2HIOC

Histone octamer (chicken), chromosomal protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HISTONE H2A)
publication title The nucleosomal core histone octamer at 3.1 A resolution: a tripartite protein assembly and a left-handed superhelix.
pubmed doi rcsb
molecule tags Structural protein,dna binding protein
total genus 31
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2hioC00
3B6FD 4Z2MH 3O62A 3KXBC 3REJB 4WU9B 3WKJA 3UTAA 1M19D 4X23B 5GSUB 3UT9C 4G92C 4WZSB 1WWSA 3AFAA 3WA9A 3REKA 3LZ0B 3AN2D 3MGPB 4Z66A 4WU9C 3REJC 4YM6A 3X1SD 1H3OA 1TAFA 3KSYA 2JSSA 5E5AA 1ID3B 1F66A 2AROB 3V9RB 4X23C 5GSUC 5AV6B 5B0ZD 3MNNA 1KX5B 3TU4B 5B2JA 4XUJB 3MGRD 1P3GD 5AV9D 3LZ0C 4J8VD 3MGPC 2PYOA 3X1VB 3AZMD 4CSRA 3REHA 1ID3C 2AROC 4KGCD 3AZLD 4ZUXA 5AV6C 2BYMA 1M1AB 1KX3D 4H9NB 3AZJA 3X1UB 1BH9A 2NQBB 4XUJC 5B0YD 4LD9A 3X1VC 4Z2MG 4DRAA 5AVCB 3MVDD 1P34B 5B1LA 1M1AC 3KWQB 3X1UC 3VH5T 2NQBC 1EQZD 3AZFD 3AZHA 5B1MC 5GT0A 5B31G 5F99B 5B33A 5CP6C 5AV8D 4R8PC 5AVCC 1P3AD 1P34C 4WNNB 4ZBJB 3LZ1B 1M18B 3WTPE 4H9RA 2FJ7D 4H9SC 3KWQC 3C1CA 3REIB 3NQUB 3AV2B 1P3BB 1HQ3D 5F99C 4WU9D 3KUYB 3LJAB 4ZBJC 3LZ1C 3W96D 2F8NH 5B1MA 5B40A 5CP6A 3AV2C 1P3BC 5B32A 4WU8A 3VH6T 4R8PA 3MGPD 3B0CT 1P3MB 3W97D 4CAYA 3B6GC 5BO0B 1ID3D 1P3PB 3AZGB 2AROD 4XZQA 1BFMA 4QLCB 3NQJB 3B0BA 5CPKB 1KX5D 3TU4D 1P3OA 4YS3B 1U35A 1N1JA 1WWIA 5FUGA 3O62B 1P3MC 3UTAB 3X1TA 4WNNA 3WKJB 1P3PC 2CV5D 5AY8C 3AZGC 3A6NB 1TZYC 5CPKC 1M1AD 3AV1A 3AFAB 3WA9B 3X1UD 3REKB 4KUDA 4YS3C 2NQBD 3WAAA 2HUEB 5CPJD 3B6GA 4Z66B 3O62C 4YM6B 2LY8A 3WKJC 5AVBD 1H3OB 1TAFB 5E5AB 1F66B 1KX4C 3VH6W 5BT1D 3B0CW 3A6NC 4Z5TD 3LELC 3MGQA 5GXQA 3MNNB 5B2JB 3AFAC 3KWQD 3WA9C 3REKC 2L5AA 1P3FA 2F8NG 2HUEC 4Z66C 4YM6C 2PYOB 5AY8A 4CSRB 3REHB 5E5AC 1M19A 1TZYA 1F66C 5CPKA 4ZUXB 5DNMC 3LZ1D 2BYMB 4YS3A 1M18D 3MNNC 3AZJB 1BH9B 5B2JC 5JA4A 5B2IA 3REID 3AYWC 3AN2A 4LD9B 2PYOC 1AOID 1KX4A 3RELA 3REHC 3LELA 3A6NA 1R4VA 5CPIA 3KUYD 3AZID 3AZND 3LJAD 4ZUXC 4J8UC 5B1LB 3AZJC 2HIOD 4J8XD 3MGRA 3AZHB 4J8VA 4E44A 4JJND 5GT0B 2YFVA 4LD9C 5B33B 3AZMA 5DNMA 1P3LD 4H9OA 4KGCA 3W98D 2BYKA 3AYWA 4DRBA 5B1LC 4H9RB 1KX3A 4QLCD 3C1CB 3VH5A 3AZHC 1JFIA 5GT0C 5B33C 2NZDA 3UTAD 4J8UA 2RVQD 1Q9CA 4J8WD 3MVDA 1P3IA 4WV4B 3C1CC 5DNNA 5B1MB 1EQZA 3WA9D 5B40B 3AZFA 3R45A 5CP6B 5B32B 4WU8B 4R8PB 5AV5D 2F8ND 4CAYB 5B24A 5AV8A 3B0DB 1ZLAD 1P3AA 3MGSD 4XZQB 2FJ7A 3UTBA 3MNND 1P3OB 3KXBD 5B40C 1U35B 1N1JB 5FUGB 5B32C 1HQ3A 4WU8C 3X1TB 2PYOD 3UT9D 3B0DC 3W96A 4G91B 4XZQC 1P3KC 3AV1B 3C1BC 1P3OC 4KUDB 1U35C 3WTPB 3REJD 3WAAB 3B6GB 4LD9D 3X1TC 3W97A 4X23D 5GSUD 3MGQB 4G91C 3AZEA 1S32B 5GXQB 3LZ0D 3AV1C 2YFWA 4KUDC 1P3FB 3WTPC 3AZHD 3WAAC 5KDMA 5AY8B 5B33D 1M19B 1TZYB 5AV6D 5GT3A 1P3KA 3MGQC 3C1BA 4XUJD 1S32C 5GXQC 3W99A 2F8NK 5JA4B 5B2IB 3C1CD 1P3FC 5JRGA 3AN2B 3X1VD 5CPJA 5G49A 1KX4B 5AVBA 3RELB 3LELB 5B31A 1M19C 5CPIB 4Z5TA 3WTPA 4UUZA 5B2IC 3MGRB 5B1MD 5AV9B 5B40D 4J8VB 3AZKA 3AN2C 5CP6D 2YFVB 5B32D 4R8PD 3AZMB 3RELC 5AVCD 1P34D 5DNMB 5CPIC 4H9OB 1S32A 4KGCB 1BH8A 2BYKB 3AYWB 2IO5B 4E45A 1KX3B 3B6FA 3MGRC 1P3GC 5AV9C 5F99D 5BS7A 1P3OD 5BNXA 4J8VC 1JFIB 1AOIA 3AZMC 2NZDB 4J8UB 3MVDB 4KGCC 3AZNA 1P3IB 2IO5C 1KX3C 5DNNB 2HIOA 4J8XA 3AV2D 1P3BD 1EQZB 3AZFB 3X1SA 3R45B 4JJNA 3B6GD 2NZDC 4NE3A 5B24B 5AV8B 1P3LA 5B0ZA 1P3AB 3MVDC 3W98A 1P3IC 1P3GA 2FJ7B 5AV9A 3UTBB 5GXQD 5DNNC 1EQZC 3AZFC 1P3MD 1HQ3B 1P3PD 3AZLA 5AY8D 3AZGD 5B24C 5AV8C 4J8WA 1TZYD 1P3AC 2CWEA 5CPKD 3W96B 2FJ7C 4YS3D 3UTBC 5B0YA 3O62D 5B2ID 3WKJD 1HQ3C 5AV5A 2F8NA 3W97B 1KX4D 3RELD 3LELD 3A6ND 1ZLAA 5CPID 5BNVA 4H9PA 3W96C 3MGSA 3AZEB 3AFAD 3REKD 2YFWB 4HGAB 4Z66D 3KXBA 4YM6D 5KDMB 4H9QB 5E5AD 4NFTA 1F66D 3W97C 3UT9A 1HTAA 5DNMD 2CV5B 5GT3B 1P3KB 3C1BB 5B2JD 3AZEC 5B32G 3AYWD 1A7WA 3W99B 4HGAC 1KX5C 1B6WA 3TU4C 4WU9A 3VH6A 5JRGB 3REJA 5CPJB 5G49B 3REHD 5AVBB 4X23A 2NZDD 5GSUA 5B31B 4ZUXD 4J8UD 2CV5C 5GT3C 3AZJD 4Z5TB 1P3ID 4UUZB 3W99C 1F1EA 3LZ0A 3MGPA 5DNND 5JRGC 3AZKB 5CPJC 1ID3A 2AROA 5AVBC 3V9RA 5B31C 5B24D 5AV6A 5B1LD 4KHAB 1BH8B 5BT1C 4Z5TC 3TU4A 1KX5A 4XUJA 3B6FB 3UTBD 4H9QA 5GT0D 5BNXB 3AZKC 3X1VA 4M6BA 2CV5A 1ULYA 1AOIB 3AZIB 3AZNB 1M1AA 4H9NA 3X1UA 2NQBA 4NE5A 1M18C 3B6FC 2HIOB 4J8XB 3REIC 3X1SB 5BS7C 4JJNB 1AOIC 4EO5B 5C3IB 5AVCA 3VH5W 1P34A 1P3LB 3KUYC 5B0ZB 3AZIC 3W98B 3AZNC 4H9SA 3KWQA 3LJAC 1P3GB 3AZED 2HIOC 4J8XC 4WU8D 3X1SC 5F99A 5CHLB 4JJNC 4KHAA 4EO5C 3AZLB 5C3IC 1P3LC 3LZ1A 4J8WB 4XZQD 5B0ZC 1M18A 3W98C 5GT3D 1P3KD 3REIA 3NQUA 3C1BD 1B67A 4QLCC 5B0YB 3W99D 1U35D 3AV2A 4AWLB 1P3BA 5JRGD 3X1TD 5AV5B 3KUYA 2F8NB 3AZIA 3AZLC 3LJAA 3UTAC 2RVQC 1KU5A 5B31D 4J8WC 5BNVB 1ZLAB 4H9PB 3MGSB 3AV1D 4KUDD 5B0YC 3WTPD 4AWLC 4NE6A 3WAAD 3KXBB 1P3MA 3AZKD 5AV5C 5BO0A 1P3PA 3AZGA 3UT9B 3MGQD 1ZLAC 4G92B 4QLCA 3NQJA 1S32D 3MGSC 1P3FD
chains in the Genus database with same CATH superfamily
3B6FD 2Y2HA 4Z2MH 3O62A 3KXBC 3REJB 4WU9B 3WKJA 3UTAA 1M19D 4X23B 5GSUB 3UT9C 4G92C 4WZSB 1WWSA 3AFAA 3WA9A 3REKA 2Y2PA 3LZ0B 3AN2D 3MGPB 4Z66A 4WU9C 3REJC 4YM6A 3X1SD 1H3OA 2ZM5A 1TAFA 3KSYA 2JSSA 5E5AA 1ID3B 1F66A 2AROB 2Y2MA 3V9RB 4X23C 5GSUC 5AV6B 5B0ZD 3MNNA 1KX5B 3TU4B 5B2JA 4XUJB 3MGRD 1P3GD 5AV9D 3LZ0C 4J8VD 3MGPC 2ZY5A 2PYOA 3X1VB 3AZMD 4CSRA 3REHA 1ID3C 2AROC 4KGCD 3AZLD 4ZUXA 5AV6C 2BYMA 1M1AB 1KX3D 3EPHA 4H9NB 3AZJA 3X1UB 1BH9A 2NQBB 4XUJC 5B0YD 4LD9A 2XD1A 3X1VC 4Z2MG 4DRAA 2ZY3A 5AVCB 3MVDD 1P34B 2G5IC 5B1LA 1M1AC 3KWQB 3X1UC 3VH5T 3P5JB 2NQBC 1EQZD 3AZFD 3AZHA 3F6TA 5B1MC 5GT0A 5B31G 5F99B 5B33A 5CP6C 5AV8D 4R8PC 5AVCC 1P3AD 1P34C 4WNNB 2Y2NA 4ZBJB 3LZ1B 1M18B 3WTPE 4H9RA 2FJ7D 4H9SC 3KWQC 3C1CA 3REIB 3NQUB 3AV2B 1P3BB 1HQ3D 5F99C 3AL0C 4WU9D 3KUYB 3LJAB 1W2EA 4ZBJC 3LZ1C 3W96D 2F8NH 5B1MA 5B40A 5CP6A 3AV2C 1P3BC 5B32A 4WU8A 3VH6T 4R8PA 3MGPD 3B0CT 3EPJA 1P3MB 3W97D 4CAYA 3B6GC 5BO0B 1ID3D 1P3PB 3AZGB 2AROD 2XD5A 4XZQA 1BFMA 4QLCB 2DF4C 3NQJB 3B0BA 5CPKB 1KX5D 3TU4D 1P3OA 4YS3B 1U35A 1N1JA 1WWIA 5FUGA 3O62B 3FDDA 1P3MC 3A1KA 3UTAB 4WNNA 3X1TA 3WKJB 2BG1A 1P3PC 2CV5D 5AY8C 3AZGC 3A6NB 1TZYC 2Y2IA 5CPKC 1M1AD 3AV1A 3AFAB 3WA9B 3X1UD 3REKB 4KUDA 4YS3C 2NQBD 3WAAA 2HUEB 5CPJD 3B6GA 4Z66B 3O62C 4YM6B 2LY8A 3WKJC 5AVBD 1H3OB 1TAFB 5E5AB 1F66B 1KX4C 3VH6W 5BT1D 3B0CW 3A6NC 4Z5TD 3LELC 3MGQA 5GXQA 3MNNB 5B2JB 3AFAC 3KWQD 3WA9C 3REKC 2L5AA 1P3FA 2F8NG 2HUEC 4Z66C 4YM6C 2PYOB 5AY8A 4DQYB 4CSRB 3REHB 5E5AC 1M19A 1TZYA 1F66C 5CPKA 4ZUXB 5DNMC 3LZ1D 2BYMB 4YS3A 1M18D 3MNNC 3AZJB 1BH9B 5B2JC 5JA4A 5B2IA 3REID 3AYWC 3AN2A 4LD9B 2PYOC 1AOID 1KX4A 3RELA 3REHC 3LELA 2ZY4A 3A6NA 1R4VA 5CPIA 3KUYD 3AZID 3AZND 3LJAD 4ZUXC 4J8UC 5B1LB 3EG5B 3AZJC 2Y2KA 2HIOD 4J8XD 3MGRA 3AZHB 4J8VA 4E44A 4JJND 5GT0B 2YFVA 4LD9C 5B33B 3AZMA 5DNMA 1P3LD 4H9OA 4KGCA 3W98D 2BYKA 3AYWA 4DRBA 5B1LC 4H9RB 1KX3A 4QLCD 3C1CB 3VH5A 3H0MC 3AZHC 1JFIA 5GT0C 5B33C 2NZDA 3UTAD 4J8UA 2RVQD 1Q9CA 4J8WD 3MVDA 1P3IA 4WV4B 3C1CC 2JE5A 3IP4C 5B1MB 5DNNA 1EQZA 3WA9D 5B40B 3AZFA 3R45A 5CP6B 5B32B 4WU8B 4R8PB 5AV5D 2F8ND 4CAYB 5B24A 5AV8A 3B0DB 1ZLAD 1P3AA 3MGSD 4XZQB 2FJ7A 3UTBA 3MNND 1P3OB 3KXBD 5B40C 1U35B 1N1JB 5FUGB 5B32C 1HQ3A 4WU8C 3X1TB 2VQRA 2PYOD 3UT9D 3B0DC 3W96A 2UWXA 4G91B 4XZQC 2ZY2A 1P3KC 3AV1B 3C1BC 1P3OC 4KUDB 1U35C 3WTPB 3REJD 3WAAB 3B6GB 4LD9D 3X1TC 3W97A 4X23D 5GSUD 3MGQB 4G91C 3AZEA 1S32B 2Y2OA 5GXQB 3LZ0D 3AV1C 2YFWA 3H0LC 4KUDC 1P3FB 3WTPC 3AZHD 3WAAC 5KDMA 5AY8B 5B33D 2DQNC 1M19B 1TZYB 5AV6D 5GT3A 1P3KA 3MGQC 3C1BA 4XUJD 1S32C 5GXQC 3W99A 2F8NK 3EPLA 5JA4B 5B2IB 3C1CD 1P3FC 5JRGA 3AN2B 3X1VD 5CPJA 5G49A 1KX4B 5AVBA 3RELB 3LELB 5B31A 1M19C 5CPIB 2J8PA 4Z5TA 2G5HC 3WTPA 4UUZA 5B2IC 3MGRB 5B1MD 5AV9B 3H0RC 5B40D 4J8VB 3AZKA 3AN2C 5CP6D 2YFVB 5B32D 4R8PD 3AZMB 3RELC 5AVCD 1P34D 5DNMB 5CPIC 4H9OB 1S32A 4KGCB 1BH8A 2BYKB 3AYWB 2IO5B 4E45A 1KX3B 3B6FA 3MGRC 1P3GC 5AV9C 5F99D 5BS7A 1P3OD 5BNXA 4J8VC 1JFIB 2Y2QA 1AOIA 3AZMC 2NZDB 2Y2GA 4J8UB 4UPKA 3MVDB 4KGCC 3AZNA 1P3IB 2IO5C 1KX3C 5DNNB 2HIOA 4J8XA 3AV2D 1P3BD 1EQZB 3AZFB 3X1SA 3R45B 4JJNA 3A1IA 3B6GD 1T3UA 2NZDC 4NE3A 5B24B 5AV8B 1P3LA 5B0ZA 1P3AB 3MVDC 3W98A 1P3IC 1P3GA 2FJ7B 5AV9A 3UTBB 5GXQD 5DNNC 2Y2LA 1EQZC 3AZFC 1P3MD 1HQ3B 1P3PD 3AZLA 5AY8D 3AZGD 5B24C 5AV8C 4J8WA 1TZYD 1P3AC 4WJ3C 2CWEA 5CPKD 3W96B 2Y2JA 2FJ7C 4YS3D 3UTBC 5B0YA 2JCHA 3O62D 5B2ID 3WKJD 1HQ3C 5AV5A 2F8NA 3W97B 1KX4D 3RELD 3LELD 3A6ND 1ZLAA 5CPID 5BNVA 4H9PA 3W96C 3MGSA 3AZEB 3AFAD 3REKD 2YFWB 4HGAB 4Z66D 3KXBA 4YM6D 5KDMB 4H9QB 5E5AD 4NFTA 1F66D 3W97C 2W8SA 3UT9A 1HTAA 5DNMD 2CV5B 5GT3B 1P3KB 3C1BB 5B2JD 3AZEC 5B32G 2RIQA 3AYWD 1A7WA 3W99B 4HGAC 1KX5C 1B6WA 3TU4C 4WU9A 3VH6A 5JRGB 3REJA 1Z2CB 5CPJB 5G49B 3REHD 5AVBB 4X23A 2NZDD 5GSUA 5B31B 4ZUXD 4J8UD 2CV5C 5GT3C 3AZJD 4Z5TB 1P3ID 4UUZB 3W99C 1F1EA 3LZ0A 3MGPA 5DNND 5JRGC 3AZKB 5CPJC 1ID3A 2AROA 5AVBC 3V9RA 5B31C 5B24D 5AV6A 5B1LD 4KHAB 1BH8B 5BT1C 4Z5TC 3TU4A 1KX5A 4XUJA 3B6FB 3UTBD 4H9QA 5GT0D 5BNXB 3AZKC 3X1VA 4M6BA 2CV5A 1ULYA 1AOIB 3AZIB 3KFUG 3AZNB 1M1AA 4H9NA 3X1UA 2NQBA 4NE5A 1M18C 3B6FC 2HIOB 4J8XB 3REIC 3X1SB 5BS7C 4JJNB 1AOIC 4EO5B 5C3IB 5AVCA 3VH5W 1P34A 1P3LB 3KUYC 5B0ZB 3AZIC 3W98B 3AZNC 4H9SA 3KWQA 3LJAC 1P3GB 3AZED 2HIOC 4J8XC 4WU8D 3X1SC 5F99A 5CHLB 4JJNC 4KHAA 4EO5C 3AZLB 5C3IC 1P3LC 3LZ1A 4J8WB 4XZQD 5B0ZC 1M18A 3W98C 5GT3D 1P3KD 2F2AC 3REIA 3EPKA 3NQUA 2FFFB 3C1BD 1B67A 4QLCC 5B0YB 3W99D 1U35D 3AV2A 4AWLB 1P3BA 5JRGD 3X1TD 5AV5B 3KUYA 2F8NB 3AZIA 3AZLC 3LJAA 3UTAC 2RVQC 1KU5A 5B31D 4J8WC 5BNVB 1ZLAB 4H9PB 3MGSB 3AV1D 4KUDD 5B0YC 3WTPD 4AWLC 4NE6A 3WAAD 3KXBB 1P3MA 3AZKD 5AV5C 5BO0A 1P3PA 3AZGA 3UT9B 3MGQD 1ZLAC 1PZRA 4G92B 4QLCA 3NQJA 1S32D 3MGSC 1P3FD
chains in the Genus database with same CATH topology
3B6FD 2Y2HA 4Z2MH 3O62A 3KXBC 3REJB 4WU9B 3WKJA 3UTAA 1M19D 4X23B 5GSUB 3UT9C 4G92C 4WZSB 1WWSA 3AFAA 3WA9A 3REKA 2Y2PA 3LZ0B 3AN2D 3MGPB 4Z66A 4WU9C 3REJC 4YM6A 3X1SD 1H3OA 2ZM5A 1TAFA 3KSYA 2JSSA 5E5AA 1ID3B 1F66A 2AROB 2Y2MA 3V9RB 4X23C 5GSUC 5AV6B 5B0ZD 3MNNA 1KX5B 3TU4B 5B2JA 4XUJB 3MGRD 1P3GD 5AV9D 3LZ0C 4J8VD 3MGPC 2ZY5A 2PYOA 3X1VB 3AZMD 4CSRA 3REHA 1ID3C 2AROC 4KGCD 3AZLD 4ZUXA 5AV6C 2BYMA 1M1AB 1KX3D 3EPHA 4H9NB 3AZJA 3X1UB 1BH9A 2NQBB 4XUJC 5B0YD 4LD9A 2XD1A 3X1VC 4Z2MG 4DRAA 2ZY3A 5AVCB 3MVDD 1P34B 2G5IC 5B1LA 1M1AC 3KWQB 3X1UC 3VH5T 3P5JB 2NQBC 1EQZD 3AZFD 3AZHA 3F6TA 5B1MC 5GT0A 5B31G 5F99B 5B33A 5CP6C 5AV8D 4R8PC 5AVCC 1P3AD 1P34C 4WNNB 2Y2NA 4ZBJB 3LZ1B 1M18B 3WTPE 4H9RA 2FJ7D 4H9SC 3KWQC 3C1CA 3REIB 3NQUB 3AV2B 1P3BB 1HQ3D 5F99C 3AL0C 4WU9D 3KUYB 3LJAB 1W2EA 4ZBJC 3LZ1C 3W96D 2F8NH 5B1MA 5B40A 5CP6A 3AV2C 1P3BC 5B32A 4WU8A 3VH6T 4R8PA 3MGPD 3B0CT 3EPJA 1P3MB 3W97D 4CAYA 3B6GC 5BO0B 1ID3D 1P3PB 3AZGB 2AROD 2XD5A 4XZQA 1BFMA 4QLCB 2DF4C 3NQJB 3B0BA 5CPKB 1KX5D 3TU4D 1P3OA 4YS3B 1U35A 1N1JA 1WWIA 5FUGA 3O62B 3FDDA 1P3MC 3A1KA 3UTAB 4WNNA 3X1TA 3WKJB 2BG1A 1P3PC 2CV5D 5AY8C 3AZGC 3A6NB 1TZYC 2Y2IA 5CPKC 1M1AD 3AV1A 3AFAB 3WA9B 3X1UD 3REKB 4KUDA 4YS3C 2NQBD 3WAAA 2HUEB 5CPJD 3B6GA 4Z66B 3O62C 4YM6B 2LY8A 3WKJC 5AVBD 1H3OB 1TAFB 5E5AB 1F66B 1KX4C 3VH6W 5BT1D 3B0CW 3A6NC 4Z5TD 3LELC 3MGQA 5GXQA 3MNNB 5B2JB 3AFAC 3KWQD 3WA9C 3REKC 2L5AA 1P3FA 2F8NG 2HUEC 4Z66C 4YM6C 2PYOB 5AY8A 4DQYB 4CSRB 3REHB 5E5AC 1M19A 1TZYA 1F66C 5CPKA 4ZUXB 5DNMC 3LZ1D 2BYMB 4YS3A 1M18D 3MNNC 3AZJB 1BH9B 5B2JC 5JA4A 5B2IA 3REID 3AYWC 3AN2A 4LD9B 2PYOC 1AOID 1KX4A 3RELA 3REHC 3LELA 2ZY4A 3A6NA 1R4VA 5CPIA 3KUYD 3AZID 3AZND 3LJAD 4ZUXC 4J8UC 5B1LB 3EG5B 3AZJC 2Y2KA 2HIOD 4J8XD 3MGRA 3AZHB 4J8VA 4E44A 4JJND 5GT0B 2YFVA 4LD9C 5B33B 3AZMA 5DNMA 1P3LD 4H9OA 4KGCA 3W98D 2BYKA 3AYWA 4DRBA 5B1LC 4H9RB 1KX3A 4QLCD 3C1CB 3VH5A 3H0MC 3AZHC 1JFIA 5GT0C 5B33C 2NZDA 3UTAD 4J8UA 2RVQD 1Q9CA 4J8WD 3MVDA 1P3IA 4WV4B 3C1CC 2JE5A 3IP4C 5B1MB 5DNNA 1EQZA 3WA9D 5B40B 3AZFA 3R45A 5CP6B 5B32B 4WU8B 4R8PB 5AV5D 2F8ND 4CAYB 5B24A 5AV8A 3B0DB 1ZLAD 1P3AA 3MGSD 4XZQB 2FJ7A 3UTBA 3MNND 1P3OB 3KXBD 5B40C 1U35B 1N1JB 5FUGB 5B32C 1HQ3A 4WU8C 3X1TB 2VQRA 2PYOD 3UT9D 3B0DC 3W96A 2UWXA 4G91B 4XZQC 2ZY2A 1P3KC 3AV1B 3C1BC 1P3OC 4KUDB 1U35C 3WTPB 3REJD 3WAAB 3B6GB 4LD9D 3X1TC 3W97A 4X23D 5GSUD 3MGQB 4G91C 3AZEA 1S32B 2Y2OA 5GXQB 3LZ0D 3AV1C 2YFWA 3H0LC 4KUDC 1P3FB 3WTPC 3AZHD 3WAAC 5KDMA 5AY8B 5B33D 2DQNC 1M19B 1TZYB 5AV6D 5GT3A 1P3KA 3MGQC 3C1BA 4XUJD 1S32C 5GXQC 3W99A 2F8NK 3EPLA 5JA4B 5B2IB 3C1CD 1P3FC 5JRGA 3AN2B 3X1VD 5CPJA 5G49A 1KX4B 5AVBA 3RELB 3LELB 5B31A 1M19C 5CPIB 2J8PA 4Z5TA 2G5HC 3WTPA 4UUZA 5B2IC 3MGRB 5B1MD 5AV9B 3H0RC 5B40D 4J8VB 3AZKA 3AN2C 5CP6D 2YFVB 5B32D 4R8PD 3AZMB 3RELC 5AVCD 1P34D 5DNMB 5CPIC 4H9OB 1S32A 4KGCB 1BH8A 2BYKB 3AYWB 2IO5B 4E45A 1KX3B 3B6FA 3MGRC 1P3GC 5AV9C 5F99D 5BS7A 1P3OD 5BNXA 4J8VC 1JFIB 2Y2QA 1AOIA 3AZMC 2NZDB 2Y2GA 4J8UB 4UPKA 3MVDB 4KGCC 3AZNA 1P3IB 2IO5C 1KX3C 5DNNB 2HIOA 4J8XA 3AV2D 1P3BD 1EQZB 3AZFB 3X1SA 3R45B 4JJNA 3A1IA 3B6GD 1T3UA 2NZDC 4NE3A 5B24B 5AV8B 1P3LA 5B0ZA 1P3AB 3MVDC 3W98A 1P3IC 1P3GA 2FJ7B 5AV9A 3UTBB 5GXQD 5DNNC 2Y2LA 1EQZC 3AZFC 1P3MD 1HQ3B 1P3PD 3AZLA 5AY8D 3AZGD 5B24C 5AV8C 4J8WA 1TZYD 1P3AC 4WJ3C 2CWEA 5CPKD 3W96B 2Y2JA 2FJ7C 4YS3D 3UTBC 5B0YA 2JCHA 3O62D 5B2ID 3WKJD 1HQ3C 5AV5A 2F8NA 3W97B 1KX4D 3RELD 3LELD 3A6ND 1ZLAA 5CPID 5BNVA 4H9PA 3W96C 3MGSA 3AZEB 3AFAD 3REKD 2YFWB 4HGAB 4Z66D 3KXBA 4YM6D 5KDMB 4H9QB 5E5AD 4NFTA 1F66D 3W97C 2W8SA 3UT9A 1HTAA 5DNMD 2CV5B 5GT3B 1P3KB 3C1BB 5B2JD 3AZEC 5B32G 2RIQA 3AYWD 1A7WA 3W99B 4HGAC 1KX5C 1B6WA 3TU4C 4WU9A 3VH6A 5JRGB 3REJA 1Z2CB 5CPJB 5G49B 3REHD 5AVBB 4X23A 2NZDD 5GSUA 5B31B 4ZUXD 4J8UD 2CV5C 5GT3C 3AZJD 4Z5TB 1P3ID 4UUZB 3W99C 1F1EA 3LZ0A 3MGPA 5DNND 5JRGC 3AZKB 5CPJC 1ID3A 2AROA 5AVBC 3V9RA 5B31C 5B24D 5AV6A 5B1LD 4KHAB 1BH8B 5BT1C 4Z5TC 3TU4A 1KX5A 4XUJA 3B6FB 3UTBD 4H9QA 5GT0D 5BNXB 3AZKC 3X1VA 4M6BA 2CV5A 1ULYA 1AOIB 3AZIB 3KFUG 3AZNB 1M1AA 4H9NA 3X1UA 2NQBA 4NE5A 1M18C 3B6FC 2HIOB 4J8XB 3REIC 3X1SB 5BS7C 4JJNB 1AOIC 4EO5B 5C3IB 5AVCA 3VH5W 1P34A 1P3LB 3KUYC 5B0ZB 3AZIC 3W98B 3AZNC 4H9SA 3KWQA 3LJAC 1P3GB 3AZED 2HIOC 4J8XC 4WU8D 3X1SC 5F99A 5CHLB 4JJNC 4KHAA 4EO5C 3AZLB 5C3IC 1P3LC 3LZ1A 4J8WB 4XZQD 5B0ZC 1M18A 3W98C 5GT3D 1P3KD 2F2AC 3REIA 3EPKA 3NQUA 2FFFB 3C1BD 1B67A 4QLCC 5B0YB 3W99D 1U35D 3AV2A 4AWLB 1P3BA 5JRGD 3X1TD 5AV5B 3KUYA 2F8NB 3AZIA 3AZLC 3LJAA 3UTAC 2RVQC 1KU5A 5B31D 4J8WC 5BNVB 1ZLAB 4H9PB 3MGSB 3AV1D 4KUDD 5B0YC 3WTPD 4AWLC 4NE6A 3WAAD 3KXBB 1P3MA 3AZKD 5AV5C 5BO0A 1P3PA 3AZGA 3UT9B 3MGQD 1ZLAC 1PZRA 4G92B 4QLCA 3NQJA 1S32D 3MGSC 1P3FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6F D;  4Z2M H;  3O62 A;  3KXB C;  3REJ B;  4WU9 B;  3WKJ A;  3UTA A;  1M19 D;  4X23 B;  5GSU B;  3UT9 C;  4G92 C;  4WZS B;  1WWS A;  3AFA A;  3WA9 A;  3REK A;  3LZ0 B;  3AN2 D;  3MGP B;  4Z66 A;  4WU9 C;  3REJ C;  4YM6 A;  3X1S D;  1H3O A;  1TAF A;  3KSY A;  2JSS A;  5E5A A;  1ID3 B;  1F66 A;  2ARO B;  3V9R B;  4X23 C;  5GSU C;  5AV6 B;  5B0Z D;  3MNN A;  1KX5 B;  3TU4 B;  5B2J A;  4XUJ B;  3MGR D;  1P3G D;  5AV9 D;  3LZ0 C;  4J8V D;  3MGP C;  2PYO A;  3X1V B;  3AZM D;  4CSR A;  3REH A;  1ID3 C;  2ARO C;  4KGC D;  3AZL D;  4ZUX A;  5AV6 C;  2BYM A;  1M1A B;  1KX3 D;  4H9N B;  3AZJ A;  3X1U B;  1BH9 A;  2NQB B;  4XUJ C;  5B0Y D;  4LD9 A;  3X1V C;  4Z2M G;  4DRA A;  5AVC B;  3MVD D;  1P34 B;  5B1L A;  1M1A C;  3KWQ B;  3X1U C;  3VH5 T;  2NQB C;  1EQZ D;  3AZF D;  3AZH A;  5B1M C;  5GT0 A;  5B31 G;  5F99 B;  5B33 A;  5CP6 C;  5AV8 D;  4R8P C;  5AVC C;  1P3A D;  1P34 C;  4WNN B;  4ZBJ B;  3LZ1 B;  1M18 B;  3WTP E;  4H9R A;  2FJ7 D;  4H9S C;  3KWQ C;  3C1C A;  3REI B;  3NQU B;  3AV2 B;  1P3B B;  1HQ3 D;  5F99 C;  4WU9 D;  3KUY B;  3LJA B;  4ZBJ C;  3LZ1 C;  3W96 D;  2F8N H;  5B1M A;  5B40 A;  5CP6 A;  3AV2 C;  1P3B C;  5B32 A;  4WU8 A;  3VH6 T;  4R8P A;  3MGP D;  3B0C T;  1P3M B;  3W97 D;  4CAY A;  3B6G C;  5BO0 B;  1ID3 D;  1P3P B;  3AZG B;  2ARO D;  4XZQ A;  1BFM A;  4QLC B;  3NQJ B;  3B0B A;  5CPK B;  1KX5 D;  3TU4 D;  1P3O A;  4YS3 B;  1U35 A;  1N1J A;  1WWI A;  5FUG A;  3O62 B;  1P3M C;  3UTA B;  3X1T A;  4WNN A;  3WKJ B;  1P3P C;  2CV5 D;  5AY8 C;  3AZG C;  3A6N B;  1TZY C;  5CPK C;  1M1A D;  3AV1 A;  3AFA B;  3WA9 B;  3X1U D;  3REK B;  4KUD A;  4YS3 C;  2NQB D;  3WAA A;  2HUE B;  5CPJ D;  3B6G A;  4Z66 B;  3O62 C;  4YM6 B;  2LY8 A;  3WKJ C;  5AVB D;  1H3O B;  1TAF B;  5E5A B;  1F66 B;  1KX4 C;  3VH6 W;  5BT1 D;  3B0C W;  3A6N C;  4Z5T D;  3LEL C;  3MGQ A;  5GXQ A;  3MNN B;  5B2J B;  3AFA C;  3KWQ D;  3WA9 C;  3REK C;  2L5A A;  1P3F A;  2F8N G;  2HUE C;  4Z66 C;  4YM6 C;  2PYO B;  5AY8 A;  4CSR B;  3REH B;  5E5A C;  1M19 A;  1TZY A;  1F66 C;  5CPK A;  4ZUX B;  5DNM C;  3LZ1 D;  2BYM B;  4YS3 A;  1M18 D;  3MNN C;  3AZJ B;  1BH9 B;  5B2J C;  5JA4 A;  5B2I A;  3REI D;  3AYW C;  3AN2 A;  4LD9 B;  2PYO C;  1AOI D;  1KX4 A;  3REL A;  3REH C;  3LEL A;  3A6N A;  1R4V A;  5CPI A;  3KUY D;  3AZI D;  3AZN D;  3LJA D;  4ZUX C;  4J8U C;  5B1L B;  3AZJ C;  2HIO D;  4J8X D;  3MGR A;  3AZH B;  4J8V A;  4E44 A;  4JJN D;  5GT0 B;  2YFV A;  4LD9 C;  5B33 B;  3AZM A;  5DNM A;  1P3L D;  4H9O A;  4KGC A;  3W98 D;  2BYK A;  3AYW A;  4DRB A;  5B1L C;  4H9R B;  1KX3 A;  4QLC D;  3C1C B;  3VH5 A;  3AZH C;  1JFI A;  5GT0 C;  5B33 C;  2NZD A;  3UTA D;  4J8U A;  2RVQ D;  1Q9C A;  4J8W D;  3MVD A;  1P3I A;  4WV4 B;  3C1C C;  5DNN A;  5B1M B;  1EQZ A;  3WA9 D;  5B40 B;  3AZF A;  3R45 A;  5CP6 B;  5B32 B;  4WU8 B;  4R8P B;  5AV5 D;  2F8N D;  4CAY B;  5B24 A;  5AV8 A;  3B0D B;  1ZLA D;  1P3A A;  3MGS D;  4XZQ B;  2FJ7 A;  3UTB A;  3MNN D;  1P3O B;  3KXB D;  5B40 C;  1U35 B;  1N1J B;  5FUG B;  5B32 C;  1HQ3 A;  4WU8 C;  3X1T B;  2PYO D;  3UT9 D;  3B0D C;  3W96 A;  4G91 B;  4XZQ C;  1P3K C;  3AV1 B;  3C1B C;  1P3O C;  4KUD B;  1U35 C;  3WTP B;  3REJ D;  3WAA B;  3B6G B;  4LD9 D;  3X1T C;  3W97 A;  4X23 D;  5GSU D;  3MGQ B;  4G91 C;  3AZE A;  1S32 B;  5GXQ B;  3LZ0 D;  3AV1 C;  2YFW A;  4KUD C;  1P3F B;  3WTP C;  3AZH D;  3WAA C;  5KDM A;  5AY8 B;  5B33 D;  1M19 B;  1TZY B;  5AV6 D;  5GT3 A;  1P3K A;  3MGQ C;  3C1B A;  4XUJ D;  1S32 C;  5GXQ C;  3W99 A;  2F8N K;  5JA4 B;  5B2I B;  3C1C D;  1P3F C;  5JRG A;  3AN2 B;  3X1V D;  5CPJ A;  5G49 A;  1KX4 B;  5AVB A;  3REL B;  3LEL B;  5B31 A;  1M19 C;  5CPI B;  4Z5T A;  3WTP A;  4UUZ A;  5B2I C;  3MGR B;  5B1M D;  5AV9 B;  5B40 D;  4J8V B;  3AZK A;  3AN2 C;  5CP6 D;  2YFV B;  5B32 D;  4R8P D;  3AZM B;  3REL C;  5AVC D;  1P34 D;  5DNM B;  5CPI C;  4H9O B;  1S32 A;  4KGC B;  1BH8 A;  2BYK B;  3AYW B;  2IO5 B;  4E45 A;  1KX3 B;  3B6F A;  3MGR C;  1P3G C;  5AV9 C;  5F99 D;  5BS7 A;  1P3O D;  5BNX A;  4J8V C;  1JFI B;  1AOI A;  3AZM C;  2NZD B;  4J8U B;  3MVD B;  4KGC C;  3AZN A;  1P3I B;  2IO5 C;  1KX3 C;  5DNN B;  2HIO A;  4J8X A;  3AV2 D;  1P3B D;  1EQZ B;  3AZF B;  3X1S A;  3R45 B;  4JJN A;  3B6G D;  2NZD C;  4NE3 A;  5B24 B;  5AV8 B;  1P3L A;  5B0Z A;  1P3A B;  3MVD C;  3W98 A;  1P3I C;  1P3G A;  2FJ7 B;  5AV9 A;  3UTB B;  5GXQ D;  5DNN C;  1EQZ C;  3AZF C;  1P3M D;  1HQ3 B;  1P3P D;  3AZL A;  5AY8 D;  3AZG D;  5B24 C;  5AV8 C;  4J8W A;  1TZY D;  1P3A C;  2CWE A;  5CPK D;  3W96 B;  2FJ7 C;  4YS3 D;  3UTB C;  5B0Y A;  3O62 D;  5B2I D;  3WKJ D;  1HQ3 C;  5AV5 A;  2F8N A;  3W97 B;  1KX4 D;  3REL D;  3LEL D;  3A6N D;  1ZLA A;  5CPI D;  5BNV A;  4H9P A;  3W96 C;  3MGS A;  3AZE B;  3AFA D;  3REK D;  2YFW B;  4HGA B;  4Z66 D;  3KXB A;  4YM6 D;  5KDM B;  4H9Q B;  5E5A D;  4NFT A;  1F66 D;  3W97 C;  3UT9 A;  1HTA A;  5DNM D;  2CV5 B;  5GT3 B;  1P3K B;  3C1B B;  5B2J D;  3AZE C;  5B32 G;  3AYW D;  1A7W A;  3W99 B;  4HGA C;  1KX5 C;  1B6W A;  3TU4 C;  4WU9 A;  3VH6 A;  5JRG B;  3REJ A;  5CPJ B;  5G49 B;  3REH D;  5AVB B;  4X23 A;  2NZD D;  5GSU A;  5B31 B;  4ZUX D;  4J8U D;  2CV5 C;  5GT3 C;  3AZJ D;  4Z5T B;  1P3I D;  4UUZ B;  3W99 C;  1F1E A;  3LZ0 A;  3MGP A;  5DNN D;  5JRG C;  3AZK B;  5CPJ C;  1ID3 A;  2ARO A;  5AVB C;  3V9R A;  5B31 C;  5B24 D;  5AV6 A;  5B1L D;  4KHA B;  1BH8 B;  5BT1 C;  4Z5T C;  3TU4 A;  1KX5 A;  4XUJ A;  3B6F B;  3UTB D;  4H9Q A;  5GT0 D;  5BNX B;  3AZK C;  3X1V A;  4M6B A;  2CV5 A;  1ULY A;  1AOI B;  3AZI B;  3AZN B;  1M1A A;  4H9N A;  3X1U A;  2NQB A;  4NE5 A;  1M18 C;  3B6F C;  2HIO B;  4J8X B;  3REI C;  3X1S B;  5BS7 C;  4JJN B;  1AOI C;  4EO5 B;  5C3I B;  5AVC A;  3VH5 W;  1P34 A;  1P3L B;  3KUY C;  5B0Z B;  3AZI C;  3W98 B;  3AZN C;  4H9S A;  3KWQ A;  3LJA C;  1P3G B;  3AZE D;  2HIO C;  4J8X C;  4WU8 D;  3X1S C;  5F99 A;  5CHL B;  4JJN C;  4KHA A;  4EO5 C;  3AZL B;  5C3I C;  1P3L C;  3LZ1 A;  4J8W B;  4XZQ D;  5B0Z C;  1M18 A;  3W98 C;  5GT3 D;  1P3K D;  3REI A;  3NQU A;  3C1B D;  1B67 A;  4QLC C;  5B0Y B;  3W99 D;  1U35 D;  3AV2 A;  4AWL B;  1P3B A;  5JRG D;  3X1T D;  5AV5 B;  3KUY A;  2F8N B;  3AZI A;  3AZL C;  3LJA A;  3UTA C;  2RVQ C;  1KU5 A;  5B31 D;  4J8W C;  5BNV B;  1ZLA B;  4H9P B;  3MGS B;  3AV1 D;  4KUD D;  5B0Y C;  3WTP D;  4AWL C;  4NE6 A;  3WAA D;  3KXB B;  1P3M A;  3AZK D;  5AV5 C;  5BO0 A;  1P3P A;  3AZG A;  3UT9 B;  3MGQ D;  1ZLA C;  4G92 B;  4QLC A;  3NQJ A;  1S32 D;  3MGS C;  1P3F D; 
#chains in the Genus database with same CATH topology
 3B6F D;  2Y2H A;  4Z2M H;  3O62 A;  3KXB C;  3REJ B;  4WU9 B;  3WKJ A;  3UTA A;  1M19 D;  4X23 B;  5GSU B;  3UT9 C;  4G92 C;  4WZS B;  1WWS A;  3AFA A;  3WA9 A;  3REK A;  2Y2P A;  3LZ0 B;  3AN2 D;  3MGP B;  4Z66 A;  4WU9 C;  3REJ C;  4YM6 A;  3X1S D;  1H3O A;  2ZM5 A;  1TAF A;  3KSY A;  2JSS A;  5E5A A;  1ID3 B;  1F66 A;  2ARO B;  2Y2M A;  3V9R B;  4X23 C;  5GSU C;  5AV6 B;  5B0Z D;  3MNN A;  1KX5 B;  3TU4 B;  5B2J A;  4XUJ B;  3MGR D;  1P3G D;  5AV9 D;  3LZ0 C;  4J8V D;  3MGP C;  2ZY5 A;  2PYO A;  3X1V B;  3AZM D;  4CSR A;  3REH A;  1ID3 C;  2ARO C;  4KGC D;  3AZL D;  4ZUX A;  5AV6 C;  2BYM A;  1M1A B;  1KX3 D;  3EPH A;  4H9N B;  3AZJ A;  3X1U B;  1BH9 A;  2NQB B;  4XUJ C;  5B0Y D;  4LD9 A;  2XD1 A;  3X1V C;  4Z2M G;  4DRA A;  2ZY3 A;  5AVC B;  3MVD D;  1P34 B;  2G5I C;  5B1L A;  1M1A C;  3KWQ B;  3X1U C;  3VH5 T;  3P5J B;  2NQB C;  1EQZ D;  3AZF D;  3AZH A;  3F6T A;  5B1M C;  5GT0 A;  5B31 G;  5F99 B;  5B33 A;  5CP6 C;  5AV8 D;  4R8P C;  5AVC C;  1P3A D;  1P34 C;  4WNN B;  2Y2N A;  4ZBJ B;  3LZ1 B;  1M18 B;  3WTP E;  4H9R A;  2FJ7 D;  4H9S C;  3KWQ C;  3C1C A;  3REI B;  3NQU B;  3AV2 B;  1P3B B;  1HQ3 D;  5F99 C;  3AL0 C;  4WU9 D;  3KUY B;  3LJA B;  1W2E A;  4ZBJ C;  3LZ1 C;  3W96 D;  2F8N H;  5B1M A;  5B40 A;  5CP6 A;  3AV2 C;  1P3B C;  5B32 A;  4WU8 A;  3VH6 T;  4R8P A;  3MGP D;  3B0C T;  3EPJ A;  1P3M B;  3W97 D;  4CAY A;  3B6G C;  5BO0 B;  1ID3 D;  1P3P B;  3AZG B;  2ARO D;  2XD5 A;  4XZQ A;  1BFM A;  4QLC B;  2DF4 C;  3NQJ B;  3B0B A;  5CPK B;  1KX5 D;  3TU4 D;  1P3O A;  4YS3 B;  1U35 A;  1N1J A;  1WWI A;  5FUG A;  3O62 B;  3FDD A;  1P3M C;  3A1K A;  3UTA B;  4WNN A;  3X1T A;  3WKJ B;  2BG1 A;  1P3P C;  2CV5 D;  5AY8 C;  3AZG C;  3A6N B;  1TZY C;  2Y2I A;  5CPK C;  1M1A D;  3AV1 A;  3AFA B;  3WA9 B;  3X1U D;  3REK B;  4KUD A;  4YS3 C;  2NQB D;  3WAA A;  2HUE B;  5CPJ D;  3B6G A;  4Z66 B;  3O62 C;  4YM6 B;  2LY8 A;  3WKJ C;  5AVB D;  1H3O B;  1TAF B;  5E5A B;  1F66 B;  1KX4 C;  3VH6 W;  5BT1 D;  3B0C W;  3A6N C;  4Z5T D;  3LEL C;  3MGQ A;  5GXQ A;  3MNN B;  5B2J B;  3AFA C;  3KWQ D;  3WA9 C;  3REK C;  2L5A A;  1P3F A;  2F8N G;  2HUE C;  4Z66 C;  4YM6 C;  2PYO B;  5AY8 A;  4DQY B;  4CSR B;  3REH B;  5E5A C;  1M19 A;  1TZY A;  1F66 C;  5CPK A;  4ZUX B;  5DNM C;  3LZ1 D;  2BYM B;  4YS3 A;  1M18 D;  3MNN C;  3AZJ B;  1BH9 B;  5B2J C;  5JA4 A;  5B2I A;  3REI D;  3AYW C;  3AN2 A;  4LD9 B;  2PYO C;  1AOI D;  1KX4 A;  3REL A;  3REH C;  3LEL A;  2ZY4 A;  3A6N A;  1R4V A;  5CPI A;  3KUY D;  3AZI D;  3AZN D;  3LJA D;  4ZUX C;  4J8U C;  5B1L B;  3EG5 B;  3AZJ C;  2Y2K A;  2HIO D;  4J8X D;  3MGR A;  3AZH B;  4J8V A;  4E44 A;  4JJN D;  5GT0 B;  2YFV A;  4LD9 C;  5B33 B;  3AZM A;  5DNM A;  1P3L D;  4H9O A;  4KGC A;  3W98 D;  2BYK A;  3AYW A;  4DRB A;  5B1L C;  4H9R B;  1KX3 A;  4QLC D;  3C1C B;  3VH5 A;  3H0M C;  3AZH C;  1JFI A;  5GT0 C;  5B33 C;  2NZD A;  3UTA D;  4J8U A;  2RVQ D;  1Q9C A;  4J8W D;  3MVD A;  1P3I A;  4WV4 B;  3C1C C;  2JE5 A;  3IP4 C;  5B1M B;  5DNN A;  1EQZ A;  3WA9 D;  5B40 B;  3AZF A;  3R45 A;  5CP6 B;  5B32 B;  4WU8 B;  4R8P B;  5AV5 D;  2F8N D;  4CAY B;  5B24 A;  5AV8 A;  3B0D B;  1ZLA D;  1P3A A;  3MGS D;  4XZQ B;  2FJ7 A;  3UTB A;  3MNN D;  1P3O B;  3KXB D;  5B40 C;  1U35 B;  1N1J B;  5FUG B;  5B32 C;  1HQ3 A;  4WU8 C;  3X1T B;  2VQR A;  2PYO D;  3UT9 D;  3B0D C;  3W96 A;  2UWX A;  4G91 B;  4XZQ C;  2ZY2 A;  1P3K C;  3AV1 B;  3C1B C;  1P3O C;  4KUD B;  1U35 C;  3WTP B;  3REJ D;  3WAA B;  3B6G B;  4LD9 D;  3X1T C;  3W97 A;  4X23 D;  5GSU D;  3MGQ B;  4G91 C;  3AZE A;  1S32 B;  2Y2O A;  5GXQ B;  3LZ0 D;  3AV1 C;  2YFW A;  3H0L C;  4KUD C;  1P3F B;  3WTP C;  3AZH D;  3WAA C;  5KDM A;  5AY8 B;  5B33 D;  2DQN C;  1M19 B;  1TZY B;  5AV6 D;  5GT3 A;  1P3K A;  3MGQ C;  3C1B A;  4XUJ D;  1S32 C;  5GXQ C;  3W99 A;  2F8N K;  3EPL A;  5JA4 B;  5B2I B;  3C1C D;  1P3F C;  5JRG A;  3AN2 B;  3X1V D;  5CPJ A;  5G49 A;  1KX4 B;  5AVB A;  3REL B;  3LEL B;  5B31 A;  1M19 C;  5CPI B;  2J8P A;  4Z5T A;  2G5H C;  3WTP A;  4UUZ A;  5B2I C;  3MGR B;  5B1M D;  5AV9 B;  3H0R C;  5B40 D;  4J8V B;  3AZK A;  3AN2 C;  5CP6 D;  2YFV B;  5B32 D;  4R8P D;  3AZM B;  3REL C;  5AVC D;  1P34 D;  5DNM B;  5CPI C;  4H9O B;  1S32 A;  4KGC B;  1BH8 A;  2BYK B;  3AYW B;  2IO5 B;  4E45 A;  1KX3 B;  3B6F A;  3MGR C;  1P3G C;  5AV9 C;  5F99 D;  5BS7 A;  1P3O D;  5BNX A;  4J8V C;  1JFI B;  2Y2Q A;  1AOI A;  3AZM C;  2NZD B;  2Y2G A;  4J8U B;  4UPK A;  3MVD B;  4KGC C;  3AZN A;  1P3I B;  2IO5 C;  1KX3 C;  5DNN B;  2HIO A;  4J8X A;  3AV2 D;  1P3B D;  1EQZ B;  3AZF B;  3X1S A;  3R45 B;  4JJN A;  3A1I A;  3B6G D;  1T3U A;  2NZD C;  4NE3 A;  5B24 B;  5AV8 B;  1P3L A;  5B0Z A;  1P3A B;  3MVD C;  3W98 A;  1P3I C;  1P3G A;  2FJ7 B;  5AV9 A;  3UTB B;  5GXQ D;  5DNN C;  2Y2L A;  1EQZ C;  3AZF C;  1P3M D;  1HQ3 B;  1P3P D;  3AZL A;  5AY8 D;  3AZG D;  5B24 C;  5AV8 C;  4J8W A;  1TZY D;  1P3A C;  4WJ3 C;  2CWE A;  5CPK D;  3W96 B;  2Y2J A;  2FJ7 C;  4YS3 D;  3UTB C;  5B0Y A;  2JCH A;  3O62 D;  5B2I D;  3WKJ D;  1HQ3 C;  5AV5 A;  2F8N A;  3W97 B;  1KX4 D;  3REL D;  3LEL D;  3A6N D;  1ZLA A;  5CPI D;  5BNV A;  4H9P A;  3W96 C;  3MGS A;  3AZE B;  3AFA D;  3REK D;  2YFW B;  4HGA B;  4Z66 D;  3KXB A;  4YM6 D;  5KDM B;  4H9Q B;  5E5A D;  4NFT A;  1F66 D;  3W97 C;  2W8S A;  3UT9 A;  1HTA A;  5DNM D;  2CV5 B;  5GT3 B;  1P3K B;  3C1B B;  5B2J D;  3AZE C;  5B32 G;  2RIQ A;  3AYW D;  1A7W A;  3W99 B;  4HGA C;  1KX5 C;  1B6W A;  3TU4 C;  4WU9 A;  3VH6 A;  5JRG B;  3REJ A;  1Z2C B;  5CPJ B;  5G49 B;  3REH D;  5AVB B;  4X23 A;  2NZD D;  5GSU A;  5B31 B;  4ZUX D;  4J8U D;  2CV5 C;  5GT3 C;  3AZJ D;  4Z5T B;  1P3I D;  4UUZ B;  3W99 C;  1F1E A;  3LZ0 A;  3MGP A;  5DNN D;  5JRG C;  3AZK B;  5CPJ C;  1ID3 A;  2ARO A;  5AVB C;  3V9R A;  5B31 C;  5B24 D;  5AV6 A;  5B1L D;  4KHA B;  1BH8 B;  5BT1 C;  4Z5T C;  3TU4 A;  1KX5 A;  4XUJ A;  3B6F B;  3UTB D;  4H9Q A;  5GT0 D;  5BNX B;  3AZK C;  3X1V A;  4M6B A;  2CV5 A;  1ULY A;  1AOI B;  3AZI B;  3KFU G;  3AZN B;  1M1A A;  4H9N A;  3X1U A;  2NQB A;  4NE5 A;  1M18 C;  3B6F C;  2HIO B;  4J8X B;  3REI C;  3X1S B;  5BS7 C;  4JJN B;  1AOI C;  4EO5 B;  5C3I B;  5AVC A;  3VH5 W;  1P34 A;  1P3L B;  3KUY C;  5B0Z B;  3AZI C;  3W98 B;  3AZN C;  4H9S A;  3KWQ A;  3LJA C;  1P3G B;  3AZE D;  2HIO C;  4J8X C;  4WU8 D;  3X1S C;  5F99 A;  5CHL B;  4JJN C;  4KHA A;  4EO5 C;  3AZL B;  5C3I C;  1P3L C;  3LZ1 A;  4J8W B;  4XZQ D;  5B0Z C;  1M18 A;  3W98 C;  5GT3 D;  1P3K D;  2F2A C;  3REI A;  3EPK A;  3NQU A;  2FFF B;  3C1B D;  1B67 A;  4QLC C;  5B0Y B;  3W99 D;  1U35 D;  3AV2 A;  4AWL B;  1P3B A;  5JRG D;  3X1T D;  5AV5 B;  3KUY A;  2F8N B;  3AZI A;  3AZL C;  3LJA A;  3UTA C;  2RVQ C;  1KU5 A;  5B31 D;  4J8W C;  5BNV B;  1ZLA B;  4H9P B;  3MGS B;  3AV1 D;  4KUD D;  5B0Y C;  3WTP D;  4AWL C;  4NE6 A;  3WAA D;  3KXB B;  1P3M A;  3AZK D;  5AV5 C;  5BO0 A;  1P3P A;  3AZG A;  3UT9 B;  3MGQ D;  1ZLA C;  1PZR A;  4G92 B;  4QLC A;  3NQJ A;  1S32 D;  3MGS C;  1P3F D; 
#chains in the Genus database with same CATH homology
 3B6F D;  2Y2H A;  4Z2M H;  3O62 A;  3KXB C;  3REJ B;  4WU9 B;  3WKJ A;  3UTA A;  1M19 D;  4X23 B;  5GSU B;  3UT9 C;  4G92 C;  4WZS B;  1WWS A;  3AFA A;  3WA9 A;  3REK A;  2Y2P A;  3LZ0 B;  3AN2 D;  3MGP B;  4Z66 A;  4WU9 C;  3REJ C;  4YM6 A;  3X1S D;  1H3O A;  2ZM5 A;  1TAF A;  3KSY A;  2JSS A;  5E5A A;  1ID3 B;  1F66 A;  2ARO B;  2Y2M A;  3V9R B;  4X23 C;  5GSU C;  5AV6 B;  5B0Z D;  3MNN A;  1KX5 B;  3TU4 B;  5B2J A;  4XUJ B;  3MGR D;  1P3G D;  5AV9 D;  3LZ0 C;  4J8V D;  3MGP C;  2ZY5 A;  2PYO A;  3X1V B;  3AZM D;  4CSR A;  3REH A;  1ID3 C;  2ARO C;  4KGC D;  3AZL D;  4ZUX A;  5AV6 C;  2BYM A;  1M1A B;  1KX3 D;  3EPH A;  4H9N B;  3AZJ A;  3X1U B;  1BH9 A;  2NQB B;  4XUJ C;  5B0Y D;  4LD9 A;  2XD1 A;  3X1V C;  4Z2M G;  4DRA A;  2ZY3 A;  5AVC B;  3MVD D;  1P34 B;  2G5I C;  5B1L A;  1M1A C;  3KWQ B;  3X1U C;  3VH5 T;  3P5J B;  2NQB C;  1EQZ D;  3AZF D;  3AZH A;  3F6T A;  5B1M C;  5GT0 A;  5B31 G;  5F99 B;  5B33 A;  5CP6 C;  5AV8 D;  4R8P C;  5AVC C;  1P3A D;  1P34 C;  4WNN B;  2Y2N A;  4ZBJ B;  3LZ1 B;  1M18 B;  3WTP E;  4H9R A;  2FJ7 D;  4H9S C;  3KWQ C;  3C1C A;  3REI B;  3NQU B;  3AV2 B;  1P3B B;  1HQ3 D;  5F99 C;  3AL0 C;  4WU9 D;  3KUY B;  3LJA B;  1W2E A;  4ZBJ C;  3LZ1 C;  3W96 D;  2F8N H;  5B1M A;  5B40 A;  5CP6 A;  3AV2 C;  1P3B C;  5B32 A;  4WU8 A;  3VH6 T;  4R8P A;  3MGP D;  3B0C T;  3EPJ A;  1P3M B;  3W97 D;  4CAY A;  3B6G C;  5BO0 B;  1ID3 D;  1P3P B;  3AZG B;  2ARO D;  2XD5 A;  4XZQ A;  1BFM A;  4QLC B;  2DF4 C;  3NQJ B;  3B0B A;  5CPK B;  1KX5 D;  3TU4 D;  1P3O A;  4YS3 B;  1U35 A;  1N1J A;  1WWI A;  5FUG A;  3O62 B;  3FDD A;  1P3M C;  3A1K A;  3UTA B;  4WNN A;  3X1T A;  3WKJ B;  2BG1 A;  1P3P C;  2CV5 D;  5AY8 C;  3AZG C;  3A6N B;  1TZY C;  2Y2I A;  5CPK C;  1M1A D;  3AV1 A;  3AFA B;  3WA9 B;  3X1U D;  3REK B;  4KUD A;  4YS3 C;  2NQB D;  3WAA A;  2HUE B;  5CPJ D;  3B6G A;  4Z66 B;  3O62 C;  4YM6 B;  2LY8 A;  3WKJ C;  5AVB D;  1H3O B;  1TAF B;  5E5A B;  1F66 B;  1KX4 C;  3VH6 W;  5BT1 D;  3B0C W;  3A6N C;  4Z5T D;  3LEL C;  3MGQ A;  5GXQ A;  3MNN B;  5B2J B;  3AFA C;  3KWQ D;  3WA9 C;  3REK C;  2L5A A;  1P3F A;  2F8N G;  2HUE C;  4Z66 C;  4YM6 C;  2PYO B;  5AY8 A;  4DQY B;  4CSR B;  3REH B;  5E5A C;  1M19 A;  1TZY A;  1F66 C;  5CPK A;  4ZUX B;  5DNM C;  3LZ1 D;  2BYM B;  4YS3 A;  1M18 D;  3MNN C;  3AZJ B;  1BH9 B;  5B2J C;  5JA4 A;  5B2I A;  3REI D;  3AYW C;  3AN2 A;  4LD9 B;  2PYO C;  1AOI D;  1KX4 A;  3REL A;  3REH C;  3LEL A;  2ZY4 A;  3A6N A;  1R4V A;  5CPI A;  3KUY D;  3AZI D;  3AZN D;  3LJA D;  4ZUX C;  4J8U C;  5B1L B;  3EG5 B;  3AZJ C;  2Y2K A;  2HIO D;  4J8X D;  3MGR A;  3AZH B;  4J8V A;  4E44 A;  4JJN D;  5GT0 B;  2YFV A;  4LD9 C;  5B33 B;  3AZM A;  5DNM A;  1P3L D;  4H9O A;  4KGC A;  3W98 D;  2BYK A;  3AYW A;  4DRB A;  5B1L C;  4H9R B;  1KX3 A;  4QLC D;  3C1C B;  3VH5 A;  3H0M C;  3AZH C;  1JFI A;  5GT0 C;  5B33 C;  2NZD A;  3UTA D;  4J8U A;  2RVQ D;  1Q9C A;  4J8W D;  3MVD A;  1P3I A;  4WV4 B;  3C1C C;  2JE5 A;  3IP4 C;  5B1M B;  5DNN A;  1EQZ A;  3WA9 D;  5B40 B;  3AZF A;  3R45 A;  5CP6 B;  5B32 B;  4WU8 B;  4R8P B;  5AV5 D;  2F8N D;  4CAY B;  5B24 A;  5AV8 A;  3B0D B;  1ZLA D;  1P3A A;  3MGS D;  4XZQ B;  2FJ7 A;  3UTB A;  3MNN D;  1P3O B;  3KXB D;  5B40 C;  1U35 B;  1N1J B;  5FUG B;  5B32 C;  1HQ3 A;  4WU8 C;  3X1T B;  2VQR A;  2PYO D;  3UT9 D;  3B0D C;  3W96 A;  2UWX A;  4G91 B;  4XZQ C;  2ZY2 A;  1P3K C;  3AV1 B;  3C1B C;  1P3O C;  4KUD B;  1U35 C;  3WTP B;  3REJ D;  3WAA B;  3B6G B;  4LD9 D;  3X1T C;  3W97 A;  4X23 D;  5GSU D;  3MGQ B;  4G91 C;  3AZE A;  1S32 B;  2Y2O A;  5GXQ B;  3LZ0 D;  3AV1 C;  2YFW A;  3H0L C;  4KUD C;  1P3F B;  3WTP C;  3AZH D;  3WAA C;  5KDM A;  5AY8 B;  5B33 D;  2DQN C;  1M19 B;  1TZY B;  5AV6 D;  5GT3 A;  1P3K A;  3MGQ C;  3C1B A;  4XUJ D;  1S32 C;  5GXQ C;  3W99 A;  2F8N K;  3EPL A;  5JA4 B;  5B2I B;  3C1C D;  1P3F C;  5JRG A;  3AN2 B;  3X1V D;  5CPJ A;  5G49 A;  1KX4 B;  5AVB A;  3REL B;  3LEL B;  5B31 A;  1M19 C;  5CPI B;  2J8P A;  4Z5T A;  2G5H C;  3WTP A;  4UUZ A;  5B2I C;  3MGR B;  5B1M D;  5AV9 B;  3H0R C;  5B40 D;  4J8V B;  3AZK A;  3AN2 C;  5CP6 D;  2YFV B;  5B32 D;  4R8P D;  3AZM B;  3REL C;  5AVC D;  1P34 D;  5DNM B;  5CPI C;  4H9O B;  1S32 A;  4KGC B;  1BH8 A;  2BYK B;  3AYW B;  2IO5 B;  4E45 A;  1KX3 B;  3B6F A;  3MGR C;  1P3G C;  5AV9 C;  5F99 D;  5BS7 A;  1P3O D;  5BNX A;  4J8V C;  1JFI B;  2Y2Q A;  1AOI A;  3AZM C;  2NZD B;  2Y2G A;  4J8U B;  4UPK A;  3MVD B;  4KGC C;  3AZN A;  1P3I B;  2IO5 C;  1KX3 C;  5DNN B;  2HIO A;  4J8X A;  3AV2 D;  1P3B D;  1EQZ B;  3AZF B;  3X1S A;  3R45 B;  4JJN A;  3A1I A;  3B6G D;  1T3U A;  2NZD C;  4NE3 A;  5B24 B;  5AV8 B;  1P3L A;  5B0Z A;  1P3A B;  3MVD C;  3W98 A;  1P3I C;  1P3G A;  2FJ7 B;  5AV9 A;  3UTB B;  5GXQ D;  5DNN C;  2Y2L A;  1EQZ C;  3AZF C;  1P3M D;  1HQ3 B;  1P3P D;  3AZL A;  5AY8 D;  3AZG D;  5B24 C;  5AV8 C;  4J8W A;  1TZY D;  1P3A C;  4WJ3 C;  2CWE A;  5CPK D;  3W96 B;  2Y2J A;  2FJ7 C;  4YS3 D;  3UTB C;  5B0Y A;  2JCH A;  3O62 D;  5B2I D;  3WKJ D;  1HQ3 C;  5AV5 A;  2F8N A;  3W97 B;  1KX4 D;  3REL D;  3LEL D;  3A6N D;  1ZLA A;  5CPI D;  5BNV A;  4H9P A;  3W96 C;  3MGS A;  3AZE B;  3AFA D;  3REK D;  2YFW B;  4HGA B;  4Z66 D;  3KXB A;  4YM6 D;  5KDM B;  4H9Q B;  5E5A D;  4NFT A;  1F66 D;  3W97 C;  2W8S A;  3UT9 A;  1HTA A;  5DNM D;  2CV5 B;  5GT3 B;  1P3K B;  3C1B B;  5B2J D;  3AZE C;  5B32 G;  2RIQ A;  3AYW D;  1A7W A;  3W99 B;  4HGA C;  1KX5 C;  1B6W A;  3TU4 C;  4WU9 A;  3VH6 A;  5JRG B;  3REJ A;  1Z2C B;  5CPJ B;  5G49 B;  3REH D;  5AVB B;  4X23 A;  2NZD D;  5GSU A;  5B31 B;  4ZUX D;  4J8U D;  2CV5 C;  5GT3 C;  3AZJ D;  4Z5T B;  1P3I D;  4UUZ B;  3W99 C;  1F1E A;  3LZ0 A;  3MGP A;  5DNN D;  5JRG C;  3AZK B;  5CPJ C;  1ID3 A;  2ARO A;  5AVB C;  3V9R A;  5B31 C;  5B24 D;  5AV6 A;  5B1L D;  4KHA B;  1BH8 B;  5BT1 C;  4Z5T C;  3TU4 A;  1KX5 A;  4XUJ A;  3B6F B;  3UTB D;  4H9Q A;  5GT0 D;  5BNX B;  3AZK C;  3X1V A;  4M6B A;  2CV5 A;  1ULY A;  1AOI B;  3AZI B;  3KFU G;  3AZN B;  1M1A A;  4H9N A;  3X1U A;  2NQB A;  4NE5 A;  1M18 C;  3B6F C;  2HIO B;  4J8X B;  3REI C;  3X1S B;  5BS7 C;  4JJN B;  1AOI C;  4EO5 B;  5C3I B;  5AVC A;  3VH5 W;  1P34 A;  1P3L B;  3KUY C;  5B0Z B;  3AZI C;  3W98 B;  3AZN C;  4H9S A;  3KWQ A;  3LJA C;  1P3G B;  3AZE D;  2HIO C;  4J8X C;  4WU8 D;  3X1S C;  5F99 A;  5CHL B;  4JJN C;  4KHA A;  4EO5 C;  3AZL B;  5C3I C;  1P3L C;  3LZ1 A;  4J8W B;  4XZQ D;  5B0Z C;  1M18 A;  3W98 C;  5GT3 D;  1P3K D;  2F2A C;  3REI A;  3EPK A;  3NQU A;  2FFF B;  3C1B D;  1B67 A;  4QLC C;  5B0Y B;  3W99 D;  1U35 D;  3AV2 A;  4AWL B;  1P3B A;  5JRG D;  3X1T D;  5AV5 B;  3KUY A;  2F8N B;  3AZI A;  3AZL C;  3LJA A;  3UTA C;  2RVQ C;  1KU5 A;  5B31 D;  4J8W C;  5BNV B;  1ZLA B;  4H9P B;  3MGS B;  3AV1 D;  4KUD D;  5B0Y C;  3WTP D;  4AWL C;  4NE6 A;  3WAA D;  3KXB B;  1P3M A;  3AZK D;  5AV5 C;  5BO0 A;  1P3P A;  3AZG A;  3UT9 B;  3MGQ D;  1ZLA C;  1PZR A;  4G92 B;  4QLC A;  3NQJ A;  1S32 D;  3MGS C;  1P3F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...