107 protein AF_0055, Northeast Structural Genomics Consortium Target GR101 (CASP Target)
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 36
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01989 DUF126 Aconitase X swivel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.10 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Phosphohistidine domain 2hi6A00
2MP0A 2HROA 3EZEA 2R82A 3T07A 1JDEA 2FM4A 1ZYMA 1GGOA 2DIKA 3EZAA 2HWGA 1VBHA 2HI6A 5JVLA 2EZCA 2EZBA 2OLSA 2E28A 1DIKA 2X0SA 1KC7A 2EZAA 3T0TA 1EZAA 1EZBA 1VBGA 3EZBA 3T05A 1KBLA
chains in the Genus database with same CATH superfamily
2MP0A 3TLCA 1NXJA 4P4EA 1ZL0A 1V6CA 3VTAA 4EYSA 4P4DA 1ZYMA 1GGOA 4C9EA 4C8AA 3EZAA 2HWGA 1VBHA 1R61A 4P45A 1CS0B 3BHXA 4P44A 2XEIA 2CIJA 4IIYA 4CZ1A 4JZ0A 4JYWA 4C99A 4W9YA 1EZAA 3TLEA 1C3OB 2PVVA 2C6CA 4P4FA 5K99A 5F1YA 4OMEA 3T05A 3S9MA 4C9UA 2GP4A 4TJXA 2XEFA 4M8DA 1JDEA 3D7GA 3TLGA 2OOTA 4C85A 4P4IA 4NGRA 3BI0A 1CE8B 2AUMA 3SJEA 2DIKA 4IIXA 1BXRB 5ELYA 1KEEB 5F09A 5IB9A 4E5SA 3FF3A 2YJTA 1Q5XA 2EZCA 2JBJA 3S9NA 2EZBA 4NGQA 3D7HA 2EZAA 3D7DA 3T0TA 1Z8LA 5JYBA 4KNGE 1CX8A 2YJVA 2C6PA 4MCSA 3SJXA 2EK9A 2D0PA 5F9MA 3K4IA 4OC1A 4CDKA 1VI4A 4NGNA 4C8FA 1ZRSA 4MCPA 3EZEA 2R82A 3T07A 4OC3A 4TJVA 2XEGA 3I74A 1C30B 3SJFA 2FM4A 4MCRA 3C8OA 4JVOA 3T5MA 4MCQA 1DE4C 4P4JA 5IR2A 2D0OA 4MI1A 4C8CA 3TYXA 3NOJA 3EIFA 3FEEA 4INJA 4TWEA 4YN3A 4C8TA 2PCNA 2JBKA 4C86A 3U1BA 3RBUA 3SR3A 2XEJA 4J0NA 4X3RA 4CDJA 2AUNA 3IIBA 1WVMA 1NBWA 1EZBA 4COBA 1J3LA 3BXMA 4E94A 3K9TA 4NGSA 3FEDA 3G23A 5F5XA 1KBLA 4NGPA 4C8PA 1XF1A 2C6GA 2HROA 3KRVA 3TLZA 3TLAA 3BI1A 4C8UA 4C84A 3KASA 4OC0A 1Y9ZA 3I6SA 3S9LA 4P4BA 1T36B 3D7FA 4COGA 2HI6A 5JVLA 4C9AA 2PVWA 1M6VB 2OLSA 4MJXA 1DIKA 2E28A 4OC4A 2X0SA 1KC7A 4OC2A 4NGTA 2B0AA 3TLYA 3ICUA 3TLGB 5D29A 4C9RA 4OC5A 3FECA 1A9XB 3GJZA 2EK8A 4NGMA 4C9VA 4H1HA 1VBGA 4CO9A 3EZBA 2C5QA 3IWWA 5FD8A 3TLBA 3SJGA 1JDBC 4LQGA 2OR4A
chains in the Genus database with same CATH topology
2MP0A 2HROA 3EZEA 2R82A 3T07A 1JDEA 2FM4A 1ZYMA 1GGOA 2DIKA 3EZAA 2HWGA 1VBHA 2HI6A 5JVLA 2EZCA 2EZBA 2OLSA 2E28A 1DIKA 2X0SA 1KC7A 2EZAA 3T0TA 1EZAA 1EZBA 1VBGA 3EZBA 3T05A 1KBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MP0 A;  2HRO A;  3EZE A;  2R82 A;  3T07 A;  1JDE A;  2FM4 A;  1ZYM A;  1GGO A;  2DIK A;  3EZA A;  2HWG A;  1VBH A;  2HI6 A;  5JVL A;  2EZC A;  2EZB A;  2OLS A;  2E28 A;  1DIK A;  2X0S A;  1KC7 A;  2EZA A;  3T0T A;  1EZA A;  1EZB A;  1VBG A;  3EZB A;  3T05 A;  1KBL A; 
#chains in the Genus database with same CATH topology
 2MP0 A;  3TLC A;  1NXJ A;  4P4E A;  1ZL0 A;  1V6C A;  3VTA A;  4EYS A;  4P4D A;  1ZYM A;  1GGO A;  4C9E A;  4C8A A;  3EZA A;  2HWG A;  1VBH A;  1R61 A;  4P45 A;  1CS0 B;  3BHX A;  4P44 A;  2XEI A;  2CIJ A;  4IIY A;  4CZ1 A;  4JZ0 A;  4JYW A;  4C99 A;  4W9Y A;  1EZA A;  3TLE A;  1C3O B;  2PVV A;  2C6C A;  4P4F A;  5K99 A;  5F1Y A;  4OME A;  3T05 A;  3S9M A;  4C9U A;  2GP4 A;  4TJX A;  2XEF A;  4M8D A;  1JDE A;  3D7G A;  3TLG A;  2OOT A;  4C85 A;  4P4I A;  4NGR A;  3BI0 A;  1CE8 B;  2AUM A;  3SJE A;  2DIK A;  4IIX A;  1BXR B;  5ELY A;  1KEE B;  5F09 A;  5IB9 A;  4E5S A;  3FF3 A;  2YJT A;  1Q5X A;  2EZC A;  2JBJ A;  3S9N A;  2EZB A;  4NGQ A;  3D7H A;  2EZA A;  3D7D A;  3T0T A;  1Z8L A;  5JYB A;  4KNG E;  1CX8 A;  2YJV A;  2C6P A;  4MCS A;  3SJX A;  2EK9 A;  2D0P A;  5F9M A;  3K4I A;  4OC1 A;  4CDK A;  1VI4 A;  4NGN A;  4C8F A;  1ZRS A;  4MCP A;  3EZE A;  2R82 A;  3T07 A;  4OC3 A;  4TJV A;  2XEG A;  3I74 A;  1C30 B;  3SJF A;  2FM4 A;  4MCR A;  3C8O A;  4JVO A;  3T5M A;  4MCQ A;  1DE4 C;  4P4J A;  5IR2 A;  2D0O A;  4MI1 A;  4C8C A;  3TYX A;  3NOJ A;  3EIF A;  3FEE A;  4INJ A;  4TWE A;  4YN3 A;  4C8T A;  2PCN A;  2JBK A;  4C86 A;  3U1B A;  3RBU A;  3SR3 A;  2XEJ A;  4J0N A;  4X3R A;  4CDJ A;  2AUN A;  3IIB A;  1WVM A;  1NBW A;  1EZB A;  4COB A;  1J3L A;  3BXM A;  4E94 A;  3K9T A;  4NGS A;  3FED A;  3G23 A;  5F5X A;  1KBL A;  4NGP A;  4C8P A;  1XF1 A;  2C6G A;  2HRO A;  3KRV A;  3TLZ A;  3TLA A;  3BI1 A;  4C8U A;  4C84 A;  3KAS A;  4OC0 A;  1Y9Z A;  3I6S A;  3S9L A;  4P4B A;  1T36 B;  3D7F A;  4COG A;  2HI6 A;  5JVL A;  4C9A A;  2PVW A;  1M6V B;  2OLS A;  4MJX A;  1DIK A;  2E28 A;  4OC4 A;  2X0S A;  1KC7 A;  4OC2 A;  4NGT A;  2B0A A;  3TLY A;  3ICU A;  3TLG B;  5D29 A;  4C9R A;  4OC5 A;  3FEC A;  1A9X B;  3GJZ A;  2EK8 A;  4NGM A;  4C9V A;  4H1H A;  1VBG A;  4CO9 A;  3EZB A;  2C5Q A;  3IWW A;  5FD8 A;  3TLB A;  3SJG A;  1JDB C;  4LQG A;  2OR4 A; 
#chains in the Genus database with same CATH homology
 2MP0 A;  2HRO A;  3EZE A;  2R82 A;  3T07 A;  1JDE A;  2FM4 A;  1ZYM A;  1GGO A;  2DIK A;  3EZA A;  2HWG A;  1VBH A;  2HI6 A;  5JVL A;  2EZC A;  2EZB A;  2OLS A;  2E28 A;  1DIK A;  2X0S A;  1KC7 A;  2EZA A;  3T0T A;  1EZA A;  1EZB A;  1VBG A;  3EZB A;  3T05 A;  1KBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...