2HIOC

Histone octamer (chicken), chromosomal protein
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HISTONE H2A)
publication title The nucleosomal core histone octamer at 3.1 A resolution: a tripartite protein assembly and a left-handed superhelix.
pubmed doi rcsb
molecule tags Structural protein,dna binding protein
total genus 31
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2hioC00
3W98C 3WAAD 1P3OD 1P3GC 3NQUA 2AROD 3VH5A 2IO5B 5AY8A 5GT3C 3RELD 3AYWA 1P3MD 5B1LB 5DNMB 3VH5T 4UUZB 3NQJA 5AV8C 5DNNA 1P3PA 5GT0A 1P3FD 5CP6D 4H9NB 4EO5C 3X1VB 1U35C 1M1AD 4X23B 1M19C 4XUJC 4J8UD 2NZDD 3MGPA 3UT9C 3WKJA 4J8VC 1P3OB 3REIA 1EQZC 5B32D 3B6GD 3AZJD 3AZKD 3W98A 2AROB 3RELB 1P3MB 4NE6A 3AZEC 5GT3A 2YFVA 5BT1C 1ZLAA 5AY8D 3AZMC 5AV5A 3X1UA 5C3IC 3C1CA 1P3FB 1H3OA 5CP6B 3B6FC 5AV8A 1M1AB 5DNND 4J8UB 2NZDB 4H9OA 1U35A 1M19A 4XUJA 5B32B 5AV9C 3B6GB 5B1MC 3UT9A 4QLCA 2PYOB 3REJA 5AVCA 3AZKB 3AZJB 5G49B 1EQZA 3REID 2BYMB 4CSRA 5B1LC 3TU4B 1P3AD 5AY8B 5DNMC 3AZEA 3AZMA 3NQJB 5CPJD 5E5AA 5DNNB 1ZLAD 1KU5A 5AV5D 3X1UD 3C1CD 3X1VC 4J8WB 5B40A 5CPKA 4Z5TD 4ZUXC 4X23C 5JRGB 3AV1A 3WAAC 1P3OC 4WU8B 3MGSA 1U35D 1ID3A 3MGQD 3REIB 4KUDD 2AROC 4QLCD 3UTAD 3RELC 3REJD 5AVCD 1P3MC 1P3AB 4G92B 3MGRB 5B1LA 5DNMA 5CPJB 1P3FC 1ZLAB 2RVQC 5CP6C 4UUZA 5AV5B 3X1UB 3X1SD 3C1CB 1AOIB 1M1AC 4Z5TB 4J8UC 2NZDC 5E5AD 5AV6D 4X23A 5B40D 5CPKD 4DRAA 5B32C 3B6GC 3MGQB 5B0YA 3AV1D 2PYOC 3AZJC 3AZKC 4KUDB 3W97D 4QLCB 3UTAB 3REJB 1BH9A 3MGSD 4HGAB 3MVDA 4J8XB 1ID3D 2AROA 3RELA 5B31A 3TU4C 5AY8C 3AV2D 4Z66A 4ZBJB 5KDMB 3W96A 3LELD 3X1SB 1P3FA 5DNNC 1TZYA 5E5AB 4J8WC 5AV6B 5B40B 5JRGC 5CPKB 4JJNA 3W99D 3AV1B 2HIOA 3W97B 2CV5A 3MGSB 1Q9CA 3REIC 2PYOA 1ID3B 5B0YD 3AN2B 5G49A 5B0ZD 1P3AC 1HQ3B 3WTPB 3AV2B 5BNVB 3LZ1D 2BYMA 4H9RA 3MGRC 4G92C 5CPIA 3MVDD 3LELB 4YS3A 3TU4A 5B33A 5B31D 5CPJC 2F8NH 1ZLAC 3C1BD 3VH6W 5AV5C 3X1UC 4Z66D 3C1CC 1AOIC 3AZLA 3W96D 4Z5TC 3W99B 2RVQD 4J8WA 1TZYD 1ULYA 4H9SA 1F66A 5JRGA 4XZQB 5B32G 3MGQC 4JJND 4LD9D 4KUDC 5B0YB 2HIOD 4QLCC 5B0ZB 4WU8A 3REJC 5AVCC 3UTAC 2CV5D 4HGAC 3LZ1B 4J8XC 1BH9B 3MVDB 2PYOD 1P3AA 5B31B 4ZBJC 1WWSA 3MGRA 3C1BB 4Z66B 3KWQD 3KXBA 3X1SC 5CPID 3W96B 3V9RA 4YS3D 3TU4D 5CPJA 5B33D 1N1JB 5E5AC 1S32A 1AOIA 1TZYB 5AV6C 4Z5TA 1P34D 5B40C 3AZLD 5CPKC 3AZFA 3LJAD 3AV1C 5GSUD 3A6NB 4JJNB 4LD9B 3W97C 4J8WD 2HIOB 2F8NK 1F66D 3MGQA 3MGSC 5JRGD 2CV5B 1ID3C 4KUDA 2L5AA 3AN2C 1B67A 3UTAA 4Z2MG 4WU8D 3WTPC 3AV2C 4J8XA 1KX4D 3KWQB 3LELC 4H9RB 5CPIB 2IO5C 4YS3B 3WA9A 3KSYA 5KDMA 3VH5W 5B33B 3X1SA 3MGRD 4R8PD 3LZ0A 3KXBD 1P34B 3AZLB 4NFTA 3LJAB 3AZHA 3W99C 5GSUB 4DRBA 5AV6A 3AZND 1S32D 1AOID 3B0CW 1F66B 3AZFD 5B0YC 3W97A 5B0ZC 5B2IA 1BH8A 3LZ1C 1KX4B 3AN2A 3MVDC 1HTAA 4CAYB 3B0DB 1HQ3A 3WTPA 2HUEB 5BNVA 5B31C 3X1TD 3AFAA 3AV2A 1M18A 3C1BC 4Z66C 4J8XD 3LELA 4R8PB 3W96C 3KXBB 5BS7C 3V9RB 3WA9D 1TZYC 3AZNB 1R4VA 1S32B 3LZ0D 1P3LD 4KHAB 3W99A 3AZFB 4JJNC 4LD9C 3AZHD 1P3BA 2HIOC 4Z2MH 4XZQA 4NE5A 2CV5C 5B0ZA 3X1TB 3LZ1A 5B2ID 3KWQC 5CPIC 3AN2D 5JA4B 1A7WA 3VH6A 4YS3C 1P3KA 1M18D 1HQ3D 3WTPD 3AFAD 3C1BA 5B33C 3WA9B 4WNNA 3VH6T 1JFIB 4YM6A 1P34C 5BS7A 3AZLC 1KX3D 3LZ0B 1P3LB 1N1JA 3LJAC 5GSUC 2JSSA 3AZHB 4H9SC 1F66C 2F8ND 3A6NA 4LD9A 3AZIA 4WU9D 1P3BD 4WU8C 4XZQD 1KX4C 5B2IB 1BH8B 3B0BA 3MNNA 2HUEC 5B31G 5GXQD 4AWLB 1M18B 3AFAB 3KWQA 4KGCA 4R8PC 5AVBD 3KXBC 1B6WA 1KX3B 3AZGD 1P3KD 3AZNC 2YFWB 1S32C 1P34A 4YM6D 3LJAA 2F8NB 5GSUA 3AZFC 5B2JB 4WU9B 2FJ7A 1P3BB 1P3IA 3A6ND 5BNXA 3UTBA 3AZID 3X1TC 1KX4A 5GXQB 5AVBB 4CAYA 3KUYD 3MNND 3AZGB 1P3KB 3WA9C 4R8PA 4KGCD 4WNNB 2CWEA 3LZ0C 1P3LC 4YM6B 1KX5A 3AZHC 3AZNA 5B24D 5F99A 3REKD 3REHA 4KHAA 3B0CT 4ZUXB 3AZIB 3WAAB 3O62A 2FJ7D 1TAFB 5BO0B 5B2IC 1P3ID 4H9PA 3KUYB 3X1TA 3UTBD 2NQBD 4AWLC 1M18C 1HQ3C 3MNNB 3AFAC 1P3GA 5JA4A 5CHLB 2BYKB 1KX3C 4KGCB 3AYWD 1BFMA 1JFIA 5B24B 3REKB 1P3LA 4H9QB 1P3PD 5GT0D 1KX5D 5B2JC 4WU9C 3R45B 1P3BC 5F99D 4WZSB 4XZQC 3REHD 2FJ7B 1P3IB 3MGPD 2NQBB 5BNXB 4J8VA 3UTBB 5FUGA 3WKJD 5GXQC 3O62D 1F1EA 5AVBC 3NQUB 3W98D 3AYWB 3AZGC 1P3KC 1P3GD 4G91B 1KX3A 5GT3D 4YM6C 1P3PB 2YFWA 5GT0B 3B6FA 1KX5B 2F8NA 5F99B 5AV8D 3REHB 2LY8A 3A6NC 5B2JA 4WU9A 3AZIC 3MGPB 3WKJB 5AV9A 5B1MA 4XUJD 3O62B 1M19D 3WTPE 3UT9D 3KUYC 5GXQA 3W98B 4H9PB 3MNNC 4J8VD 1EQZD 5AVBA 1P3GB 4KGCC 5GT3B 3AZGA 2YFVB 5B24C 3AZED 1H3OB 3REKC 4E44A 5BT1D 2F8NG 5AV8B 3AZMD 4H9NA 3X1VA 4E45A 4M6BA 3B6FD 4EO5B 4ZUXA 1WWIA 2FJ7C 4H9OB 1U35B 1M19B 4XUJB 1P3IC 3WAAA 3UT9B 5B2JD 1P3OA 3UTBC 2NQBC 1TAFA 5AVCB 5BO0A 4J8VB 5FUGB 1EQZB 5AV9D 5B1MD 3KUYA 4NE3A 1P3MA 3B0DC 3AYWC 4CSRB 4G91C 2BYKA 3AZEB 5B1LD 5CP6A 5DNMD 3AZMB 1P3PC 5GT0C 5C3IB 5B24A 1KX5C 3REKA 3B6FB 5F99C 1M1AA 3REHC 4H9QA 4J8UA 2NZDA 4WV4B 3R45A 3MGPC 3X1VD 3WKJC 5B32A 3B6GA 4ZUXD 4X23D 3O62C 5AV9B 3AZJA 3AZKA 5B1MB 2NQBA
chains in the Genus database with same CATH superfamily
3W98C 3WAAD 1P3OD 1P3GC 3NQUA 2AROD 3VH5A 2IO5B 5AY8A 5GT3C 3RELD 3AYWA 1P3MD 5B1LB 5DNMB 3VH5T 4UUZB 3NQJA 5AV8C 5DNNA 1P3PA 5GT0A 1P3FD 3A1IA 5CP6D 4H9NB 4EO5C 3X1VB 1U35C 1M1AD 4X23B 1M19C 4XUJC 4J8UD 2NZDD 3MGPA 3UT9C 3WKJA 4J8VC 1P3OB 3REIA 1EQZC 5B32D 3B6GD 3AZJD 3AZKD 3W98A 2AROB 3RELB 1P3MB 4NE6A 3AZEC 5GT3A 2YFVA 5BT1C 1ZLAA 5AY8D 3H0LC 3AZMC 5AV5A 3X1UA 5C3IC 3C1CA 1P3FB 1H3OA 5CP6B 3B6FC 5AV8A 4DQYB 1M1AB 5DNND 4J8UB 2NZDB 4H9OA 1U35A 1M19A 4XUJA 5B32B 5AV9C 3B6GB 5B1MC 2Y2LA 3UT9A 4QLCA 2PYOB 3REJA 5AVCA 3AZKB 3AZJB 2UWXA 5G49B 2Y2NA 1EQZA 3REID 2BYMB 2ZY3A 4CSRA 5B1LC 3TU4B 1P3AD 5AY8B 5DNMC 3AZEA 3EPKA 3AZMA 3NQJB 5CPJD 5E5AA 5DNNB 1ZLAD 1KU5A 5AV5D 3X1UD 3C1CD 3X1VC 4J8WB 2ZM5A 5B40A 5CPKA 4Z5TD 4ZUXC 4X23C 5JRGB 3AV1A 3WAAC 1P3OC 4WU8B 3MGSA 1U35D 1ID3A 3MGQD 2DF4C 3REIB 2Y2GA 4KUDD 2AROC 4QLCD 3UTAD 3RELC 3REJD 5AVCD 1P3MC 1P3AB 4G92B 3MGRB 5B1LA 4UPKA 5DNMA 5CPJB 1P3FC 2XD1A 2RVQC 5CP6C 4UUZA 1ZLAB 5AV5B 3X1UB 3X1SD 3C1CB 1AOIB 1M1AC 4Z5TB 4J8UC 2NZDC 5E5AD 5AV6D 4X23A 5B40D 3IP4C 4DRAA 5CPKD 5B32C 1T3UA 3B6GC 2Y2KA 3MGQB 5B0YA 3AV1D 2PYOC 3AZJC 3AZKC 4KUDB 3W97D 4QLCB 3UTAB 3REJB 1BH9A 3MGSD 4HGAB 3MVDA 4J8XB 1ID3D 2AROA 2JCHA 3RELA 5B31A 3TU4C 3EPLA 5AY8C 3AV2D 4Z66A 4ZBJB 5KDMB 3W96A 3LELD 3X1SB 2G5HC 2XD5A 1P3FA 5DNNC 1TZYA 5E5AB 4J8WC 5AV6B 3F6TA 5JRGC 5B40B 5CPKB 4JJNA 3W99D 3AV1B 2HIOA 3W97B 2CV5A 3MGSB 1Q9CA 3REIC 2PYOA 2ZY4A 1ID3B 5B0YD 2ZY5A 5G49A 3AN2B 5B0ZD 1P3AC 1HQ3B 3WTPB 3AV2B 5BNVB 3LZ1D 2BYMA 4H9RA 3MGRC 4G92C 5CPIA 3EG5B 3MVDD 3LELB 4YS3A 3TU4A 5B33A 5B31D 5CPJC 2F8NH 1ZLAC 3C1BD 3VH6W 5AV5C 3X1UC 4Z66D 3C1CC 1AOIC 3AZLA 3W96D 4Z5TC 2Y2MA 3W99B 2RVQD 4J8WA 1TZYD 1ULYA 4H9SA 1F66A 5JRGA 4XZQB 5B32G 3MGQC 4JJND 4LD9D 4KUDC 5B0YB 2HIOD 4QLCC 5B0ZB 4WU8A 3EPJA 5AVCC 3REJC 3UTAC 2CV5D 4HGAC 3LZ1B 4J8XC 1BH9B 3MVDB 2PYOD 1P3AA 5B31B 4ZBJC 1WWSA 3MGRA 3C1BB 4Z66B 3KWQD 3KXBA 3X1SC 5CPID 3W96B 3V9RA 4YS3D 3TU4D 5CPJA 5B33D 1N1JB 5E5AC 1S32A 1AOIA 1TZYB 5AV6C 4Z5TA 1P34D 5B40C 3AZLD 5CPKC 3AZFA 3LJAD 3AV1C 5GSUD 3A6NB 4JJNB 4LD9B 3W97C 4J8WD 2HIOB 2F8NK 1F66D 3MGQA 3MGSC 5JRGD 2CV5B 1ID3C 4KUDA 2L5AA 3AN2C 1B67A 3UTAA 4Z2MG 4WU8D 3WTPC 3AV2C 4J8XA 1KX4D 3KWQB 3LELC 4H9RB 5CPIB 2IO5C 4YS3B 3WA9A 3KSYA 5KDMA 3AL0C 3VH5W 5B33B 3X1SA 3MGRD 4R8PD 3LZ0A 3KXBD 1P34B 3AZLB 2Y2JA 4NFTA 3LJAB 3AZHA 3W99C 5GSUB 4DRBA 5AV6A 3AZND 1S32D 1AOID 3B0CW 1F66B 3AZFD 5B0YC 3W97A 5B0ZC 5B2IA 1BH8A 3LZ1C 1KX4B 4WJ3C 3AN2A 3MVDC 1HTAA 4CAYB 3B0DB 1HQ3A 3WTPA 2HUEB 5BNVA 5B31C 3X1TD 3AFAA 3AV2A 1M18A 3C1BC 4Z66C 4J8XD 3LELA 4R8PB 3W96C 3KXBB 5BS7C 3V9RB 3WA9D 1TZYC 3AZNB 1R4VA 1S32B 3LZ0D 1P3LD 4KHAB 3W99A 3AZFB 4JJNC 4LD9C 3AZHD 1P3BA 2HIOC 4Z2MH 4XZQA 4NE5A 2CV5C 5B0ZA 2Y2OA 2W8SA 3X1TB 3LZ1A 5B2ID 1W2EA 3KWQC 5CPIC 3AN2D 5JA4B 1A7WA 3VH6A 4YS3C 1P3KA 1M18D 1HQ3D 3WTPD 3AFAD 3C1BA 5B33C 3WA9B 3KFUG 4WNNA 3VH6T 1JFIB 4YM6A 1P34C 5BS7A 3AZLC 1KX3D 3LZ0B 1P3LB 1N1JA 3LJAC 5GSUC 2JSSA 3AZHB 4H9SC 1F66C 2F8ND 3EPHA 3A6NA 4LD9A 3AZIA 4WU9D 1P3BD 4WU8C 4XZQD 1KX4C 5B2IB 1BH8B 2Y2PA 3B0BA 3MNNA 2HUEC 5B31G 5GXQD 4AWLB 1M18B 3AFAB 3KWQA 4KGCA 5AVBD 2RIQA 2VQRA 4R8PC 3KXBC 1B6WA 1KX3B 3AZGD 1P3KD 3AZNC 2YFWB 1S32C 1P34A 4YM6D 3LJAA 2F8NB 5GSUA 3AZFC 5B2JB 4WU9B 2FJ7A 1P3BB 1P3IA 3A6ND 5BNXA 3UTBA 3AZID 3X1TC 1KX4A 5GXQB 5AVBB 4CAYA 3KUYD 3MNND 3AZGB 1P3KB 3WA9C 4R8PA 4KGCD 2ZY2A 4WNNB 2CWEA 3LZ0C 1P3LC 4YM6B 1KX5A 3AZHC 3AZNA 5B24D 5F99A 2DQNC 3REHA 3REKD 4KHAA 3B0CT 4ZUXB 2JE5A 3A1KA 3AZIB 3WAAB 3O62A 2FJ7D 1TAFB 5BO0B 5B2IC 1P3ID 4H9PA 3KUYB 3X1TA 3UTBD 2NQBD 4AWLC 1M18C 1HQ3C 3MNNB 3AFAC 1P3GA 5JA4A 5CHLB 2BYKB 1KX3C 4KGCB 3AYWD 1BFMA 1JFIA 2Y2QA 5B24B 3REKB 1P3LA 4H9QB 1P3PD 5GT0D 1KX5D 3H0RC 5B2JC 4WU9C 3R45B 1P3BC 5F99D 4WZSB 4XZQC 3REHD 2FJ7B 1P3IB 3MGPD 2NQBB 5BNXB 4J8VA 3UTBB 5FUGA 3WKJD 5GXQC 3O62D 1F1EA 5AVBC 3NQUB 3W98D 3AYWB 3AZGC 1P3KC 1P3GD 4G91B 1KX3A 5GT3D 4YM6C 2F2AC 1P3PB 2YFWA 5GT0B 3B6FA 1KX5B 2F8NA 5F99B 5AV8D 3REHB 3P5JB 2LY8A 3A6NC 5B2JA 4WU9A 3AZIC 3MGPB 3WKJB 5AV9A 5B1MA 4XUJD 3O62B 1M19D 3WTPE 3UT9D 3KUYC 5GXQA 3W98B 4H9PB 3MNNC 4J8VD 1EQZD 5AVBA 1Z2CB 1P3GB 4KGCC 3H0MC 2FFFB 5GT3B 2BG1A 3AZGA 2YFVB 5B24C 3AZED 1H3OB 3REKC 4E44A 5BT1D 2F8NG 5AV8B 3AZMD 2Y2HA 4H9NA 3X1VA 4E45A 4M6BA 3B6FD 4EO5B 4ZUXA 1WWIA 2FJ7C 4H9OB 1U35B 1M19B 4XUJB 1P3IC 3WAAA 3UT9B 5B2JD 3FDDA 3UTBC 1P3OA 2NQBC 1TAFA 5AVCB 5BO0A 4J8VB 5FUGB 1EQZB 5AV9D 5B1MD 3KUYA 4NE3A 1P3MA 3B0DC 3AYWC 4CSRB 1PZRA 2BYKA 4G91C 3AZEB 5B1LD 5CP6A 5DNMD 3AZMB 1P3PC 2Y2IA 5GT0C 5C3IB 5B24A 1KX5C 2G5IC 3REKA 3B6FB 5F99C 1M1AA 3REHC 4H9QA 4J8UA 2NZDA 4WV4B 3R45A 3MGPC 3X1VD 3WKJC 5B32A 3B6GA 4ZUXD 4X23D 3O62C 5AV9B 3AZJA 3AZKA 5B1MB 2NQBA 2J8PA
chains in the Genus database with same CATH topology
3W98C 3WAAD 1P3OD 1P3GC 3NQUA 2AROD 3VH5A 2IO5B 5AY8A 5GT3C 3RELD 3AYWA 1P3MD 5B1LB 5DNMB 3VH5T 4UUZB 3NQJA 5AV8C 5DNNA 1P3PA 5GT0A 1P3FD 3A1IA 5CP6D 4H9NB 4EO5C 3X1VB 1U35C 1M1AD 4X23B 1M19C 4XUJC 4J8UD 2NZDD 3MGPA 3UT9C 3WKJA 4J8VC 1P3OB 3REIA 1EQZC 5B32D 3B6GD 3AZJD 3AZKD 3W98A 2AROB 3RELB 1P3MB 4NE6A 3AZEC 5GT3A 2YFVA 5BT1C 1ZLAA 5AY8D 3H0LC 3AZMC 5AV5A 3X1UA 5C3IC 3C1CA 1P3FB 1H3OA 5CP6B 3B6FC 5AV8A 4DQYB 1M1AB 5DNND 4J8UB 2NZDB 4H9OA 1U35A 1M19A 4XUJA 5B32B 5AV9C 3B6GB 5B1MC 2Y2LA 3UT9A 4QLCA 2PYOB 3REJA 5AVCA 3AZKB 3AZJB 2UWXA 5G49B 2Y2NA 1EQZA 3REID 2BYMB 2ZY3A 4CSRA 5B1LC 3TU4B 1P3AD 5AY8B 5DNMC 3AZEA 3EPKA 3AZMA 3NQJB 5CPJD 5E5AA 5DNNB 1ZLAD 1KU5A 5AV5D 3X1UD 3C1CD 3X1VC 4J8WB 2ZM5A 5B40A 5CPKA 4Z5TD 4ZUXC 4X23C 5JRGB 3AV1A 3WAAC 1P3OC 4WU8B 3MGSA 1U35D 1ID3A 3MGQD 2DF4C 3REIB 2Y2GA 4KUDD 2AROC 4QLCD 3UTAD 3RELC 3REJD 5AVCD 1P3MC 1P3AB 4G92B 3MGRB 5B1LA 4UPKA 5DNMA 5CPJB 1P3FC 2XD1A 2RVQC 5CP6C 4UUZA 1ZLAB 5AV5B 3X1UB 3X1SD 3C1CB 1AOIB 1M1AC 4Z5TB 4J8UC 2NZDC 5E5AD 5AV6D 4X23A 5B40D 3IP4C 4DRAA 5CPKD 5B32C 1T3UA 3B6GC 2Y2KA 3MGQB 5B0YA 3AV1D 2PYOC 3AZJC 3AZKC 4KUDB 3W97D 4QLCB 3UTAB 3REJB 1BH9A 3MGSD 4HGAB 3MVDA 4J8XB 1ID3D 2AROA 2JCHA 3RELA 5B31A 3TU4C 3EPLA 5AY8C 3AV2D 4Z66A 4ZBJB 5KDMB 3W96A 3LELD 3X1SB 2G5HC 2XD5A 1P3FA 5DNNC 1TZYA 5E5AB 4J8WC 5AV6B 3F6TA 5JRGC 5B40B 5CPKB 4JJNA 3W99D 3AV1B 2HIOA 3W97B 2CV5A 3MGSB 1Q9CA 3REIC 2PYOA 2ZY4A 1ID3B 5B0YD 2ZY5A 5G49A 3AN2B 5B0ZD 1P3AC 1HQ3B 3WTPB 3AV2B 5BNVB 3LZ1D 2BYMA 4H9RA 3MGRC 4G92C 5CPIA 3EG5B 3MVDD 3LELB 4YS3A 3TU4A 5B33A 5B31D 5CPJC 2F8NH 1ZLAC 3C1BD 3VH6W 5AV5C 3X1UC 4Z66D 3C1CC 1AOIC 3AZLA 3W96D 4Z5TC 2Y2MA 3W99B 2RVQD 4J8WA 1TZYD 1ULYA 4H9SA 1F66A 5JRGA 4XZQB 5B32G 3MGQC 4JJND 4LD9D 4KUDC 5B0YB 2HIOD 4QLCC 5B0ZB 4WU8A 3EPJA 5AVCC 3REJC 3UTAC 2CV5D 4HGAC 3LZ1B 4J8XC 1BH9B 3MVDB 2PYOD 1P3AA 5B31B 4ZBJC 1WWSA 3MGRA 3C1BB 4Z66B 3KWQD 3KXBA 3X1SC 5CPID 3W96B 3V9RA 4YS3D 3TU4D 5CPJA 5B33D 1N1JB 5E5AC 1S32A 1AOIA 1TZYB 5AV6C 4Z5TA 1P34D 5B40C 3AZLD 5CPKC 3AZFA 3LJAD 3AV1C 5GSUD 3A6NB 4JJNB 4LD9B 3W97C 4J8WD 2HIOB 2F8NK 1F66D 3MGQA 3MGSC 5JRGD 2CV5B 1ID3C 4KUDA 2L5AA 3AN2C 1B67A 3UTAA 4Z2MG 4WU8D 3WTPC 3AV2C 4J8XA 1KX4D 3KWQB 3LELC 4H9RB 5CPIB 2IO5C 4YS3B 3WA9A 3KSYA 5KDMA 3AL0C 3VH5W 5B33B 3X1SA 3MGRD 4R8PD 3LZ0A 3KXBD 1P34B 3AZLB 2Y2JA 4NFTA 3LJAB 3AZHA 3W99C 5GSUB 4DRBA 5AV6A 3AZND 1S32D 1AOID 3B0CW 1F66B 3AZFD 5B0YC 3W97A 5B0ZC 5B2IA 1BH8A 3LZ1C 1KX4B 4WJ3C 3AN2A 3MVDC 1HTAA 4CAYB 3B0DB 1HQ3A 3WTPA 2HUEB 5BNVA 5B31C 3X1TD 3AFAA 3AV2A 1M18A 3C1BC 4Z66C 4J8XD 3LELA 4R8PB 3W96C 3KXBB 5BS7C 3V9RB 3WA9D 1TZYC 3AZNB 1R4VA 1S32B 3LZ0D 1P3LD 4KHAB 3W99A 3AZFB 4JJNC 4LD9C 3AZHD 1P3BA 2HIOC 4Z2MH 4XZQA 4NE5A 2CV5C 5B0ZA 2Y2OA 2W8SA 3X1TB 3LZ1A 5B2ID 1W2EA 3KWQC 5CPIC 3AN2D 5JA4B 1A7WA 3VH6A 4YS3C 1P3KA 1M18D 1HQ3D 3WTPD 3AFAD 3C1BA 5B33C 3WA9B 3KFUG 4WNNA 3VH6T 1JFIB 4YM6A 1P34C 5BS7A 3AZLC 1KX3D 3LZ0B 1P3LB 1N1JA 3LJAC 5GSUC 2JSSA 3AZHB 4H9SC 1F66C 2F8ND 3EPHA 3A6NA 4LD9A 3AZIA 4WU9D 1P3BD 4WU8C 4XZQD 1KX4C 5B2IB 1BH8B 2Y2PA 3B0BA 3MNNA 2HUEC 5B31G 5GXQD 4AWLB 1M18B 3AFAB 3KWQA 4KGCA 5AVBD 2RIQA 2VQRA 4R8PC 3KXBC 1B6WA 1KX3B 3AZGD 1P3KD 3AZNC 2YFWB 1S32C 1P34A 4YM6D 3LJAA 2F8NB 5GSUA 3AZFC 5B2JB 4WU9B 2FJ7A 1P3BB 1P3IA 3A6ND 5BNXA 3UTBA 3AZID 3X1TC 1KX4A 5GXQB 5AVBB 4CAYA 3KUYD 3MNND 3AZGB 1P3KB 3WA9C 4R8PA 4KGCD 2ZY2A 4WNNB 2CWEA 3LZ0C 1P3LC 4YM6B 1KX5A 3AZHC 3AZNA 5B24D 5F99A 2DQNC 3REHA 3REKD 4KHAA 3B0CT 4ZUXB 2JE5A 3A1KA 3AZIB 3WAAB 3O62A 2FJ7D 1TAFB 5BO0B 5B2IC 1P3ID 4H9PA 3KUYB 3X1TA 3UTBD 2NQBD 4AWLC 1M18C 1HQ3C 3MNNB 3AFAC 1P3GA 5JA4A 5CHLB 2BYKB 1KX3C 4KGCB 3AYWD 1BFMA 1JFIA 2Y2QA 5B24B 3REKB 1P3LA 4H9QB 1P3PD 5GT0D 1KX5D 3H0RC 5B2JC 4WU9C 3R45B 1P3BC 5F99D 4WZSB 4XZQC 3REHD 2FJ7B 1P3IB 3MGPD 2NQBB 5BNXB 4J8VA 3UTBB 5FUGA 3WKJD 5GXQC 3O62D 1F1EA 5AVBC 3NQUB 3W98D 3AYWB 3AZGC 1P3KC 1P3GD 4G91B 1KX3A 5GT3D 4YM6C 2F2AC 1P3PB 2YFWA 5GT0B 3B6FA 1KX5B 2F8NA 5F99B 5AV8D 3REHB 3P5JB 2LY8A 3A6NC 5B2JA 4WU9A 3AZIC 3MGPB 3WKJB 5AV9A 5B1MA 4XUJD 3O62B 1M19D 3WTPE 3UT9D 3KUYC 5GXQA 3W98B 4H9PB 3MNNC 4J8VD 1EQZD 5AVBA 1Z2CB 1P3GB 4KGCC 3H0MC 2FFFB 5GT3B 2BG1A 3AZGA 2YFVB 5B24C 3AZED 1H3OB 3REKC 4E44A 5BT1D 2F8NG 5AV8B 3AZMD 2Y2HA 4H9NA 3X1VA 4E45A 4M6BA 3B6FD 4EO5B 4ZUXA 1WWIA 2FJ7C 4H9OB 1U35B 1M19B 4XUJB 1P3IC 3WAAA 3UT9B 5B2JD 3FDDA 3UTBC 1P3OA 2NQBC 1TAFA 5AVCB 5BO0A 4J8VB 5FUGB 1EQZB 5AV9D 5B1MD 3KUYA 4NE3A 1P3MA 3B0DC 3AYWC 4CSRB 1PZRA 2BYKA 4G91C 3AZEB 5B1LD 5CP6A 5DNMD 3AZMB 1P3PC 2Y2IA 5GT0C 5C3IB 5B24A 1KX5C 2G5IC 3REKA 3B6FB 5F99C 1M1AA 3REHC 4H9QA 4J8UA 2NZDA 4WV4B 3R45A 3MGPC 3X1VD 3WKJC 5B32A 3B6GA 4ZUXD 4X23D 3O62C 5AV9B 3AZJA 3AZKA 5B1MB 2NQBA 2J8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W98 C;  3WAA D;  1P3O D;  1P3G C;  3NQU A;  2ARO D;  3VH5 A;  2IO5 B;  5AY8 A;  5GT3 C;  3REL D;  3AYW A;  1P3M D;  5B1L B;  5DNM B;  3VH5 T;  4UUZ B;  3NQJ A;  5AV8 C;  5DNN A;  1P3P A;  5GT0 A;  1P3F D;  5CP6 D;  4H9N B;  4EO5 C;  3X1V B;  1U35 C;  1M1A D;  4X23 B;  1M19 C;  4XUJ C;  4J8U D;  2NZD D;  3MGP A;  3UT9 C;  3WKJ A;  4J8V C;  1P3O B;  3REI A;  1EQZ C;  5B32 D;  3B6G D;  3AZJ D;  3AZK D;  3W98 A;  2ARO B;  3REL B;  1P3M B;  4NE6 A;  3AZE C;  5GT3 A;  2YFV A;  5BT1 C;  1ZLA A;  5AY8 D;  3AZM C;  5AV5 A;  3X1U A;  5C3I C;  3C1C A;  1P3F B;  1H3O A;  5CP6 B;  3B6F C;  5AV8 A;  1M1A B;  5DNN D;  4J8U B;  2NZD B;  4H9O A;  1U35 A;  1M19 A;  4XUJ A;  5B32 B;  5AV9 C;  3B6G B;  5B1M C;  3UT9 A;  4QLC A;  2PYO B;  3REJ A;  5AVC A;  3AZK B;  3AZJ B;  5G49 B;  1EQZ A;  3REI D;  2BYM B;  4CSR A;  5B1L C;  3TU4 B;  1P3A D;  5AY8 B;  5DNM C;  3AZE A;  3AZM A;  3NQJ B;  5CPJ D;  5E5A A;  5DNN B;  1ZLA D;  1KU5 A;  5AV5 D;  3X1U D;  3C1C D;  3X1V C;  4J8W B;  5B40 A;  5CPK A;  4Z5T D;  4ZUX C;  4X23 C;  5JRG B;  3AV1 A;  3WAA C;  1P3O C;  4WU8 B;  3MGS A;  1U35 D;  1ID3 A;  3MGQ D;  3REI B;  4KUD D;  2ARO C;  4QLC D;  3UTA D;  3REL C;  3REJ D;  5AVC D;  1P3M C;  1P3A B;  4G92 B;  3MGR B;  5B1L A;  5DNM A;  5CPJ B;  1P3F C;  1ZLA B;  2RVQ C;  5CP6 C;  4UUZ A;  5AV5 B;  3X1U B;  3X1S D;  3C1C B;  1AOI B;  1M1A C;  4Z5T B;  4J8U C;  2NZD C;  5E5A D;  5AV6 D;  4X23 A;  5B40 D;  5CPK D;  4DRA A;  5B32 C;  3B6G C;  3MGQ B;  5B0Y A;  3AV1 D;  2PYO C;  3AZJ C;  3AZK C;  4KUD B;  3W97 D;  4QLC B;  3UTA B;  3REJ B;  1BH9 A;  3MGS D;  4HGA B;  3MVD A;  4J8X B;  1ID3 D;  2ARO A;  3REL A;  5B31 A;  3TU4 C;  5AY8 C;  3AV2 D;  4Z66 A;  4ZBJ B;  5KDM B;  3W96 A;  3LEL D;  3X1S B;  1P3F A;  5DNN C;  1TZY A;  5E5A B;  4J8W C;  5AV6 B;  5B40 B;  5JRG C;  5CPK B;  4JJN A;  3W99 D;  3AV1 B;  2HIO A;  3W97 B;  2CV5 A;  3MGS B;  1Q9C A;  3REI C;  2PYO A;  1ID3 B;  5B0Y D;  3AN2 B;  5G49 A;  5B0Z D;  1P3A C;  1HQ3 B;  3WTP B;  3AV2 B;  5BNV B;  3LZ1 D;  2BYM A;  4H9R A;  3MGR C;  4G92 C;  5CPI A;  3MVD D;  3LEL B;  4YS3 A;  3TU4 A;  5B33 A;  5B31 D;  5CPJ C;  2F8N H;  1ZLA C;  3C1B D;  3VH6 W;  5AV5 C;  3X1U C;  4Z66 D;  3C1C C;  1AOI C;  3AZL A;  3W96 D;  4Z5T C;  3W99 B;  2RVQ D;  4J8W A;  1TZY D;  1ULY A;  4H9S A;  1F66 A;  5JRG A;  4XZQ B;  5B32 G;  3MGQ C;  4JJN D;  4LD9 D;  4KUD C;  5B0Y B;  2HIO D;  4QLC C;  5B0Z B;  4WU8 A;  3REJ C;  5AVC C;  3UTA C;  2CV5 D;  4HGA C;  3LZ1 B;  4J8X C;  1BH9 B;  3MVD B;  2PYO D;  1P3A A;  5B31 B;  4ZBJ C;  1WWS A;  3MGR A;  3C1B B;  4Z66 B;  3KWQ D;  3KXB A;  3X1S C;  5CPI D;  3W96 B;  3V9R A;  4YS3 D;  3TU4 D;  5CPJ A;  5B33 D;  1N1J B;  5E5A C;  1S32 A;  1AOI A;  1TZY B;  5AV6 C;  4Z5T A;  1P34 D;  5B40 C;  3AZL D;  5CPK C;  3AZF A;  3LJA D;  3AV1 C;  5GSU D;  3A6N B;  4JJN B;  4LD9 B;  3W97 C;  4J8W D;  2HIO B;  2F8N K;  1F66 D;  3MGQ A;  3MGS C;  5JRG D;  2CV5 B;  1ID3 C;  4KUD A;  2L5A A;  3AN2 C;  1B67 A;  3UTA A;  4Z2M G;  4WU8 D;  3WTP C;  3AV2 C;  4J8X A;  1KX4 D;  3KWQ B;  3LEL C;  4H9R B;  5CPI B;  2IO5 C;  4YS3 B;  3WA9 A;  3KSY A;  5KDM A;  3VH5 W;  5B33 B;  3X1S A;  3MGR D;  4R8P D;  3LZ0 A;  3KXB D;  1P34 B;  3AZL B;  4NFT A;  3LJA B;  3AZH A;  3W99 C;  5GSU B;  4DRB A;  5AV6 A;  3AZN D;  1S32 D;  1AOI D;  3B0C W;  1F66 B;  3AZF D;  5B0Y C;  3W97 A;  5B0Z C;  5B2I A;  1BH8 A;  3LZ1 C;  1KX4 B;  3AN2 A;  3MVD C;  1HTA A;  4CAY B;  3B0D B;  1HQ3 A;  3WTP A;  2HUE B;  5BNV A;  5B31 C;  3X1T D;  3AFA A;  3AV2 A;  1M18 A;  3C1B C;  4Z66 C;  4J8X D;  3LEL A;  4R8P B;  3W96 C;  3KXB B;  5BS7 C;  3V9R B;  3WA9 D;  1TZY C;  3AZN B;  1R4V A;  1S32 B;  3LZ0 D;  1P3L D;  4KHA B;  3W99 A;  3AZF B;  4JJN C;  4LD9 C;  3AZH D;  1P3B A;  2HIO C;  4Z2M H;  4XZQ A;  4NE5 A;  2CV5 C;  5B0Z A;  3X1T B;  3LZ1 A;  5B2I D;  3KWQ C;  5CPI C;  3AN2 D;  5JA4 B;  1A7W A;  3VH6 A;  4YS3 C;  1P3K A;  1M18 D;  1HQ3 D;  3WTP D;  3AFA D;  3C1B A;  5B33 C;  3WA9 B;  4WNN A;  3VH6 T;  1JFI B;  4YM6 A;  1P34 C;  5BS7 A;  3AZL C;  1KX3 D;  3LZ0 B;  1P3L B;  1N1J A;  3LJA C;  5GSU C;  2JSS A;  3AZH B;  4H9S C;  1F66 C;  2F8N D;  3A6N A;  4LD9 A;  3AZI A;  4WU9 D;  1P3B D;  4WU8 C;  4XZQ D;  1KX4 C;  5B2I B;  1BH8 B;  3B0B A;  3MNN A;  2HUE C;  5B31 G;  5GXQ D;  4AWL B;  1M18 B;  3AFA B;  3KWQ A;  4KGC A;  4R8P C;  5AVB D;  3KXB C;  1B6W A;  1KX3 B;  3AZG D;  1P3K D;  3AZN C;  2YFW B;  1S32 C;  1P34 A;  4YM6 D;  3LJA A;  2F8N B;  5GSU A;  3AZF C;  5B2J B;  4WU9 B;  2FJ7 A;  1P3B B;  1P3I A;  3A6N D;  5BNX A;  3UTB A;  3AZI D;  3X1T C;  1KX4 A;  5GXQ B;  5AVB B;  4CAY A;  3KUY D;  3MNN D;  3AZG B;  1P3K B;  3WA9 C;  4R8P A;  4KGC D;  4WNN B;  2CWE A;  3LZ0 C;  1P3L C;  4YM6 B;  1KX5 A;  3AZH C;  3AZN A;  5B24 D;  5F99 A;  3REK D;  3REH A;  4KHA A;  3B0C T;  4ZUX B;  3AZI B;  3WAA B;  3O62 A;  2FJ7 D;  1TAF B;  5BO0 B;  5B2I C;  1P3I D;  4H9P A;  3KUY B;  3X1T A;  3UTB D;  2NQB D;  4AWL C;  1M18 C;  1HQ3 C;  3MNN B;  3AFA C;  1P3G A;  5JA4 A;  5CHL B;  2BYK B;  1KX3 C;  4KGC B;  3AYW D;  1BFM A;  1JFI A;  5B24 B;  3REK B;  1P3L A;  4H9Q B;  1P3P D;  5GT0 D;  1KX5 D;  5B2J C;  4WU9 C;  3R45 B;  1P3B C;  5F99 D;  4WZS B;  4XZQ C;  3REH D;  2FJ7 B;  1P3I B;  3MGP D;  2NQB B;  5BNX B;  4J8V A;  3UTB B;  5FUG A;  3WKJ D;  5GXQ C;  3O62 D;  1F1E A;  5AVB C;  3NQU B;  3W98 D;  3AYW B;  3AZG C;  1P3K C;  1P3G D;  4G91 B;  1KX3 A;  5GT3 D;  4YM6 C;  1P3P B;  2YFW A;  5GT0 B;  3B6F A;  1KX5 B;  2F8N A;  5F99 B;  5AV8 D;  3REH B;  2LY8 A;  3A6N C;  5B2J A;  4WU9 A;  3AZI C;  3MGP B;  3WKJ B;  5AV9 A;  5B1M A;  4XUJ D;  3O62 B;  1M19 D;  3WTP E;  3UT9 D;  3KUY C;  5GXQ A;  3W98 B;  4H9P B;  3MNN C;  4J8V D;  1EQZ D;  5AVB A;  1P3G B;  4KGC C;  5GT3 B;  3AZG A;  2YFV B;  5B24 C;  3AZE D;  1H3O B;  3REK C;  4E44 A;  5BT1 D;  2F8N G;  5AV8 B;  3AZM D;  4H9N A;  3X1V A;  4E45 A;  4M6B A;  3B6F D;  4EO5 B;  4ZUX A;  1WWI A;  2FJ7 C;  4H9O B;  1U35 B;  1M19 B;  4XUJ B;  1P3I C;  3WAA A;  3UT9 B;  5B2J D;  1P3O A;  3UTB C;  2NQB C;  1TAF A;  5AVC B;  5BO0 A;  4J8V B;  5FUG B;  1EQZ B;  5AV9 D;  5B1M D;  3KUY A;  4NE3 A;  1P3M A;  3B0D C;  3AYW C;  4CSR B;  4G91 C;  2BYK A;  3AZE B;  5B1L D;  5CP6 A;  5DNM D;  3AZM B;  1P3P C;  5GT0 C;  5C3I B;  5B24 A;  1KX5 C;  3REK A;  3B6F B;  5F99 C;  1M1A A;  3REH C;  4H9Q A;  4J8U A;  2NZD A;  4WV4 B;  3R45 A;  3MGP C;  3X1V D;  3WKJ C;  5B32 A;  3B6G A;  4ZUX D;  4X23 D;  3O62 C;  5AV9 B;  3AZJ A;  3AZK A;  5B1M B;  2NQB A; 
#chains in the Genus database with same CATH topology
 3W98 C;  3WAA D;  1P3O D;  1P3G C;  3NQU A;  2ARO D;  3VH5 A;  2IO5 B;  5AY8 A;  5GT3 C;  3REL D;  3AYW A;  1P3M D;  5B1L B;  5DNM B;  3VH5 T;  4UUZ B;  3NQJ A;  5AV8 C;  5DNN A;  1P3P A;  5GT0 A;  1P3F D;  3A1I A;  5CP6 D;  4H9N B;  4EO5 C;  3X1V B;  1U35 C;  1M1A D;  4X23 B;  1M19 C;  4XUJ C;  4J8U D;  2NZD D;  3MGP A;  3UT9 C;  3WKJ A;  4J8V C;  1P3O B;  3REI A;  1EQZ C;  5B32 D;  3B6G D;  3AZJ D;  3AZK D;  3W98 A;  2ARO B;  3REL B;  1P3M B;  4NE6 A;  3AZE C;  5GT3 A;  2YFV A;  5BT1 C;  1ZLA A;  5AY8 D;  3H0L C;  3AZM C;  5AV5 A;  3X1U A;  5C3I C;  3C1C A;  1P3F B;  1H3O A;  5CP6 B;  3B6F C;  5AV8 A;  4DQY B;  1M1A B;  5DNN D;  4J8U B;  2NZD B;  4H9O A;  1U35 A;  1M19 A;  4XUJ A;  5B32 B;  5AV9 C;  3B6G B;  5B1M C;  2Y2L A;  3UT9 A;  4QLC A;  2PYO B;  3REJ A;  5AVC A;  3AZK B;  3AZJ B;  2UWX A;  5G49 B;  2Y2N A;  1EQZ A;  3REI D;  2BYM B;  2ZY3 A;  4CSR A;  5B1L C;  3TU4 B;  1P3A D;  5AY8 B;  5DNM C;  3AZE A;  3EPK A;  3AZM A;  3NQJ B;  5CPJ D;  5E5A A;  5DNN B;  1ZLA D;  1KU5 A;  5AV5 D;  3X1U D;  3C1C D;  3X1V C;  4J8W B;  2ZM5 A;  5B40 A;  5CPK A;  4Z5T D;  4ZUX C;  4X23 C;  5JRG B;  3AV1 A;  3WAA C;  1P3O C;  4WU8 B;  3MGS A;  1U35 D;  1ID3 A;  3MGQ D;  2DF4 C;  3REI B;  2Y2G A;  4KUD D;  2ARO C;  4QLC D;  3UTA D;  3REL C;  3REJ D;  5AVC D;  1P3M C;  1P3A B;  4G92 B;  3MGR B;  5B1L A;  4UPK A;  5DNM A;  5CPJ B;  1P3F C;  2XD1 A;  2RVQ C;  5CP6 C;  4UUZ A;  1ZLA B;  5AV5 B;  3X1U B;  3X1S D;  3C1C B;  1AOI B;  1M1A C;  4Z5T B;  4J8U C;  2NZD C;  5E5A D;  5AV6 D;  4X23 A;  5B40 D;  3IP4 C;  4DRA A;  5CPK D;  5B32 C;  1T3U A;  3B6G C;  2Y2K A;  3MGQ B;  5B0Y A;  3AV1 D;  2PYO C;  3AZJ C;  3AZK C;  4KUD B;  3W97 D;  4QLC B;  3UTA B;  3REJ B;  1BH9 A;  3MGS D;  4HGA B;  3MVD A;  4J8X B;  1ID3 D;  2ARO A;  2JCH A;  3REL A;  5B31 A;  3TU4 C;  3EPL A;  5AY8 C;  3AV2 D;  4Z66 A;  4ZBJ B;  5KDM B;  3W96 A;  3LEL D;  3X1S B;  2G5H C;  2XD5 A;  1P3F A;  5DNN C;  1TZY A;  5E5A B;  4J8W C;  5AV6 B;  3F6T A;  5JRG C;  5B40 B;  5CPK B;  4JJN A;  3W99 D;  3AV1 B;  2HIO A;  3W97 B;  2CV5 A;  3MGS B;  1Q9C A;  3REI C;  2PYO A;  2ZY4 A;  1ID3 B;  5B0Y D;  2ZY5 A;  5G49 A;  3AN2 B;  5B0Z D;  1P3A C;  1HQ3 B;  3WTP B;  3AV2 B;  5BNV B;  3LZ1 D;  2BYM A;  4H9R A;  3MGR C;  4G92 C;  5CPI A;  3EG5 B;  3MVD D;  3LEL B;  4YS3 A;  3TU4 A;  5B33 A;  5B31 D;  5CPJ C;  2F8N H;  1ZLA C;  3C1B D;  3VH6 W;  5AV5 C;  3X1U C;  4Z66 D;  3C1C C;  1AOI C;  3AZL A;  3W96 D;  4Z5T C;  2Y2M A;  3W99 B;  2RVQ D;  4J8W A;  1TZY D;  1ULY A;  4H9S A;  1F66 A;  5JRG A;  4XZQ B;  5B32 G;  3MGQ C;  4JJN D;  4LD9 D;  4KUD C;  5B0Y B;  2HIO D;  4QLC C;  5B0Z B;  4WU8 A;  3EPJ A;  5AVC C;  3REJ C;  3UTA C;  2CV5 D;  4HGA C;  3LZ1 B;  4J8X C;  1BH9 B;  3MVD B;  2PYO D;  1P3A A;  5B31 B;  4ZBJ C;  1WWS A;  3MGR A;  3C1B B;  4Z66 B;  3KWQ D;  3KXB A;  3X1S C;  5CPI D;  3W96 B;  3V9R A;  4YS3 D;  3TU4 D;  5CPJ A;  5B33 D;  1N1J B;  5E5A C;  1S32 A;  1AOI A;  1TZY B;  5AV6 C;  4Z5T A;  1P34 D;  5B40 C;  3AZL D;  5CPK C;  3AZF A;  3LJA D;  3AV1 C;  5GSU D;  3A6N B;  4JJN B;  4LD9 B;  3W97 C;  4J8W D;  2HIO B;  2F8N K;  1F66 D;  3MGQ A;  3MGS C;  5JRG D;  2CV5 B;  1ID3 C;  4KUD A;  2L5A A;  3AN2 C;  1B67 A;  3UTA A;  4Z2M G;  4WU8 D;  3WTP C;  3AV2 C;  4J8X A;  1KX4 D;  3KWQ B;  3LEL C;  4H9R B;  5CPI B;  2IO5 C;  4YS3 B;  3WA9 A;  3KSY A;  5KDM A;  3AL0 C;  3VH5 W;  5B33 B;  3X1S A;  3MGR D;  4R8P D;  3LZ0 A;  3KXB D;  1P34 B;  3AZL B;  2Y2J A;  4NFT A;  3LJA B;  3AZH A;  3W99 C;  5GSU B;  4DRB A;  5AV6 A;  3AZN D;  1S32 D;  1AOI D;  3B0C W;  1F66 B;  3AZF D;  5B0Y C;  3W97 A;  5B0Z C;  5B2I A;  1BH8 A;  3LZ1 C;  1KX4 B;  4WJ3 C;  3AN2 A;  3MVD C;  1HTA A;  4CAY B;  3B0D B;  1HQ3 A;  3WTP A;  2HUE B;  5BNV A;  5B31 C;  3X1T D;  3AFA A;  3AV2 A;  1M18 A;  3C1B C;  4Z66 C;  4J8X D;  3LEL A;  4R8P B;  3W96 C;  3KXB B;  5BS7 C;  3V9R B;  3WA9 D;  1TZY C;  3AZN B;  1R4V A;  1S32 B;  3LZ0 D;  1P3L D;  4KHA B;  3W99 A;  3AZF B;  4JJN C;  4LD9 C;  3AZH D;  1P3B A;  2HIO C;  4Z2M H;  4XZQ A;  4NE5 A;  2CV5 C;  5B0Z A;  2Y2O A;  2W8S A;  3X1T B;  3LZ1 A;  5B2I D;  1W2E A;  3KWQ C;  5CPI C;  3AN2 D;  5JA4 B;  1A7W A;  3VH6 A;  4YS3 C;  1P3K A;  1M18 D;  1HQ3 D;  3WTP D;  3AFA D;  3C1B A;  5B33 C;  3WA9 B;  3KFU G;  4WNN A;  3VH6 T;  1JFI B;  4YM6 A;  1P34 C;  5BS7 A;  3AZL C;  1KX3 D;  3LZ0 B;  1P3L B;  1N1J A;  3LJA C;  5GSU C;  2JSS A;  3AZH B;  4H9S C;  1F66 C;  2F8N D;  3EPH A;  3A6N A;  4LD9 A;  3AZI A;  4WU9 D;  1P3B D;  4WU8 C;  4XZQ D;  1KX4 C;  5B2I B;  1BH8 B;  2Y2P A;  3B0B A;  3MNN A;  2HUE C;  5B31 G;  5GXQ D;  4AWL B;  1M18 B;  3AFA B;  3KWQ A;  4KGC A;  5AVB D;  2RIQ A;  2VQR A;  4R8P C;  3KXB C;  1B6W A;  1KX3 B;  3AZG D;  1P3K D;  3AZN C;  2YFW B;  1S32 C;  1P34 A;  4YM6 D;  3LJA A;  2F8N B;  5GSU A;  3AZF C;  5B2J B;  4WU9 B;  2FJ7 A;  1P3B B;  1P3I A;  3A6N D;  5BNX A;  3UTB A;  3AZI D;  3X1T C;  1KX4 A;  5GXQ B;  5AVB B;  4CAY A;  3KUY D;  3MNN D;  3AZG B;  1P3K B;  3WA9 C;  4R8P A;  4KGC D;  2ZY2 A;  4WNN B;  2CWE A;  3LZ0 C;  1P3L C;  4YM6 B;  1KX5 A;  3AZH C;  3AZN A;  5B24 D;  5F99 A;  2DQN C;  3REH A;  3REK D;  4KHA A;  3B0C T;  4ZUX B;  2JE5 A;  3A1K A;  3AZI B;  3WAA B;  3O62 A;  2FJ7 D;  1TAF B;  5BO0 B;  5B2I C;  1P3I D;  4H9P A;  3KUY B;  3X1T A;  3UTB D;  2NQB D;  4AWL C;  1M18 C;  1HQ3 C;  3MNN B;  3AFA C;  1P3G A;  5JA4 A;  5CHL B;  2BYK B;  1KX3 C;  4KGC B;  3AYW D;  1BFM A;  1JFI A;  2Y2Q A;  5B24 B;  3REK B;  1P3L A;  4H9Q B;  1P3P D;  5GT0 D;  1KX5 D;  3H0R C;  5B2J C;  4WU9 C;  3R45 B;  1P3B C;  5F99 D;  4WZS B;  4XZQ C;  3REH D;  2FJ7 B;  1P3I B;  3MGP D;  2NQB B;  5BNX B;  4J8V A;  3UTB B;  5FUG A;  3WKJ D;  5GXQ C;  3O62 D;  1F1E A;  5AVB C;  3NQU B;  3W98 D;  3AYW B;  3AZG C;  1P3K C;  1P3G D;  4G91 B;  1KX3 A;  5GT3 D;  4YM6 C;  2F2A C;  1P3P B;  2YFW A;  5GT0 B;  3B6F A;  1KX5 B;  2F8N A;  5F99 B;  5AV8 D;  3REH B;  3P5J B;  2LY8 A;  3A6N C;  5B2J A;  4WU9 A;  3AZI C;  3MGP B;  3WKJ B;  5AV9 A;  5B1M A;  4XUJ D;  3O62 B;  1M19 D;  3WTP E;  3UT9 D;  3KUY C;  5GXQ A;  3W98 B;  4H9P B;  3MNN C;  4J8V D;  1EQZ D;  5AVB A;  1Z2C B;  1P3G B;  4KGC C;  3H0M C;  2FFF B;  5GT3 B;  2BG1 A;  3AZG A;  2YFV B;  5B24 C;  3AZE D;  1H3O B;  3REK C;  4E44 A;  5BT1 D;  2F8N G;  5AV8 B;  3AZM D;  2Y2H A;  4H9N A;  3X1V A;  4E45 A;  4M6B A;  3B6F D;  4EO5 B;  4ZUX A;  1WWI A;  2FJ7 C;  4H9O B;  1U35 B;  1M19 B;  4XUJ B;  1P3I C;  3WAA A;  3UT9 B;  5B2J D;  3FDD A;  3UTB C;  1P3O A;  2NQB C;  1TAF A;  5AVC B;  5BO0 A;  4J8V B;  5FUG B;  1EQZ B;  5AV9 D;  5B1M D;  3KUY A;  4NE3 A;  1P3M A;  3B0D C;  3AYW C;  4CSR B;  1PZR A;  2BYK A;  4G91 C;  3AZE B;  5B1L D;  5CP6 A;  5DNM D;  3AZM B;  1P3P C;  2Y2I A;  5GT0 C;  5C3I B;  5B24 A;  1KX5 C;  2G5I C;  3REK A;  3B6F B;  5F99 C;  1M1A A;  3REH C;  4H9Q A;  4J8U A;  2NZD A;  4WV4 B;  3R45 A;  3MGP C;  3X1V D;  3WKJ C;  5B32 A;  3B6G A;  4ZUX D;  4X23 D;  3O62 C;  5AV9 B;  3AZJ A;  3AZK A;  5B1M B;  2NQB A;  2J8P A; 
#chains in the Genus database with same CATH homology
 3W98 C;  3WAA D;  1P3O D;  1P3G C;  3NQU A;  2ARO D;  3VH5 A;  2IO5 B;  5AY8 A;  5GT3 C;  3REL D;  3AYW A;  1P3M D;  5B1L B;  5DNM B;  3VH5 T;  4UUZ B;  3NQJ A;  5AV8 C;  5DNN A;  1P3P A;  5GT0 A;  1P3F D;  3A1I A;  5CP6 D;  4H9N B;  4EO5 C;  3X1V B;  1U35 C;  1M1A D;  4X23 B;  1M19 C;  4XUJ C;  4J8U D;  2NZD D;  3MGP A;  3UT9 C;  3WKJ A;  4J8V C;  1P3O B;  3REI A;  1EQZ C;  5B32 D;  3B6G D;  3AZJ D;  3AZK D;  3W98 A;  2ARO B;  3REL B;  1P3M B;  4NE6 A;  3AZE C;  5GT3 A;  2YFV A;  5BT1 C;  1ZLA A;  5AY8 D;  3H0L C;  3AZM C;  5AV5 A;  3X1U A;  5C3I C;  3C1C A;  1P3F B;  1H3O A;  5CP6 B;  3B6F C;  5AV8 A;  4DQY B;  1M1A B;  5DNN D;  4J8U B;  2NZD B;  4H9O A;  1U35 A;  1M19 A;  4XUJ A;  5B32 B;  5AV9 C;  3B6G B;  5B1M C;  2Y2L A;  3UT9 A;  4QLC A;  2PYO B;  3REJ A;  5AVC A;  3AZK B;  3AZJ B;  2UWX A;  5G49 B;  2Y2N A;  1EQZ A;  3REI D;  2BYM B;  2ZY3 A;  4CSR A;  5B1L C;  3TU4 B;  1P3A D;  5AY8 B;  5DNM C;  3AZE A;  3EPK A;  3AZM A;  3NQJ B;  5CPJ D;  5E5A A;  5DNN B;  1ZLA D;  1KU5 A;  5AV5 D;  3X1U D;  3C1C D;  3X1V C;  4J8W B;  2ZM5 A;  5B40 A;  5CPK A;  4Z5T D;  4ZUX C;  4X23 C;  5JRG B;  3AV1 A;  3WAA C;  1P3O C;  4WU8 B;  3MGS A;  1U35 D;  1ID3 A;  3MGQ D;  2DF4 C;  3REI B;  2Y2G A;  4KUD D;  2ARO C;  4QLC D;  3UTA D;  3REL C;  3REJ D;  5AVC D;  1P3M C;  1P3A B;  4G92 B;  3MGR B;  5B1L A;  4UPK A;  5DNM A;  5CPJ B;  1P3F C;  2XD1 A;  2RVQ C;  5CP6 C;  4UUZ A;  1ZLA B;  5AV5 B;  3X1U B;  3X1S D;  3C1C B;  1AOI B;  1M1A C;  4Z5T B;  4J8U C;  2NZD C;  5E5A D;  5AV6 D;  4X23 A;  5B40 D;  3IP4 C;  4DRA A;  5CPK D;  5B32 C;  1T3U A;  3B6G C;  2Y2K A;  3MGQ B;  5B0Y A;  3AV1 D;  2PYO C;  3AZJ C;  3AZK C;  4KUD B;  3W97 D;  4QLC B;  3UTA B;  3REJ B;  1BH9 A;  3MGS D;  4HGA B;  3MVD A;  4J8X B;  1ID3 D;  2ARO A;  2JCH A;  3REL A;  5B31 A;  3TU4 C;  3EPL A;  5AY8 C;  3AV2 D;  4Z66 A;  4ZBJ B;  5KDM B;  3W96 A;  3LEL D;  3X1S B;  2G5H C;  2XD5 A;  1P3F A;  5DNN C;  1TZY A;  5E5A B;  4J8W C;  5AV6 B;  3F6T A;  5JRG C;  5B40 B;  5CPK B;  4JJN A;  3W99 D;  3AV1 B;  2HIO A;  3W97 B;  2CV5 A;  3MGS B;  1Q9C A;  3REI C;  2PYO A;  2ZY4 A;  1ID3 B;  5B0Y D;  2ZY5 A;  5G49 A;  3AN2 B;  5B0Z D;  1P3A C;  1HQ3 B;  3WTP B;  3AV2 B;  5BNV B;  3LZ1 D;  2BYM A;  4H9R A;  3MGR C;  4G92 C;  5CPI A;  3EG5 B;  3MVD D;  3LEL B;  4YS3 A;  3TU4 A;  5B33 A;  5B31 D;  5CPJ C;  2F8N H;  1ZLA C;  3C1B D;  3VH6 W;  5AV5 C;  3X1U C;  4Z66 D;  3C1C C;  1AOI C;  3AZL A;  3W96 D;  4Z5T C;  2Y2M A;  3W99 B;  2RVQ D;  4J8W A;  1TZY D;  1ULY A;  4H9S A;  1F66 A;  5JRG A;  4XZQ B;  5B32 G;  3MGQ C;  4JJN D;  4LD9 D;  4KUD C;  5B0Y B;  2HIO D;  4QLC C;  5B0Z B;  4WU8 A;  3EPJ A;  5AVC C;  3REJ C;  3UTA C;  2CV5 D;  4HGA C;  3LZ1 B;  4J8X C;  1BH9 B;  3MVD B;  2PYO D;  1P3A A;  5B31 B;  4ZBJ C;  1WWS A;  3MGR A;  3C1B B;  4Z66 B;  3KWQ D;  3KXB A;  3X1S C;  5CPI D;  3W96 B;  3V9R A;  4YS3 D;  3TU4 D;  5CPJ A;  5B33 D;  1N1J B;  5E5A C;  1S32 A;  1AOI A;  1TZY B;  5AV6 C;  4Z5T A;  1P34 D;  5B40 C;  3AZL D;  5CPK C;  3AZF A;  3LJA D;  3AV1 C;  5GSU D;  3A6N B;  4JJN B;  4LD9 B;  3W97 C;  4J8W D;  2HIO B;  2F8N K;  1F66 D;  3MGQ A;  3MGS C;  5JRG D;  2CV5 B;  1ID3 C;  4KUD A;  2L5A A;  3AN2 C;  1B67 A;  3UTA A;  4Z2M G;  4WU8 D;  3WTP C;  3AV2 C;  4J8X A;  1KX4 D;  3KWQ B;  3LEL C;  4H9R B;  5CPI B;  2IO5 C;  4YS3 B;  3WA9 A;  3KSY A;  5KDM A;  3AL0 C;  3VH5 W;  5B33 B;  3X1S A;  3MGR D;  4R8P D;  3LZ0 A;  3KXB D;  1P34 B;  3AZL B;  2Y2J A;  4NFT A;  3LJA B;  3AZH A;  3W99 C;  5GSU B;  4DRB A;  5AV6 A;  3AZN D;  1S32 D;  1AOI D;  3B0C W;  1F66 B;  3AZF D;  5B0Y C;  3W97 A;  5B0Z C;  5B2I A;  1BH8 A;  3LZ1 C;  1KX4 B;  4WJ3 C;  3AN2 A;  3MVD C;  1HTA A;  4CAY B;  3B0D B;  1HQ3 A;  3WTP A;  2HUE B;  5BNV A;  5B31 C;  3X1T D;  3AFA A;  3AV2 A;  1M18 A;  3C1B C;  4Z66 C;  4J8X D;  3LEL A;  4R8P B;  3W96 C;  3KXB B;  5BS7 C;  3V9R B;  3WA9 D;  1TZY C;  3AZN B;  1R4V A;  1S32 B;  3LZ0 D;  1P3L D;  4KHA B;  3W99 A;  3AZF B;  4JJN C;  4LD9 C;  3AZH D;  1P3B A;  2HIO C;  4Z2M H;  4XZQ A;  4NE5 A;  2CV5 C;  5B0Z A;  2Y2O A;  2W8S A;  3X1T B;  3LZ1 A;  5B2I D;  1W2E A;  3KWQ C;  5CPI C;  3AN2 D;  5JA4 B;  1A7W A;  3VH6 A;  4YS3 C;  1P3K A;  1M18 D;  1HQ3 D;  3WTP D;  3AFA D;  3C1B A;  5B33 C;  3WA9 B;  3KFU G;  4WNN A;  3VH6 T;  1JFI B;  4YM6 A;  1P34 C;  5BS7 A;  3AZL C;  1KX3 D;  3LZ0 B;  1P3L B;  1N1J A;  3LJA C;  5GSU C;  2JSS A;  3AZH B;  4H9S C;  1F66 C;  2F8N D;  3EPH A;  3A6N A;  4LD9 A;  3AZI A;  4WU9 D;  1P3B D;  4WU8 C;  4XZQ D;  1KX4 C;  5B2I B;  1BH8 B;  2Y2P A;  3B0B A;  3MNN A;  2HUE C;  5B31 G;  5GXQ D;  4AWL B;  1M18 B;  3AFA B;  3KWQ A;  4KGC A;  5AVB D;  2RIQ A;  2VQR A;  4R8P C;  3KXB C;  1B6W A;  1KX3 B;  3AZG D;  1P3K D;  3AZN C;  2YFW B;  1S32 C;  1P34 A;  4YM6 D;  3LJA A;  2F8N B;  5GSU A;  3AZF C;  5B2J B;  4WU9 B;  2FJ7 A;  1P3B B;  1P3I A;  3A6N D;  5BNX A;  3UTB A;  3AZI D;  3X1T C;  1KX4 A;  5GXQ B;  5AVB B;  4CAY A;  3KUY D;  3MNN D;  3AZG B;  1P3K B;  3WA9 C;  4R8P A;  4KGC D;  2ZY2 A;  4WNN B;  2CWE A;  3LZ0 C;  1P3L C;  4YM6 B;  1KX5 A;  3AZH C;  3AZN A;  5B24 D;  5F99 A;  2DQN C;  3REH A;  3REK D;  4KHA A;  3B0C T;  4ZUX B;  2JE5 A;  3A1K A;  3AZI B;  3WAA B;  3O62 A;  2FJ7 D;  1TAF B;  5BO0 B;  5B2I C;  1P3I D;  4H9P A;  3KUY B;  3X1T A;  3UTB D;  2NQB D;  4AWL C;  1M18 C;  1HQ3 C;  3MNN B;  3AFA C;  1P3G A;  5JA4 A;  5CHL B;  2BYK B;  1KX3 C;  4KGC B;  3AYW D;  1BFM A;  1JFI A;  2Y2Q A;  5B24 B;  3REK B;  1P3L A;  4H9Q B;  1P3P D;  5GT0 D;  1KX5 D;  3H0R C;  5B2J C;  4WU9 C;  3R45 B;  1P3B C;  5F99 D;  4WZS B;  4XZQ C;  3REH D;  2FJ7 B;  1P3I B;  3MGP D;  2NQB B;  5BNX B;  4J8V A;  3UTB B;  5FUG A;  3WKJ D;  5GXQ C;  3O62 D;  1F1E A;  5AVB C;  3NQU B;  3W98 D;  3AYW B;  3AZG C;  1P3K C;  1P3G D;  4G91 B;  1KX3 A;  5GT3 D;  4YM6 C;  2F2A C;  1P3P B;  2YFW A;  5GT0 B;  3B6F A;  1KX5 B;  2F8N A;  5F99 B;  5AV8 D;  3REH B;  3P5J B;  2LY8 A;  3A6N C;  5B2J A;  4WU9 A;  3AZI C;  3MGP B;  3WKJ B;  5AV9 A;  5B1M A;  4XUJ D;  3O62 B;  1M19 D;  3WTP E;  3UT9 D;  3KUY C;  5GXQ A;  3W98 B;  4H9P B;  3MNN C;  4J8V D;  1EQZ D;  5AVB A;  1Z2C B;  1P3G B;  4KGC C;  3H0M C;  2FFF B;  5GT3 B;  2BG1 A;  3AZG A;  2YFV B;  5B24 C;  3AZE D;  1H3O B;  3REK C;  4E44 A;  5BT1 D;  2F8N G;  5AV8 B;  3AZM D;  2Y2H A;  4H9N A;  3X1V A;  4E45 A;  4M6B A;  3B6F D;  4EO5 B;  4ZUX A;  1WWI A;  2FJ7 C;  4H9O B;  1U35 B;  1M19 B;  4XUJ B;  1P3I C;  3WAA A;  3UT9 B;  5B2J D;  3FDD A;  3UTB C;  1P3O A;  2NQB C;  1TAF A;  5AVC B;  5BO0 A;  4J8V B;  5FUG B;  1EQZ B;  5AV9 D;  5B1M D;  3KUY A;  4NE3 A;  1P3M A;  3B0D C;  3AYW C;  4CSR B;  1PZR A;  2BYK A;  4G91 C;  3AZE B;  5B1L D;  5CP6 A;  5DNM D;  3AZM B;  1P3P C;  2Y2I A;  5GT0 C;  5C3I B;  5B24 A;  1KX5 C;  2G5I C;  3REK A;  3B6F B;  5F99 C;  1M1A A;  3REH C;  4H9Q A;  4J8U A;  2NZD A;  4WV4 B;  3R45 A;  3MGP C;  3X1V D;  3WKJ C;  5B32 A;  3B6G A;  4ZUX D;  4X23 D;  3O62 C;  5AV9 B;  3AZJ A;  3AZK A;  5B1M B;  2NQB A;  2J8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...