2HI6A

Solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
132
structure length
132
Chain Sequence
VKFACRAITRGRAEGEALVTKEYISFLGGIDKETGIVKEDCEIKGESVAGRILVFPGGKGSTVGSYVLLNLRKNGVAPKAIINKKTETIIAVGAAMAEIPLVEVRDEKFFEAVKTGDRVVVNADEGYVELIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0107 protein AF0055
publication title Solution NMR structure of UPF0107 protein AF_0055, Northeast Structural Genomics Consortium Target GR101 (CASP Target)
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 36
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01989 DUF126 Aconitase X swivel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.10 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Phosphohistidine domain 2hi6A00
3EZBA 3T0TA 2EZAA 2EZCA 2HWGA 2DIKA 3EZAA 1KBLA 1DIKA 3T07A 1ZYMA 2HROA 1GGOA 2OLSA 2EZBA 1EZBA 1VBGA 2MP0A 5JVLA 3T05A 2E28A 1VBHA 2FM4A 2R82A 2X0SA 1KC7A 1EZAA 3EZEA 2HI6A 1JDEA
chains in the Genus database with same CATH superfamily
2AUNA 4H1HA 3RBUA 3TLBA 3BI1A 4NGNA 2XEGA 5F09A 4P4FA 1ZRSA 1M6VB 4COBA 4EYSA 4C86A 4JVOA 3T07A 3TLYA 4C9AA 1XF1A 2XEIA 5F1YA 5K99A 1ZYMA 4C99A 1GGOA 4IIXA 5D29A 3K9TA 4TJXA 4CDJA 4NGPA 2JBKA 3SR3A 4C8CA 4JYWA 1CS0B 4C9EA 4C9UA 5JVLA 3T05A 3G23A 2E28A 3NOJA 4NGTA 2R82A 1DE4C 5IR2A 1EZAA 1R61A 2HI6A 1ZL0A 3D7FA 2C6GA 2OOTA 4MCRA 1V6CA 2EZCA 4P4BA 4JZ0A 1A9XB 1Y9ZA 5ELYA 1T36B 2CIJA 1C3OB 3KRVA 3TLGB 3TLZA 4CZ1A 3FEEA 2C6CA 2C5QA 3IWWA 4MJXA 4P4JA 1CE8B 4C8UA 4P45A 4C84A 2EZBA 4TWEA 1EZBA 3S9MA 2YJVA 4OC1A 2PVWA 4C8FA 1C30B 4C8AA 1VBHA 2D0OA 4OC5A 2FM4A 3D7HA 3SJEA 3K4IA 4YN3A 4OC4A 2X0SA 4CDKA 1KC7A 1JDBC 1NBWA 3EZEA 1CX8A 1JDEA 3C8OA 3D7DA 3EZBA 4INJA 3SJFA 4MCQA 3T0TA 4IIYA 4MCPA 3BXMA 3SJXA 3FEDA 2DIKA 1J3LA 1VI4A 4P4IA 5F9MA 3EZAA 4W9YA 2AUMA 4OC2A 3BI0A 2JBJA 5JYBA 1KEEB 4OMEA 4P44A 1BXRB 5FD8A 4NGQA 2HROA 2OLSA 3TLEA 3FECA 4KNGE 3VTAA 1WVMA 4CO9A 5F5XA 3ICUA 2D0PA 3I74A 2PCNA 4E94A 2GP4A 3D7GA 4TJVA 2EK8A 4NGMA 4M8DA 4MI1A 3TLCA 3S9LA 3TYXA 1NXJA 2EZAA 3TLAA 2EK9A 5IB9A 2HWGA 4NGSA 1Q5XA 2PVVA 2YJTA 4E5SA 3KASA 3U1BA 1KBLA 1DIKA 1Z8LA 3BHXA 4C9VA 2XEFA 4J0NA 3EIFA 4X3RA 3IIBA 3S9NA 3I6SA 4C8PA 3T5MA 4COGA 1VBGA 2B0AA 4LQGA 4OC3A 4P4EA 3FF3A 4OC0A 4C9RA 2XEJA 2MP0A 3GJZA 3TLGA 4P4DA 2C6PA 3SJGA 2OR4A 4NGRA 4C8TA 4MCSA 4C85A
chains in the Genus database with same CATH topology
3EZBA 3T0TA 2EZAA 2EZCA 2HWGA 2DIKA 3EZAA 1KBLA 1DIKA 3T07A 1ZYMA 2HROA 1GGOA 2OLSA 2EZBA 1EZBA 1VBGA 2MP0A 5JVLA 3T05A 2E28A 1VBHA 2FM4A 2R82A 2X0SA 1KC7A 1EZAA 3EZEA 2HI6A 1JDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZB A;  3T0T A;  2EZA A;  2EZC A;  2HWG A;  2DIK A;  3EZA A;  1KBL A;  1DIK A;  3T07 A;  1ZYM A;  2HRO A;  1GGO A;  2OLS A;  2EZB A;  1EZB A;  1VBG A;  2MP0 A;  5JVL A;  3T05 A;  2E28 A;  1VBH A;  2FM4 A;  2R82 A;  2X0S A;  1KC7 A;  1EZA A;  3EZE A;  2HI6 A;  1JDE A; 
#chains in the Genus database with same CATH topology
 2AUN A;  4H1H A;  3RBU A;  3TLB A;  3BI1 A;  4NGN A;  2XEG A;  5F09 A;  4P4F A;  1ZRS A;  1M6V B;  4COB A;  4EYS A;  4C86 A;  4JVO A;  3T07 A;  3TLY A;  4C9A A;  1XF1 A;  2XEI A;  5F1Y A;  5K99 A;  1ZYM A;  4C99 A;  1GGO A;  4IIX A;  5D29 A;  3K9T A;  4TJX A;  4CDJ A;  4NGP A;  2JBK A;  3SR3 A;  4C8C A;  4JYW A;  1CS0 B;  4C9E A;  4C9U A;  5JVL A;  3T05 A;  3G23 A;  2E28 A;  3NOJ A;  4NGT A;  2R82 A;  1DE4 C;  5IR2 A;  1EZA A;  1R61 A;  2HI6 A;  1ZL0 A;  3D7F A;  2C6G A;  2OOT A;  4MCR A;  1V6C A;  2EZC A;  4P4B A;  4JZ0 A;  1A9X B;  1Y9Z A;  5ELY A;  1T36 B;  2CIJ A;  1C3O B;  3KRV A;  3TLG B;  3TLZ A;  4CZ1 A;  3FEE A;  2C6C A;  2C5Q A;  3IWW A;  4MJX A;  4P4J A;  1CE8 B;  4C8U A;  4P45 A;  4C84 A;  2EZB A;  4TWE A;  1EZB A;  3S9M A;  2YJV A;  4OC1 A;  2PVW A;  4C8F A;  1C30 B;  4C8A A;  1VBH A;  2D0O A;  4OC5 A;  2FM4 A;  3D7H A;  3SJE A;  3K4I A;  4YN3 A;  4OC4 A;  2X0S A;  4CDK A;  1KC7 A;  1JDB C;  1NBW A;  3EZE A;  1CX8 A;  1JDE A;  3C8O A;  3D7D A;  3EZB A;  4INJ A;  3SJF A;  4MCQ A;  3T0T A;  4IIY A;  4MCP A;  3BXM A;  3SJX A;  3FED A;  2DIK A;  1J3L A;  1VI4 A;  4P4I A;  5F9M A;  3EZA A;  4W9Y A;  2AUM A;  4OC2 A;  3BI0 A;  2JBJ A;  5JYB A;  1KEE B;  4OME A;  4P44 A;  1BXR B;  5FD8 A;  4NGQ A;  2HRO A;  2OLS A;  3TLE A;  3FEC A;  4KNG E;  3VTA A;  1WVM A;  4CO9 A;  5F5X A;  3ICU A;  2D0P A;  3I74 A;  2PCN A;  4E94 A;  2GP4 A;  3D7G A;  4TJV A;  2EK8 A;  4NGM A;  4M8D A;  4MI1 A;  3TLC A;  3S9L A;  3TYX A;  1NXJ A;  2EZA A;  3TLA A;  2EK9 A;  5IB9 A;  2HWG A;  4NGS A;  1Q5X A;  2PVV A;  2YJT A;  4E5S A;  3KAS A;  3U1B A;  1KBL A;  1DIK A;  1Z8L A;  3BHX A;  4C9V A;  2XEF A;  4J0N A;  3EIF A;  4X3R A;  3IIB A;  3S9N A;  3I6S A;  4C8P A;  3T5M A;  4COG A;  1VBG A;  2B0A A;  4LQG A;  4OC3 A;  4P4E A;  3FF3 A;  4OC0 A;  4C9R A;  2XEJ A;  2MP0 A;  3GJZ A;  3TLG A;  4P4D A;  2C6P A;  3SJG A;  2OR4 A;  4NGR A;  4C8T A;  4MCS A;  4C85 A; 
#chains in the Genus database with same CATH homology
 3EZB A;  3T0T A;  2EZA A;  2EZC A;  2HWG A;  2DIK A;  3EZA A;  1KBL A;  1DIK A;  3T07 A;  1ZYM A;  2HRO A;  1GGO A;  2OLS A;  2EZB A;  1EZB A;  1VBG A;  2MP0 A;  5JVL A;  3T05 A;  2E28 A;  1VBH A;  2FM4 A;  2R82 A;  2X0S A;  1KC7 A;  1EZA A;  3EZE A;  2HI6 A;  1JDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...