2HINA

Structure of n15 cro at 1.05 a: an ortholog of lambda cro with a completely different but equally effective dimerization mechanism
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAYKLKSDFTSQRMGKEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N15 Cro and lambda Cro: orthologous DNA-binding domains with completely different but equally effective homodimer interfaces.
pubmed doi rcsb
source organism Enterobacteria phage n15
molecule tags Transcription
molecule keywords Repressor protein
total genus 23
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14549 P22_Cro DNA-binding transcriptional regulator Cro
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2hinA00
2CROA 1R63A 1NEQA 2XI8A 1ZZBA 3QYXA 2GRMA 4MCTA 2XSDC 2LYJA 2BNNA 1PRVA 3KXAA 3SCGA 3MLFA 1ZS4A 2EWTA 4JCXA 2LYLA 4X4DA 1IC8A 2JVLA 2IUOA 2LYKA 3RZZA 1ZAYA 1SQ8A 4PU3C 3L1PA 2CSFA 2HINA 2XCJA 3CLCA 4I6TA 1AU7A 1EFAA 3DNVB 2AWIA 3LISA 4I6UA 2EBYA 1RIOA 2IV1A 1QQAA 3EUSA 1GT0C 3SCHA 4X4GA 3OQMA 1CJGA 1WH8A 2IVQA 2AXVA 1DWKA 1YSEA 1UTXA 3S8QA 1ZUGA 1XWRA 4OB4A 1L1MA 3GN5B 3LFPA 2OFYA 5A7LA 2PUFA 3OMTA 1LQCA 2L8NA 1HF0A 3F52A 1ZZ8A 1QP4A 2H8RA 2KPJA 1RZSA 4GHJA 2GZUA 3O9XA 3BD1A 2OR1L 4MCXA 3OQNA 4J1XA 1QPZA 2L49A 1RZRD 1NERA 4Z5HA 2PPXA 1ADRA 2KZ8A 1Y7YA 4PU4C 1LLIA 1X2LA 4JQDA 2KEIA 2KEKA 4PU8A 3JXBC 2O38A 3FYAA 1PERL 3QF3A 2JCGA 3HZIB 1S7EA 1PRAA 1QP0A 2AXZA 1BDIA 4X4CA 1JFTA 2MEZA 1QQBA 1RPEL 2GRLA 2LYRA 2WUSR 2FJRA 2IU7A 3KJXA 4PU7A 4Z5CA 4FN3A 3BDNA 4YG1A 1RZRA 1JH9A 2AW6A 2D5VA 1WIZA 1ZZ6A 4Z58A 1LMB3 3CROL 1R69A 3U3WA 1PRUA 2BNMA 2LCVA 2MQKA 1LCDA 2WIUB 1LCCA 4J1WA 1OSLA 3QWGA 2LYQA 1VPWA 2O4AA 3FMYA 1PNRA 3SCFA 4NDWA 2ICTA 1UXCA 3CECA 5K98B 4X4IA 2BJCA 2PUGA 1ZZCA 2B5AA 1O4XA 2O49A 3OP9A 1Y9QA 3UFDA 1UXDA 3ZKCA 2R63A 2PIJA 4I6RA 3GBFA 1DW9A 2AXUA 2AUWA 3B7HA 4O8BA 4FBIA 2LYPA 1OCTC 2IVGA 2XIUA 2KEJA 3H5TA 3QQ6A 1B0NA 2ICPA 2XJ3A 1QP7A 4F8DA 4JCYA 3G5GA 1CQTA 1WETA 1ZZ9A 2HSGA 3F6WA 4Y42A 4X4HA 2PUBA 4YBAA 4GQMA 3JXCL 1ZPQA 4IWRA 2LYSA 3GN5A 1POUA 2A6CA 3G7DA 1JFSA 3TRBA 1X57A 4YG4A 4YG7B 1ZZ7A 2PUAA 4Z59A 3KZ3A 4X4EA 3FYMA 1BDHA 3ZHMA 3BS3A 3OQOA 2PUCA 2PE5A 3PXPA 3JXDL 1E3OC 1ZVVA 2PUEA 3IVPA 4Z5DA 3ZHIA 4X4BA 4IVZA 3D1NI 2PUDA 4I8TA 4IA8A 3R1FA 2EF8A 2IVBA 2R1JL 4YARA 3F51A 1WH6A 2BNOA 3VK0A 1JWLA 4X4FA
chains in the Genus database with same CATH superfamily
3KL4A 2CROA 3TFLA 2XI8A 2XSDC 2LYJA 3SCGA 5DRTA 2IUOA 2LYKA 1ZAYA 1U2ZA 1SQ8A 4PU3C 1QZXA 3L1PA 2CSFA 4EQZA 4I6TA 3DNVB 2AWIA 3LISA 3VWSA 2IV1A 3S8QA 1ZUGA 1XWRA 1L1MA 3LFPA 2PUFA 2L8NA 1HF0A 3F52A 1QP4A 2KPJA 2GZUA 2PXDA 3QOWA 3OQNA 2L49A 1NERA 3MEJA 2KEIA 4PU8A 1PRAA 1BDIA 4X4CA 3A9YA 2LLVA 2GRLA 3LQXA 3TELA 3SX0A 2V3CC 1LMB3 1R69A 3U3WA 2BNMA 2LYQA 4O8BA 2J7UA 4FBIA 2PXLA 2XIUA 3H5TA 3QQ6A 3UWPA 1B0NA 3JXCL 1ZPQA 3G7DA 3GZCA 2PUAA 4Z59A 3JXDL 1ZVVA 3D1NI 3PE5A 2IVBA 2R1JL 3F51A 3VK0A 3NROA 5DTMA 3A9ZA 1ZZBA 2GRMA 1PRVA 2YBDA 4JCXA 4X4DA 1IC8A 2HINA 4Q2JA 1RIOA 4DE9A 3EUSA 3SCHA 4X4GA 1YSEA 1UTXA 1MFQC 2LNMA 2PXBA 2O38A 3FYAA 1QP0A 2AXZA 2PXEA 1JFTA 2MEZA 1RPEL 4PU7A 2AW6A 1LCDA 2LCVA 2XXAA 2WIUB 1LCCA 1OSLA 3QWGA 2PXQA 3FMYA 1PNRA 2ICTA 3CECA 4X4IA 2B5AA 1O4XA 2O49A 3OP9A 1Y9QA 2R63A 4I6RA 1DW9A 2AUWA 3B7HA 2HCNA 2FFHA 2MXDA 2XJ3A 1QP7A 4F8DA 4JCYA 2PUBA 1WETA 1ZZ9A 3F6WA 3OWQA 4GQMA 4IWRA 2LYSA 4YG4A 4YG7B 4X4EA 3ZPXA 3FYMA 3OQOA 4IVZA 2PUDA 2EF8A 4YARA 1JWLA 2ODRD 4WVLA 1R63A 1DULA 4MCTA 1ZS4A 2JVLA 3RZZA 3A9XA 1AU7A 1HQ1A 1EFAA 4I6UA 2EBYA 1QQAA 1GT0C 3OQMA 4EZIA 2XXPA 2IVQA 2PXFA 5A7LA 1LQCA 2JQEA 2H8RA 1RZSA 3BD1A 2OR1L 3M9LA 4J1XA 5GAGi 3R09A 3TEPA 1ADRA 2KZ8A 1LLIA 4JQDA 1X2LA 3JXBC 1PERL 2JCGA 3HZIB 4ER5A 1QQBA 3KJXA 4Z5CA 3BDNA 3NDBB 1JH9A 4YG1A 1PRUA 2MQKA 4J1WA 2PXVA 1VPWA 2O4AA 5DTRA 2PUGA 3UFDA 1UXDA 2PIJA 2AXUA 2ICPA 3ME5A 3OKZA 3QOXA 3DM5A 4Y42A 4ER0A 3GN5A 2A6CA 1JFSA 3G0TA 1ZZ7A 3NXHA 2PXUA 5DTQA 2PUCA 2PE5A 3PXPA 1E3OC 2PUEA 3ZHIA 4I8TA 4EKIA 4IA8A 3GZDA 2BNOA 2D5VA 1NEQA 3QYXA 2BNNA 3KXAA 3MLFA 2EWTA 2LYLA 2HFZA 3GZDC 2PXKA 2XCJA 3CLCA 2VEOA 3GUUA 1CJGA 5DSXA 4OBMA 1WH8A 2AXVA 1DWKA 4OB4A 4ER3A 3GN5B 2OFYA 3OMTA 1QB2A 1ZZ8A 4GHJA 3O9XA 4MCXA 3NZLA 1QPZA 1RZRD 4Z5HA 2PPXA 4HRAA 1Y7YA 4PU4C 4EKGA 5DRYA 4DE8A 2KEKA 3QF3A 2PXTA 2LLWA 1S7EA 2HCSA 1NW3A 4ER7A 2LYRA 2WUSR 2FJRA 2IU7A 4FN3A 3CROL 1RZRA 1WIZA 1ZZ6A 4Z58A 5GAHi 4EK9A 3SCFA 4NDWA 5K98B 1UXCA 2BJCA 1ZZCA 3ZKCA 3GBFA 2J7WA 1OCTC 2LYPA 2IVGA 2KEJA 2L1PA 5DT2A 2PXPA 3QFIA 3G5GA 1CQTA 4X4HA 2HSGA 4YBAA 1POUA 2M4HA 3TRBA 1X57A 3KZ3A 1BDHA 3ZHMA 3SR4A 5JUWA 3BS3A 4ER6A 3IVPA 4Z5DA 4X4BA 3R1FA 2XXQA 1WH6A 4X4FA
chains in the Genus database with same CATH topology
2CROA 1R63A 1NEQA 2XI8A 1ZZBA 3QYXA 2GRMA 4MCTA 2XSDC 2LYJA 2BNNA 1PRVA 3KXAA 3SCGA 3MLFA 1ZS4A 2EWTA 4JCXA 2LYLA 4X4DA 1IC8A 2JVLA 2IUOA 2LYKA 3RZZA 1ZAYA 1SQ8A 4PU3C 3L1PA 2CSFA 2HINA 2XCJA 3CLCA 4I6TA 1AU7A 1EFAA 3DNVB 2AWIA 3LISA 4I6UA 2EBYA 1RIOA 2IV1A 1QQAA 3EUSA 1GT0C 3SCHA 4X4GA 3OQMA 1CJGA 1WH8A 2IVQA 2AXVA 1DWKA 1YSEA 1UTXA 3S8QA 1ZUGA 1XWRA 4OB4A 1L1MA 3GN5B 3LFPA 2OFYA 5A7LA 2PUFA 3OMTA 1LQCA 2L8NA 1HF0A 3F52A 1ZZ8A 1QP4A 2H8RA 2KPJA 1RZSA 4GHJA 2GZUA 3O9XA 3BD1A 2OR1L 4MCXA 3OQNA 4J1XA 1QPZA 2L49A 1RZRD 1NERA 4Z5HA 2PPXA 1ADRA 2KZ8A 1Y7YA 4PU4C 1LLIA 1X2LA 4JQDA 2KEIA 2KEKA 4PU8A 3JXBC 2O38A 3FYAA 1PERL 3QF3A 2JCGA 3HZIB 1S7EA 1PRAA 1QP0A 2AXZA 1BDIA 4X4CA 1JFTA 2MEZA 1QQBA 1RPEL 2GRLA 2LYRA 2WUSR 2FJRA 2IU7A 3KJXA 4PU7A 4Z5CA 4FN3A 3BDNA 4YG1A 1RZRA 1JH9A 2AW6A 2D5VA 1WIZA 1ZZ6A 4Z58A 1LMB3 3CROL 1R69A 3U3WA 1PRUA 2BNMA 2LCVA 2MQKA 1LCDA 2WIUB 1LCCA 4J1WA 1OSLA 3QWGA 2LYQA 1VPWA 2O4AA 3FMYA 1PNRA 3SCFA 4NDWA 2ICTA 1UXCA 3CECA 5K98B 4X4IA 2BJCA 2PUGA 1ZZCA 2B5AA 1O4XA 2O49A 3OP9A 1Y9QA 3UFDA 1UXDA 3ZKCA 2R63A 2PIJA 4I6RA 3GBFA 1DW9A 2AXUA 2AUWA 3B7HA 4O8BA 4FBIA 2LYPA 1OCTC 2IVGA 2XIUA 2KEJA 3H5TA 3QQ6A 1B0NA 2ICPA 2XJ3A 1QP7A 4F8DA 4JCYA 3G5GA 1CQTA 1WETA 1ZZ9A 2HSGA 3F6WA 4Y42A 4X4HA 2PUBA 4YBAA 4GQMA 3JXCL 1ZPQA 4IWRA 2LYSA 3GN5A 1POUA 2A6CA 3G7DA 1JFSA 3TRBA 1X57A 4YG4A 4YG7B 1ZZ7A 2PUAA 4Z59A 3KZ3A 4X4EA 3FYMA 1BDHA 3ZHMA 3BS3A 3OQOA 2PUCA 2PE5A 3PXPA 3JXDL 1E3OC 1ZVVA 2PUEA 3IVPA 4Z5DA 3ZHIA 4X4BA 4IVZA 3D1NI 2PUDA 4I8TA 4IA8A 3R1FA 2EF8A 2IVBA 2R1JL 4YARA 3F51A 1WH6A 2BNOA 3VK0A 1JWLA 4X4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRO A;  1R63 A;  1NEQ A;  2XI8 A;  1ZZB A;  3QYX A;  2GRM A;  4MCT A;  2XSD C;  2LYJ A;  2BNN A;  1PRV A;  3KXA A;  3SCG A;  3MLF A;  1ZS4 A;  2EWT A;  4JCX A;  2LYL A;  4X4D A;  1IC8 A;  2JVL A;  2IUO A;  2LYK A;  3RZZ A;  1ZAY A;  1SQ8 A;  4PU3 C;  3L1P A;  2CSF A;  2HIN A;  2XCJ A;  3CLC A;  4I6T A;  1AU7 A;  1EFA A;  3DNV B;  2AWI A;  3LIS A;  4I6U A;  2EBY A;  1RIO A;  2IV1 A;  1QQA A;  3EUS A;  1GT0 C;  3SCH A;  4X4G A;  3OQM A;  1CJG A;  1WH8 A;  2IVQ A;  2AXV A;  1DWK A;  1YSE A;  1UTX A;  3S8Q A;  1ZUG A;  1XWR A;  4OB4 A;  1L1M A;  3GN5 B;  3LFP A;  2OFY A;  5A7L A;  2PUF A;  3OMT A;  1LQC A;  2L8N A;  1HF0 A;  3F52 A;  1ZZ8 A;  1QP4 A;  2H8R A;  2KPJ A;  1RZS A;  4GHJ A;  2GZU A;  3O9X A;  3BD1 A;  2OR1 L;  4MCX A;  3OQN A;  4J1X A;  1QPZ A;  2L49 A;  1RZR D;  1NER A;  4Z5H A;  2PPX A;  1ADR A;  2KZ8 A;  1Y7Y A;  4PU4 C;  1LLI A;  1X2L A;  4JQD A;  2KEI A;  2KEK A;  4PU8 A;  3JXB C;  2O38 A;  3FYA A;  1PER L;  3QF3 A;  2JCG A;  3HZI B;  1S7E A;  1PRA A;  1QP0 A;  2AXZ A;  1BDI A;  4X4C A;  1JFT A;  2MEZ A;  1QQB A;  1RPE L;  2GRL A;  2LYR A;  2WUS R;  2FJR A;  2IU7 A;  3KJX A;  4PU7 A;  4Z5C A;  4FN3 A;  3BDN A;  4YG1 A;  1RZR A;  1JH9 A;  2AW6 A;  2D5V A;  1WIZ A;  1ZZ6 A;  4Z58 A;  1LMB 3;  3CRO L;  1R69 A;  3U3W A;  1PRU A;  2BNM A;  2LCV A;  2MQK A;  1LCD A;  2WIU B;  1LCC A;  4J1W A;  1OSL A;  3QWG A;  2LYQ A;  1VPW A;  2O4A A;  3FMY A;  1PNR A;  3SCF A;  4NDW A;  2ICT A;  1UXC A;  3CEC A;  5K98 B;  4X4I A;  2BJC A;  2PUG A;  1ZZC A;  2B5A A;  1O4X A;  2O49 A;  3OP9 A;  1Y9Q A;  3UFD A;  1UXD A;  3ZKC A;  2R63 A;  2PIJ A;  4I6R A;  3GBF A;  1DW9 A;  2AXU A;  2AUW A;  3B7H A;  4O8B A;  4FBI A;  2LYP A;  1OCT C;  2IVG A;  2XIU A;  2KEJ A;  3H5T A;  3QQ6 A;  1B0N A;  2ICP A;  2XJ3 A;  1QP7 A;  4F8D A;  4JCY A;  3G5G A;  1CQT A;  1WET A;  1ZZ9 A;  2HSG A;  3F6W A;  4Y42 A;  4X4H A;  2PUB A;  4YBA A;  4GQM A;  3JXC L;  1ZPQ A;  4IWR A;  2LYS A;  3GN5 A;  1POU A;  2A6C A;  3G7D A;  1JFS A;  3TRB A;  1X57 A;  4YG4 A;  4YG7 B;  1ZZ7 A;  2PUA A;  4Z59 A;  3KZ3 A;  4X4E A;  3FYM A;  1BDH A;  3ZHM A;  3BS3 A;  3OQO A;  2PUC A;  2PE5 A;  3PXP A;  3JXD L;  1E3O C;  1ZVV A;  2PUE A;  3IVP A;  4Z5D A;  3ZHI A;  4X4B A;  4IVZ A;  3D1N I;  2PUD A;  4I8T A;  4IA8 A;  3R1F A;  2EF8 A;  2IVB A;  2R1J L;  4YAR A;  3F51 A;  1WH6 A;  2BNO A;  3VK0 A;  1JWL A;  4X4F A; 
#chains in the Genus database with same CATH topology
 3KL4 A;  2CRO A;  3TFL A;  2XI8 A;  2XSD C;  2LYJ A;  3SCG A;  5DRT A;  2IUO A;  2LYK A;  1ZAY A;  1U2Z A;  1SQ8 A;  4PU3 C;  1QZX A;  3L1P A;  2CSF A;  4EQZ A;  4I6T A;  3DNV B;  2AWI A;  3LIS A;  3VWS A;  2IV1 A;  3S8Q A;  1ZUG A;  1XWR A;  1L1M A;  3LFP A;  2PUF A;  2L8N A;  1HF0 A;  3F52 A;  1QP4 A;  2KPJ A;  2GZU A;  2PXD A;  3QOW A;  3OQN A;  2L49 A;  1NER A;  3MEJ A;  2KEI A;  4PU8 A;  1PRA A;  1BDI A;  4X4C A;  3A9Y A;  2LLV A;  2GRL A;  3LQX A;  3TEL A;  3SX0 A;  2V3C C;  1LMB 3;  1R69 A;  3U3W A;  2BNM A;  2LYQ A;  4O8B A;  2J7U A;  4FBI A;  2PXL A;  2XIU A;  3H5T A;  3QQ6 A;  3UWP A;  1B0N A;  3JXC L;  1ZPQ A;  3G7D A;  3GZC A;  2PUA A;  4Z59 A;  3JXD L;  1ZVV A;  3D1N I;  3PE5 A;  2IVB A;  2R1J L;  3F51 A;  3VK0 A;  3NRO A;  5DTM A;  3A9Z A;  1ZZB A;  2GRM A;  1PRV A;  2YBD A;  4JCX A;  4X4D A;  1IC8 A;  2HIN A;  4Q2J A;  1RIO A;  4DE9 A;  3EUS A;  3SCH A;  4X4G A;  1YSE A;  1UTX A;  1MFQ C;  2LNM A;  2PXB A;  2O38 A;  3FYA A;  1QP0 A;  2AXZ A;  2PXE A;  1JFT A;  2MEZ A;  1RPE L;  4PU7 A;  2AW6 A;  1LCD A;  2LCV A;  2XXA A;  2WIU B;  1LCC A;  1OSL A;  3QWG A;  2PXQ A;  3FMY A;  1PNR A;  2ICT A;  3CEC A;  4X4I A;  2B5A A;  1O4X A;  2O49 A;  3OP9 A;  1Y9Q A;  2R63 A;  4I6R A;  1DW9 A;  2AUW A;  3B7H A;  2HCN A;  2FFH A;  2MXD A;  2XJ3 A;  1QP7 A;  4F8D A;  4JCY A;  2PUB A;  1WET A;  1ZZ9 A;  3F6W A;  3OWQ A;  4GQM A;  4IWR A;  2LYS A;  4YG4 A;  4YG7 B;  4X4E A;  3ZPX A;  3FYM A;  3OQO A;  4IVZ A;  2PUD A;  2EF8 A;  4YAR A;  1JWL A;  2ODR D;  4WVL A;  1R63 A;  1DUL A;  4MCT A;  1ZS4 A;  2JVL A;  3RZZ A;  3A9X A;  1AU7 A;  1HQ1 A;  1EFA A;  4I6U A;  2EBY A;  1QQA A;  1GT0 C;  3OQM A;  4EZI A;  2XXP A;  2IVQ A;  2PXF A;  5A7L A;  1LQC A;  2JQE A;  2H8R A;  1RZS A;  3BD1 A;  2OR1 L;  3M9L A;  4J1X A;  5GAG i;  3R09 A;  3TEP A;  1ADR A;  2KZ8 A;  1LLI A;  4JQD A;  1X2L A;  3JXB C;  1PER L;  2JCG A;  3HZI B;  4ER5 A;  1QQB A;  3KJX A;  4Z5C A;  3BDN A;  3NDB B;  1JH9 A;  4YG1 A;  1PRU A;  2MQK A;  4J1W A;  2PXV A;  1VPW A;  2O4A A;  5DTR A;  2PUG A;  3UFD A;  1UXD A;  2PIJ A;  2AXU A;  2ICP A;  3ME5 A;  3OKZ A;  3QOX A;  3DM5 A;  4Y42 A;  4ER0 A;  3GN5 A;  2A6C A;  1JFS A;  3G0T A;  1ZZ7 A;  3NXH A;  2PXU A;  5DTQ A;  2PUC A;  2PE5 A;  3PXP A;  1E3O C;  2PUE A;  3ZHI A;  4I8T A;  4EKI A;  4IA8 A;  3GZD A;  2BNO A;  2D5V A;  1NEQ A;  3QYX A;  2BNN A;  3KXA A;  3MLF A;  2EWT A;  2LYL A;  2HFZ A;  3GZD C;  2PXK A;  2XCJ A;  3CLC A;  2VEO A;  3GUU A;  1CJG A;  5DSX A;  4OBM A;  1WH8 A;  2AXV A;  1DWK A;  4OB4 A;  4ER3 A;  3GN5 B;  2OFY A;  3OMT A;  1QB2 A;  1ZZ8 A;  4GHJ A;  3O9X A;  4MCX A;  3NZL A;  1QPZ A;  1RZR D;  4Z5H A;  2PPX A;  4HRA A;  1Y7Y A;  4PU4 C;  4EKG A;  5DRY A;  4DE8 A;  2KEK A;  3QF3 A;  2PXT A;  2LLW A;  1S7E A;  2HCS A;  1NW3 A;  4ER7 A;  2LYR A;  2WUS R;  2FJR A;  2IU7 A;  4FN3 A;  3CRO L;  1RZR A;  1WIZ A;  1ZZ6 A;  4Z58 A;  5GAH i;  4EK9 A;  3SCF A;  4NDW A;  5K98 B;  1UXC A;  2BJC A;  1ZZC A;  3ZKC A;  3GBF A;  2J7W A;  1OCT C;  2LYP A;  2IVG A;  2KEJ A;  2L1P A;  5DT2 A;  2PXP A;  3QFI A;  3G5G A;  1CQT A;  4X4H A;  2HSG A;  4YBA A;  1POU A;  2M4H A;  3TRB A;  1X57 A;  3KZ3 A;  1BDH A;  3ZHM A;  3SR4 A;  5JUW A;  3BS3 A;  4ER6 A;  3IVP A;  4Z5D A;  4X4B A;  3R1F A;  2XXQ A;  1WH6 A;  4X4F A; 
#chains in the Genus database with same CATH homology
 2CRO A;  1R63 A;  1NEQ A;  2XI8 A;  1ZZB A;  3QYX A;  2GRM A;  4MCT A;  2XSD C;  2LYJ A;  2BNN A;  1PRV A;  3KXA A;  3SCG A;  3MLF A;  1ZS4 A;  2EWT A;  4JCX A;  2LYL A;  4X4D A;  1IC8 A;  2JVL A;  2IUO A;  2LYK A;  3RZZ A;  1ZAY A;  1SQ8 A;  4PU3 C;  3L1P A;  2CSF A;  2HIN A;  2XCJ A;  3CLC A;  4I6T A;  1AU7 A;  1EFA A;  3DNV B;  2AWI A;  3LIS A;  4I6U A;  2EBY A;  1RIO A;  2IV1 A;  1QQA A;  3EUS A;  1GT0 C;  3SCH A;  4X4G A;  3OQM A;  1CJG A;  1WH8 A;  2IVQ A;  2AXV A;  1DWK A;  1YSE A;  1UTX A;  3S8Q A;  1ZUG A;  1XWR A;  4OB4 A;  1L1M A;  3GN5 B;  3LFP A;  2OFY A;  5A7L A;  2PUF A;  3OMT A;  1LQC A;  2L8N A;  1HF0 A;  3F52 A;  1ZZ8 A;  1QP4 A;  2H8R A;  2KPJ A;  1RZS A;  4GHJ A;  2GZU A;  3O9X A;  3BD1 A;  2OR1 L;  4MCX A;  3OQN A;  4J1X A;  1QPZ A;  2L49 A;  1RZR D;  1NER A;  4Z5H A;  2PPX A;  1ADR A;  2KZ8 A;  1Y7Y A;  4PU4 C;  1LLI A;  1X2L A;  4JQD A;  2KEI A;  2KEK A;  4PU8 A;  3JXB C;  2O38 A;  3FYA A;  1PER L;  3QF3 A;  2JCG A;  3HZI B;  1S7E A;  1PRA A;  1QP0 A;  2AXZ A;  1BDI A;  4X4C A;  1JFT A;  2MEZ A;  1QQB A;  1RPE L;  2GRL A;  2LYR A;  2WUS R;  2FJR A;  2IU7 A;  3KJX A;  4PU7 A;  4Z5C A;  4FN3 A;  3BDN A;  4YG1 A;  1RZR A;  1JH9 A;  2AW6 A;  2D5V A;  1WIZ A;  1ZZ6 A;  4Z58 A;  1LMB 3;  3CRO L;  1R69 A;  3U3W A;  1PRU A;  2BNM A;  2LCV A;  2MQK A;  1LCD A;  2WIU B;  1LCC A;  4J1W A;  1OSL A;  3QWG A;  2LYQ A;  1VPW A;  2O4A A;  3FMY A;  1PNR A;  3SCF A;  4NDW A;  2ICT A;  1UXC A;  3CEC A;  5K98 B;  4X4I A;  2BJC A;  2PUG A;  1ZZC A;  2B5A A;  1O4X A;  2O49 A;  3OP9 A;  1Y9Q A;  3UFD A;  1UXD A;  3ZKC A;  2R63 A;  2PIJ A;  4I6R A;  3GBF A;  1DW9 A;  2AXU A;  2AUW A;  3B7H A;  4O8B A;  4FBI A;  2LYP A;  1OCT C;  2IVG A;  2XIU A;  2KEJ A;  3H5T A;  3QQ6 A;  1B0N A;  2ICP A;  2XJ3 A;  1QP7 A;  4F8D A;  4JCY A;  3G5G A;  1CQT A;  1WET A;  1ZZ9 A;  2HSG A;  3F6W A;  4Y42 A;  4X4H A;  2PUB A;  4YBA A;  4GQM A;  3JXC L;  1ZPQ A;  4IWR A;  2LYS A;  3GN5 A;  1POU A;  2A6C A;  3G7D A;  1JFS A;  3TRB A;  1X57 A;  4YG4 A;  4YG7 B;  1ZZ7 A;  2PUA A;  4Z59 A;  3KZ3 A;  4X4E A;  3FYM A;  1BDH A;  3ZHM A;  3BS3 A;  3OQO A;  2PUC A;  2PE5 A;  3PXP A;  3JXD L;  1E3O C;  1ZVV A;  2PUE A;  3IVP A;  4Z5D A;  3ZHI A;  4X4B A;  4IVZ A;  3D1N I;  2PUD A;  4I8T A;  4IA8 A;  3R1F A;  2EF8 A;  2IVB A;  2R1J L;  4YAR A;  3F51 A;  1WH6 A;  2BNO A;  3VK0 A;  1JWL A;  4X4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...