2HI7A

Crystal structure of dsba-dsbb-ubiquinone complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
188
Chain Sequence
b'AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Crystal Structure of the DsbB-DsbA Complex Reveals a Mechanism of Disulfide Bond Generation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 53
structure length 188
sequence length 188
ec nomenclature ec 1.8.4.-:
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2hi7A00
2H73A 2H6YA 2HRFA 3LWAA 3KD0A 5E59A 2H76A 3EVIA 2AB6A 5G31A 5KEJA 3FEUA 4EL1A 4ZILA 1TP9A 5HR3A 4MP4A 1YEXA 1T1VA 2IIYA 3G7JA 3QFBC 1JFUA 3ZYWA 3KEBA 3F3QA 1XW5A 2FWHA 5DQSA 2LQQA 4HQSA 4WEYA 2MYGA 2N5FA 2HSHA 2H01A 3CTFA 3P8WA 4RI6A 20GSA 2IMKA 5F05A 4MZCA 3ZITA 2LQOA 1GTAA 5AGYA 4I8BA 18GSA 2LRTA 1SENA 3DIEA 3H1NA 4K8MA 4OO4A 1VF3A 1A2JA 5F0GA 3FKFA 3UJ1A 2DJKA 3TJJA 2VCVA 4D73B 1BQ7A 3TCOA 3FZAA 2GZZA 2YCDA 5HQPA 2FNOA 4KNDA 5D8IA 6GSSA 3A5WA 3HJOA 5ECQB 1URMA 4XRAA 3VWVA 5KN2A 4YQVA 4WKWA 4HJMA 3UAPA 1W89A 4PQIA 2P31A 3E0UA 2K8VA 1EGOA 4F0CA 5J4UA 3QMXA 2GSTA 1Y6EA 2KP2A 5L71A 3PGTA 4K6XA 4ECCA 4DSQA 4HOJA 3MWHA 1LJRA 2OKAA 2WRTA 3GN3A 4HDEA 2DC5A 5IPHA 1B48A 2OBKA 3V1WA 2E0QA 4MF5A 3D4TA 1XWCA 2RM5A 5ECNB 4HQZA 3TJFA 1MD4A 8GSSA 3ZZXA 5DAKA 1B8XA 1ZYEA 2HI7A 1GSFA 3UARA 2YZUA 1J0FA 1XFLA 4KE3A 3VWWA 2CZ3A 5G5FA 3ISOA 3IOSA 3J7Yb 3ZIJA 4I2TA 2WCIA 1HNBA 3H8QA 2LKUA 4OO5A 1KNGA 1SKWB 5ECSA 3KP8A 2JSZA 4JR6A 5J3RA 3M8NA 4WR4A 4DVCA 1XVWA 3IHQA 1BYEA 1R7HA 2I1UA 3CSHA 1AQXA 1OE8A 3LG6A 2GTUA 2VOCA 1HNCA 3S9FA 4HU7A 2GVPA 2YZHA 4KCAA 2FHEA 5COHA 5AN1A 1PX6A 2RUEA 4JU5A 1MEKA 1V40A 3LYPA 2B5XA 3O3TA 1Y25A 4G19A 4F03A 3ZVJD 1F2EA 2NTOA 2R2JA 3DXBA 2X64A 3HCZA 3KIJA 2HNLA 3QAGA 1GNEA 1N8JA 3H4KA 3VLNA 3I9V2 2HZEA 4MJEA 3RHBA 4OFTA 1BX9A 1QGVA 1XWGA 5B8BA 4YH2A 1X5EA 1Z6NA 1ZL9A 2EIRA 5CP1A 4L8EA 3GX8A 1TK5B 5HFKA 4HU9A 2IFQB 2GT5A 1RK4A 4YQMA 3L9SA 1AW9A 5CRHA 4FO5A 1YY7A 3GL3A 1JZDA 2R5GA 1VRSD 2CVKA 2YPMA 5EPFA 1B9XC 2H1BA 4XIHA 5DALA 1USBA 4F2IA 2BJXA 11GSA 2LTKA 3E3EA 3F3RA 1Z7PA 4MLYA 3P2AA 2O89A 1G7EA 4TXOA 1GUMA 4O7HA 2C0DA 5G1KA 4MABA 1I5GA 1SK1A 1AAZA 1T3BA 4KW6A 2AAWA 2N5AA 4XS4A 1TRUA 4EUYA 2YJ7A 1JZRA 4L0UA 1PSQA 2H0GA 2YANA 2NDOA 3IAS2 3F9UA 4PURA 2MMZA 5IIZA 4NMUA 4Z7XA 4N30A 4N0VA 1OC9B 3KH7A 4ZBDA 1NHYA 2KP1A 4IBPA 3D4MA 2PWJA 5H5QA 1DE2A 2GQKA 3FR6A 4ZBAA 3TKRA 4AJ7A 1FVJA 1OE7A 1AXDA 3ZIVA 1M9BA 5CAXA 1UVZA 1TKDB 1VF4A 3UL3A 5F07A 2CVDA 1SKRB 2L4QA 4V1Ap 12GSA 4MCUA 1SYXA 4OFNA 4PNGA 5ECRB 3GURA 3Q74A 3US3A 1EOHA 4IP6A 1ERWA 4MPGA 2JACA 1GTUA 3CYNA 4K0NA 4PXOA 2PUKC 2C3TA 5GSSA 2HSYA 3IXRA 4GSNA 4ZBBA 3GNJA 4BPYA 5KN0A 2AHEA 4OFMA 4ML6A 1YEPA 5F06A 3E9JB 1K3YA 4LMVA 1ML6A 4IQAA 3ZFLA 2MZCA 1X5DA 1A24A 3ED3A 3APSA 5A5KA 4K7IA 3KMOA 5EL8A 1U6TA 2H0IA 2MMNA 3GKMA 1WMJA 4MJBA 2VLVA 1XWAA 4HZ2A 2B7KA 3K8NA 2NBSA 1G7OA 3R2QA 2AJQB 3F4TA 5HR1A 3C8EA 1TRVA 1AC1A 4MH3A 1WP0A 3LEFA 3BJ5A 4K7OA 5EY6A 2G2QA 2J23A 4XHMA 2DSAA 4ZXGA 3MDKA 4J2FA 1SJ6A 2K9FA 1TI3A 4OMVA 3FZ5A 5IOXA 2CVBA 5CYYA 3IA1A 1BAYA 4KDYA 2GDRA 4LMWA 4ECIA 2H0HA 5DCHA 1PMTA 4O32A 3VI7A 1HNAA 2F3MA 3UMAA 2VL2A 2KHPA 2CAIA 4WR5A 5IMZA 1U87A 17GSA 4BL7A 4V1Ag 2L5OA 2IL3A 3GUSA 2H75A 3EU3A 3EMPA 4XS1A 2A2RA 2GS3A 5DJMA 2JL4A 3HZ4A 4MA9A 2L4CA 2OA7A 5ECOB 2K18A 1K0MA 3I69A 1B4QA 3ERFA 10GSA 1JZOA 1WIKA 1I9DA 1DBYA 4BVYA 5JCGA 4MDCA 1TDIA 3I6AA 2JADA 2VL2C 4RQXA 5AIVA 4NXIA 5B6MA 1CQHA 2DIYA 4AF2A 3APQA 1GUHA 2E2GA 4XTSA 3KXOA 1GUKA 1H4OA 5IM9A 2FWGA 3DEXA 2P5QA 1YJ6A 4CW9A 4IQ1A 1UA5A 3HJPA 1A8LA 3GH9A 4EO3A 1LU4A 5J9CA 1FO5A 1J08A 3LFLA 5D9WA 5JCUA 4IVFA 1V58A 1GNWA 4KA0A 2CV4A 3PINA 2L5LA 5EVOA 5JCWA 2VM1A 3GIXA 2J9HA 19GSA 4RI7A 1YKAA 2OJLA 2IMDA 1ILOA 2JSYA 4NV5A 3TKSA 4GTUA 4Q5NA 3Q18A 1XPVA 2C1YA 1SKSB 4L5OA 2LSTA 2HFDA 5D9VA 1BG5A 2OE0A 2IPAA 4V2MA 2MBSA 3CMIA 14GSA 2FCHA 1PN9A 5ECPB 4E8HA 2I3YA 1VGLA 2H74A 4HUAA 1X9MB 1K0CA 3TOUA 3CRUA 4EDYA 3TKSC 4GLTA 2HZEB 3VPTA 4WF5A 1QMVA 4FYCA 3RHCA 4ZB8A 3IBHA 2LS5A 1FVKA 3IDVA 3HZ8A 1U3AA 7GSSA 4JZQA 2LNSA 4GCIA 2DJ0A 4WBJA 4I2UA 2X8GA 1QXHA 2F8AA 2P0GA 2GSQA 2C0FA 4PQ1A 1A8YA 5DALB 5CNWA 1PQNA 3LJRA 3VWUA 5ABRA 5JWOB 4MZWA 1F6MC 3GHAA 3RDWA 2DLXA 1ZOFA 4TXOB 1XW9A 1YZXA 2C0EA 2OACA 3WT2A 3IE3A 3SBCA 1T8EB 1AQWA 2V32A 1MD3A 2WDUA 1PRXA 2G0FA 2JZTA 2WJUA 4XS4B 4KDUA 5IMAA 1MDJA 1JHBA 1SJZA 4FH8A 1GP1A 3VK9A 2WB9A 1MDKA 3QDNA 4AGSA 2OE1A 2KUCA 1XXUA 4HS1A 1IYIA 5ELAA 3KTBA 2B7JA 1GSDA 4BVXA 3UVTA 1KEBA 1M2DA 1SD9A 3CRTA 3HHVA 3HY2A 2LUSA 2RUFA 2YV9A 3QAVA 5FHIA 3TJKA 4HI7A 1J9BA 2EIQA 2AYTA 2PGTA 3UIWA 1ERTA 2C8UA 1Z3EA 4Q5FA 4ZB6A 2JZRA 3TGZA 3O6TA 4YAVA 4AJ6A 3ME7A 2B1LA 3HKRA 3GH6A 3DVXA 2C4JA 1F3AA 1PL2A 1TI1A 3Q19A 3Q6OA 5ECLB 4F9ZA 1EEMA 1ZMAA 4IN0A 3ZFBA 2LRCA 1TK0B 3ZMKA 3L0HA 1GSEA 2M80A 1THOA 3M1GA 1M2BA 4KDXA 2KLXA 3TOTA 1M7TA 4ILFA 1XWKA 3TB2A 1XCCA 4KAEA 3QFAC 1OYJA 2YV7A 3FR9A 3D22A 4KX4A 4FYBA 1NSWA 2X8HA 1S3DA 2QKEA 3GSTA 3I43A 3DRNA 1WPIA 2VLTA 4MMMA 1VF2A 4HJ2A 2B6MA 2H1DA 1EOGA 5IPGA 4IW9A 5GSTA 1ST9A 4EVMA 4MJCA 1XOAA 4KSMA 5IQYA 2ES7A 2M46A 3WGXA 1T4ZA 4LA1A 4F82A 2HYXA 5D96A 3JCML 2F8FA 4TR4A 5CRDA 3O76A 3VWXA 5IOWA 2IJYA 3M9JA 1F3BA 3RPPA 1HQOA 3G7YA 9GSSA 3CBUA 3VFIA 5A4WA 2PPTA 1ERUA 1AIUA 4O92A 3NIVA 3EWLA 3L4NA 1DUGA 1UN2A 3BD2A 2VCZA 5IMDA 3QOUA 2FY6A 2CA8A 2DJ1A 2K6VA 2LEGA 1KTEA 4KUNA 1PKWA 2O87A 3ZL5A 3RPNA 3DYRA 1TTZA 1PGTA 1OC8A 3PH9A 2ON7A 1PA3A 4MH2A 1ERVA 1FB0A 1YDKA 2I4AA 4XCSA 4TVEA 5INYA 2XPEA 2D2ZA 1XZOA 3A2WA 1K0NA 2DBCA 1A0RP 4TR1A 1R5AA 3FW2A 2FUG2 1VF1A 2HLSA 5ECMB 1C72A 4MZBA 3AY8A 4WF4A 2V1MA 1V57A 2C3QA 5HFIA 5HR2A 5IO0A 2HE3A 1GSQA 1EWXA 2PU9C 1QFNA 4GF0A 1ZYQB 3WGEA 1TXXA 3LORA 4WBRD 1NW2A 2H1GA 3DD3A 3QD9A 1TJDA 3U6VA 1EP7A 3QR6A 5G1LA 4OCEA 1E2YA 2YWNA 1WWJA 1KBNA 2LJKA 4BWSA 2N5BA 1SJIA 4NPBA 3F6DA 5LD0A 4JRRA 1T4YA 5ECHB 2L59A 2IMEA 3F6FA 2WFCA 4ECJA 5GZZB 5ENUA 4EKZA 5D9XA 2VD0A 4POBA 3TKQA 3RAZA 2CX4A 5JWRB 4BA7A 3MNGA 4K0GA 2HXKA 2M72A 1K0DA 3A3TA 3HJMA 3UBLA 1EZKA 4POKA 4JR4A 1V2AA 3GFKA 3TJBA 3HDCA 5ID2A 1O81A 3P7XA 2A4VA 2TRXA 3NOFA 2DJJA 5IO2A 2MMOA 2DMLA 4N10A 1V9WA 1O85A 3CSIA 2O8VB 1GULA 2WS2A 2VCWA 3TKSE 1XW6A 1A2LA 4K7NA 3G9BA 3L9VA 2L57A 2V41A 2PBJA 1Q4JA 3SWLA 3FRCA 4N11A 4XS6A 5ECIB 1B9YC 1XBSA 2CX3A 4IHUA 1M2AA 5DCGA 2H19A 4PNFA 4IKHA 3DMLA 1RQMA 5DQYA 3UEMA 1N2AA 3C71A 1HD2A 6GSVA 5HFGA 1OC3A 1THXA 4CDOA 1SL2B 3UOMA 3CTGA 1PX7A 3UBKA 1BJXA 1Z7RA 4PUFC 3GA4A 5A4UA 2ZUPA 5DAKB 2IMFA 3QPMA 4FIWA 4QL7A 4XRDA 2RLIA 3LSZA 4KB3A 1SD8A 3GTUA 1FAAA 3WT1A 1NHOA 2YP6A 5LCZA 5KN1A 1O7UA 4GXZA 2KOKA 3VPQA 1QQ2A 4MPFA 3C73A 1M99A 1AQVA 3FZ4A 3EINA 4BWQA 3TKPA 1XIYA 2NPBA 2R6KA 5CO3A 2I81A 1Q98A 4J56E 4KCEA 4O5RA 3TRPA 2BMXA 3HXSA 2FD3A 2YJHA 3D6IA 4K1FA 3N9JA 2YOIA 2VIMA 4P3YB 1FHEA 2VCXA 5CRWA 2GT6A 2HT9A 5F8BA 2IN3A 1A23A 1WOUA 3ZMLA 4K2DA 3GKKA 4KSOA 2B5YA 1OAZA 4IGJA 3RBTA 1R4WA 1GH2A 4CHSA 3FYGA 4K9ZA 2VL9A 1K0AA 5G2ZA 2ALBA 1SYRA 5D73A 2EC4A 2F51A 4JE1A 1DSBA 1K3LA 3TRQA 3KMNA 2XC2A 3W6GA 2WGRA 2YN1A 3P90A 1LBKA 3DWVA 1SU9A 3GV1A 3UVHA 3WYWA 3IK9A 3FY7A 4L0WA 5DVBA 2YWIA 1K0OA 1O6JA 2FA8A 2C80A 1T7PB 1GRXA 4G2EA 1ZGNA 3KP9A 3DVWA 1FW1A 3HD5A 3ME8A 5B8AA 2H30A 5IMFA 3DGQA 5J5NA 1GSUA 2A2SA 3ZVJA 3FK8A 4DEJA 3GSSA 5CRGA 4GQFA 3KCMA 1ZZYA 4J57E 3M0FA 2IMIA 3EMXA 4WXTA 3QAWA 1WE0A 4N0ZA 3HVXA 2RM6A 2FWFA 4V2NA 4POMA 4GSTA 4ULXA 6GSUA 2H70A 4ZIJA 4EE0A 1S3AA 5FT3A 3VURA 1WRYA 1U88A 2PN8A 2GGTA 4MJAA 5C04A 4TR1B 2H72A 1SK2A 2GZYA 2VUPA 3GX0A 1HYUA 4DSSA 1GTIA 4GSSA 4MF6A 1TRSA 3KJYA 2B3SA 1B4PA 4TR0A 3C1SA 3F4SA 2O7KA 4ACSA 2CAQA 4RQRA 2C3NA 2OADA 2MMAA 3TDGA 4H86A 6GSWA 2DJ3A 1G0TA 3W8SA 2REMA 2YWMA 2GQMA 3GKNA 4IELA 3BCKA 1A2MA 1AUCA 2GZPA 3LGCA 5DDLA 1OKDA 1U3IA 2H6XA 3FHKA 1V98A 3ZREA 4V2LA 2H8LA 1GWCA 2FA4A 2PMTA 2AUVA 2QGVA 3IC4A 2QSIA 4TR3A 3GRXA 2E7PA 3IV4A 1M0UA 1K0BA 4LLRA 1JLWA 1CQGA 3BOAA 4ZL7A 1Z9HA 5KN3A 2FLSA 2ON5A 2WZ9A 2OE3A 3HVVA 2TRCP 3F4RA 1GTBA 3LYKA 2V6OA 4X1UA 4ZL9A 1TOFA 1BEDA 4I5QA 4IJIA 13GSA 2FGXA 1EV4A 3EC3A 1TW9A 1ABAA 1PL1A 2EIOA 3MAKA 1DE1A 1YKCA 6GSTA 3BBYA 3HA9A 4Q5RA 2VCTA 3A2VA 3C1RA 4GWRA 2DIZA 5ID2B 2HRNA 3L78A 5H5SA 1PD21 5HR0A 4QL9A 4ID0A 4G10A 4G9HA 1GL8A 2VAFA 4D73A 5FWGA 2K8SA 3H79A 4NV2A 1EGRA 2XPDA 4ZL8A 4EF0A 1GLPA 1QK8A 1Z6MA 5J41A 3GKXA 1TU7A 1O8XA 3IPZA 3GYKA 3A2XA 5E4WA 5C00A 3KTLA 1YQ1A 2LV3A 4I97A 2XHFA 5D9TA 2P5RA 4WETA 4X0XA 1M9AA 2YNXA 4LL4B 1PKZA 1XOBA 2GLRA 2ZNMA 1F9MA 3HVSA 2V2GA 3G7IA 5GAPD 4JBBA 1A0FA 3NZNA 4ZB9A 2VLUA 4TKYA 2RIIA 1NM3A 4F0BA 5LNKe 4E8EA 5ELGA 4PX1A 1SL0B 4TXVA 1JLVA 3KGKA 3IRAA 2AV4A 1X0RA 1ZCPA 3DKSA 3D21A 4I6XA 4HZ4A 4EDZA 4POLA 3HYPA 4ISDA 4NWYA 3IR4A 3KM6A 5GAND 2VCQA 4QQ7A 3D0ZA 2FWEA 4KGIA 3GTUB 1K3OA 4TRXA 3VI5A 1TK8B 3ZLPA 2C0GA 2V6KA 1H75A 4NHWA 3WD6A 1EV9A 2PVOC 3F0IA 1G6YA 5JWQB 2YWOA 5H5RA 2F9SA 4FYUA 5ECKB 1GSYA 2PVQA 4NAXA 5G30A 1YF0A 3C7MA 4AJ8A 3LQ7A 3ERGA 2I9HA 2OBIA 1S3CA 3EE2A 4Q5QA 1QUWA 3CSJA 3KH9A 3U5RE 4EXJA 4MF7A 16GSA 3FZ9A 4PUAA 2VD1A 1G6WA 3LXTA 6GSXA 4RUVA 5IMVA 4DSRA 3OR5A 2LJAA 2GQLA 1F37A 4IS0A 2TIRA 2HZFA 5G5EA 4EC0A 2X99A 3M9KA 3H93A 2BTOT 2H71A 3TRXA 3IAM2 2LNTA 4TW5A 4IJ3A 1O73A 1EP8A 3W8JA 2XBQA 4KH7A 1X9WB 3LXZA 1GLQA 1W4VA 1R5PA 2GSRA 1FG4A 4JEDA 4YAPA 1O8WA 2IFQA 3BCIA 3EURA 2JU5A 2O85A 4HEA2 4GQCA 2MBTA 1YF1A 2X8CA 4ECBA 3F8UA 4L5LA 3ZRDA 4MK3A 3TUEA 2ZCTA 3PR8A 2H1AA 1R26A 22GSA 1TU8A 5DJLA 5A4VA 3EU4A 1E6BA 4TN8A 2H6ZA 3J7Yk 2CZ2A 2L6DA 1XWBA 3MSZA 3M3MA 3APOA 1GSSA 1T00A 1X5CA 2IWTA 3F63A 2WULA 1OKTA 3QCPA 4NHZA 2R37A 2CQ9A 1UC7A 1TRWA 6GSYA 2H66A 2DMMA 1OC9A 2GSSA 2LJRA 1X9SB 4LL1B 1WJKA 1FB6A 4PQHA 1SK0A 2QC7A 4PGTA 2L6CA 2CT6A 3KZQA 2XBIA 4TOPA 1MDIA 2NVLA 3WGDA 5B6NA 2E2MA 3ZTLA 1JZWA 3FR3A 1ACVA 2B1KA 3L9UA 1MTCA 1XVQA 2VM2A 4IP1A 5IMCA 3GL5A 4OCFA 2PERA 4DSSB 3D5JA 1RW1A 3CXGA 1FOVA 3ERWA 3TJGA 1OVNA 2Z9SA 5DBQA 2VO4A 1ON4A 4YQUA 2JZSA 3GMFA 1IYHA 1Z5YE 4GRFA 2R4VA 4ML1A 5AIXA 3N5OA 5AISA 1EEJA 4OWYA 2B5EA 3IK7A 3EYTA 2VL3A 2R3XA 5D93A 5CREA 4OD7A 2LRNA 2DJ2A 5J9BA 5B7CA 1SL1B 4X43A
chains in the Genus database with same CATH superfamily
2H73A 2H6YA 2HRFA 3LWAA 3KD0A 5E59A 2H76A 3EVIA 2AB6A 5G31A 5KEJA 3FEUA 4EL1A 4ZILA 1TP9A 5HR3A 4MP4A 1YEXA 1T1VA 2IIYA 3G7JA 3QFBC 1JFUA 3ZYWA 3KEBA 3F3QA 1XW5A 2FWHA 5DQSA 2LQQA 4HQSA 4WEYA 2MYGA 2N5FA 2HSHA 2H01A 3CTFA 3P8WA 4RI6A 20GSA 2IMKA 5F05A 4MZCA 3ZITA 2LQOA 1GTAA 5AGYA 4I8BA 18GSA 2LRTA 1SENA 3DIEA 3H1NA 4K8MA 4OO4A 1VF3A 1A2JA 5F0GA 3FKFA 3UJ1A 2DJKA 3TJJA 2VCVA 4D73B 1BQ7A 3TCOA 3FZAA 2GZZA 2YCDA 5HQPA 2FNOA 4KNDA 5D8IA 6GSSA 3A5WA 3HVNA 3HJOA 5ECQB 1URMA 4XRAA 3VWVA 5KN2A 4YQVA 2R0CA 4WKWA 4HJMA 3UAPA 1W89A 4PQIA 2P31A 1M3JA 2K8VA 3E0UA 1EGOA 4F0CA 5J4UA 3QMXA 2GSTA 1Y6EA 2KP2A 5L71A 3PGTA 4K6XA 4ECCA 4DSQA 4HOJA 3MWHA 1LJRA 2OKAA 2WRTA 3GN3A 4HDEA 2DC5A 5IPHA 1B48A 2OBKA 3V1WA 2E0QA 2R0PA 4MF5A 3D4TA 1XWCA 4K5RA 2RM5A 5ECNB 4HQZA 3TJFA 1MD4A 8GSSA 3ZZXA 5DAKA 1B8XA 1ZYEA 2HI7A 1GSFA 3UARA 2YZUA 4EIPA 1J0FA 1XFLA 4KE3A 3VWWA 2CZ3A 5G5FA 3ISOA 3IOSA 3J7Yb 3ZIJA 4I2TA 2WCIA 1HNBA 3H8QA 2LKUA 4OO5A 1KNGA 1SKWB 5ECSA 3KP8A 2JSZA 4JR6A 5J3RA 3M8NA 4WR4A 4DVCA 1XVWA 3IHQA 1BYEA 1R7HA 2I1UA 3CSHA 2DKHA 1AQXA 1OE8A 3LG6A 4CY8A 2GTUA 2VOCA 1HNCA 3IC8A 3S9FA 4HU7A 2GVPA 4KF9A 2YZHA 4KCAA 2FHEA 5COHA 5AN1A 1PX6A 2RUEA 4JU5A 3EPTA 1MEKA 1V40A 3LYPA 2B5XA 2DKIA 3O3TA 1Y25A 4G19A 4F03A 3ZVJD 1F2EA 2NTOA 2R2JA 3DXBA 2X64A 3HCZA 3KIJA 2HNLA 3QAGA 1GNEA 1N8JA 3H4KA 3VLNA 3I9V2 2HZEA 4MJEA 3RHBA 4OFTA 1BX9A 1QGVA 1XWGA 5B8BA 3PPUA 5BRTA 4YH2A 1FOHA 1X5EA 1Z6NA 1ZL9A 2EIRA 5CP1A 4L8EA 3GX8A 1TK5B 5HFKA 4HU9A 2IFQB 2GT5A 1RK4A 4YQMA 3L9SA 1AW9A 5CRHA 4FO5A 1YY7A 3GL3A 1JZDA 2R5GA 1VRSD 2CVKA 2YPMA 5EPFA 1B9XC 2H1BA 4XIHA 5DALA 1USBA 4F2IA 2BJXA 11GSA 1XG8A 2LTKA 3E3EA 3F3RA 1Z7PA 4MLYA 3P2AA 2O89A 1G7EA 4TXOA 1GUMA 4O7HA 2C0DA 5G1KA 4MABA 1I5GA 1SK1A 1AAZA 1T3BA 4KW6A 2AAWA 2N5AA 4XS4A 1TRUA 4EUYA 2YJ7A 1JZRA 4HSCX 4L0UA 1PSQA 2H0GA 2YANA 2NDOA 3IAS2 3F9UA 4PURA 2MMZA 5IIZA 4NMUA 4Z7XA 4N30A 4N0VA 1OC9B 3KH7A 4ZBDA 1NHYA 2KP1A 4IBPA 3D4MA 2PWJA 5H5QA 1DE2A 2GQKA 3FR6A 4ZBAA 3TKRA 4AJ7A 1FVJA 1OE7A 1AXDA 3ZIVA 1M9BA 1PN0A 5CAXA 1UVZA 1TKDB 1VF4A 3UL3A 5F07A 2CVDA 1SKRB 2L4QA 4V1Ap 12GSA 4MCUA 1SYXA 4OFNA 4PNGA 2HRAA 5ECRB 3GURA 3Q74A 3US3A 1EOHA 4IP6A 1ERWA 4MPGA 2JACA 1GTUA 3CYNA 4K0NA 4PXOA 2PUKC 2C3TA 5GSSA 2HSYA 3IXRA 4GSNA 4ZBBA 3GNJA 4BPYA 5KN0A 2AHEA 4OFMA 4ML6A 1YEPA 5F06A 3E9JB 1K3YA 4LMVA 1ML6A 4IQAA 3ZFLA 2MZCA 1X5DA 1A24A 3ED3A 3APSA 5A5KA 4K7IA 3KMOA 5EL8A 1U6TA 2H0IA 2MMNA 3GKMA 1WMJA 4MJBA 2VLVA 4YKFA 1XWAA 4HZ2A 2B7KA 3K8NA 2NBSA 1G7OA 3R2QA 2AJQB 3F4TA 5HR1A 3C8EA 1TRVA 1AC1A 4MH3A 1WP0A 3LEFA 3BJ5A 4K7OA 5EY6A 2G2QA 2J23A 4XHMA 2DSAA 4ZXGA 3MDKA 4J2FA 1SJ6A 2K9FA 1TI3A 4OMVA 3FZ5A 5IOXA 2CVBA 5CYYA 3IA1A 1BAYA 3IHGA 4KDYA 2GDRA 4LMWA 4ECIA 2H0HA 5DCHA 1PMTA 4O32A 4EIQA 3VI7A 1HNAA 2F3MA 3UMAA 2VL2A 2KHPA 2CAIA 4WR5A 5IMZA 1U87A 17GSA 4BL7A 4V1Ag 2L5OA 2IL3A 3GUSA 2H75A 3EU3A 3EMPA 4XS1A 2A2RA 2GS3A 5DJMA 2JL4A 3HZ4A 4MA9A 2L4CA 4K2XA 1S3RA 2OA7A 5ECOB 2K18A 1K0MA 3I69A 4Z2TA 1B4QA 3ERFA 10GSA 1JZOA 1WIKA 1I9DA 1DBYA 4BVYA 5JCGA 4MDCA 1TDIA 3I6AA 2JADA 2VL2C 4RQXA 5AIVA 4NXIA 4CY6A 5B6MA 1CQHA 2X4AA 2DIYA 4AF2A 3APQA 3CQFA 1GUHA 2E2GA 4XTSA 3KXOA 1GUKA 1H4OA 5IM9A 2FWGA 3DEXA 2P5QA 1YJ6A 4CW9A 4IQ1A 1UA5A 3HJPA 1A8LA 3GH9A 4EO3A 1LU4A 5J9CA 1FO5A 1J08A 3LFLA 5D9WA 5JCUA 4IVFA 1V58A 1GNWA 4KA0A 2CV4A 3PINA 2L5LA 5EVOA 5JCWA 2VM1A 3GIXA 2J9HA 19GSA 4RI7A 1YKAA 2OJLA 2IMDA 1ILOA 2JSYA 4NV5A 3TKSA 4GTUA 4Q5NA 3Q18A 1XPVA 4A5PA 2C1YA 1SKSB 4L5OA 2LSTA 2HFDA 5D9VA 1BG5A 2OE0A 2IPAA 4V2MA 2MBSA 3CMIA 14GSA 2FCHA 1PN9A 5ECPB 4E8HA 4X4JA 2I3YA 1VGLA 2H74A 4HUAA 2X49A 1X9MB 1K0CA 3TOUA 3CRUA 4EDYA 3TKSC 4GLTA 2HZEB 3VPTA 4WF5A 1QMVA 3FMWA 4FYCA 3RHCA 4ZB8A 3IBHA 2LS5A 1FVKA 3IDVA 3HZ8A 1U3AA 7GSSA 4JZQA 2LNSA 4GCIA 2DJ0A 4WBJA 4I2UA 2R0GA 1ZYPA 2X8GA 1QXHA 2F8AA 2P0GA 2GSQA 2C0FA 4PQ1A 1A8YA 5DALB 5CNWA 1PQNA 3LJRA 3VWUA 5ABRA 5JWOB 4MZWA 1F6MC 3GHAA 3RDWA 2DLXA 1ZOFA 4TXOB 1XW9A 1YZXA 2C0EA 2OACA 3WT2A 3IE3A 3SBCA 1T8EB 1AQWA 2V32A 1MD3A 2WDUA 1PRXA 2G0FA 2JZTA 2WJUA 4XS4B 4KDUA 5IMAA 1MDJA 1JHBA 1SJZA 4FH8A 1GP1A 3VK9A 2WB9A 1MDKA 3QDNA 4AGSA 2OE1A 2KUCA 1XXUA 4HS1A 1IYIA 5ELAA 3KTBA 2B7JA 1GSDA 4BVXA 3UVTA 1KEBA 1M2DA 1SD9A 3CRTA 3HHVA 3HY2A 2LUSA 2RUFA 2YV9A 3QAVA 5FHIA 3TJKA 4HI7A 1J9BA 3MYDA 2EIQA 2AYTA 2PGTA 3UIWA 1ERTA 2C8UA 1Z3EA 4Q5FA 4ZB6A 2JZRA 3TGZA 3O6TA 4YAVA 4AJ6A 3ME7A 2B1LA 3HKRA 2A2PA 3GH6A 3DVXA 2C4JA 1F3AA 1PL2A 1TI1A 3Q19A 3Q6OA 5ECLB 4F9ZA 1EEMA 1ZMAA 4IN0A 3ZFBA 2LRCA 1TK0B 3ZMKA 3L0HA 1GSEA 2M80A 1THOA 3M1GA 1M2BA 4KDXA 2KLXA 3TOTA 1M7TA 4ILFA 1XWKA 3TB2A 1XCCA 4KAEA 3QFAC 1OYJA 2YV7A 3FR9A 3D22A 4KX4A 4FYBA 1NSWA 2X8HA 1S3DA 2QKEA 3GSTA 3I43A 3DRNA 4G0LA 1WPIA 2VLTA 4MMMA 1VF2A 4HJ2A 2B6MA 2H1DA 1EOGA 5IPGA 4IW9A 5GSTA 1ST9A 4EVMA 2QA2A 4MJCA 1XOAA 4KSMA 5IQYA 2ES7A 2M46A 3WGXA 1T4ZA 4LA1A 4F82A 2HYXA 5D96A 3JCML 2F8FA 4TR4A 5CRDA 3O76A 3VWXA 5IOWA 2IJYA 3M9JA 1F3BA 2QA1A 3RPPA 1HQOA 3G7YA 9GSSA 3CBUA 3VFIA 5A4WA 2PPTA 1ERUA 1AIUA 4BIKA 4O92A 3NIVA 3EWLA 3L4NA 1DUGA 1UN2A 3BD2A 2VCZA 5IMDA 3QOUA 2FY6A 2CA8A 2DJ1A 2K6VA 2LEGA 1KTEA 4KUNA 1PKWA 2O87A 3ZL5A 3RPNA 3DYRA 1TTZA 1PGTA 1OC8A 3PH9A 2ON7A 1PA3A 4MH2A 4G0KA 1ERVA 1FB0A 4BL7B 1YDKA 2I4AA 4XCSA 4TVEA 5INYA 2XPEA 2D2ZA 1XZOA 3A2WA 1K0NA 2DBCA 1A0RP 4TR1A 1R5AA 3FW2A 2FUG2 1VF1A 2HLSA 5ECMB 1C72A 5KOWA 4MZBA 4BVYB 3AY8A 1PFOA 4WF4A 2V1MA 1V57A 2C3QA 5HFIA 5HR2A 5IO0A 2HE3A 1GSQA 1EWXA 2PU9C 1QFNA 4GF0A 1ZYQB 3WGEA 1TXXA 3LORA 4WBRD 1NW2A 2H1GA 3DD3A 3QD9A 1TJDA 3U6VA 1EP7A 3QR6A 5G1LA 4OCEA 1E2YA 2YWNA 1WWJA 1KBNA 2LJKA 4BWSA 2N5BA 1SJIA 4NPBA 3F6DA 5LD0A 4JRRA 1T4YA 5ECHB 2L59A 2IMEA 3F6FA 2WFCA 4ECJA 5GZZB 5ENUA 4EKZA 5D9XA 2VD0A 4POBA 2UZ8A 3TKQA 3RAZA 2CX4A 5JWRB 4BA7A 3MNGA 4K0GA 2HXKA 2M72A 1K0DA 3A3TA 3HJMA 3UBLA 1EZKA 4POKA 4JR4A 1V2AA 3GFKA 3TJBA 3HDCA 5ID2A 1O81A 2HSMA 3P7XA 2A4VA 2TRXA 3NOFA 2DJJA 5IO2A 2MMOA 2DMLA 4N10A 1V9WA 1O85A 3CSIA 2O8VB 4ICYA 1GULA 3LW9A 2WS2A 2VCWA 3TKSE 1XW6A 3A5IA 1A2LA 4K7NA 3G9BA 3L9VA 2L57A 2V41A 2PBJA 1Q4JA 3SWLA 3FRCA 4N11A 4XS6A 5ECIB 1B9YC 1XBSA 2CX3A 4IHUA 1M2AA 5DCGA 2H19A 4PNFA 4IKHA 3DMLA 1RQMA 5DQYA 3UEMA 4Z2RA 1N2AA 3C71A 1HD2A 6GSVA 5HFGA 1OC3A 1THXA 4CDOA 5BMUA 1SL2B 3UOMA 3CTGA 1PX7A 3UBKA 1BJXA 1Z7RA 4PUFC 3GA4A 5A4UA 2ZUPA 5DAKB 2IMFA 3QPMA 4FIWA 4QL7A 4XRDA 4BVXB 2RLIA 3LSZA 4KB3A 1SD8A 3GTUA 1FAAA 3WT1A 1NHOA 2YP6A 5LCZA 5KN1A 1O7UA 4GXZA 2KOKA 1ZYNA 3VPQA 1QQ2A 4MPFA 3C73A 1M99A 1AQVA 3FZ4A 3EINA 4BWQA 3TKPA 1XIYA 2NPBA 2R6KA 5CO3A 2I81A 1Q98A 4J56E 4KCEA 4O5RA 3TRPA 2BMXA 3HXSA 2FD3A 2YJHA 3D6IA 4K1FA 3N9JA 2YOIA 2VIMA 4P3YB 1FHEA 2VCXA 5CRWA 2GT6A 2HT9A 5F8BA 2IN3A 1A23A 1WOUA 4O5QA 3ZMLA 4K2DA 3GKKA 4KSOA 2B5YA 1OAZA 4IGJA 3RBTA 1R4WA 1GH2A 4CHSA 3FYGA 4K9ZA 2VL9A 1K0AA 5G2ZA 2ALBA 1SYRA 5D73A 2EC4A 2F51A 4JE1A 1DSBA 1K3LA 3TRQA 3KMNA 2XC2A 3W6GA 2WGRA 2HRKA 2YN1A 3P90A 1LBKA 3DWVA 1SU9A 3GV1A 3UVHA 3WYWA 3IK9A 3FY7A 4L0WA 5DVBA 2YWIA 4Z2UA 1K0OA 1O6JA 2FA8A 2C80A 1T7PB 1GRXA 4G2EA 1ZGNA 3KP9A 3DVWA 1FW1A 3HD5A 3ME8A 4YKGA 5B8AA 2H30A 5IMFA 3DGQA 5J5NA 1GSUA 2A2SA 3ZVJA 3FK8A 4DEJA 3GSSA 5CRGA 4GQFA 3KCMA 1ZZYA 4J57E 3M0FA 2IMIA 3EMXA 4WXTA 3QAWA 1WE0A 4N0ZA 3HVXA 2RM6A 2FWFA 4V2NA 4POMA 4GSTA 4ULXA 6GSUA 2H70A 4ZIJA 4EE0A 1S3AA 5FT3A 3VURA 1WRYA 4K5SA 1U88A 2PN8A 2GGTA 4MJAA 5C04A 4TR1B 2H72A 1SK2A 2GZYA 2VUPA 3GX0A 1HYUA 4DSSA 1GTIA 4GSSA 4MF6A 1TRSA 3KJYA 2B3SA 1B4PA 4TR0A 3C1SA 3F4SA 2O7KA 4ACSA 2CAQA 4RQRA 2C3NA 2OADA 2MMAA 3TDGA 4H86A 6GSWA 2DJ3A 1G0TA 3W8SA 2REMA 2YWMA 2GQMA 3GKNA 4IELA 3BCKA 4USSA 1A2MA 1AUCA 2GZPA 3LGCA 2A4HA 5DDLA 1OKDA 1U3IA 2H6XA 3FHKA 1V98A 3ZREA 4V2LA 2H8LA 1GWCA 2FA4A 2PMTA 2AUVA 2QGVA 3IC4A 2QSIA 4TR3A 3GRXA 2E7PA 3IV4A 1M0UA 1K0BA 4LLRA 1JLWA 1CQGA 3BOAA 4ZL7A 1Z9HA 5KN3A 2FLSA 2ON5A 2WZ9A 2OE3A 5KOXA 3HVVA 2TRCP 3F4RA 1GTBA 3LYKA 2V6OA 4X1UA 4ZL9A 1TOFA 1BEDA 4I5QA 4IJIA 13GSA 2FGXA 1EV4A 3EC3A 1TW9A 1ABAA 1PL1A 2EIOA 3MAKA 1DE1A 1YKCA 6GSTA 3BBYA 3HA9A 4Q5RA 2VCTA 3A2VA 3C1RA 4GWRA 2DIZA 5ID2B 2HRNA 3L78A 5H5SA 1PD21 5HR0A 4QL9A 4ID0A 4G10A 4G9HA 1GL8A 2VAFA 4D73A 5FWGA 2K8SA 3H79A 4NV2A 1EGRA 2XPDA 4FQUA 4ZL8A 4EF0A 1GLPA 1QK8A 1Z6MA 5J41A 3GKXA 1TU7A 1O8XA 3IPZA 3GYKA 3A2XA 5E4WA 5C00A 3KTLA 1YQ1A 2LV3A 4I97A 2XHFA 5D9TA 2P5RA 4WETA 4X0XA 1M9AA 2YNXA 4LL4B 1PKZA 1XOBA 2GLRA 2ZNMA 1F9MA 3HVSA 2V2GA 3G7IA 5GAPD 4JBBA 1A0FA 3NZNA 4ZB9A 2VLUA 4TKYA 2RIIA 1NM3A 4F0BA 5LNKe 4E8EA 5ELGA 4PX1A 1SL0B 4TXVA 1JLVA 3KGKA 3IRAA 2AV4A 1X0RA 1ZCPA 3DKSA 3D21A 4I6XA 4HZ4A 4EDZA 4POLA 3HYPA 4ISDA 4NWYA 1M3IA 3IR4A 3KM6A 5GAND 2VCQA 4QQ7A 3D0ZA 2FWEA 4KGIA 3GTUB 1K3OA 4TRXA 3VI5A 1TK8B 3ZLPA 2C0GA 2V6KA 1H75A 4NHWA 3WD6A 1EV9A 2PVOC 3F0IA 1G6YA 3MIXA 2YWOA 5JWQB 5H5RA 2F9SA 4FYUA 5ECKB 1GSYA 2PVQA 4NAXA 5G30A 1YF0A 3C7MA 4AJ8A 3LQ7A 3ERGA 2I9HA 2OBIA 1S3CA 3EE2A 4Q5QA 1QUWA 3CSJA 3KH9A 3U5RE 4EXJA 4MF7A 16GSA 3FZ9A 4PUAA 2VD1A 1G6WA 3LXTA 4MNNA 6GSXA 4RUVA 5IMVA 4DSRA 3OR5A 2LJAA 2GQLA 1F37A 4IS0A 2TIRA 2HZFA 5G5EA 4EC0A 2X99A 3M9KA 3H93A 2BTOT 2H71A 3TRXA 4G0IA 3IAM2 2LNTA 4TW5A 4IJ3A 1O73A 1EP8A 3W8JA 2XBQA 4KH7A 1X9WB 3LXZA 1GLQA 1W4VA 1R5PA 2GSRA 1FG4A 4JEDA 4YAPA 1O8WA 2IFQA 3BCIA 3EURA 2JU5A 2O85A 4HEA2 4GQCA 2MBTA 1YF1A 2X8CA 4ECBA 3F8UA 4L5LA 3ZRDA 4MK3A 3TUEA 2ZCTA 3PR8A 2H1AA 1R26A 22GSA 1TU8A 5DJLA 5A4VA 3EU4A 1E6BA 4TN8A 2H6ZA 3J7Yk 2CZ2A 2L6DA 1XWBA 3MSZA 3M3MA 3APOA 1GSSA 1T00A 1X5CA 2IWTA 3F63A 2WULA 1OKTA 3QCPA 4NHZA 2R37A 2CQ9A 1UC7A 1TRWA 6GSYA 2H66A 2DMMA 4O5UA 1OC9A 2GSSA 2LJRA 1X9SB 4LL1B 1WJKA 1FB6A 4PQHA 1SK0A 2QC7A 4PGTA 2L6CA 2CT6A 3KZQA 2XBIA 4TOPA 1MDIA 2NVLA 3WGDA 5B6NA 2E2MA 3ZTLA 1JZWA 3FR3A 1ACVA 2B1KA 3L9UA 1MTCA 1XVQA 2VM2A 4IP1A 5IMCA 3GL5A 4OCFA 2PERA 4DSSB 3D5JA 1RW1A 3CXGA 1FOVA 3ERWA 3TJGA 1OVNA 2Z9SA 5DBQA 2VO4A 1ON4A 4YQUA 2JZSA 3GMFA 1IYHA 1Z5YE 4GRFA 2R4VA 4ML1A 5AIXA 3N5OA 5AISA 1EEJA 4OWYA 2B5EA 3IK7A 3R3EA 3EYTA 4PTSA 2VL3A 2R3XA 5D93A 5CREA 4OD7A 2LRNA 2DJ2A 5J9BA 5B7CA 1SL1B 4X43A
chains in the Genus database with same CATH topology
2H73A 2H6YA 2HRFA 3LWAA 3KD0A 5E59A 2H76A 3EVIA 2AB6A 5G31A 5KEJA 3FEUA 4EL1A 4ZILA 1TP9A 5HR3A 4MP4A 1YEXA 1T1VA 2IIYA 3G7JA 3QFBC 1JFUA 3ZYWA 3KEBA 3F3QA 1XW5A 2FWHA 5DQSA 2LQQA 4HQSA 4WEYA 2MYGA 2N5FA 2HSHA 2H01A 3CTFA 3P8WA 4RI6A 20GSA 2IMKA 5F05A 4MZCA 3ZITA 2LQOA 1GTAA 5AGYA 4I8BA 18GSA 2LRTA 1SENA 3DIEA 3H1NA 4K8MA 4OO4A 1VF3A 1A2JA 5F0GA 3FKFA 3UJ1A 2DJKA 3TJJA 2VCVA 4D73B 1BQ7A 3TCOA 3FZAA 2GZZA 2YCDA 5HQPA 2FNOA 4KNDA 5D8IA 6GSSA 3A5WA 3HJOA 5ECQB 1URMA 4XRAA 3VWVA 5KN2A 4YQVA 2R0CA 4WKWA 4HJMA 3UAPA 1W89A 4PQIA 2P31A 3E0UA 2K8VA 1EGOA 4F0CA 5J4UA 3QMXA 2GSTA 1Y6EA 2KP2A 5L71A 3PGTA 4K6XA 4ECCA 4DSQA 4HOJA 3MWHA 1LJRA 2OKAA 2WRTA 3GN3A 4HDEA 2DC5A 5IPHA 1B48A 2OBKA 3V1WA 2E0QA 2R0PA 4MF5A 3D4TA 1XWCA 4K5RA 2RM5A 5ECNB 4HQZA 3TJFA 1MD4A 8GSSA 3ZZXA 5DAKA 1B8XA 1ZYEA 2HI7A 1GSFA 3UARA 2YZUA 4EIPA 1J0FA 1XFLA 4KE3A 3VWWA 2CZ3A 5G5FA 3ISOA 3IOSA 3J7Yb 3ZIJA 4I2TA 2WCIA 1HNBA 3H8QA 2LKUA 4OO5A 1KNGA 1SKWB 5ECSA 3KP8A 2JSZA 4JR6A 5J3RA 3M8NA 4WR4A 4DVCA 1XVWA 3IHQA 1BYEA 1R7HA 2I1UA 3CSHA 2DKHA 1AQXA 1OE8A 3LG6A 4CY8A 2GTUA 2VOCA 1HNCA 3IC8A 3S9FA 4HU7A 2GVPA 4KF9A 2YZHA 4KCAA 2FHEA 5COHA 5AN1A 1PX6A 2RUEA 4JU5A 3EPTA 1MEKA 1V40A 3LYPA 2B5XA 2DKIA 3O3TA 1Y25A 4G19A 4F03A 3ZVJD 1F2EA 2NTOA 2R2JA 3DXBA 2X64A 3HCZA 3KIJA 2HNLA 3QAGA 1GNEA 1N8JA 3H4KA 3VLNA 3I9V2 2HZEA 4MJEA 3RHBA 4OFTA 1BX9A 1QGVA 1XWGA 5B8BA 3PPUA 5BRTA 4YH2A 1FOHA 1X5EA 1Z6NA 1ZL9A 2EIRA 5CP1A 4L8EA 3GX8A 1TK5B 5HFKA 4HU9A 2IFQB 2GT5A 1RK4A 4YQMA 3L9SA 1AW9A 5CRHA 4FO5A 1YY7A 3GL3A 1JZDA 2R5GA 1VRSD 2CVKA 2YPMA 5EPFA 1B9XC 2H1BA 4XIHA 5DALA 1USBA 4F2IA 2BJXA 11GSA 2LTKA 3E3EA 3F3RA 1Z7PA 4MLYA 3P2AA 2O89A 1G7EA 4TXOA 1GUMA 4O7HA 2C0DA 5G1KA 4MABA 1I5GA 1SK1A 1AAZA 1T3BA 4KW6A 2AAWA 2N5AA 4XS4A 1TRUA 4EUYA 2YJ7A 1JZRA 4L0UA 1PSQA 2H0GA 2YANA 2NDOA 3IAS2 3F9UA 4PURA 2MMZA 5IIZA 4NMUA 4Z7XA 4N30A 4N0VA 1OC9B 3KH7A 4ZBDA 1NHYA 2KP1A 4IBPA 3D4MA 2PWJA 5H5QA 1DE2A 2GQKA 3FR6A 4ZBAA 3TKRA 4AJ7A 1FVJA 1OE7A 1AXDA 3ZIVA 1M9BA 1PN0A 5CAXA 1UVZA 1TKDB 1VF4A 3UL3A 5F07A 2CVDA 1SKRB 2L4QA 4V1Ap 12GSA 4MCUA 1SYXA 4OFNA 4PNGA 2HRAA 5ECRB 3GURA 3Q74A 3US3A 1EOHA 4IP6A 1ERWA 4MPGA 2JACA 1GTUA 3CYNA 4K0NA 4PXOA 2PUKC 2C3TA 5GSSA 2HSYA 3IXRA 4GSNA 4ZBBA 3GNJA 4BPYA 5KN0A 2AHEA 4OFMA 4ML6A 1YEPA 5F06A 3E9JB 1K3YA 4LMVA 1ML6A 4IQAA 3ZFLA 2MZCA 1X5DA 1A24A 3ED3A 3APSA 5A5KA 4K7IA 3KMOA 5EL8A 1U6TA 2H0IA 2MMNA 3GKMA 1WMJA 4MJBA 2VLVA 4YKFA 1XWAA 4HZ2A 2B7KA 3K8NA 2NBSA 1G7OA 3R2QA 2AJQB 3F4TA 5HR1A 3C8EA 1TRVA 1AC1A 4MH3A 1WP0A 3LEFA 3BJ5A 4K7OA 5EY6A 2G2QA 2J23A 4XHMA 2DSAA 4ZXGA 3MDKA 4J2FA 1SJ6A 2K9FA 1TI3A 4OMVA 3FZ5A 5IOXA 2CVBA 5CYYA 3IA1A 1BAYA 3IHGA 4KDYA 2GDRA 4LMWA 4ECIA 2H0HA 5DCHA 1PMTA 4O32A 4EIQA 3VI7A 1HNAA 2F3MA 3UMAA 2VL2A 2KHPA 2CAIA 4WR5A 5IMZA 1U87A 17GSA 4BL7A 4V1Ag 2L5OA 2IL3A 3GUSA 2H75A 3EU3A 3EMPA 4XS1A 2A2RA 2GS3A 5DJMA 2JL4A 3HZ4A 4MA9A 2L4CA 4K2XA 2OA7A 5ECOB 2K18A 1K0MA 3I69A 4Z2TA 1B4QA 3ERFA 10GSA 1JZOA 1WIKA 1I9DA 1DBYA 4BVYA 5JCGA 4MDCA 1TDIA 3I6AA 2JADA 2VL2C 4RQXA 5AIVA 4NXIA 4CY6A 5B6MA 1CQHA 2X4AA 2DIYA 4AF2A 3APQA 1GUHA 2E2GA 4XTSA 3KXOA 1GUKA 1H4OA 5IM9A 2FWGA 3DEXA 2P5QA 1YJ6A 4CW9A 4IQ1A 1UA5A 3HJPA 1A8LA 3GH9A 4EO3A 1LU4A 5J9CA 1FO5A 1J08A 3LFLA 5D9WA 5JCUA 4IVFA 1V58A 1GNWA 4KA0A 2CV4A 3PINA 2L5LA 5EVOA 5JCWA 2VM1A 3GIXA 2J9HA 19GSA 4RI7A 1YKAA 2OJLA 2IMDA 1ILOA 2JSYA 4NV5A 3TKSA 4GTUA 4Q5NA 3Q18A 1XPVA 4A5PA 2C1YA 1SKSB 4L5OA 2LSTA 2HFDA 5D9VA 1BG5A 2OE0A 2IPAA 4V2MA 2MBSA 3CMIA 14GSA 2FCHA 1PN9A 5ECPB 4E8HA 4X4JA 2I3YA 1VGLA 2H74A 4HUAA 2X49A 1X9MB 1K0CA 3TOUA 3CRUA 4EDYA 3TKSC 4GLTA 2HZEB 3VPTA 4WF5A 1QMVA 3FMWA 4FYCA 3RHCA 4ZB8A 3IBHA 2LS5A 1FVKA 3IDVA 3HZ8A 1U3AA 7GSSA 4JZQA 2LNSA 4GCIA 2DJ0A 4WBJA 4I2UA 2R0GA 1ZYPA 2X8GA 1QXHA 2F8AA 2P0GA 2GSQA 2C0FA 4PQ1A 1A8YA 5DALB 5CNWA 1PQNA 3LJRA 3VWUA 5ABRA 5JWOB 4MZWA 1F6MC 3GHAA 3RDWA 2DLXA 1ZOFA 4TXOB 1XW9A 1YZXA 2C0EA 2OACA 3WT2A 3IE3A 3SBCA 1T8EB 1AQWA 2V32A 1MD3A 2WDUA 1PRXA 2G0FA 2JZTA 2WJUA 4XS4B 4KDUA 5IMAA 1MDJA 1JHBA 1SJZA 4FH8A 1GP1A 3VK9A 2WB9A 1MDKA 3QDNA 4AGSA 2OE1A 2KUCA 1XXUA 4HS1A 1IYIA 5ELAA 3KTBA 2B7JA 1GSDA 4BVXA 3UVTA 1KEBA 1M2DA 1SD9A 3CRTA 3HHVA 3HY2A 2LUSA 2RUFA 2YV9A 3QAVA 5FHIA 3TJKA 4HI7A 1J9BA 3MYDA 2EIQA 2AYTA 2PGTA 3UIWA 1ERTA 2C8UA 1Z3EA 4Q5FA 4ZB6A 2JZRA 3TGZA 3O6TA 4YAVA 4AJ6A 3ME7A 2B1LA 3HKRA 2A2PA 3GH6A 3DVXA 2C4JA 1F3AA 1PL2A 1TI1A 3Q19A 3Q6OA 5ECLB 4F9ZA 1EEMA 1ZMAA 4IN0A 3ZFBA 2LRCA 1TK0B 3ZMKA 3L0HA 1GSEA 2M80A 1THOA 3M1GA 1M2BA 4KDXA 2KLXA 3TOTA 1M7TA 4ILFA 1XWKA 3TB2A 1XCCA 4KAEA 3QFAC 1OYJA 2YV7A 3FR9A 3D22A 4KX4A 4FYBA 1NSWA 2X8HA 1S3DA 2QKEA 3GSTA 3I43A 3DRNA 4G0LA 1WPIA 2VLTA 4MMMA 1VF2A 4HJ2A 2B6MA 2H1DA 1EOGA 5IPGA 4IW9A 5GSTA 1ST9A 4EVMA 2QA2A 4MJCA 1XOAA 4KSMA 5IQYA 2ES7A 2M46A 3WGXA 1T4ZA 4LA1A 4F82A 2HYXA 5D96A 3JCML 2F8FA 4TR4A 5CRDA 3O76A 3VWXA 5IOWA 2IJYA 3M9JA 1F3BA 2QA1A 3RPPA 1HQOA 3G7YA 9GSSA 3CBUA 3VFIA 5A4WA 2PPTA 1ERUA 1AIUA 4O92A 3NIVA 3EWLA 3L4NA 1DUGA 1UN2A 3BD2A 2VCZA 5IMDA 3QOUA 2FY6A 2CA8A 2DJ1A 2K6VA 2LEGA 1KTEA 4KUNA 1PKWA 2O87A 3ZL5A 3RPNA 3DYRA 1TTZA 1PGTA 1OC8A 3PH9A 2ON7A 1PA3A 4MH2A 4G0KA 1ERVA 1FB0A 4BL7B 1YDKA 2I4AA 4XCSA 4TVEA 5INYA 2XPEA 2D2ZA 1XZOA 3A2WA 1K0NA 2DBCA 1A0RP 4TR1A 1R5AA 3FW2A 2FUG2 1VF1A 2HLSA 5ECMB 1C72A 5KOWA 4MZBA 4BVYB 3AY8A 4WF4A 2V1MA 1V57A 2C3QA 5HFIA 5HR2A 5IO0A 2HE3A 1GSQA 1EWXA 2PU9C 1QFNA 4GF0A 1ZYQB 3WGEA 1TXXA 3LORA 4WBRD 1NW2A 2H1GA 3DD3A 3QD9A 1TJDA 3U6VA 1EP7A 3QR6A 5G1LA 4OCEA 1E2YA 2YWNA 1WWJA 1KBNA 2LJKA 4BWSA 2N5BA 1SJIA 4NPBA 3F6DA 5LD0A 4JRRA 1T4YA 5ECHB 2L59A 2IMEA 3F6FA 2WFCA 4ECJA 5GZZB 5ENUA 4EKZA 5D9XA 2VD0A 4POBA 2UZ8A 3TKQA 3RAZA 2CX4A 5JWRB 4BA7A 3MNGA 4K0GA 2HXKA 2M72A 1K0DA 3A3TA 3HJMA 3UBLA 1EZKA 4POKA 4JR4A 1V2AA 3GFKA 3TJBA 3HDCA 5ID2A 1O81A 2HSMA 3P7XA 2A4VA 2TRXA 3NOFA 2DJJA 5IO2A 2MMOA 2DMLA 4N10A 1V9WA 1O85A 3CSIA 2O8VB 4ICYA 1GULA 3LW9A 2WS2A 2VCWA 3TKSE 1XW6A 3A5IA 1A2LA 4K7NA 3G9BA 3L9VA 2L57A 2V41A 2PBJA 1Q4JA 3SWLA 3FRCA 4N11A 4XS6A 5ECIB 1B9YC 1XBSA 2CX3A 4IHUA 1M2AA 5DCGA 2H19A 4PNFA 4IKHA 3DMLA 1RQMA 5DQYA 3UEMA 4Z2RA 1N2AA 3C71A 1HD2A 6GSVA 5HFGA 1OC3A 1THXA 4CDOA 5BMUA 1SL2B 3UOMA 3CTGA 1PX7A 3UBKA 1BJXA 1Z7RA 4PUFC 3GA4A 5A4UA 2ZUPA 5DAKB 2IMFA 3QPMA 4FIWA 4QL7A 4XRDA 4BVXB 2RLIA 3LSZA 4KB3A 1SD8A 3GTUA 1FAAA 3WT1A 1NHOA 2YP6A 5LCZA 5KN1A 1O7UA 4GXZA 2KOKA 1ZYNA 3VPQA 1QQ2A 4MPFA 3C73A 1M99A 1AQVA 3FZ4A 3EINA 4BWQA 3TKPA 1XIYA 2NPBA 2R6KA 5CO3A 2I81A 1Q98A 4J56E 4KCEA 4O5RA 3TRPA 2BMXA 3HXSA 2FD3A 2YJHA 3D6IA 4K1FA 3N9JA 2YOIA 2VIMA 4P3YB 1FHEA 2VCXA 5CRWA 2GT6A 2HT9A 5F8BA 2IN3A 1A23A 1WOUA 4O5QA 3ZMLA 4K2DA 3GKKA 4KSOA 2B5YA 1OAZA 4IGJA 3RBTA 1R4WA 1GH2A 4CHSA 3FYGA 4K9ZA 2VL9A 1K0AA 5G2ZA 2ALBA 1SYRA 5D73A 2EC4A 2F51A 4JE1A 1DSBA 1K3LA 3TRQA 3KMNA 2XC2A 3W6GA 2WGRA 2HRKA 2YN1A 3P90A 1LBKA 3DWVA 1SU9A 3GV1A 3UVHA 3WYWA 3IK9A 3FY7A 4L0WA 5DVBA 2YWIA 4Z2UA 1K0OA 1O6JA 2FA8A 2C80A 1T7PB 1GRXA 4G2EA 1ZGNA 3KP9A 3DVWA 1FW1A 3HD5A 3ME8A 4YKGA 5B8AA 2H30A 5IMFA 3DGQA 5J5NA 1GSUA 2A2SA 3ZVJA 3FK8A 4DEJA 3GSSA 5CRGA 4GQFA 3KCMA 1ZZYA 4J57E 3M0FA 2IMIA 3EMXA 4WXTA 3QAWA 1WE0A 4N0ZA 3HVXA 2RM6A 2FWFA 4V2NA 4POMA 4GSTA 4ULXA 6GSUA 2H70A 4ZIJA 4EE0A 1S3AA 5FT3A 3VURA 1WRYA 4K5SA 1U88A 2PN8A 2GGTA 4MJAA 5C04A 4TR1B 2H72A 1SK2A 2GZYA 2VUPA 3GX0A 1HYUA 4DSSA 1GTIA 4GSSA 4MF6A 1TRSA 3KJYA 2B3SA 1B4PA 4TR0A 3C1SA 3F4SA 2O7KA 4ACSA 2CAQA 4RQRA 2C3NA 2OADA 2MMAA 3TDGA 4H86A 6GSWA 2DJ3A 1G0TA 3W8SA 2REMA 2YWMA 2GQMA 3GKNA 4IELA 3BCKA 4USSA 1A2MA 1AUCA 2GZPA 3LGCA 2A4HA 5DDLA 1OKDA 1U3IA 2H6XA 3FHKA 1V98A 3ZREA 4V2LA 2H8LA 1GWCA 2FA4A 2PMTA 2AUVA 2QGVA 3IC4A 2QSIA 4TR3A 3GRXA 2E7PA 3IV4A 1M0UA 1K0BA 4LLRA 1JLWA 1CQGA 3BOAA 4ZL7A 1Z9HA 5KN3A 2FLSA 2ON5A 2WZ9A 2OE3A 5KOXA 3HVVA 2TRCP 3F4RA 1GTBA 3LYKA 2V6OA 4X1UA 4ZL9A 1TOFA 1BEDA 4I5QA 4IJIA 13GSA 2FGXA 1EV4A 3EC3A 1TW9A 1ABAA 1PL1A 2EIOA 3MAKA 1DE1A 1YKCA 6GSTA 3BBYA 3HA9A 4Q5RA 2VCTA 3A2VA 3C1RA 4GWRA 2DIZA 5ID2B 2HRNA 3L78A 5H5SA 1PD21 5HR0A 4QL9A 4ID0A 4G10A 4G9HA 1GL8A 2VAFA 4D73A 5FWGA 2K8SA 3H79A 4NV2A 1EGRA 2XPDA 4FQUA 4ZL8A 4EF0A 1GLPA 1QK8A 1Z6MA 5J41A 3GKXA 1TU7A 1O8XA 3IPZA 3GYKA 3A2XA 5E4WA 5C00A 3KTLA 1YQ1A 2LV3A 4I97A 2XHFA 5D9TA 2P5RA 4WETA 4X0XA 1M9AA 2YNXA 4LL4B 1PKZA 1XOBA 2GLRA 2ZNMA 1F9MA 3HVSA 2V2GA 3G7IA 5GAPD 4JBBA 1A0FA 3NZNA 4ZB9A 2VLUA 4TKYA 2RIIA 1NM3A 4F0BA 5LNKe 4E8EA 5ELGA 4PX1A 1SL0B 4TXVA 1JLVA 3KGKA 3IRAA 2AV4A 1X0RA 1ZCPA 3DKSA 3D21A 4I6XA 4HZ4A 4EDZA 4POLA 3HYPA 4ISDA 4NWYA 3IR4A 3KM6A 5GAND 2VCQA 4QQ7A 3D0ZA 2FWEA 4KGIA 3GTUB 1K3OA 4TRXA 3VI5A 1TK8B 3ZLPA 2C0GA 2V6KA 1H75A 4NHWA 3WD6A 1EV9A 2PVOC 3F0IA 1G6YA 3MIXA 2YWOA 5JWQB 5H5RA 2F9SA 4FYUA 5ECKB 1GSYA 2PVQA 4NAXA 5G30A 1YF0A 3C7MA 4AJ8A 3LQ7A 3ERGA 2I9HA 2OBIA 1S3CA 3EE2A 4Q5QA 1QUWA 3CSJA 3KH9A 3U5RE 4EXJA 4MF7A 16GSA 3FZ9A 4PUAA 2VD1A 1G6WA 3LXTA 4MNNA 6GSXA 4RUVA 5IMVA 4DSRA 3OR5A 2LJAA 2GQLA 1F37A 4IS0A 2TIRA 2HZFA 5G5EA 4EC0A 2X99A 3M9KA 3H93A 2BTOT 2H71A 3TRXA 4G0IA 3IAM2 2LNTA 4TW5A 4IJ3A 1O73A 1EP8A 3W8JA 2XBQA 4KH7A 1X9WB 3LXZA 1GLQA 1W4VA 1R5PA 2GSRA 1FG4A 4JEDA 4YAPA 1O8WA 2IFQA 3BCIA 3EURA 2JU5A 2O85A 4HEA2 4GQCA 2MBTA 1YF1A 2X8CA 4ECBA 3F8UA 4L5LA 3ZRDA 4MK3A 3TUEA 2ZCTA 3PR8A 2H1AA 1R26A 22GSA 1TU8A 5DJLA 5A4VA 3EU4A 1E6BA 4TN8A 2H6ZA 3J7Yk 2CZ2A 2L6DA 1XWBA 3MSZA 3M3MA 3APOA 1GSSA 1T00A 1X5CA 2IWTA 3F63A 2WULA 1OKTA 3QCPA 4NHZA 2R37A 2CQ9A 1UC7A 1TRWA 6GSYA 2H66A 2DMMA 4O5UA 1OC9A 2GSSA 2LJRA 1X9SB 4LL1B 1WJKA 1FB6A 4PQHA 1SK0A 2QC7A 4PGTA 2L6CA 2CT6A 3KZQA 2XBIA 4TOPA 1MDIA 2NVLA 3WGDA 5B6NA 2E2MA 3ZTLA 1JZWA 3FR3A 1ACVA 2B1KA 3L9UA 1MTCA 1XVQA 2VM2A 4IP1A 5IMCA 3GL5A 4OCFA 2PERA 4DSSB 3D5JA 1RW1A 3CXGA 1FOVA 3ERWA 3TJGA 1OVNA 2Z9SA 5DBQA 2VO4A 1ON4A 4YQUA 2JZSA 3GMFA 1IYHA 1Z5YE 4GRFA 2R4VA 4ML1A 5AIXA 3N5OA 5AISA 1EEJA 4OWYA 2B5EA 3IK7A 3R3EA 3EYTA 4PTSA 2VL3A 2R3XA 5D93A 5CREA 4OD7A 2LRNA 2DJ2A 5J9BA 5B7CA 1SL1B 4X43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H73 A;  2H6Y A;  2HRF A;  3LWA A;  3KD0 A;  5E59 A;  2H76 A;  3EVI A;  2AB6 A;  5G31 A;  5KEJ A;  3FEU A;  4EL1 A;  4ZIL A;  1TP9 A;  5HR3 A;  4MP4 A;  1YEX A;  1T1V A;  2IIY A;  3G7J A;  3QFB C;  1JFU A;  3ZYW A;  3KEB A;  3F3Q A;  1XW5 A;  2FWH A;  5DQS A;  2LQQ A;  4HQS A;  4WEY A;  2MYG A;  2N5F A;  2HSH A;  2H01 A;  3CTF A;  3P8W A;  4RI6 A;  20GS A;  2IMK A;  5F05 A;  4MZC A;  3ZIT A;  2LQO A;  1GTA A;  5AGY A;  4I8B A;  18GS A;  2LRT A;  1SEN A;  3DIE A;  3H1N A;  4K8M A;  4OO4 A;  1VF3 A;  1A2J A;  5F0G A;  3FKF A;  3UJ1 A;  2DJK A;  3TJJ A;  2VCV A;  4D73 B;  1BQ7 A;  3TCO A;  3FZA A;  2GZZ A;  2YCD A;  5HQP A;  2FNO A;  4KND A;  5D8I A;  6GSS A;  3A5W A;  3HJO A;  5ECQ B;  1URM A;  4XRA A;  3VWV A;  5KN2 A;  4YQV A;  4WKW A;  4HJM A;  3UAP A;  1W89 A;  4PQI A;  2P31 A;  3E0U A;  2K8V A;  1EGO A;  4F0C A;  5J4U A;  3QMX A;  2GST A;  1Y6E A;  2KP2 A;  5L71 A;  3PGT A;  4K6X A;  4ECC A;  4DSQ A;  4HOJ A;  3MWH A;  1LJR A;  2OKA A;  2WRT A;  3GN3 A;  4HDE A;  2DC5 A;  5IPH A;  1B48 A;  2OBK A;  3V1W A;  2E0Q A;  4MF5 A;  3D4T A;  1XWC A;  2RM5 A;  5ECN B;  4HQZ A;  3TJF A;  1MD4 A;  8GSS A;  3ZZX A;  5DAK A;  1B8X A;  1ZYE A;  2HI7 A;  1GSF A;  3UAR A;  2YZU A;  1J0F A;  1XFL A;  4KE3 A;  3VWW A;  2CZ3 A;  5G5F A;  3ISO A;  3IOS A;  3J7Y b;  3ZIJ A;  4I2T A;  2WCI A;  1HNB A;  3H8Q A;  2LKU A;  4OO5 A;  1KNG A;  1SKW B;  5ECS A;  3KP8 A;  2JSZ A;  4JR6 A;  5J3R A;  3M8N A;  4WR4 A;  4DVC A;  1XVW A;  3IHQ A;  1BYE A;  1R7H A;  2I1U A;  3CSH A;  1AQX A;  1OE8 A;  3LG6 A;  2GTU A;  2VOC A;  1HNC A;  3S9F A;  4HU7 A;  2GVP A;  2YZH A;  4KCA A;  2FHE A;  5COH A;  5AN1 A;  1PX6 A;  2RUE A;  4JU5 A;  1MEK A;  1V40 A;  3LYP A;  2B5X A;  3O3T A;  1Y25 A;  4G19 A;  4F03 A;  3ZVJ D;  1F2E A;  2NTO A;  2R2J A;  3DXB A;  2X64 A;  3HCZ A;  3KIJ A;  2HNL A;  3QAG A;  1GNE A;  1N8J A;  3H4K A;  3VLN A;  3I9V 2;  2HZE A;  4MJE A;  3RHB A;  4OFT A;  1BX9 A;  1QGV A;  1XWG A;  5B8B A;  4YH2 A;  1X5E A;  1Z6N A;  1ZL9 A;  2EIR A;  5CP1 A;  4L8E A;  3GX8 A;  1TK5 B;  5HFK A;  4HU9 A;  2IFQ B;  2GT5 A;  1RK4 A;  4YQM A;  3L9S A;  1AW9 A;  5CRH A;  4FO5 A;  1YY7 A;  3GL3 A;  1JZD A;  2R5G A;  1VRS D;  2CVK A;  2YPM A;  5EPF A;  1B9X C;  2H1B A;  4XIH A;  5DAL A;  1USB A;  4F2I A;  2BJX A;  11GS A;  2LTK A;  3E3E A;  3F3R A;  1Z7P A;  4MLY A;  3P2A A;  2O89 A;  1G7E A;  4TXO A;  1GUM A;  4O7H A;  2C0D A;  5G1K A;  4MAB A;  1I5G A;  1SK1 A;  1AAZ A;  1T3B A;  4KW6 A;  2AAW A;  2N5A A;  4XS4 A;  1TRU A;  4EUY A;  2YJ7 A;  1JZR A;  4L0U A;  1PSQ A;  2H0G A;  2YAN A;  2NDO A;  3IAS 2;  3F9U A;  4PUR A;  2MMZ A;  5IIZ A;  4NMU A;  4Z7X A;  4N30 A;  4N0V A;  1OC9 B;  3KH7 A;  4ZBD A;  1NHY A;  2KP1 A;  4IBP A;  3D4M A;  2PWJ A;  5H5Q A;  1DE2 A;  2GQK A;  3FR6 A;  4ZBA A;  3TKR A;  4AJ7 A;  1FVJ A;  1OE7 A;  1AXD A;  3ZIV A;  1M9B A;  5CAX A;  1UVZ A;  1TKD B;  1VF4 A;  3UL3 A;  5F07 A;  2CVD A;  1SKR B;  2L4Q A;  4V1A p;  12GS A;  4MCU A;  1SYX A;  4OFN A;  4PNG A;  5ECR B;  3GUR A;  3Q74 A;  3US3 A;  1EOH A;  4IP6 A;  1ERW A;  4MPG A;  2JAC A;  1GTU A;  3CYN A;  4K0N A;  4PXO A;  2PUK C;  2C3T A;  5GSS A;  2HSY A;  3IXR A;  4GSN A;  4ZBB A;  3GNJ A;  4BPY A;  5KN0 A;  2AHE A;  4OFM A;  4ML6 A;  1YEP A;  5F06 A;  3E9J B;  1K3Y A;  4LMV A;  1ML6 A;  4IQA A;  3ZFL A;  2MZC A;  1X5D A;  1A24 A;  3ED3 A;  3APS A;  5A5K A;  4K7I A;  3KMO A;  5EL8 A;  1U6T A;  2H0I A;  2MMN A;  3GKM A;  1WMJ A;  4MJB A;  2VLV A;  1XWA A;  4HZ2 A;  2B7K A;  3K8N A;  2NBS A;  1G7O A;  3R2Q A;  2AJQ B;  3F4T A;  5HR1 A;  3C8E A;  1TRV A;  1AC1 A;  4MH3 A;  1WP0 A;  3LEF A;  3BJ5 A;  4K7O A;  5EY6 A;  2G2Q A;  2J23 A;  4XHM A;  2DSA A;  4ZXG A;  3MDK A;  4J2F A;  1SJ6 A;  2K9F A;  1TI3 A;  4OMV A;  3FZ5 A;  5IOX A;  2CVB A;  5CYY A;  3IA1 A;  1BAY A;  4KDY A;  2GDR A;  4LMW A;  4ECI A;  2H0H A;  5DCH A;  1PMT A;  4O32 A;  3VI7 A;  1HNA A;  2F3M A;  3UMA A;  2VL2 A;  2KHP A;  2CAI A;  4WR5 A;  5IMZ A;  1U87 A;  17GS A;  4BL7 A;  4V1A g;  2L5O A;  2IL3 A;  3GUS A;  2H75 A;  3EU3 A;  3EMP A;  4XS1 A;  2A2R A;  2GS3 A;  5DJM A;  2JL4 A;  3HZ4 A;  4MA9 A;  2L4C A;  2OA7 A;  5ECO B;  2K18 A;  1K0M A;  3I69 A;  1B4Q A;  3ERF A;  10GS A;  1JZO A;  1WIK A;  1I9D A;  1DBY A;  4BVY A;  5JCG A;  4MDC A;  1TDI A;  3I6A A;  2JAD A;  2VL2 C;  4RQX A;  5AIV A;  4NXI A;  5B6M A;  1CQH A;  2DIY A;  4AF2 A;  3APQ A;  1GUH A;  2E2G A;  4XTS A;  3KXO A;  1GUK A;  1H4O A;  5IM9 A;  2FWG A;  3DEX A;  2P5Q A;  1YJ6 A;  4CW9 A;  4IQ1 A;  1UA5 A;  3HJP A;  1A8L A;  3GH9 A;  4EO3 A;  1LU4 A;  5J9C A;  1FO5 A;  1J08 A;  3LFL A;  5D9W A;  5JCU A;  4IVF A;  1V58 A;  1GNW A;  4KA0 A;  2CV4 A;  3PIN A;  2L5L A;  5EVO A;  5JCW A;  2VM1 A;  3GIX A;  2J9H A;  19GS A;  4RI7 A;  1YKA A;  2OJL A;  2IMD A;  1ILO A;  2JSY A;  4NV5 A;  3TKS A;  4GTU A;  4Q5N A;  3Q18 A;  1XPV A;  2C1Y A;  1SKS B;  4L5O A;  2LST A;  2HFD A;  5D9V A;  1BG5 A;  2OE0 A;  2IPA A;  4V2M A;  2MBS A;  3CMI A;  14GS A;  2FCH A;  1PN9 A;  5ECP B;  4E8H A;  2I3Y A;  1VGL A;  2H74 A;  4HUA A;  1X9M B;  1K0C A;  3TOU A;  3CRU A;  4EDY A;  3TKS C;  4GLT A;  2HZE B;  3VPT A;  4WF5 A;  1QMV A;  4FYC A;  3RHC A;  4ZB8 A;  3IBH A;  2LS5 A;  1FVK A;  3IDV A;  3HZ8 A;  1U3A A;  7GSS A;  4JZQ A;  2LNS A;  4GCI A;  2DJ0 A;  4WBJ A;  4I2U A;  2X8G A;  1QXH A;  2F8A A;  2P0G A;  2GSQ A;  2C0F A;  4PQ1 A;  1A8Y A;  5DAL B;  5CNW A;  1PQN A;  3LJR A;  3VWU A;  5ABR A;  5JWO B;  4MZW A;  1F6M C;  3GHA A;  3RDW A;  2DLX A;  1ZOF A;  4TXO B;  1XW9 A;  1YZX A;  2C0E A;  2OAC A;  3WT2 A;  3IE3 A;  3SBC A;  1T8E B;  1AQW A;  2V32 A;  1MD3 A;  2WDU A;  1PRX A;  2G0F A;  2JZT A;  2WJU A;  4XS4 B;  4KDU A;  5IMA A;  1MDJ A;  1JHB A;  1SJZ A;  4FH8 A;  1GP1 A;  3VK9 A;  2WB9 A;  1MDK A;  3QDN A;  4AGS A;  2OE1 A;  2KUC A;  1XXU A;  4HS1 A;  1IYI A;  5ELA A;  3KTB A;  2B7J A;  1GSD A;  4BVX A;  3UVT A;  1KEB A;  1M2D A;  1SD9 A;  3CRT A;  3HHV A;  3HY2 A;  2LUS A;  2RUF A;  2YV9 A;  3QAV A;  5FHI A;  3TJK A;  4HI7 A;  1J9B A;  2EIQ A;  2AYT A;  2PGT A;  3UIW A;  1ERT A;  2C8U A;  1Z3E A;  4Q5F A;  4ZB6 A;  2JZR A;  3TGZ A;  3O6T A;  4YAV A;  4AJ6 A;  3ME7 A;  2B1L A;  3HKR A;  3GH6 A;  3DVX A;  2C4J A;  1F3A A;  1PL2 A;  1TI1 A;  3Q19 A;  3Q6O A;  5ECL B;  4F9Z A;  1EEM A;  1ZMA A;  4IN0 A;  3ZFB A;  2LRC A;  1TK0 B;  3ZMK A;  3L0H A;  1GSE A;  2M80 A;  1THO A;  3M1G A;  1M2B A;  4KDX A;  2KLX A;  3TOT A;  1M7T A;  4ILF A;  1XWK A;  3TB2 A;  1XCC A;  4KAE A;  3QFA C;  1OYJ A;  2YV7 A;  3FR9 A;  3D22 A;  4KX4 A;  4FYB A;  1NSW A;  2X8H A;  1S3D A;  2QKE A;  3GST A;  3I43 A;  3DRN A;  1WPI A;  2VLT A;  4MMM A;  1VF2 A;  4HJ2 A;  2B6M A;  2H1D A;  1EOG A;  5IPG A;  4IW9 A;  5GST A;  1ST9 A;  4EVM A;  4MJC A;  1XOA A;  4KSM A;  5IQY A;  2ES7 A;  2M46 A;  3WGX A;  1T4Z A;  4LA1 A;  4F82 A;  2HYX A;  5D96 A;  3JCM L;  2F8F A;  4TR4 A;  5CRD A;  3O76 A;  3VWX A;  5IOW A;  2IJY A;  3M9J A;  1F3B A;  3RPP A;  1HQO A;  3G7Y A;  9GSS A;  3CBU A;  3VFI A;  5A4W A;  2PPT A;  1ERU A;  1AIU A;  4O92 A;  3NIV A;  3EWL A;  3L4N A;  1DUG A;  1UN2 A;  3BD2 A;  2VCZ A;  5IMD A;  3QOU A;  2FY6 A;  2CA8 A;  2DJ1 A;  2K6V A;  2LEG A;  1KTE A;  4KUN A;  1PKW A;  2O87 A;  3ZL5 A;  3RPN A;  3DYR A;  1TTZ A;  1PGT A;  1OC8 A;  3PH9 A;  2ON7 A;  1PA3 A;  4MH2 A;  1ERV A;  1FB0 A;  1YDK A;  2I4A A;  4XCS A;  4TVE A;  5INY A;  2XPE A;  2D2Z A;  1XZO A;  3A2W A;  1K0N A;  2DBC A;  1A0R P;  4TR1 A;  1R5A A;  3FW2 A;  2FUG 2;  1VF1 A;  2HLS A;  5ECM B;  1C72 A;  4MZB A;  3AY8 A;  4WF4 A;  2V1M A;  1V57 A;  2C3Q A;  5HFI A;  5HR2 A;  5IO0 A;  2HE3 A;  1GSQ A;  1EWX A;  2PU9 C;  1QFN A;  4GF0 A;  1ZYQ B;  3WGE A;  1TXX A;  3LOR A;  4WBR D;  1NW2 A;  2H1G A;  3DD3 A;  3QD9 A;  1TJD A;  3U6V A;  1EP7 A;  3QR6 A;  5G1L A;  4OCE A;  1E2Y A;  2YWN A;  1WWJ A;  1KBN A;  2LJK A;  4BWS A;  2N5B A;  1SJI A;  4NPB A;  3F6D A;  5LD0 A;  4JRR A;  1T4Y A;  5ECH B;  2L59 A;  2IME A;  3F6F A;  2WFC A;  4ECJ A;  5GZZ B;  5ENU A;  4EKZ A;  5D9X A;  2VD0 A;  4POB A;  3TKQ A;  3RAZ A;  2CX4 A;  5JWR B;  4BA7 A;  3MNG A;  4K0G A;  2HXK A;  2M72 A;  1K0D A;  3A3T A;  3HJM A;  3UBL A;  1EZK A;  4POK A;  4JR4 A;  1V2A A;  3GFK A;  3TJB A;  3HDC A;  5ID2 A;  1O81 A;  3P7X A;  2A4V A;  2TRX A;  3NOF A;  2DJJ A;  5IO2 A;  2MMO A;  2DML A;  4N10 A;  1V9W A;  1O85 A;  3CSI A;  2O8V B;  1GUL A;  2WS2 A;  2VCW A;  3TKS E;  1XW6 A;  1A2L A;  4K7N A;  3G9B A;  3L9V A;  2L57 A;  2V41 A;  2PBJ A;  1Q4J A;  3SWL A;  3FRC A;  4N11 A;  4XS6 A;  5ECI B;  1B9Y C;  1XBS A;  2CX3 A;  4IHU A;  1M2A A;  5DCG A;  2H19 A;  4PNF A;  4IKH A;  3DML A;  1RQM A;  5DQY A;  3UEM A;  1N2A A;  3C71 A;  1HD2 A;  6GSV A;  5HFG A;  1OC3 A;  1THX A;  4CDO A;  1SL2 B;  3UOM A;  3CTG A;  1PX7 A;  3UBK A;  1BJX A;  1Z7R A;  4PUF C;  3GA4 A;  5A4U A;  2ZUP A;  5DAK B;  2IMF A;  3QPM A;  4FIW A;  4QL7 A;  4XRD A;  2RLI A;  3LSZ A;  4KB3 A;  1SD8 A;  3GTU A;  1FAA A;  3WT1 A;  1NHO A;  2YP6 A;  5LCZ A;  5KN1 A;  1O7U A;  4GXZ A;  2KOK A;  3VPQ A;  1QQ2 A;  4MPF A;  3C73 A;  1M99 A;  1AQV A;  3FZ4 A;  3EIN A;  4BWQ A;  3TKP A;  1XIY A;  2NPB A;  2R6K A;  5CO3 A;  2I81 A;  1Q98 A;  4J56 E;  4KCE A;  4O5R A;  3TRP A;  2BMX A;  3HXS A;  2FD3 A;  2YJH A;  3D6I A;  4K1F A;  3N9J A;  2YOI A;  2VIM A;  4P3Y B;  1FHE A;  2VCX A;  5CRW A;  2GT6 A;  2HT9 A;  5F8B A;  2IN3 A;  1A23 A;  1WOU A;  3ZML A;  4K2D A;  3GKK A;  4KSO A;  2B5Y A;  1OAZ A;  4IGJ A;  3RBT A;  1R4W A;  1GH2 A;  4CHS A;  3FYG A;  4K9Z A;  2VL9 A;  1K0A A;  5G2Z A;  2ALB A;  1SYR A;  5D73 A;  2EC4 A;  2F51 A;  4JE1 A;  1DSB A;  1K3L A;  3TRQ A;  3KMN A;  2XC2 A;  3W6G A;  2WGR A;  2YN1 A;  3P90 A;  1LBK A;  3DWV A;  1SU9 A;  3GV1 A;  3UVH A;  3WYW A;  3IK9 A;  3FY7 A;  4L0W A;  5DVB A;  2YWI A;  1K0O A;  1O6J A;  2FA8 A;  2C80 A;  1T7P B;  1GRX A;  4G2E A;  1ZGN A;  3KP9 A;  3DVW A;  1FW1 A;  3HD5 A;  3ME8 A;  5B8A A;  2H30 A;  5IMF A;  3DGQ A;  5J5N A;  1GSU A;  2A2S A;  3ZVJ A;  3FK8 A;  4DEJ A;  3GSS A;  5CRG A;  4GQF A;  3KCM A;  1ZZY A;  4J57 E;  3M0F A;  2IMI A;  3EMX A;  4WXT A;  3QAW A;  1WE0 A;  4N0Z A;  3HVX A;  2RM6 A;  2FWF A;  4V2N A;  4POM A;  4GST A;  4ULX A;  6GSU A;  2H70 A;  4ZIJ A;  4EE0 A;  1S3A A;  5FT3 A;  3VUR A;  1WRY A;  1U88 A;  2PN8 A;  2GGT A;  4MJA A;  5C04 A;  4TR1 B;  2H72 A;  1SK2 A;  2GZY A;  2VUP A;  3GX0 A;  1HYU A;  4DSS A;  1GTI A;  4GSS A;  4MF6 A;  1TRS A;  3KJY A;  2B3S A;  1B4P A;  4TR0 A;  3C1S A;  3F4S A;  2O7K A;  4ACS A;  2CAQ A;  4RQR A;  2C3N A;  2OAD A;  2MMA A;  3TDG A;  4H86 A;  6GSW A;  2DJ3 A;  1G0T A;  3W8S A;  2REM A;  2YWM A;  2GQM A;  3GKN A;  4IEL A;  3BCK A;  1A2M A;  1AUC A;  2GZP A;  3LGC A;  5DDL A;  1OKD A;  1U3I A;  2H6X A;  3FHK A;  1V98 A;  3ZRE A;  4V2L A;  2H8L A;  1GWC A;  2FA4 A;  2PMT A;  2AUV A;  2QGV A;  3IC4 A;  2QSI A;  4TR3 A;  3GRX A;  2E7P A;  3IV4 A;  1M0U A;  1K0B A;  4LLR A;  1JLW A;  1CQG A;  3BOA A;  4ZL7 A;  1Z9H A;  5KN3 A;  2FLS A;  2ON5 A;  2WZ9 A;  2OE3 A;  3HVV A;  2TRC P;  3F4R A;  1GTB A;  3LYK A;  2V6O A;  4X1U A;  4ZL9 A;  1TOF A;  1BED A;  4I5Q A;  4IJI A;  13GS A;  2FGX A;  1EV4 A;  3EC3 A;  1TW9 A;  1ABA A;  1PL1 A;  2EIO A;  3MAK A;  1DE1 A;  1YKC A;  6GST A;  3BBY A;  3HA9 A;  4Q5R A;  2VCT A;  3A2V A;  3C1R A;  4GWR A;  2DIZ A;  5ID2 B;  2HRN A;  3L78 A;  5H5S A;  1PD2 1;  5HR0 A;  4QL9 A;  4ID0 A;  4G10 A;  4G9H A;  1GL8 A;  2VAF A;  4D73 A;  5FWG A;  2K8S A;  3H79 A;  4NV2 A;  1EGR A;  2XPD A;  4ZL8 A;  4EF0 A;  1GLP A;  1QK8 A;  1Z6M A;  5J41 A;  3GKX A;  1TU7 A;  1O8X A;  3IPZ A;  3GYK A;  3A2X A;  5E4W A;  5C00 A;  3KTL A;  1YQ1 A;  2LV3 A;  4I97 A;  2XHF A;  5D9T A;  2P5R A;  4WET A;  4X0X A;  1M9A A;  2YNX A;  4LL4 B;  1PKZ A;  1XOB A;  2GLR A;  2ZNM A;  1F9M A;  3HVS A;  2V2G A;  3G7I A;  5GAP D;  4JBB A;  1A0F A;  3NZN A;  4ZB9 A;  2VLU A;  4TKY A;  2RII A;  1NM3 A;  4F0B A;  5LNK e;  4E8E A;  5ELG A;  4PX1 A;  1SL0 B;  4TXV A;  1JLV A;  3KGK A;  3IRA A;  2AV4 A;  1X0R A;  1ZCP A;  3DKS A;  3D21 A;  4I6X A;  4HZ4 A;  4EDZ A;  4POL A;  3HYP A;  4ISD A;  4NWY A;  3IR4 A;  3KM6 A;  5GAN D;  2VCQ A;  4QQ7 A;  3D0Z A;  2FWE A;  4KGI A;  3GTU B;  1K3O A;  4TRX A;  3VI5 A;  1TK8 B;  3ZLP A;  2C0G A;  2V6K A;  1H75 A;  4NHW A;  3WD6 A;  1EV9 A;  2PVO C;  3F0I A;  1G6Y A;  5JWQ B;  2YWO A;  5H5R A;  2F9S A;  4FYU A;  5ECK B;  1GSY A;  2PVQ A;  4NAX A;  5G30 A;  1YF0 A;  3C7M A;  4AJ8 A;  3LQ7 A;  3ERG A;  2I9H A;  2OBI A;  1S3C A;  3EE2 A;  4Q5Q A;  1QUW A;  3CSJ A;  3KH9 A;  3U5R E;  4EXJ A;  4MF7 A;  16GS A;  3FZ9 A;  4PUA A;  2VD1 A;  1G6W A;  3LXT A;  6GSX A;  4RUV A;  5IMV A;  4DSR A;  3OR5 A;  2LJA A;  2GQL A;  1F37 A;  4IS0 A;  2TIR A;  2HZF A;  5G5E A;  4EC0 A;  2X99 A;  3M9K A;  3H93 A;  2BTO T;  2H71 A;  3TRX A;  3IAM 2;  2LNT A;  4TW5 A;  4IJ3 A;  1O73 A;  1EP8 A;  3W8J A;  2XBQ A;  4KH7 A;  1X9W B;  3LXZ A;  1GLQ A;  1W4V A;  1R5P A;  2GSR A;  1FG4 A;  4JED A;  4YAP A;  1O8W A;  2IFQ A;  3BCI A;  3EUR A;  2JU5 A;  2O85 A;  4HEA 2;  4GQC A;  2MBT A;  1YF1 A;  2X8C A;  4ECB A;  3F8U A;  4L5L A;  3ZRD A;  4MK3 A;  3TUE A;  2ZCT A;  3PR8 A;  2H1A A;  1R26 A;  22GS A;  1TU8 A;  5DJL A;  5A4V A;  3EU4 A;  1E6B A;  4TN8 A;  2H6Z A;  3J7Y k;  2CZ2 A;  2L6D A;  1XWB A;  3MSZ A;  3M3M A;  3APO A;  1GSS A;  1T00 A;  1X5C A;  2IWT A;  3F63 A;  2WUL A;  1OKT A;  3QCP A;  4NHZ A;  2R37 A;  2CQ9 A;  1UC7 A;  1TRW A;  6GSY A;  2H66 A;  2DMM A;  1OC9 A;  2GSS A;  2LJR A;  1X9S B;  4LL1 B;  1WJK A;  1FB6 A;  4PQH A;  1SK0 A;  2QC7 A;  4PGT A;  2L6C A;  2CT6 A;  3KZQ A;  2XBI A;  4TOP A;  1MDI A;  2NVL A;  3WGD A;  5B6N A;  2E2M A;  3ZTL A;  1JZW A;  3FR3 A;  1ACV A;  2B1K A;  3L9U A;  1MTC A;  1XVQ A;  2VM2 A;  4IP1 A;  5IMC A;  3GL5 A;  4OCF A;  2PER A;  4DSS B;  3D5J A;  1RW1 A;  3CXG A;  1FOV A;  3ERW A;  3TJG A;  1OVN A;  2Z9S A;  5DBQ A;  2VO4 A;  1ON4 A;  4YQU A;  2JZS A;  3GMF A;  1IYH A;  1Z5Y E;  4GRF A;  2R4V A;  4ML1 A;  5AIX A;  3N5O A;  5AIS A;  1EEJ A;  4OWY A;  2B5E A;  3IK7 A;  3EYT A;  2VL3 A;  2R3X A;  5D93 A;  5CRE A;  4OD7 A;  2LRN A;  2DJ2 A;  5J9B A;  5B7C A;  1SL1 B;  4X43 A; 
#chains in the Genus database with same CATH topology
 2H73 A;  2H6Y A;  2HRF A;  3LWA A;  3KD0 A;  5E59 A;  2H76 A;  3EVI A;  2AB6 A;  5G31 A;  5KEJ A;  3FEU A;  4EL1 A;  4ZIL A;  1TP9 A;  5HR3 A;  4MP4 A;  1YEX A;  1T1V A;  2IIY A;  3G7J A;  3QFB C;  1JFU A;  3ZYW A;  3KEB A;  3F3Q A;  1XW5 A;  2FWH A;  5DQS A;  2LQQ A;  4HQS A;  4WEY A;  2MYG A;  2N5F A;  2HSH A;  2H01 A;  3CTF A;  3P8W A;  4RI6 A;  20GS A;  2IMK A;  5F05 A;  4MZC A;  3ZIT A;  2LQO A;  1GTA A;  5AGY A;  4I8B A;  18GS A;  2LRT A;  1SEN A;  3DIE A;  3H1N A;  4K8M A;  4OO4 A;  1VF3 A;  1A2J A;  5F0G A;  3FKF A;  3UJ1 A;  2DJK A;  3TJJ A;  2VCV A;  4D73 B;  1BQ7 A;  3TCO A;  3FZA A;  2GZZ A;  2YCD A;  5HQP A;  2FNO A;  4KND A;  5D8I A;  6GSS A;  3A5W A;  3HVN A;  3HJO A;  5ECQ B;  1URM A;  4XRA A;  3VWV A;  5KN2 A;  4YQV A;  2R0C A;  4WKW A;  4HJM A;  3UAP A;  1W89 A;  4PQI A;  2P31 A;  1M3J A;  2K8V A;  3E0U A;  1EGO A;  4F0C A;  5J4U A;  3QMX A;  2GST A;  1Y6E A;  2KP2 A;  5L71 A;  3PGT A;  4K6X A;  4ECC A;  4DSQ A;  4HOJ A;  3MWH A;  1LJR A;  2OKA A;  2WRT A;  3GN3 A;  4HDE A;  2DC5 A;  5IPH A;  1B48 A;  2OBK A;  3V1W A;  2E0Q A;  2R0P A;  4MF5 A;  3D4T A;  1XWC A;  4K5R A;  2RM5 A;  5ECN B;  4HQZ A;  3TJF A;  1MD4 A;  8GSS A;  3ZZX A;  5DAK A;  1B8X A;  1ZYE A;  2HI7 A;  1GSF A;  3UAR A;  2YZU A;  4EIP A;  1J0F A;  1XFL A;  4KE3 A;  3VWW A;  2CZ3 A;  5G5F A;  3ISO A;  3IOS A;  3J7Y b;  3ZIJ A;  4I2T A;  2WCI A;  1HNB A;  3H8Q A;  2LKU A;  4OO5 A;  1KNG A;  1SKW B;  5ECS A;  3KP8 A;  2JSZ A;  4JR6 A;  5J3R A;  3M8N A;  4WR4 A;  4DVC A;  1XVW A;  3IHQ A;  1BYE A;  1R7H A;  2I1U A;  3CSH A;  2DKH A;  1AQX A;  1OE8 A;  3LG6 A;  4CY8 A;  2GTU A;  2VOC A;  1HNC A;  3IC8 A;  3S9F A;  4HU7 A;  2GVP A;  4KF9 A;  2YZH A;  4KCA A;  2FHE A;  5COH A;  5AN1 A;  1PX6 A;  2RUE A;  4JU5 A;  3EPT A;  1MEK A;  1V40 A;  3LYP A;  2B5X A;  2DKI A;  3O3T A;  1Y25 A;  4G19 A;  4F03 A;  3ZVJ D;  1F2E A;  2NTO A;  2R2J A;  3DXB A;  2X64 A;  3HCZ A;  3KIJ A;  2HNL A;  3QAG A;  1GNE A;  1N8J A;  3H4K A;  3VLN A;  3I9V 2;  2HZE A;  4MJE A;  3RHB A;  4OFT A;  1BX9 A;  1QGV A;  1XWG A;  5B8B A;  3PPU A;  5BRT A;  4YH2 A;  1FOH A;  1X5E A;  1Z6N A;  1ZL9 A;  2EIR A;  5CP1 A;  4L8E A;  3GX8 A;  1TK5 B;  5HFK A;  4HU9 A;  2IFQ B;  2GT5 A;  1RK4 A;  4YQM A;  3L9S A;  1AW9 A;  5CRH A;  4FO5 A;  1YY7 A;  3GL3 A;  1JZD A;  2R5G A;  1VRS D;  2CVK A;  2YPM A;  5EPF A;  1B9X C;  2H1B A;  4XIH A;  5DAL A;  1USB A;  4F2I A;  2BJX A;  11GS A;  1XG8 A;  2LTK A;  3E3E A;  3F3R A;  1Z7P A;  4MLY A;  3P2A A;  2O89 A;  1G7E A;  4TXO A;  1GUM A;  4O7H A;  2C0D A;  5G1K A;  4MAB A;  1I5G A;  1SK1 A;  1AAZ A;  1T3B A;  4KW6 A;  2AAW A;  2N5A A;  4XS4 A;  1TRU A;  4EUY A;  2YJ7 A;  1JZR A;  4HSC X;  4L0U A;  1PSQ A;  2H0G A;  2YAN A;  2NDO A;  3IAS 2;  3F9U A;  4PUR A;  2MMZ A;  5IIZ A;  4NMU A;  4Z7X A;  4N30 A;  4N0V A;  1OC9 B;  3KH7 A;  4ZBD A;  1NHY A;  2KP1 A;  4IBP A;  3D4M A;  2PWJ A;  5H5Q A;  1DE2 A;  2GQK A;  3FR6 A;  4ZBA A;  3TKR A;  4AJ7 A;  1FVJ A;  1OE7 A;  1AXD A;  3ZIV A;  1M9B A;  1PN0 A;  5CAX A;  1UVZ A;  1TKD B;  1VF4 A;  3UL3 A;  5F07 A;  2CVD A;  1SKR B;  2L4Q A;  4V1A p;  12GS A;  4MCU A;  1SYX A;  4OFN A;  4PNG A;  2HRA A;  5ECR B;  3GUR A;  3Q74 A;  3US3 A;  1EOH A;  4IP6 A;  1ERW A;  4MPG A;  2JAC A;  1GTU A;  3CYN A;  4K0N A;  4PXO A;  2PUK C;  2C3T A;  5GSS A;  2HSY A;  3IXR A;  4GSN A;  4ZBB A;  3GNJ A;  4BPY A;  5KN0 A;  2AHE A;  4OFM A;  4ML6 A;  1YEP A;  5F06 A;  3E9J B;  1K3Y A;  4LMV A;  1ML6 A;  4IQA A;  3ZFL A;  2MZC A;  1X5D A;  1A24 A;  3ED3 A;  3APS A;  5A5K A;  4K7I A;  3KMO A;  5EL8 A;  1U6T A;  2H0I A;  2MMN A;  3GKM A;  1WMJ A;  4MJB A;  2VLV A;  4YKF A;  1XWA A;  4HZ2 A;  2B7K A;  3K8N A;  2NBS A;  1G7O A;  3R2Q A;  2AJQ B;  3F4T A;  5HR1 A;  3C8E A;  1TRV A;  1AC1 A;  4MH3 A;  1WP0 A;  3LEF A;  3BJ5 A;  4K7O A;  5EY6 A;  2G2Q A;  2J23 A;  4XHM A;  2DSA A;  4ZXG A;  3MDK A;  4J2F A;  1SJ6 A;  2K9F A;  1TI3 A;  4OMV A;  3FZ5 A;  5IOX A;  2CVB A;  5CYY A;  3IA1 A;  1BAY A;  3IHG A;  4KDY A;  2GDR A;  4LMW A;  4ECI A;  2H0H A;  5DCH A;  1PMT A;  4O32 A;  4EIQ A;  3VI7 A;  1HNA A;  2F3M A;  3UMA A;  2VL2 A;  2KHP A;  2CAI A;  4WR5 A;  5IMZ A;  1U87 A;  17GS A;  4BL7 A;  4V1A g;  2L5O A;  2IL3 A;  3GUS A;  2H75 A;  3EU3 A;  3EMP A;  4XS1 A;  2A2R A;  2GS3 A;  5DJM A;  2JL4 A;  3HZ4 A;  4MA9 A;  2L4C A;  4K2X A;  1S3R A;  2OA7 A;  5ECO B;  2K18 A;  1K0M A;  3I69 A;  4Z2T A;  1B4Q A;  3ERF A;  10GS A;  1JZO A;  1WIK A;  1I9D A;  1DBY A;  4BVY A;  5JCG A;  4MDC A;  1TDI A;  3I6A A;  2JAD A;  2VL2 C;  4RQX A;  5AIV A;  4NXI A;  4CY6 A;  5B6M A;  1CQH A;  2X4A A;  2DIY A;  4AF2 A;  3APQ A;  3CQF A;  1GUH A;  2E2G A;  4XTS A;  3KXO A;  1GUK A;  1H4O A;  5IM9 A;  2FWG A;  3DEX A;  2P5Q A;  1YJ6 A;  4CW9 A;  4IQ1 A;  1UA5 A;  3HJP A;  1A8L A;  3GH9 A;  4EO3 A;  1LU4 A;  5J9C A;  1FO5 A;  1J08 A;  3LFL A;  5D9W A;  5JCU A;  4IVF A;  1V58 A;  1GNW A;  4KA0 A;  2CV4 A;  3PIN A;  2L5L A;  5EVO A;  5JCW A;  2VM1 A;  3GIX A;  2J9H A;  19GS A;  4RI7 A;  1YKA A;  2OJL A;  2IMD A;  1ILO A;  2JSY A;  4NV5 A;  3TKS A;  4GTU A;  4Q5N A;  3Q18 A;  1XPV A;  4A5P A;  2C1Y A;  1SKS B;  4L5O A;  2LST A;  2HFD A;  5D9V A;  1BG5 A;  2OE0 A;  2IPA A;  4V2M A;  2MBS A;  3CMI A;  14GS A;  2FCH A;  1PN9 A;  5ECP B;  4E8H A;  4X4J A;  2I3Y A;  1VGL A;  2H74 A;  4HUA A;  2X49 A;  1X9M B;  1K0C A;  3TOU A;  3CRU A;  4EDY A;  3TKS C;  4GLT A;  2HZE B;  3VPT A;  4WF5 A;  1QMV A;  3FMW A;  4FYC A;  3RHC A;  4ZB8 A;  3IBH A;  2LS5 A;  1FVK A;  3IDV A;  3HZ8 A;  1U3A A;  7GSS A;  4JZQ A;  2LNS A;  4GCI A;  2DJ0 A;  4WBJ A;  4I2U A;  2R0G A;  1ZYP A;  2X8G A;  1QXH A;  2F8A A;  2P0G A;  2GSQ A;  2C0F A;  4PQ1 A;  1A8Y A;  5DAL B;  5CNW A;  1PQN A;  3LJR A;  3VWU A;  5ABR A;  5JWO B;  4MZW A;  1F6M C;  3GHA A;  3RDW A;  2DLX A;  1ZOF A;  4TXO B;  1XW9 A;  1YZX A;  2C0E A;  2OAC A;  3WT2 A;  3IE3 A;  3SBC A;  1T8E B;  1AQW A;  2V32 A;  1MD3 A;  2WDU A;  1PRX A;  2G0F A;  2JZT A;  2WJU A;  4XS4 B;  4KDU A;  5IMA A;  1MDJ A;  1JHB A;  1SJZ A;  4FH8 A;  1GP1 A;  3VK9 A;  2WB9 A;  1MDK A;  3QDN A;  4AGS A;  2OE1 A;  2KUC A;  1XXU A;  4HS1 A;  1IYI A;  5ELA A;  3KTB A;  2B7J A;  1GSD A;  4BVX A;  3UVT A;  1KEB A;  1M2D A;  1SD9 A;  3CRT A;  3HHV A;  3HY2 A;  2LUS A;  2RUF A;  2YV9 A;  3QAV A;  5FHI A;  3TJK A;  4HI7 A;  1J9B A;  3MYD A;  2EIQ A;  2AYT A;  2PGT A;  3UIW A;  1ERT A;  2C8U A;  1Z3E A;  4Q5F A;  4ZB6 A;  2JZR A;  3TGZ A;  3O6T A;  4YAV A;  4AJ6 A;  3ME7 A;  2B1L A;  3HKR A;  2A2P A;  3GH6 A;  3DVX A;  2C4J A;  1F3A A;  1PL2 A;  1TI1 A;  3Q19 A;  3Q6O A;  5ECL B;  4F9Z A;  1EEM A;  1ZMA A;  4IN0 A;  3ZFB A;  2LRC A;  1TK0 B;  3ZMK A;  3L0H A;  1GSE A;  2M80 A;  1THO A;  3M1G A;  1M2B A;  4KDX A;  2KLX A;  3TOT A;  1M7T A;  4ILF A;  1XWK A;  3TB2 A;  1XCC A;  4KAE A;  3QFA C;  1OYJ A;  2YV7 A;  3FR9 A;  3D22 A;  4KX4 A;  4FYB A;  1NSW A;  2X8H A;  1S3D A;  2QKE A;  3GST A;  3I43 A;  3DRN A;  4G0L A;  1WPI A;  2VLT A;  4MMM A;  1VF2 A;  4HJ2 A;  2B6M A;  2H1D A;  1EOG A;  5IPG A;  4IW9 A;  5GST A;  1ST9 A;  4EVM A;  2QA2 A;  4MJC A;  1XOA A;  4KSM A;  5IQY A;  2ES7 A;  2M46 A;  3WGX A;  1T4Z A;  4LA1 A;  4F82 A;  2HYX A;  5D96 A;  3JCM L;  2F8F A;  4TR4 A;  5CRD A;  3O76 A;  3VWX A;  5IOW A;  2IJY A;  3M9J A;  1F3B A;  2QA1 A;  3RPP A;  1HQO A;  3G7Y A;  9GSS A;  3CBU A;  3VFI A;  5A4W A;  2PPT A;  1ERU A;  1AIU A;  4BIK A;  4O92 A;  3NIV A;  3EWL A;  3L4N A;  1DUG A;  1UN2 A;  3BD2 A;  2VCZ A;  5IMD A;  3QOU A;  2FY6 A;  2CA8 A;  2DJ1 A;  2K6V A;  2LEG A;  1KTE A;  4KUN A;  1PKW A;  2O87 A;  3ZL5 A;  3RPN A;  3DYR A;  1TTZ A;  1PGT A;  1OC8 A;  3PH9 A;  2ON7 A;  1PA3 A;  4MH2 A;  4G0K A;  1ERV A;  1FB0 A;  4BL7 B;  1YDK A;  2I4A A;  4XCS A;  4TVE A;  5INY A;  2XPE A;  2D2Z A;  1XZO A;  3A2W A;  1K0N A;  2DBC A;  1A0R P;  4TR1 A;  1R5A A;  3FW2 A;  2FUG 2;  1VF1 A;  2HLS A;  5ECM B;  1C72 A;  5KOW A;  4MZB A;  4BVY B;  3AY8 A;  1PFO A;  4WF4 A;  2V1M A;  1V57 A;  2C3Q A;  5HFI A;  5HR2 A;  5IO0 A;  2HE3 A;  1GSQ A;  1EWX A;  2PU9 C;  1QFN A;  4GF0 A;  1ZYQ B;  3WGE A;  1TXX A;  3LOR A;  4WBR D;  1NW2 A;  2H1G A;  3DD3 A;  3QD9 A;  1TJD A;  3U6V A;  1EP7 A;  3QR6 A;  5G1L A;  4OCE A;  1E2Y A;  2YWN A;  1WWJ A;  1KBN A;  2LJK A;  4BWS A;  2N5B A;  1SJI A;  4NPB A;  3F6D A;  5LD0 A;  4JRR A;  1T4Y A;  5ECH B;  2L59 A;  2IME A;  3F6F A;  2WFC A;  4ECJ A;  5GZZ B;  5ENU A;  4EKZ A;  5D9X A;  2VD0 A;  4POB A;  2UZ8 A;  3TKQ A;  3RAZ A;  2CX4 A;  5JWR B;  4BA7 A;  3MNG A;  4K0G A;  2HXK A;  2M72 A;  1K0D A;  3A3T A;  3HJM A;  3UBL A;  1EZK A;  4POK A;  4JR4 A;  1V2A A;  3GFK A;  3TJB A;  3HDC A;  5ID2 A;  1O81 A;  2HSM A;  3P7X A;  2A4V A;  2TRX A;  3NOF A;  2DJJ A;  5IO2 A;  2MMO A;  2DML A;  4N10 A;  1V9W A;  1O85 A;  3CSI A;  2O8V B;  4ICY A;  1GUL A;  3LW9 A;  2WS2 A;  2VCW A;  3TKS E;  1XW6 A;  3A5I A;  1A2L A;  4K7N A;  3G9B A;  3L9V A;  2L57 A;  2V41 A;  2PBJ A;  1Q4J A;  3SWL A;  3FRC A;  4N11 A;  4XS6 A;  5ECI B;  1B9Y C;  1XBS A;  2CX3 A;  4IHU A;  1M2A A;  5DCG A;  2H19 A;  4PNF A;  4IKH A;  3DML A;  1RQM A;  5DQY A;  3UEM A;  4Z2R A;  1N2A A;  3C71 A;  1HD2 A;  6GSV A;  5HFG A;  1OC3 A;  1THX A;  4CDO A;  5BMU A;  1SL2 B;  3UOM A;  3CTG A;  1PX7 A;  3UBK A;  1BJX A;  1Z7R A;  4PUF C;  3GA4 A;  5A4U A;  2ZUP A;  5DAK B;  2IMF A;  3QPM A;  4FIW A;  4QL7 A;  4XRD A;  4BVX B;  2RLI A;  3LSZ A;  4KB3 A;  1SD8 A;  3GTU A;  1FAA A;  3WT1 A;  1NHO A;  2YP6 A;  5LCZ A;  5KN1 A;  1O7U A;  4GXZ A;  2KOK A;  1ZYN A;  3VPQ A;  1QQ2 A;  4MPF A;  3C73 A;  1M99 A;  1AQV A;  3FZ4 A;  3EIN A;  4BWQ A;  3TKP A;  1XIY A;  2NPB A;  2R6K A;  5CO3 A;  2I81 A;  1Q98 A;  4J56 E;  4KCE A;  4O5R A;  3TRP A;  2BMX A;  3HXS A;  2FD3 A;  2YJH A;  3D6I A;  4K1F A;  3N9J A;  2YOI A;  2VIM A;  4P3Y B;  1FHE A;  2VCX A;  5CRW A;  2GT6 A;  2HT9 A;  5F8B A;  2IN3 A;  1A23 A;  1WOU A;  4O5Q A;  3ZML A;  4K2D A;  3GKK A;  4KSO A;  2B5Y A;  1OAZ A;  4IGJ A;  3RBT A;  1R4W A;  1GH2 A;  4CHS A;  3FYG A;  4K9Z A;  2VL9 A;  1K0A A;  5G2Z A;  2ALB A;  1SYR A;  5D73 A;  2EC4 A;  2F51 A;  4JE1 A;  1DSB A;  1K3L A;  3TRQ A;  3KMN A;  2XC2 A;  3W6G A;  2WGR A;  2HRK A;  2YN1 A;  3P90 A;  1LBK A;  3DWV A;  1SU9 A;  3GV1 A;  3UVH A;  3WYW A;  3IK9 A;  3FY7 A;  4L0W A;  5DVB A;  2YWI A;  4Z2U A;  1K0O A;  1O6J A;  2FA8 A;  2C80 A;  1T7P B;  1GRX A;  4G2E A;  1ZGN A;  3KP9 A;  3DVW A;  1FW1 A;  3HD5 A;  3ME8 A;  4YKG A;  5B8A A;  2H30 A;  5IMF A;  3DGQ A;  5J5N A;  1GSU A;  2A2S A;  3ZVJ A;  3FK8 A;  4DEJ A;  3GSS A;  5CRG A;  4GQF A;  3KCM A;  1ZZY A;  4J57 E;  3M0F A;  2IMI A;  3EMX A;  4WXT A;  3QAW A;  1WE0 A;  4N0Z A;  3HVX A;  2RM6 A;  2FWF A;  4V2N A;  4POM A;  4GST A;  4ULX A;  6GSU A;  2H70 A;  4ZIJ A;  4EE0 A;  1S3A A;  5FT3 A;  3VUR A;  1WRY A;  4K5S A;  1U88 A;  2PN8 A;  2GGT A;  4MJA A;  5C04 A;  4TR1 B;  2H72 A;  1SK2 A;  2GZY A;  2VUP A;  3GX0 A;  1HYU A;  4DSS A;  1GTI A;  4GSS A;  4MF6 A;  1TRS A;  3KJY A;  2B3S A;  1B4P A;  4TR0 A;  3C1S A;  3F4S A;  2O7K A;  4ACS A;  2CAQ A;  4RQR A;  2C3N A;  2OAD A;  2MMA A;  3TDG A;  4H86 A;  6GSW A;  2DJ3 A;  1G0T A;  3W8S A;  2REM A;  2YWM A;  2GQM A;  3GKN A;  4IEL A;  3BCK A;  4USS A;  1A2M A;  1AUC A;  2GZP A;  3LGC A;  2A4H A;  5DDL A;  1OKD A;  1U3I A;  2H6X A;  3FHK A;  1V98 A;  3ZRE A;  4V2L A;  2H8L A;  1GWC A;  2FA4 A;  2PMT A;  2AUV A;  2QGV A;  3IC4 A;  2QSI A;  4TR3 A;  3GRX A;  2E7P A;  3IV4 A;  1M0U A;  1K0B A;  4LLR A;  1JLW A;  1CQG A;  3BOA A;  4ZL7 A;  1Z9H A;  5KN3 A;  2FLS A;  2ON5 A;  2WZ9 A;  2OE3 A;  5KOX A;  3HVV A;  2TRC P;  3F4R A;  1GTB A;  3LYK A;  2V6O A;  4X1U A;  4ZL9 A;  1TOF A;  1BED A;  4I5Q A;  4IJI A;  13GS A;  2FGX A;  1EV4 A;  3EC3 A;  1TW9 A;  1ABA A;  1PL1 A;  2EIO A;  3MAK A;  1DE1 A;  1YKC A;  6GST A;  3BBY A;  3HA9 A;  4Q5R A;  2VCT A;  3A2V A;  3C1R A;  4GWR A;  2DIZ A;  5ID2 B;  2HRN A;  3L78 A;  5H5S A;  1PD2 1;  5HR0 A;  4QL9 A;  4ID0 A;  4G10 A;  4G9H A;  1GL8 A;  2VAF A;  4D73 A;  5FWG A;  2K8S A;  3H79 A;  4NV2 A;  1EGR A;  2XPD A;  4FQU A;  4ZL8 A;  4EF0 A;  1GLP A;  1QK8 A;  1Z6M A;  5J41 A;  3GKX A;  1TU7 A;  1O8X A;  3IPZ A;  3GYK A;  3A2X A;  5E4W A;  5C00 A;  3KTL A;  1YQ1 A;  2LV3 A;  4I97 A;  2XHF A;  5D9T A;  2P5R A;  4WET A;  4X0X A;  1M9A A;  2YNX A;  4LL4 B;  1PKZ A;  1XOB A;  2GLR A;  2ZNM A;  1F9M A;  3HVS A;  2V2G A;  3G7I A;  5GAP D;  4JBB A;  1A0F A;  3NZN A;  4ZB9 A;  2VLU A;  4TKY A;  2RII A;  1NM3 A;  4F0B A;  5LNK e;  4E8E A;  5ELG A;  4PX1 A;  1SL0 B;  4TXV A;  1JLV A;  3KGK A;  3IRA A;  2AV4 A;  1X0R A;  1ZCP A;  3DKS A;  3D21 A;  4I6X A;  4HZ4 A;  4EDZ A;  4POL A;  3HYP A;  4ISD A;  4NWY A;  1M3I A;  3IR4 A;  3KM6 A;  5GAN D;  2VCQ A;  4QQ7 A;  3D0Z A;  2FWE A;  4KGI A;  3GTU B;  1K3O A;  4TRX A;  3VI5 A;  1TK8 B;  3ZLP A;  2C0G A;  2V6K A;  1H75 A;  4NHW A;  3WD6 A;  1EV9 A;  2PVO C;  3F0I A;  1G6Y A;  3MIX A;  2YWO A;  5JWQ B;  5H5R A;  2F9S A;  4FYU A;  5ECK B;  1GSY A;  2PVQ A;  4NAX A;  5G30 A;  1YF0 A;  3C7M A;  4AJ8 A;  3LQ7 A;  3ERG A;  2I9H A;  2OBI A;  1S3C A;  3EE2 A;  4Q5Q A;  1QUW A;  3CSJ A;  3KH9 A;  3U5R E;  4EXJ A;  4MF7 A;  16GS A;  3FZ9 A;  4PUA A;  2VD1 A;  1G6W A;  3LXT A;  4MNN A;  6GSX A;  4RUV A;  5IMV A;  4DSR A;  3OR5 A;  2LJA A;  2GQL A;  1F37 A;  4IS0 A;  2TIR A;  2HZF A;  5G5E A;  4EC0 A;  2X99 A;  3M9K A;  3H93 A;  2BTO T;  2H71 A;  3TRX A;  4G0I A;  3IAM 2;  2LNT A;  4TW5 A;  4IJ3 A;  1O73 A;  1EP8 A;  3W8J A;  2XBQ A;  4KH7 A;  1X9W B;  3LXZ A;  1GLQ A;  1W4V A;  1R5P A;  2GSR A;  1FG4 A;  4JED A;  4YAP A;  1O8W A;  2IFQ A;  3BCI A;  3EUR A;  2JU5 A;  2O85 A;  4HEA 2;  4GQC A;  2MBT A;  1YF1 A;  2X8C A;  4ECB A;  3F8U A;  4L5L A;  3ZRD A;  4MK3 A;  3TUE A;  2ZCT A;  3PR8 A;  2H1A A;  1R26 A;  22GS A;  1TU8 A;  5DJL A;  5A4V A;  3EU4 A;  1E6B A;  4TN8 A;  2H6Z A;  3J7Y k;  2CZ2 A;  2L6D A;  1XWB A;  3MSZ A;  3M3M A;  3APO A;  1GSS A;  1T00 A;  1X5C A;  2IWT A;  3F63 A;  2WUL A;  1OKT A;  3QCP A;  4NHZ A;  2R37 A;  2CQ9 A;  1UC7 A;  1TRW A;  6GSY A;  2H66 A;  2DMM A;  4O5U A;  1OC9 A;  2GSS A;  2LJR A;  1X9S B;  4LL1 B;  1WJK A;  1FB6 A;  4PQH A;  1SK0 A;  2QC7 A;  4PGT A;  2L6C A;  2CT6 A;  3KZQ A;  2XBI A;  4TOP A;  1MDI A;  2NVL A;  3WGD A;  5B6N A;  2E2M A;  3ZTL A;  1JZW A;  3FR3 A;  1ACV A;  2B1K A;  3L9U A;  1MTC A;  1XVQ A;  2VM2 A;  4IP1 A;  5IMC A;  3GL5 A;  4OCF A;  2PER A;  4DSS B;  3D5J A;  1RW1 A;  3CXG A;  1FOV A;  3ERW A;  3TJG A;  1OVN A;  2Z9S A;  5DBQ A;  2VO4 A;  1ON4 A;  4YQU A;  2JZS A;  3GMF A;  1IYH A;  1Z5Y E;  4GRF A;  2R4V A;  4ML1 A;  5AIX A;  3N5O A;  5AIS A;  1EEJ A;  4OWY A;  2B5E A;  3IK7 A;  3R3E A;  3EYT A;  4PTS A;  2VL3 A;  2R3X A;  5D93 A;  5CRE A;  4OD7 A;  2LRN A;  2DJ2 A;  5J9B A;  5B7C A;  1SL1 B;  4X43 A; 
#chains in the Genus database with same CATH homology
 2H73 A;  2H6Y A;  2HRF A;  3LWA A;  3KD0 A;  5E59 A;  2H76 A;  3EVI A;  2AB6 A;  5G31 A;  5KEJ A;  3FEU A;  4EL1 A;  4ZIL A;  1TP9 A;  5HR3 A;  4MP4 A;  1YEX A;  1T1V A;  2IIY A;  3G7J A;  3QFB C;  1JFU A;  3ZYW A;  3KEB A;  3F3Q A;  1XW5 A;  2FWH A;  5DQS A;  2LQQ A;  4HQS A;  4WEY A;  2MYG A;  2N5F A;  2HSH A;  2H01 A;  3CTF A;  3P8W A;  4RI6 A;  20GS A;  2IMK A;  5F05 A;  4MZC A;  3ZIT A;  2LQO A;  1GTA A;  5AGY A;  4I8B A;  18GS A;  2LRT A;  1SEN A;  3DIE A;  3H1N A;  4K8M A;  4OO4 A;  1VF3 A;  1A2J A;  5F0G A;  3FKF A;  3UJ1 A;  2DJK A;  3TJJ A;  2VCV A;  4D73 B;  1BQ7 A;  3TCO A;  3FZA A;  2GZZ A;  2YCD A;  5HQP A;  2FNO A;  4KND A;  5D8I A;  6GSS A;  3A5W A;  3HJO A;  5ECQ B;  1URM A;  4XRA A;  3VWV A;  5KN2 A;  4YQV A;  2R0C A;  4WKW A;  4HJM A;  3UAP A;  1W89 A;  4PQI A;  2P31 A;  3E0U A;  2K8V A;  1EGO A;  4F0C A;  5J4U A;  3QMX A;  2GST A;  1Y6E A;  2KP2 A;  5L71 A;  3PGT A;  4K6X A;  4ECC A;  4DSQ A;  4HOJ A;  3MWH A;  1LJR A;  2OKA A;  2WRT A;  3GN3 A;  4HDE A;  2DC5 A;  5IPH A;  1B48 A;  2OBK A;  3V1W A;  2E0Q A;  2R0P A;  4MF5 A;  3D4T A;  1XWC A;  4K5R A;  2RM5 A;  5ECN B;  4HQZ A;  3TJF A;  1MD4 A;  8GSS A;  3ZZX A;  5DAK A;  1B8X A;  1ZYE A;  2HI7 A;  1GSF A;  3UAR A;  2YZU A;  4EIP A;  1J0F A;  1XFL A;  4KE3 A;  3VWW A;  2CZ3 A;  5G5F A;  3ISO A;  3IOS A;  3J7Y b;  3ZIJ A;  4I2T A;  2WCI A;  1HNB A;  3H8Q A;  2LKU A;  4OO5 A;  1KNG A;  1SKW B;  5ECS A;  3KP8 A;  2JSZ A;  4JR6 A;  5J3R A;  3M8N A;  4WR4 A;  4DVC A;  1XVW A;  3IHQ A;  1BYE A;  1R7H A;  2I1U A;  3CSH A;  2DKH A;  1AQX A;  1OE8 A;  3LG6 A;  4CY8 A;  2GTU A;  2VOC A;  1HNC A;  3IC8 A;  3S9F A;  4HU7 A;  2GVP A;  4KF9 A;  2YZH A;  4KCA A;  2FHE A;  5COH A;  5AN1 A;  1PX6 A;  2RUE A;  4JU5 A;  3EPT A;  1MEK A;  1V40 A;  3LYP A;  2B5X A;  2DKI A;  3O3T A;  1Y25 A;  4G19 A;  4F03 A;  3ZVJ D;  1F2E A;  2NTO A;  2R2J A;  3DXB A;  2X64 A;  3HCZ A;  3KIJ A;  2HNL A;  3QAG A;  1GNE A;  1N8J A;  3H4K A;  3VLN A;  3I9V 2;  2HZE A;  4MJE A;  3RHB A;  4OFT A;  1BX9 A;  1QGV A;  1XWG A;  5B8B A;  3PPU A;  5BRT A;  4YH2 A;  1FOH A;  1X5E A;  1Z6N A;  1ZL9 A;  2EIR A;  5CP1 A;  4L8E A;  3GX8 A;  1TK5 B;  5HFK A;  4HU9 A;  2IFQ B;  2GT5 A;  1RK4 A;  4YQM A;  3L9S A;  1AW9 A;  5CRH A;  4FO5 A;  1YY7 A;  3GL3 A;  1JZD A;  2R5G A;  1VRS D;  2CVK A;  2YPM A;  5EPF A;  1B9X C;  2H1B A;  4XIH A;  5DAL A;  1USB A;  4F2I A;  2BJX A;  11GS A;  2LTK A;  3E3E A;  3F3R A;  1Z7P A;  4MLY A;  3P2A A;  2O89 A;  1G7E A;  4TXO A;  1GUM A;  4O7H A;  2C0D A;  5G1K A;  4MAB A;  1I5G A;  1SK1 A;  1AAZ A;  1T3B A;  4KW6 A;  2AAW A;  2N5A A;  4XS4 A;  1TRU A;  4EUY A;  2YJ7 A;  1JZR A;  4L0U A;  1PSQ A;  2H0G A;  2YAN A;  2NDO A;  3IAS 2;  3F9U A;  4PUR A;  2MMZ A;  5IIZ A;  4NMU A;  4Z7X A;  4N30 A;  4N0V A;  1OC9 B;  3KH7 A;  4ZBD A;  1NHY A;  2KP1 A;  4IBP A;  3D4M A;  2PWJ A;  5H5Q A;  1DE2 A;  2GQK A;  3FR6 A;  4ZBA A;  3TKR A;  4AJ7 A;  1FVJ A;  1OE7 A;  1AXD A;  3ZIV A;  1M9B A;  1PN0 A;  5CAX A;  1UVZ A;  1TKD B;  1VF4 A;  3UL3 A;  5F07 A;  2CVD A;  1SKR B;  2L4Q A;  4V1A p;  12GS A;  4MCU A;  1SYX A;  4OFN A;  4PNG A;  2HRA A;  5ECR B;  3GUR A;  3Q74 A;  3US3 A;  1EOH A;  4IP6 A;  1ERW A;  4MPG A;  2JAC A;  1GTU A;  3CYN A;  4K0N A;  4PXO A;  2PUK C;  2C3T A;  5GSS A;  2HSY A;  3IXR A;  4GSN A;  4ZBB A;  3GNJ A;  4BPY A;  5KN0 A;  2AHE A;  4OFM A;  4ML6 A;  1YEP A;  5F06 A;  3E9J B;  1K3Y A;  4LMV A;  1ML6 A;  4IQA A;  3ZFL A;  2MZC A;  1X5D A;  1A24 A;  3ED3 A;  3APS A;  5A5K A;  4K7I A;  3KMO A;  5EL8 A;  1U6T A;  2H0I A;  2MMN A;  3GKM A;  1WMJ A;  4MJB A;  2VLV A;  4YKF A;  1XWA A;  4HZ2 A;  2B7K A;  3K8N A;  2NBS A;  1G7O A;  3R2Q A;  2AJQ B;  3F4T A;  5HR1 A;  3C8E A;  1TRV A;  1AC1 A;  4MH3 A;  1WP0 A;  3LEF A;  3BJ5 A;  4K7O A;  5EY6 A;  2G2Q A;  2J23 A;  4XHM A;  2DSA A;  4ZXG A;  3MDK A;  4J2F A;  1SJ6 A;  2K9F A;  1TI3 A;  4OMV A;  3FZ5 A;  5IOX A;  2CVB A;  5CYY A;  3IA1 A;  1BAY A;  3IHG A;  4KDY A;  2GDR A;  4LMW A;  4ECI A;  2H0H A;  5DCH A;  1PMT A;  4O32 A;  4EIQ A;  3VI7 A;  1HNA A;  2F3M A;  3UMA A;  2VL2 A;  2KHP A;  2CAI A;  4WR5 A;  5IMZ A;  1U87 A;  17GS A;  4BL7 A;  4V1A g;  2L5O A;  2IL3 A;  3GUS A;  2H75 A;  3EU3 A;  3EMP A;  4XS1 A;  2A2R A;  2GS3 A;  5DJM A;  2JL4 A;  3HZ4 A;  4MA9 A;  2L4C A;  4K2X A;  2OA7 A;  5ECO B;  2K18 A;  1K0M A;  3I69 A;  4Z2T A;  1B4Q A;  3ERF A;  10GS A;  1JZO A;  1WIK A;  1I9D A;  1DBY A;  4BVY A;  5JCG A;  4MDC A;  1TDI A;  3I6A A;  2JAD A;  2VL2 C;  4RQX A;  5AIV A;  4NXI A;  4CY6 A;  5B6M A;  1CQH A;  2X4A A;  2DIY A;  4AF2 A;  3APQ A;  1GUH A;  2E2G A;  4XTS A;  3KXO A;  1GUK A;  1H4O A;  5IM9 A;  2FWG A;  3DEX A;  2P5Q A;  1YJ6 A;  4CW9 A;  4IQ1 A;  1UA5 A;  3HJP A;  1A8L A;  3GH9 A;  4EO3 A;  1LU4 A;  5J9C A;  1FO5 A;  1J08 A;  3LFL A;  5D9W A;  5JCU A;  4IVF A;  1V58 A;  1GNW A;  4KA0 A;  2CV4 A;  3PIN A;  2L5L A;  5EVO A;  5JCW A;  2VM1 A;  3GIX A;  2J9H A;  19GS A;  4RI7 A;  1YKA A;  2OJL A;  2IMD A;  1ILO A;  2JSY A;  4NV5 A;  3TKS A;  4GTU A;  4Q5N A;  3Q18 A;  1XPV A;  4A5P A;  2C1Y A;  1SKS B;  4L5O A;  2LST A;  2HFD A;  5D9V A;  1BG5 A;  2OE0 A;  2IPA A;  4V2M A;  2MBS A;  3CMI A;  14GS A;  2FCH A;  1PN9 A;  5ECP B;  4E8H A;  4X4J A;  2I3Y A;  1VGL A;  2H74 A;  4HUA A;  2X49 A;  1X9M B;  1K0C A;  3TOU A;  3CRU A;  4EDY A;  3TKS C;  4GLT A;  2HZE B;  3VPT A;  4WF5 A;  1QMV A;  3FMW A;  4FYC A;  3RHC A;  4ZB8 A;  3IBH A;  2LS5 A;  1FVK A;  3IDV A;  3HZ8 A;  1U3A A;  7GSS A;  4JZQ A;  2LNS A;  4GCI A;  2DJ0 A;  4WBJ A;  4I2U A;  2R0G A;  1ZYP A;  2X8G A;  1QXH A;  2F8A A;  2P0G A;  2GSQ A;  2C0F A;  4PQ1 A;  1A8Y A;  5DAL B;  5CNW A;  1PQN A;  3LJR A;  3VWU A;  5ABR A;  5JWO B;  4MZW A;  1F6M C;  3GHA A;  3RDW A;  2DLX A;  1ZOF A;  4TXO B;  1XW9 A;  1YZX A;  2C0E A;  2OAC A;  3WT2 A;  3IE3 A;  3SBC A;  1T8E B;  1AQW A;  2V32 A;  1MD3 A;  2WDU A;  1PRX A;  2G0F A;  2JZT A;  2WJU A;  4XS4 B;  4KDU A;  5IMA A;  1MDJ A;  1JHB A;  1SJZ A;  4FH8 A;  1GP1 A;  3VK9 A;  2WB9 A;  1MDK A;  3QDN A;  4AGS A;  2OE1 A;  2KUC A;  1XXU A;  4HS1 A;  1IYI A;  5ELA A;  3KTB A;  2B7J A;  1GSD A;  4BVX A;  3UVT A;  1KEB A;  1M2D A;  1SD9 A;  3CRT A;  3HHV A;  3HY2 A;  2LUS A;  2RUF A;  2YV9 A;  3QAV A;  5FHI A;  3TJK A;  4HI7 A;  1J9B A;  3MYD A;  2EIQ A;  2AYT A;  2PGT A;  3UIW A;  1ERT A;  2C8U A;  1Z3E A;  4Q5F A;  4ZB6 A;  2JZR A;  3TGZ A;  3O6T A;  4YAV A;  4AJ6 A;  3ME7 A;  2B1L A;  3HKR A;  2A2P A;  3GH6 A;  3DVX A;  2C4J A;  1F3A A;  1PL2 A;  1TI1 A;  3Q19 A;  3Q6O A;  5ECL B;  4F9Z A;  1EEM A;  1ZMA A;  4IN0 A;  3ZFB A;  2LRC A;  1TK0 B;  3ZMK A;  3L0H A;  1GSE A;  2M80 A;  1THO A;  3M1G A;  1M2B A;  4KDX A;  2KLX A;  3TOT A;  1M7T A;  4ILF A;  1XWK A;  3TB2 A;  1XCC A;  4KAE A;  3QFA C;  1OYJ A;  2YV7 A;  3FR9 A;  3D22 A;  4KX4 A;  4FYB A;  1NSW A;  2X8H A;  1S3D A;  2QKE A;  3GST A;  3I43 A;  3DRN A;  4G0L A;  1WPI A;  2VLT A;  4MMM A;  1VF2 A;  4HJ2 A;  2B6M A;  2H1D A;  1EOG A;  5IPG A;  4IW9 A;  5GST A;  1ST9 A;  4EVM A;  2QA2 A;  4MJC A;  1XOA A;  4KSM A;  5IQY A;  2ES7 A;  2M46 A;  3WGX A;  1T4Z A;  4LA1 A;  4F82 A;  2HYX A;  5D96 A;  3JCM L;  2F8F A;  4TR4 A;  5CRD A;  3O76 A;  3VWX A;  5IOW A;  2IJY A;  3M9J A;  1F3B A;  2QA1 A;  3RPP A;  1HQO A;  3G7Y A;  9GSS A;  3CBU A;  3VFI A;  5A4W A;  2PPT A;  1ERU A;  1AIU A;  4O92 A;  3NIV A;  3EWL A;  3L4N A;  1DUG A;  1UN2 A;  3BD2 A;  2VCZ A;  5IMD A;  3QOU A;  2FY6 A;  2CA8 A;  2DJ1 A;  2K6V A;  2LEG A;  1KTE A;  4KUN A;  1PKW A;  2O87 A;  3ZL5 A;  3RPN A;  3DYR A;  1TTZ A;  1PGT A;  1OC8 A;  3PH9 A;  2ON7 A;  1PA3 A;  4MH2 A;  4G0K A;  1ERV A;  1FB0 A;  4BL7 B;  1YDK A;  2I4A A;  4XCS A;  4TVE A;  5INY A;  2XPE A;  2D2Z A;  1XZO A;  3A2W A;  1K0N A;  2DBC A;  1A0R P;  4TR1 A;  1R5A A;  3FW2 A;  2FUG 2;  1VF1 A;  2HLS A;  5ECM B;  1C72 A;  5KOW A;  4MZB A;  4BVY B;  3AY8 A;  4WF4 A;  2V1M A;  1V57 A;  2C3Q A;  5HFI A;  5HR2 A;  5IO0 A;  2HE3 A;  1GSQ A;  1EWX A;  2PU9 C;  1QFN A;  4GF0 A;  1ZYQ B;  3WGE A;  1TXX A;  3LOR A;  4WBR D;  1NW2 A;  2H1G A;  3DD3 A;  3QD9 A;  1TJD A;  3U6V A;  1EP7 A;  3QR6 A;  5G1L A;  4OCE A;  1E2Y A;  2YWN A;  1WWJ A;  1KBN A;  2LJK A;  4BWS A;  2N5B A;  1SJI A;  4NPB A;  3F6D A;  5LD0 A;  4JRR A;  1T4Y A;  5ECH B;  2L59 A;  2IME A;  3F6F A;  2WFC A;  4ECJ A;  5GZZ B;  5ENU A;  4EKZ A;  5D9X A;  2VD0 A;  4POB A;  2UZ8 A;  3TKQ A;  3RAZ A;  2CX4 A;  5JWR B;  4BA7 A;  3MNG A;  4K0G A;  2HXK A;  2M72 A;  1K0D A;  3A3T A;  3HJM A;  3UBL A;  1EZK A;  4POK A;  4JR4 A;  1V2A A;  3GFK A;  3TJB A;  3HDC A;  5ID2 A;  1O81 A;  2HSM A;  3P7X A;  2A4V A;  2TRX A;  3NOF A;  2DJJ A;  5IO2 A;  2MMO A;  2DML A;  4N10 A;  1V9W A;  1O85 A;  3CSI A;  2O8V B;  4ICY A;  1GUL A;  3LW9 A;  2WS2 A;  2VCW A;  3TKS E;  1XW6 A;  3A5I A;  1A2L A;  4K7N A;  3G9B A;  3L9V A;  2L57 A;  2V41 A;  2PBJ A;  1Q4J A;  3SWL A;  3FRC A;  4N11 A;  4XS6 A;  5ECI B;  1B9Y C;  1XBS A;  2CX3 A;  4IHU A;  1M2A A;  5DCG A;  2H19 A;  4PNF A;  4IKH A;  3DML A;  1RQM A;  5DQY A;  3UEM A;  4Z2R A;  1N2A A;  3C71 A;  1HD2 A;  6GSV A;  5HFG A;  1OC3 A;  1THX A;  4CDO A;  5BMU A;  1SL2 B;  3UOM A;  3CTG A;  1PX7 A;  3UBK A;  1BJX A;  1Z7R A;  4PUF C;  3GA4 A;  5A4U A;  2ZUP A;  5DAK B;  2IMF A;  3QPM A;  4FIW A;  4QL7 A;  4XRD A;  4BVX B;  2RLI A;  3LSZ A;  4KB3 A;  1SD8 A;  3GTU A;  1FAA A;  3WT1 A;  1NHO A;  2YP6 A;  5LCZ A;  5KN1 A;  1O7U A;  4GXZ A;  2KOK A;  1ZYN A;  3VPQ A;  1QQ2 A;  4MPF A;  3C73 A;  1M99 A;  1AQV A;  3FZ4 A;  3EIN A;  4BWQ A;  3TKP A;  1XIY A;  2NPB A;  2R6K A;  5CO3 A;  2I81 A;  1Q98 A;  4J56 E;  4KCE A;  4O5R A;  3TRP A;  2BMX A;  3HXS A;  2FD3 A;  2YJH A;  3D6I A;  4K1F A;  3N9J A;  2YOI A;  2VIM A;  4P3Y B;  1FHE A;  2VCX A;  5CRW A;  2GT6 A;  2HT9 A;  5F8B A;  2IN3 A;  1A23 A;  1WOU A;  4O5Q A;  3ZML A;  4K2D A;  3GKK A;  4KSO A;  2B5Y A;  1OAZ A;  4IGJ A;  3RBT A;  1R4W A;  1GH2 A;  4CHS A;  3FYG A;  4K9Z A;  2VL9 A;  1K0A A;  5G2Z A;  2ALB A;  1SYR A;  5D73 A;  2EC4 A;  2F51 A;  4JE1 A;  1DSB A;  1K3L A;  3TRQ A;  3KMN A;  2XC2 A;  3W6G A;  2WGR A;  2HRK A;  2YN1 A;  3P90 A;  1LBK A;  3DWV A;  1SU9 A;  3GV1 A;  3UVH A;  3WYW A;  3IK9 A;  3FY7 A;  4L0W A;  5DVB A;  2YWI A;  4Z2U A;  1K0O A;  1O6J A;  2FA8 A;  2C80 A;  1T7P B;  1GRX A;  4G2E A;  1ZGN A;  3KP9 A;  3DVW A;  1FW1 A;  3HD5 A;  3ME8 A;  4YKG A;  5B8A A;  2H30 A;  5IMF A;  3DGQ A;  5J5N A;  1GSU A;  2A2S A;  3ZVJ A;  3FK8 A;  4DEJ A;  3GSS A;  5CRG A;  4GQF A;  3KCM A;  1ZZY A;  4J57 E;  3M0F A;  2IMI A;  3EMX A;  4WXT A;  3QAW A;  1WE0 A;  4N0Z A;  3HVX A;  2RM6 A;  2FWF A;  4V2N A;  4POM A;  4GST A;  4ULX A;  6GSU A;  2H70 A;  4ZIJ A;  4EE0 A;  1S3A A;  5FT3 A;  3VUR A;  1WRY A;  4K5S A;  1U88 A;  2PN8 A;  2GGT A;  4MJA A;  5C04 A;  4TR1 B;  2H72 A;  1SK2 A;  2GZY A;  2VUP A;  3GX0 A;  1HYU A;  4DSS A;  1GTI A;  4GSS A;  4MF6 A;  1TRS A;  3KJY A;  2B3S A;  1B4P A;  4TR0 A;  3C1S A;  3F4S A;  2O7K A;  4ACS A;  2CAQ A;  4RQR A;  2C3N A;  2OAD A;  2MMA A;  3TDG A;  4H86 A;  6GSW A;  2DJ3 A;  1G0T A;  3W8S A;  2REM A;  2YWM A;  2GQM A;  3GKN A;  4IEL A;  3BCK A;  4USS A;  1A2M A;  1AUC A;  2GZP A;  3LGC A;  2A4H A;  5DDL A;  1OKD A;  1U3I A;  2H6X A;  3FHK A;  1V98 A;  3ZRE A;  4V2L A;  2H8L A;  1GWC A;  2FA4 A;  2PMT A;  2AUV A;  2QGV A;  3IC4 A;  2QSI A;  4TR3 A;  3GRX A;  2E7P A;  3IV4 A;  1M0U A;  1K0B A;  4LLR A;  1JLW A;  1CQG A;  3BOA A;  4ZL7 A;  1Z9H A;  5KN3 A;  2FLS A;  2ON5 A;  2WZ9 A;  2OE3 A;  5KOX A;  3HVV A;  2TRC P;  3F4R A;  1GTB A;  3LYK A;  2V6O A;  4X1U A;  4ZL9 A;  1TOF A;  1BED A;  4I5Q A;  4IJI A;  13GS A;  2FGX A;  1EV4 A;  3EC3 A;  1TW9 A;  1ABA A;  1PL1 A;  2EIO A;  3MAK A;  1DE1 A;  1YKC A;  6GST A;  3BBY A;  3HA9 A;  4Q5R A;  2VCT A;  3A2V A;  3C1R A;  4GWR A;  2DIZ A;  5ID2 B;  2HRN A;  3L78 A;  5H5S A;  1PD2 1;  5HR0 A;  4QL9 A;  4ID0 A;  4G10 A;  4G9H A;  1GL8 A;  2VAF A;  4D73 A;  5FWG A;  2K8S A;  3H79 A;  4NV2 A;  1EGR A;  2XPD A;  4FQU A;  4ZL8 A;  4EF0 A;  1GLP A;  1QK8 A;  1Z6M A;  5J41 A;  3GKX A;  1TU7 A;  1O8X A;  3IPZ A;  3GYK A;  3A2X A;  5E4W A;  5C00 A;  3KTL A;  1YQ1 A;  2LV3 A;  4I97 A;  2XHF A;  5D9T A;  2P5R A;  4WET A;  4X0X A;  1M9A A;  2YNX A;  4LL4 B;  1PKZ A;  1XOB A;  2GLR A;  2ZNM A;  1F9M A;  3HVS A;  2V2G A;  3G7I A;  5GAP D;  4JBB A;  1A0F A;  3NZN A;  4ZB9 A;  2VLU A;  4TKY A;  2RII A;  1NM3 A;  4F0B A;  5LNK e;  4E8E A;  5ELG A;  4PX1 A;  1SL0 B;  4TXV A;  1JLV A;  3KGK A;  3IRA A;  2AV4 A;  1X0R A;  1ZCP A;  3DKS A;  3D21 A;  4I6X A;  4HZ4 A;  4EDZ A;  4POL A;  3HYP A;  4ISD A;  4NWY A;  3IR4 A;  3KM6 A;  5GAN D;  2VCQ A;  4QQ7 A;  3D0Z A;  2FWE A;  4KGI A;  3GTU B;  1K3O A;  4TRX A;  3VI5 A;  1TK8 B;  3ZLP A;  2C0G A;  2V6K A;  1H75 A;  4NHW A;  3WD6 A;  1EV9 A;  2PVO C;  3F0I A;  1G6Y A;  3MIX A;  2YWO A;  5JWQ B;  5H5R A;  2F9S A;  4FYU A;  5ECK B;  1GSY A;  2PVQ A;  4NAX A;  5G30 A;  1YF0 A;  3C7M A;  4AJ8 A;  3LQ7 A;  3ERG A;  2I9H A;  2OBI A;  1S3C A;  3EE2 A;  4Q5Q A;  1QUW A;  3CSJ A;  3KH9 A;  3U5R E;  4EXJ A;  4MF7 A;  16GS A;  3FZ9 A;  4PUA A;  2VD1 A;  1G6W A;  3LXT A;  4MNN A;  6GSX A;  4RUV A;  5IMV A;  4DSR A;  3OR5 A;  2LJA A;  2GQL A;  1F37 A;  4IS0 A;  2TIR A;  2HZF A;  5G5E A;  4EC0 A;  2X99 A;  3M9K A;  3H93 A;  2BTO T;  2H71 A;  3TRX A;  4G0I A;  3IAM 2;  2LNT A;  4TW5 A;  4IJ3 A;  1O73 A;  1EP8 A;  3W8J A;  2XBQ A;  4KH7 A;  1X9W B;  3LXZ A;  1GLQ A;  1W4V A;  1R5P A;  2GSR A;  1FG4 A;  4JED A;  4YAP A;  1O8W A;  2IFQ A;  3BCI A;  3EUR A;  2JU5 A;  2O85 A;  4HEA 2;  4GQC A;  2MBT A;  1YF1 A;  2X8C A;  4ECB A;  3F8U A;  4L5L A;  3ZRD A;  4MK3 A;  3TUE A;  2ZCT A;  3PR8 A;  2H1A A;  1R26 A;  22GS A;  1TU8 A;  5DJL A;  5A4V A;  3EU4 A;  1E6B A;  4TN8 A;  2H6Z A;  3J7Y k;  2CZ2 A;  2L6D A;  1XWB A;  3MSZ A;  3M3M A;  3APO A;  1GSS A;  1T00 A;  1X5C A;  2IWT A;  3F63 A;  2WUL A;  1OKT A;  3QCP A;  4NHZ A;  2R37 A;  2CQ9 A;  1UC7 A;  1TRW A;  6GSY A;  2H66 A;  2DMM A;  4O5U A;  1OC9 A;  2GSS A;  2LJR A;  1X9S B;  4LL1 B;  1WJK A;  1FB6 A;  4PQH A;  1SK0 A;  2QC7 A;  4PGT A;  2L6C A;  2CT6 A;  3KZQ A;  2XBI A;  4TOP A;  1MDI A;  2NVL A;  3WGD A;  5B6N A;  2E2M A;  3ZTL A;  1JZW A;  3FR3 A;  1ACV A;  2B1K A;  3L9U A;  1MTC A;  1XVQ A;  2VM2 A;  4IP1 A;  5IMC A;  3GL5 A;  4OCF A;  2PER A;  4DSS B;  3D5J A;  1RW1 A;  3CXG A;  1FOV A;  3ERW A;  3TJG A;  1OVN A;  2Z9S A;  5DBQ A;  2VO4 A;  1ON4 A;  4YQU A;  2JZS A;  3GMF A;  1IYH A;  1Z5Y E;  4GRF A;  2R4V A;  4ML1 A;  5AIX A;  3N5O A;  5AIS A;  1EEJ A;  4OWY A;  2B5E A;  3IK7 A;  3R3E A;  3EYT A;  4PTS A;  2VL3 A;  2R3X A;  5D93 A;  5CRE A;  4OD7 A;  2LRN A;  2DJ2 A;  5J9B A;  5B7C A;  1SL1 B;  4X43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...