2HK7A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with mercury at 2.5 angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
269
Chain Sequence
b'MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate dehydrogenase
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
total genus 83
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk7A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk7A01
6LDHA 1R37A 1HT0A 4PG4A 1ENYA 2DQ4A 4EZBA 1R4MB 1CQJA 2I9PA 2F1KA 1E7QA 1GU7A 1MG5A 1Q7BA 1LJ8A 1LQTA 2IZ1A 4FR5A 2Q46A 4ALLA 5KKCA 4PG8A 2QRJA 1BVUA 3AWDA 3OIDA 1GUZA 2OL4A 3GDOA 3PQFA 1SEVA 1KYQA 3K31A 4L76A 1ZXLA 4DIFA 5A5EA 3ICCA 3INRA 4UVDA 3SLGA 3DBHA 3OH8A 1Y9EA 4ND3A 1ZEMA 3HADA 2FN7A 2OUIA 3GFBA 1Y6JA 3A06A 4FFMA 1EDOA 1D4FA 4MP8A 3UCEA 1EMDA 1DIAA 4NFHA 2Q2WA 1UH5A 3TSCA 2J3IA 2NWQA 3K5PA 2VQ3A 3PFWO 3AY3A 3RUEA 2O7SA 4FFNA 1BW9B 5KKAA 4RZHA 4A27A 2R2GA 1JU9A 1MX3A 4GGOA 2WTBA 3EVTA 2Y0EA 3KEQA 4GX2A 3VH1A 4J7CA 1UXGA 3PDUA 5L9AA 1HZJA 1NX6A 4I08A 1G6KA 5K6AC 1O94A 4GLLA 1KVUA 1PJTA 5I7VA 2G76A 1OI7A 4AJ4A 5TRTA 2ZJ0A 4NQZA 5DP2A 3LLVA 2HKIA 3I9KA 2GLXA 2GPTA 1PGQA 3HQ4O 1P1RA 1YVEI 4U6QA 1HETA 3FNFA 3EK2A 1S6YA 3RU7A 4E3ZA 1CQIA 5C7IO 2VRCA 3CMMA 3FPLA 3ZN2A 2CVOA 1VL0A 1KVTA 3DHYA 1O89A 5JO9A 1HLPA 1PL8A 3ZWOA 5I7FA 3K8ZA 4PG7A 3WFIA 1Z6ZA 3GY0A 1VSVA 3V2GA 2V6GA 3GMDA 5JE8A 4IZHA 3DWFA 4CQMB 3H5RA 4BB6A 2G17A 2Q49A 5CEFA 1E6UA 3SJ7A 1YB4A 4C7KA 2O4CA 5FEUA 2X7HA 2GN4A 4YAGA 1NHWA 4Z9XA 5A06A 3DEYX 2NV6A 2VN8A 3KUXA 4Q3AA 2Q1SA 2VHZA 3AFNA 3I3OA 3I5MA 3T4XA 1E3WA 4JXKA 2A4KA 2NTVA 4RPJA 3D1LA 2BRUA 4TRMA 4HNGA 4BO3A 2FPPA 1SPXA 3QWBA 3WG9A 1ISFA 3IAHA 3DFZA 1QXSA 4IY1A 2EWMA 3I4FA 5TIIA 3GEGA 4OYRA 2O3RA 2Z1MA 3QQPA 5FI5A 2EP5A 1ENZA 1E7WA 4WCDA 5ENDA 3SX2A 2H9IA 4WUVA 1Q7GA 5A04A 1JTVA 4A2CA 2CSUA 1QV7A 2VHWA 3LT1A 1NVMB 3AUTA 4CR6A 5JCJD 1Y8QB 4BNNA 5KJ6A 4LCJA 1VJTA 1GV1A 1QLJA 3PTZA 3TRIA 2YZ7A 4KMSA 1U28A 3AOGA 4OSOA 4UUOA 5JY6A 1A5ZA 3GAFA 3C7CB 4QFDA 3GHHA 2EV9A 2FPGA 3UCXA 2JFHA 4YPOA 1GYQA 4I5FA 3NEPX 2ZKLA 1UXHA 4M54A 3DAFA 2B4RO 1R12A 4LVCA 2DUWA 4JBHA 3UN1A 5BNTA 1QR6A 5AQ1A 2BH9A 3I9OA 3QA9A 3ASVA 5MDHA 5LDGA 2VTDA 1ZKMA 2RIRA 3KYCB 1L1FA 2VOEA 3SVTA 4YR9A 1UZNA 3AU9A 4IS3A 1O6ZA 3HB4X 1GYPA 1A4IA 3OJFA 2QRKA 4NIMA 1LDYA 3GAZA 3JQAD 3QHAA 4WLFA 3HZZA 3JD1A 3WLFA 4PG6A 1T2FA 3PQDA 1X1TA 2XF8A 3GDGA 3KETA 5THKA 3LT4A 1I2BA 3U62A 4J4BA 2IRWA 4H3VA 3VVCA 4EUEA 4TQGA 3GRPA 3FBTA 5A5FA 4DWVA 3KYBA 1MG0A 1X13A 2VCYA 3NDIA 1F14A 3VZQA 1NFQA 1B0AA 5DF1A 3EVNA 2VWHA 1EE9A 2IZ0A 3JTMA 3KM0A 1XU7A 3RAJA 2WYWA 1K89A 4YJDA 3GFGA 3V1YA 2C5EA 4ZVVA 2PZKA 2WJPA 2I6TA 4OIMA 3L4BA 3S2EA 1H2HA 2D3TA 3A1NA 2AE2A 1UDCA 5KCZA 4XB1A 1GCUA 2PKRA 1JVBA 4YRDA 5JO0A 3R1IA 4U8GA 4FIZA 4QTZA 4XIYA 2I67A 3VH3A 4FJ2A 2OBYA 4E13A 1BRMA 1OOEA 2PA3A 4M8SA 3GT0A 4YWJA 5IZCA 5AYVA 1WNTA 3GC6A 1HDCA 2I99A 4XJTA 5J23A 4IPTA 3JQBA 5G0UA 3TNLA 4YYZA 1AN9A 1KEWA 1UP4A 4MKXA 1ADGA 2E49A 3R3SA 3SEFA 4NFSA 2HRBA 4OJNA 1JQBA 2FR0A 3KB6A 3CH6A 5ES3A 3EMKA 3ONFA 2AQIA 4RJTA 3I4CA 3OMLA 5JLAA 4DL9A 4HFNA 3WQQA 3VH4A 1KEVA 3VOSA 5JDIA 2Z1NA 1HXHA 4BGUA 2C29D 4L8VA 3JQ8B 4PLGA 5FWNA 1Y8RB 1JA9A 2BLLA 2YQ4A 4D41A 4ZGWA 5BQFA 3OHSX 5IDQA 3H7AA 4DC1A 4NBRA 4RZIA 2FZEA 3E82A 2J6IA 4GMFA 2I76A 2C54A 2OMEA 4YQYA 2VZ9A 1A71A 3PHHA 3M2PA 1JKFA 3PZBA 1SAYA 4J49A 3Q2KA 1BW9A 3V5NA 1T4DA 5JXWA 3CKYA 1TLTA 1RM5A 3TZHA 3AJRA 1W73A 3U9LA 3OJOA 4EI2A 2ZTUA 3JQ7B 2PGJA 3HHPA 1CEQA 3BMOB 5COQA 4R9RA 1YJQA 4BO7A 4RVUA 2LDBA 1YS4A 3X2EA 2D4AA 2B4TO 1SBYA 1HYEA 3H4VA 4RV9A 1MC4A 2BGMA 2PD4A 1VPDA 3WSWA 1HLDA 3EUWA 4DLAA 4S1VA 1YJ8A 3QP9A 4FSHA 2AEJA 1ZMTA 4IBOA 1DHTA 4LVUA 2PLAA 3AU8A 4DRYA 3U4DA 1B3BA 4IXTA 2YQ5A 5TNXA 4GKVA 1B15A 5AXAA 1IZ0A 4AJIA 3N74A 3DZIA 5JY1A 4CLHA 1AGNA 1VJ0A 3ZHYA 2Y93A 4H15A 4URFA 4RDHA 2IDZA 2YW9A 4OKIA 3I9NA 3S8MA 1DC3A 4IQGA 2GN9A 3PK0A 3UHAA 9LDTA 1V35A 4IUYA 4CQMA 1IYZA 3NYWA 5A03A 1HWYA 5G0WA 1U4SA 5IN5A 1VM6A 3ZWMA 2C7VA 2Q45A 2YYYA 4QO8A 4R1UA 1F12A 1HDYA 2HO5A 3B1FA 4B4UA 1NR7A 4E5NA 1BXKA 4MVJI 3ZW9A 5IFLA 1RYEA 4G81A 5B37A 2DPHA 4J4HA 4BNHA 4XCVA 3OJLA 1GUFA 2SCUA 3LLSA 1LLQA 3JQGB 3SC4A 2R00A 3F5SA 3WTBA 1UUFA 3O8QB 4J1NA 2GSDA 1ZEJA 1EUZA 3JYPA 2X4GA 2PD6A 1U1IA 5B4TA 1P9LA 2BF7A 3K96A 5CEJA 4N5LA 1U4OA 3JQFA 2JKVA 1KY5A 3R0IA 1GAEO 4M87A 4NHEA 4R3WA 2B37A 4WGGA 3EC7A 5C5IA 3L4BC 4D3FA 4GLOA 2DUUA 4JLWA 4B3IA 4D42A 5B12A 2D8AA 3VPGA 3ZU5A 1J49A 4BO2A 2G0TA 2X9NA 4INAA 4Y8VA 1UDAA 1Y5MA 1Y8QA 4WJZA 3ZV3A 4CR7A 3TZ6A 4NFYA 2Q1TA 4PN3A 4GGPA 3X2FA 3HFSA 1H2BA 1LLUA 2BFOA 2VUTA 2WYUA 3JQEA 3LYLA 3ANMA 4OAQA 3V8BA 1R4NB 5IZCC 4J9VA 5JYDA 5T8KA 5KIAA 7ADHA 4MO2A 2YDXA 4R9SA 3Q9NA 1LSSA 2WWRA 3RKUA 3TF5A 4FB5A 2NLOA 3VH2A 4B7CA 4I1IA 4II2A 1TEHA 3I9JA 3TZCA 5K0ZA 3DZKA 4BNMA 3DMTA 2WYVA 1DRVA 1XU9A 2FHSA 4YAIA 1LRJA 4I5EA 2P4QA 4HKTA 1TB4A 4BGEA 4I5DA 1EVZA 4E2ZA 3ZU4A 3SC6A 4ALNA 3BMCB 1OC2A 2GD1O 3KYCA 3PWKA 3DBLB 1T4BA 1PS9A 3L6DA 2VWQA 4E30A 3WGGA 2Q4EA 4KWHA 2AQ8A 1FDWA 4R1TA 2QZ9A 4U7WA 3JQ6A 3PWZA 1FXSA 2HMWA 2Q1UA 4PVDA 2B4QA 1YONA 2YFQA 3ORFA 1I3MA 4QXMA 3WQSB 1GTMA 5L40A 1GCOA 2CDAA 4ZU3A 3ZV5A 2NSDA 2ZB7A 1I36A 3WWZA 1DC4A 4IZIA 2C0CA 1ID1A 4J91A 1I32A 3S2IA 4YCAA 4ZQGA 3D4OA 4EJ6A 4ND5A 5IXYA 2VNAA 3IP3A 2PNFA 2Q2QA 4TMFA 5HS6A 4BVAA 4Z9YA 3BHIA 1W0CA 3OSUA 4A5OA 4JBIA 1P1IA 3LC1O 2X5JO 1EUCA 5F5NA 2DBQA 2J3KA 3GG2A 2OHXA 1LSJA 3D64A 4GL4A 4P38A 1NM5A 1V3TA 1Z45A 3W6ZA 2ZB3A 4DIBA 5A05A 3RASA 1DIHA 4CQMD 4D79A 1AHIA 1LU9A 1ISHA 5L7TA 4BNXA 1V3UA 2IYOA 1EEHA 3BMNA 7MDHA 1YB1A 2PZMA 2VNSA 3I52A 3GK3A 3ZU3A 5ADHA 3PXXA 4BNJA 3C7DB 2DKNA 4IJKA 1E77A 4WASA 4YBZA 4AL4A 4EW6A 4CL3A 4N7RA 1PWZA 1Q0LA 2WD8A 4MVJF 4OOEA 4S3MA 4WNIA 4EJ0A 1NWHA 4J7XA 2B83A 2DTEA 3E5RA 4JIGA 3GQVA 1R16A 3AI2A 2HSDA 3CMCO 4CM4B 1IHXA 1P45A 3IP1A 3JQCA 3LU1A 1GV0A 4P4NA 3ZWCA 4D44A 3KO8A 2J5KA 2WMDA 2PD3A 1I5RA 5KVSA 1P44A 3INTA 5DZSA 1HE4A 1LC0A 3JQ8A 5DBIA 1Y8RA 4XRRA 4JGBA 4J4TA 4KUGA 2DLDA 3DBRB 4KZPA 4LISA 4P22A 4FFOA 5EJ2A 2Y68A 4DA9A 1N2SA 1A9ZA 5EQFA 3AUUA 4YJHB 5C3MA 3ROPA 1PR3A 3PVZA 4J0EA 1MB4A 4EUHA 4F6CA 4J2OA 4ALJA 2IODA 2G5CA 3OA2A 1X0VA 2RH8A 3IC5A 3NGXA 3VC7A 4XKJA 4WLUA 5L3ZA 2RHRA 1NXQA 3ZWPA 4MVJA 4TKLA 4CUKA 5JCXA 2X58A 1RM4A 1WP4A 1BSVA 2P9EA 4BKRA 4BKUA 4AJHA 5ER6A 3JQ7A 3GGOA 3BMOA 3WLEA 3KLMX 2ILTA 1ENPA 1X14A 1QG6A 3GUCA 1E3JA 3JSAA 5AXCA 3W1VA 5DOVA 1HDGO 1Y1PA 3GEDA 1FDUA 3NTRA 3W4JA 1ISGA 3ZWVA 4FC7A 3TN7A 2ZATA 4CMKA 1PZGA 1U2GA 3D7LA 1T26A 3MWEB 5G0VA 2PGDA 3EZLA 5JS6A 1MFZA 1U8FO 2HJSA 2XOXA 2EW8A 3OFSA 1LQUA 3F3SA 4XGKA 3KLPX 3RJ9A 1P1FA 2ZB8A 3WR5A 4YAKA 3UH1A 1H0KA 1SEPA 2PKQP 2AEFA 3H8VA 4H7PA 2I5PO 3E9QA 1PS0A 4N54A 2V6BA 4RVFA 1PR9A 3JD4A 3OJEA 2EW2A 4J3FA 3GVHA 4NZ9A 5BR7A 3H3FA 3KSDO 2X9VA 1QRRA 4O63O 1N8KA 4B3JA 3F6YA 2CF5A 4WCFA 4KQXA 4CM8A 3V2UA 2EERA 5G0SA 1E1KA 3A14A 1WAMA 2WD7A 4Y98A 1Z82A 1K6XA 3PYXA 5CPFA 4XYBA 2IEBA 4ONEA 3NT5A 3E48A 1ISIA 1ZK2A 3DFUA 3UOGA 1WDMA 4BNLA 1JVSA 1B8PA 3JQGA 5EIOA 3GGGA 1WZEA 2E82A 3IOYA 4DIOA 3O8QA 1CYDA 4R16A 5A1TA 3L9WA 2V6FA 1NFFA 1Y9AA 3C1AA 4QUKA 4YRAA 5EPOA 3PJGA 4TROA 4LRSB 4W99A 1C1XB 3WBBA 2NVUB 5JFOA 4LCEA 4II3A 4JJGA 2ZYGA 4XYLA 2V6MA 3A4VA 3VTFA 5JMPA 4WOKA 3PYMA 2VT2A 4UAGA 4NNJA 1EUDA 4PVCA 3OF2A 5TX7A 4N18A 5L7YA 5IDYA 2D1YA 3GVPA 4GH5A 3SLKA 3ROKA 3Q6IA 4W4TA 2YFHA 1GPDG 1SMKA 2JFFA 2EJWA 4ZICA 2FR1A 4YDRA 1R0LA 1R4NA 1B14A 4RO0A 3EGOA 4CM9A 5B4UA 1W6UA 4XQ9A 1I30A 4LMRA 2D2IA 4DPLA 1WXDA 3GPDG 4IMRA 5GZ1A 3ZHBA 1YBAA 4RPHA 5F5LA 2A92A 3U4HA 1XCBA 1PJ3A 1RKXA 4RF5A 2J3HA 1KS9A 4RVHA 5JCJA 1BXGB 4Q9NA 4YJGB 1UP7A 3H9JA 1AHHA 3BMCA 1YDWA 3BZUA 1GQQA 4M89A 5JAQA 1GPJA 3IUPA 3ADPA 1YXMA 3CEAA 2EGGA 4MVJD 3GLQA 4PG5A 4Z3KA 1ZK3A 1T2EA 3I6QA 4ZQFA 1PL6A 3DZGA 2DC1A 4YT4A 1ZIDA 2XXJA 4K9DA 1HKUA 3NT4A 4GWGA 4E5KA 2HU2A 4FCCA 1ADFA 3E8XA 4IJUA 5HBRA 1B16A 4NG5A 4K6CA 5EINA 1EBFA 1PQPA 5B4VA 4Y67A 1GFSA 2QZZA 5F3RA 4R4JA 3ZNNA 3FNHA 4FFRA 3U4IA 3SXPA 1PL7A 3Q9UA 3JQAA 1I8TA 5L7WA 3LDHA 2GN8A 3C7AA 4CMIB 4CV3A 3OETA 3FN4A 3TFQA 1Q0QA 1SOVA 5THQA 4LSMA 4GI2A 4QT0A 4A26A 3NV9A 1KOLA 1R0SA 3G1TA 4D0RA 2JAHA 2WM3A 1PJ2A 2EIHA 2OORA 3ETDA 3KVOA 3ZW8A 1ZUD1 3G79A 1Q0HA 4BV9A 3CXRA 4BOYA 4R68A 3FTNA 1NPTO 2Y1CA 1LDNA 4YACA 3RUHA 2O3SA 5TQVA 4CLOB 1PZEA 4RLHA 3D0OA 2O2SA 2EF1A 4ZQEA 1K6IA 3DONA 4Q3BA 3LQFA 5I8WA 4ZRMA 1XKQA 4NK4A 4C4OA 4E32A 1NPYA 3RI3A 2G1UA 5COBA 4XGIA 2RHCA 1N7HA 2QX7A 3CUKA 1K5HA 3C1TA 3WGZA 3N7UA 3KTDA 4W6ZA 1YOVB 3HDJA 2XAAA 4FBGA 4NU6A 4OHUA 2CUKA 2X8LA 4WCFC 1GZ4A 3NDRA 4W7IA 2PZLA 2PR2A 3D4PA 3CZMA 3R3JA 3D4NA 4CM4A 2WSBA 4XR9A 3FRJA 5HS4A 2X1HA 2X5OA 2ZQZA 3LF2A 4J0FA 4PZCA 3T4EA 2X0NA 1C14A 1ZK0A 2DM6A 3N58A 3EDMA 3PPIA 2QHXA 4IIVA 1JWAB 4UUMA 3RC9A 3ZGYA 2C82A 5I8ZA 4DLBA 4E2YA 3GGPA 5KWEA 4LN1A 1MC5A 2GDZA 4D7AA 1A4UA 2VHYA 3Q11A 1K6JA 3VHRA 1GZ6A 2PGLA 5A9SB 2VTEA 4YJHA 5KVVA 4CM9D 3WB9A 4FGWA 3ZI0A 3F1KA 3VPXA 5CHEA 3JV7A 1U3TA 2WE7A 1V0JA 5AXBA 4DVJA 1PU2A 2QRLA 1DFGA 3M1AA 3DHEA 2NU8A 3ZWXA 4A7PA 3ONEA 3BTSA 4CJXA 3ZWNA 3KV3O 5C37A 2OFPA 3UGKA 1B8VA 3S55A 4N5NA 5TJ9A 2DTXA 2C7GA 1YGYA 3OBBA 4AJ2A 3GN2A 3FR8A 4FPXA 4ND1A 2FSVA 1M75A 3WNQA 3F4LA 5ICSA 3W8DA 4RF3A 1NQAO 3M2TA 1A7KA 4KWIA 4GVXA 1O5IA 1C0IA 4MVJM 4IS2A 2D5CA 3MJTA 1E1NA 5F1OA 2G82A 1K2WA 1IE3A 4X54A 5JMWA 1DIGA 2Z5LA 2Y1DA 3GVCA 2JD2A 4BNZA 1YDEA 1NR1A 1QYXA 2FOIA 3HFGA 2HLPA 4BO4A 1XR3A 4JNKA 5EQDA 2QYSA 1BMDA 3JD3A 1A27A 3FHLA 5CFZA 1Z73A 4YEDA 1ADBA 5GZ3A 1OMOA 4TVBA 3UKOA 1YL7A 1Z75A 1HEUA 2DAPA 1M6HA 3M6IA 4DBVO 1UR5A 4YQZA 3RUFA 4NI5A 1GQ2A 2BGKA 4JJIA 4G2NA 4KQWA 5FF9A 4HUJA 5CDUA 1KC3A 3JYLA 2P68A 5EMHA 5ENVA 2YY7A 4RF2A 1X7DA 1O0SA 4L4SA 2W4QA 2HK9A 2W90A 5DCUA 3UICA 4E31A 4XDZA 4L4RA 4Q3NA 4OXYA 3OP4A 3ZV4A 4DQVA 4ZRNA 1YH3A 1F06A 3RD5A 1I2CA 1XIVA 2NQ8A 5K9ZA 4Z0PA 1VC2A 3E5MA 1FDTA 3MOGA 4KDEA 4YB8A 4FDAA 4CPDA 1H94A 4BO6A 1C1XA 1SZJG 2NVUA 1NBOA 2PWZA 5CDGA 3RCBA 1E6WA 3MJSA 4GWKA 4NBVA 1VRWA 5LDHA 3WICA 1EVJA 1E5QA 2CFCA 5C7OO 1YQDA 4HWKA 3WGTA 4W82A 5G4KB 5F1PA 2GZ3A 1PJCA 3ETGA 2J3JA 1Z74A 1XELA 2HK8A 2ET6A 3JYQA 5DN9A 1MGOA 1XYGA 4BO1A 4CM1A 3BYZA 3JYOA 1SCUA 2ZB4A 4TWRA 3UF0A 4XA8A 1RJWA 2C20A 1YO6A 2YJZA 3GEMA 4EYEA 1Y7TA 1R4MA 2EG9A 3E1KA 5B1YA 5CDTA 1XG5A 3G1UA 5TGDA 2DT5A 1BG6A 3HE3A 3HDQA 1ISJA 1BXGA 4F46A 3RUAA 8LDHA 2OP1A 2P9CA 2NADA 3DAPA 3QLJA 4YJGA 3FWNA 4FFPA 4MVJE 4A0SA 5ITVA 3RSHA 4BNFA 2OOSA 3VPSA 4CMGA 4NJOA 1I10A 3GPIA 1G0NA 1TVEA 2BFPA 3M1LA 4J6FA 4R1NA 3RUCA 1XQ1A 2HAEA 1P1JA 3H3JA 4CQLB 3IKTA 4OM8A 3BMQB 3D3EA 2Y1EA 2BI8A 2PTGA 2PV7A 4HP8A 4B4VA 3IKVA 5CP8A 3LC2O 3FBGA 1YWGO 1U3UA 4D43A 1UXJA 3H2SA 4P4GA 1D8AA 3G49A 1PJQA 4XEHA 3I23A 1E7YA 1PJSA 1LEHA 2I66A 1DHRA 2Q2VA 4DYDA 1V9LA 4JP2A 2Y0CA 2DPGA 2J5RA 1ZXBA 4IXWA 3AM3A 4XJSA 4JN6B 2JD1A 1SB8A 4J1TA 2YHIB 4MOWA 4E2XA 1LDGA 2F00A 2VYNA 2NU6A 1K0UA 2CF6A 3C8MA 1VKNA 3R6DA 3JYNA 2UYYA 2X0JA 4TKMA 3Q2IA 4CLOA 5TT1A 3H9EO 5KJ1A 4LK3A 1EDZA 4QECA 4RLSA 3W4IA 3DL2A 3EAGA 4TSKA 4BUCA 1H6CA 1NNUA 1MA0A 2HJRA 3LC7O 1JDJA 5GMOA 1E1LA 2X22A 1NTOA 3PIDA 4NBUA 4YJFB 3AUSA 3BAZA 5LCXA 1YOVA 3AY6A 4JBGA 4NJMB 2ZK7A 5L53A 4KDFA 2CY0A 2PY6A 5EL0A 4CUJA 1HDXA 2CD9A 3LVFO 4H16A 4XZ3A 3WJ7A 4CLRB 3PHJA 1YRLA 3TDKA 2GO1A 2RAFA 4RF4A 1Y81A 3DXFA 3HB5X 5KJEA 4YT5A 2JHGA 4BNVA 3FSRA 1NYTA 2JCYA 4Y6PA 3DBVO 1KEPA 1D3AA 4J7UA 4E5YA 3EYWA 2FP4A 3ULKA 4FC6A 5JAIA 2JAPA 4XD2A 4MKZA 1ONOA 1ZNQO 1HE2A 2B5VA 5T5QA 2HCTA 1P0FA 2C2XA 4Q3CA 1CERA 4B4WA 3ZU2A 1QSGA 2HMVA 1M2WA 1D7OA 3O4RA 4FN4A 3T7CA 3KZVA 4BNGA 4OGWA 2X9GA 5IAAA 1ZH8A 3L77A 5FFFA 1UP6A 2FMUA 3O03A 5EESA 1OC4A 2NU7A 4ID9A 1HDOA 4BKPA 4YRBA 1U8XX 2X86A 1ZSYA 1IL0A 4TZTA 2GR9A 1ORRA 4WEQA 3WBFA 4UVGA 4CODB 4NDNE 5JYEA 4BQRA 4Q39A 4XQGA 1AXEA 1C1DB 1PEDA 3JQBC 4J16A 4OO3A 1IZ9A 1DRUA 2E37A 2Y0DA 2Y1GA 4GVLA 3JD2A 1EQ2A 4AJLA 4JROA 4UUPA 4L74A 2VUSA 1Z7BA 2DBZA 4JP3A 3ITDA 4ROSA 5G0TA 4WLNA 4D0SA 2VZ0A 3K92A 3F47A 1VLLA 3PJEA 4GPD1 4B8WA 2QQ5A 3DDNA 4RORA 5JDIC 4YT8A 2LDXA 2OBNA 3ST7A 2FZWA 1I3KA 2NM0A 1MXHA 4KUHA 1NVGA 4PZDA 4WPGA 1I0ZA 4DUPA 1BXZA 4OMUA 4XR4A 1DIRA 4HNHA 3DR3A 4UEOA 2J5QA 2CZCA 1GQYA 4OSPA 1WWKA 4CM3A 4CMEA 5IG2A 4W7HA 5IZ4A 1ZJYA 2I3GA 4FOOA 4BMNA 1E3SA 2VYND 2Q4BA 2JCVA 3QWAA 5U1PA 4AVYA 1DFIA 4NH4A 3WJAA 3DBHB 3L07A 1D1TA 4R3NA 1YQXA 2O4UX 1FJHA 4IDEA 3W4KA 3Q3CA 4JCOA 1BTOA 4YAEA 4I5GA 4AJKA 2IXBA 4PLPA 4WK6A 4U0KA 1E3LA 3G17A 4Z9FA 4J9UE 4A10A 3ENNA 3PGJA 4ZQHA 4CLEA 5JC8A 1O8CA 1LXCA 2AQHA 2JCXA 3C3XA 2HUNA 2PZJA 2ZTVA 1R15A 5HM8A 3L6OO 1H6DA 3QJ5A 1PSDA 2P91A 3PGXA 4MIYA 1IUKA 3ABIA 4B8ZA 2AMFA 5KVCA 5G4KA 1M6WA 4GAEA 3JQ9A 5I7SA 1XHLA 3OQ1A 4E21A 4CR8A 3ANNA 5BT9A 1KEUA 2HRZA 3ZWAA 3PZRA 1GY8A 1LRLA 3OECA 1EVYA 1UXKA 4CM5A 5AVOA 1XWFA 3CZRA 2D0IA 4M55A 5TF4A 3H9GA 4U5QA 5T64A 1DJQA 1JW9B 1ISMA 2X0RA 1SNYA 1R66A 1MP0A 4TRRA 2FY8A 2NVBA 1DB3A 3HN7A 4N5MA 1I24A 1SO8A 4WOJA 3VAZA 1XGKA 1D1SA 4DBZA 4MJLA 4TVOA 4BO9A 3WTCA 3H9QA 2OP0A 1P31A 3OA0A 4IMPA 3WSVA 3INGA 4J1QA 2R00C 2A35A 2NU9A 1YL6A 4CQLA 1HTBA 2ZIZA 4GX1A 5A3VA 3BMQA 4XRGA 4KP7A 5CEEA 3FTPA 3I1JA 1BVRA 1NFRA 1PGPA 1UAYA 3JQFC 3KBOA 3C1OA 1JAYA 1X7GA 2X6TA 4FS3A 4RQUA 3HDHA 3KRTA 2BD0A 1E3IA 4D3SA 2UVDA 4E0BA 1KY4A 2GGSA 3GF4A 4E4YA 3BTVA 5CG2A 3F9IA 3NAQA 3S1LA 3E18A 3WOHA 3RBXA 5A02A 3PFFA 4EJMA 1T2AA 1DDOA 5T8KC 1O95A 3JQDA 4P8RA 3I9LA 3OIGA 4J90A 3W8FA 2EP7A 1C0PA 3NGLA 4P4LA 4F45A 4BNTA 3PJFA 1CWUA 4NMHA 3DMTC 1KVQA 1S7CA 3F4BA 4QFCA 5L51A 3FI9A 2BELA 2AG5A 3HN2A 4GX5A 3L9XA 2AE1A 4MKRA 3FNEA 2CMDA 3FCOA 3NX4A 5K6AA 1QKIA 1EK6A 1QV6A 1ZW1A 4GQAA 1X7HA 5FYDA 1PQUA 4Z0TA 2PKQO 4CUZA 4I9UA 3AM4A 3HWRA 3UXYA 4R5MA 4NJMA 1BDBA 3RJ5A 1ZSNA 4Y6SA 5A9RA 3OQBA 4PLFA 5IDWA 4DQUA 4CLRA 3ENKA 3G3EA 4AFNA 1Q7CA 3GVIA 4Z6KA 3A28A 4CMEC 2QIOA 1YBVA 3BHMA 1GZ3A 2TMGA 4YAJA 1NQTA 4NPCA 1NAHA 3ZZNA 3QVOA 5TC4A 2EEZA 3U49A 4BNWA 4QSMA 2O48X 5H82A 4AICA 4IQ0A 3WWYA 1IHYA 4BIIA 2HK7A 5ER9A 1XA0A 1KETA 2O3TA 3GA0A 3RROA 1QMGA 1XDWA 5U9CA 5LC1A 1N9GB 4EEZA 1EZ4A 3TL3A 2W2KB 4LW8A 2Q50A 3WX0A 5IXSA 2Q99A 5I9MA 5L4LA 3H65A 4IM7A 4QQRA 2NUAA 3OM9A 2CDBA 3DZBA 1DAOA 3WDSA 1PJ4A 4XQEA 3MWDB 3VZPA 1U9JA 3B6ZA 3K9QO 3RFVA 3ZNQA 3UUWA 1WDLA 3OIFA 1HE3A 2I3AA 1DJNA 3ADOA 5FI3A 5TSDA 1Y5RA 1W4ZA 3RFTA 4UVEA 2P5YA 2B5WA 4HADA 4J43A 1R6DA 5DDIP 3JCZA 4Y9DA 1PQWA 1T24A 2X5KO 1DEHA 3E9NA 1C1DA 4LGVA 3ROMA 5KVQA 1B7GO 3LK7A 1T1RA 5IN4A 2ZJ1A 3RFXA 1XLTA 3MTJA 1U3VA 2JD0A 1VKOA 1T1SA 5L4NA 1ADCA 1CDOA 1NASA 5COAA 2R6JA 4YXFA 3KHUA 2WEKA 2O7QA 3PEFA 2D59A 5JDCA 3L4SO 3VTZA 1TT5B 4OKNA 3DBLA 4AJJA 1ZK4A 1HDZA 4D45A 4ALKA 3HG7A 4L0QA 5I9LA 3Q0EA 3E6AA 5CAEA 1DLJA 1GL3A 3S2FA 3B1JA 3IMFA 1KVRA 1YQGA 3TFOA 2IE0A 1DFHA 4XYGA 1WMAA 1E7MA 4OQYA 4RQTA 1H6AA 1IPEA 1WPQA 4ITUA 4DPMA 2AQKA 2FSSA 1RYDA 4J1SA 2V65A 5T67A 4UULA 2E4AA 3KEOA 4PLCA 1FDSA 2Y67A 4RL6A 4IQ8A 2JL1A 3IJRA 4KTTE 3H2ZA 3VDRA 2PH3A 3GHYA 3KXDA 4FW8A 2IYPA 9LDBA 2XXBA 3VZRA 1GDHA 2FRDA 1M76A 3ZHXA 1DPGA 2GERA 4PRKA 3ITKA 2JHFA 1IY8A 1J0XO 1AE1A 4FGSA 1X0XA 3GZNB 4W9NA 1NQOA 2OO5A 4MP3A 3IJPA 1ENOA 3ON5A 3WYCA 2NNLD 1XQ6A 4ALMA 2IXAA 3GH3A 4AJPA 1T2DA 1EFLA 3D3WB 4IDCA 4DPKA 4U6SA 1IOLA 2EKQA 3OEWA 4EDFA 1O9BA 3OEYA 5ILGA 1YBMA 4NBWA 5IDXA 2GYYA 3QVWA 2IEDA 3VPHA 3LSYA 3AY7A 5TS3A 1UDBA 5U4QA 2BFAA 3QWIA 5ICMA 1SC6A 2DU8A 1HF3A 1ULUA 1LDBA 4DREA 3QV1A 5KJFA 3GRKA 4BNIA 1E92A 1L7DA 2AA3A 3NRCA 3GNQA 1PZHA 4YTEA 3U4CA 1YE3A 3PHLA 4BNKA 4U0JA 1PJBA 2ZTMA 1HYHA 1C0LA 1K3TA 3CPSA 4G5HA 2NTJA 5EERA 1GD1O 5KJCA 1H9BA 2X23A 5AXDA 2C2YA 1ZMOA 1DBVO 5DCYA 2POQX 4FQ8A 3DBRA 3RIHA 1IB6A 1V3VA 1GEEA 3TQHA 4O5OA 2Y66A 4GX0A 1PIWA 3LZ6A 4HV4A 3D5QA 4CM7A 3PQEA 4E6PA 3RKRA 3BTOA 3DQPA 2AHRA 2HMUA 1E7SA 1GYRA 4L4XA 3TZKA 4IDGA 1V6AA 3H6KA 1PS8A 3WGYA 1QLHA 5T6BA 1B2LA 3PLNA 1R0KA 4FFLA 1DXYA 4PLZA 1PGNA 4I8XA 4CLDA 2BKAA 3EHEA 2AXQA 4TZKA 3ZDFA 5ILOA 1U5AA 4UEKA 2HDHA 4G65A 4RPGA 4WEOA 4IINA 1ARZA 4E33A 1Q1NA 1EVIA 3DAGA 3BXXA 3NJ8A 3MJEA 4D3DA 2A94A 3QW2A 1E1MA 2CDCA 2CVZA 1CF2O 3BTUA 4FJ0A 3ETEA 4ESOA 4WLEA 2Y1FA 3V2HA 3VZSA 1G0OA 2VOJA 3WIDA 5MGBA 4NK5A 1LDEA 4ILKA 4A73A 5JC1A 5JDCC 4R5HA 1N1EA 3AFMA 5TT0A 2QG4A 4ALIA 1NVTA 3NUGA 3FD8A 3QVXA 5CDSA 4QO7A 5GZ6A 5TLSA 1PJLA 1ZVMA 2RBEA 3QWFA 1NPDA 3DMYA 3VPFA 1FDVA 3P19A 3VKUA 1ULSA 4GKBA 1N92A 3CTMA 3F5QA 5BSGA 3LF1A 3LT2A 1F0YA 4RDIA 1VI2A 3FR7A 4OXKA 3PDJA 2YUTA 3W8EA 1ONNA 1I2ZA 3NJ4A 3HJAA 5KNLA 2AEMA 4OQZA 2GCGA 2EHDA 2P4HX 2PFGA 3UVEA 4YVFA 4IJVA 4RGBA 1N9GA 2EXXA 4EBFA 5IJZA 3GNTA 2O50A 3NDJA 1JN0A 2W2KA 4JJFA 4AJNA 1MUUA 1NHGA 3ICPA 4IDFA 2I65A 2J8ZA 4ZN6A 2ZCVA 4B79A 4W9NC 3TJRA 3DZJA 5HWSA 3AOEA 4K6FA 1G1AA 2GRAA 1MXFA 5BNFA 4EGFA 4E12A 3PHIA 3SBOA 4R69A 3TOZA 2Q1WA 2VHVA 3KOUA 4GMGA 4ZHSA 5T57A 2VRCD 4CMHA 1KERA 4RPLA 2DBVO 1P74A 2E48A 3LT0A 3O26A 1I33A 3GDFA 4BO5A 1LRKA 2AG8A 3KSUA 1ZCJA 4CMAA 1ZO8A 3TL2A 3BMNB 3H9UA 4L9RA 3PHGA 3DZFA 3MEQA 1EFKA 5DBFA 4DMLA 4XQCA 6ADHA 4OL9A 1TT5A 1YB5A 1F17A 4UVIA 4HFRA 2DVMA 1CJCA 4M49A 1TA4A 3AK4A 1F8GA 1VL6A 2O3UA 3DOJA 2GN6A 5H83A 4ZA2A 2ZTLA 1HRDA 4Z3DA 2NVWA 2VT3A 3RC1A 3QE3A 4DXHA 3RWBA 4CV1A 4XDYA 3ROQA 4D46A 4UUNA 3AI3A 3F46A 2FPIA 5BSEA 3H5NA 1N7GA 4WECA 1B3RA 1TI7A 2IZZA 4YT2A 2YV1A 3UCFA 4A03A 3WGIA 1LA2A 4WE3A 2DTDA 3FWZA 2EGHA 3NTQA 1DLIA 1H5QA 4DQXA 3HDYA 5A9TA 1XEAA 4CMIA 3WMXA 4BMVA 4LRTB 1HL3A 2NACA 1DOHA 3EY4A 3S2GA 3HSKA 3WNVA 2P9GA 5CPBA 3GZ4A 1H93A 5DULA 2H63A 2UAGA 4R54A 4AJOA 3GZNA 2P2SA 4DYVA 3BHJA 3D5TA 2DFVA 2OGUA 2TMDA 1CIVA 1EE2A 3ZNPA 3GVXA 3ONDA 3AW9A 3IIEA 4R01A 4HY3A 2HMSA 2Y1OA 1RWBA 4M86A 4TRNA 3D3WA 3ZWWA 2BI7A 1W8DA 2PH5A 1LBEA 1GEGA 3RU9A 3PIIA 4Z0HO 1QYCA 3K73O 2C07A 1WZIA 4WNCA 3STHA 4PLVA 5KOIA 3O38A 1OZAA 3G0OA 4TRJA 4UVHA 1LLDA 5AOVA 4GSLA 4HBGA 5L95A 1P33A 4F3YA 5CDYA 5KTKA 1HE5A 2VWPA 3BIOA 3FNGA 1J5PA 2PK3A 3L6EA 1LDMA 3CINA 3P7MA 1I01A 3VKVA 3B70A 4MINA 1M67A 2BHLA 4PLYA 5DNAA 3CE6A 3COSA 3TWOA 1C3VA 4DGSA 2JJYA 1MFPA 3EZYA 1PZFA 4WLOA 3U09A 5JW6A 1LUAA 4MP6A 5G4LA 4WCFB 1B8UA 3B20A 4XX0A 5HRUA 3K6JA 5A9SA 1DO8A 4CM8B 3PJDA 3RBZA 1ONPA 4E5PA 3ZCXA 3GN1A 2W2LA 2WD7B 3NKLA 1UJMA 3IL2A 4IDAA 1HZZA 2A9FA 2GASA 1T25A 1DC6A 1XSEA 3SJUA 3KYDB 1YL5A 8ADHA 2E6UX 4LMPA 3AOEC 3W6UA 1GR0A 4B4OA 1EBUA 4AJEA 2Y99A 3CIFA 5JSFA 3GMSA 3NT2A 2GUGA 3WQRA 2EKLA 1HDRA 3ASUA 3P2OA 1ZBQA 2VUUA 4BQPA 4PLHA 4E2WA 3L0DA 4XB2A 2Z95A 3DHNA 5DBGA 2YV3A 4XYEA 1AXGA 4ND4A 3ZWYA 3FPCA 1LSOA 2FR8A 1J6UA 3TZQA 3C85A 3U3XA 3MTGA 4LSWA 3DTTA 3PRJA 4BO8A 1LC3A 1OFGA 1QORA 2RH4A 2DBRA 2VYVA 2VZ8A 3QY9A 2YHUA 2B0JA 1EK5A 4FOSA 4O1MA 4R41A 1MLDA 2EKPA 3WXBA 3PYLA 1UZMA 3KSZO 3PWSA 5IF3A 1GADO 4IDDA 2O23A 3GNSA 1FF9A 2O3QA 2OZPA 2ZCUA 3QWHA 2H1SA 4IIUA 5JAMA 3QIVA 3B1KA 3EW7A 4BGIA 5F21A 4AG3A 2B35A 3K2BA 4R51A 5DOZA 3WGHA 2UUOA 1BGVA 3CSDA 3PLRA 5L4SA 1UXIA 1U5CA 1LSUA 4CLXA 4IGFA 4F6LA 3V1UA 1VL8A 4J2HA 1ZJZA 5DT9A 3WYBA 1B26A 1KIFA 4MIEA 4L75A 1CRWG 1U7HA 1FMCA 3E03A 4O0LA 4EITA 3T7EA 2X0IA 1QYVA 1LNQA 3ANLA 3QVSA 1IULA 3ZH2A 5GY7A 3UAGA 4IGEA 4MDHA 1E7RA 4ND2A 4CMBA 1LLCA 1IPFA 1P0CA 3QRWA 4B3HA 3UFXA 2QW8A 1DIBA 1JKJA 3E9MA 4QX6A 3MJ4A 5CG1A 2RCYA 4RVSA 4MPDA 1Z7EA 4K26A 3U0BA 3TOXA 4CMCA 1NQ5A 4K1LA 2CVQA 3P5SA 3JQAB 3ZNOA 4XIJA 3VDQA 4BNYA 5F1KA 3GUYA 4PGFA 1JKIA 4O6VA 5ITWA 1N1GA 1VSUA 1J4AA 4WKGA 5EN4A 5C7LO 4NBTA 4OXNA 3I9MA 2JFGA 2NQTA 1JWBB 5I9NA 2VRBA 1CETA 4XYMA 3H5AA 1Q2XA 5L45A 2ZYAA 3C24A 4HX5A 4I9HA 3RUDA 2W2LD 3MJCA 4BHTA 4MVJG 3F1LA 4DLLA 1AUPA 4B7UA 1SOWA 4DMMA 3OQ6A 4PIVA 2XPCA 2ZYDA 1PGJA 1P77A 2YDYA 3PP8A 3Q1LA 4HXYA 4YA6A 4EUFA 1QYWA 4PZEA 1JLLA 1H6BA 1RM0A 3MCVA 5G2OA 4AJ1A 2H6EA 2ZQYA 3QSGA 1FK8A 1A9YA 4JK3A 3ZV6A 1WVGA 1DRWA 5BNIA 1V8BA 4K28A 1MV8A 2QYTA 3P2YA 4FJ1A 5HTOA 4EEXA 1U3WA 1E3WB 4HFJA 2O2YA 3IQDB 2VYVD 1ZSVA 1NP3A 2BMAA 1LI4A 3GG9A 1NWCA 1KC1A 1X1EA 4DC0A 3A9WA 1M66A 1PX0A 3I6IA 1OBFO 2GZ1A 3HNPA 3O9ZA 4B7XA 1P3DA 4CL8A 5JBIA 1E0DA 3IDSA 4BB5A 3VVBA 4CM6A 3V1TC 1U7TA 2D5AA 2UUPA 4OOFA 4PCVA 4NR0A 1YKFA 2GZ2A 2YHIA 3MZ0A 1JAXA 4QEDA 1HSOA 1C0KA 1VE9A 2Y05A 1E3EA 3DOOA 5DCWA 4BMSA 5H81A 4MIOA 3RUIA 1SB9A 3U5TA 4ZQBA 1U2DA 3FF4A 1DSSG 4XGNA 4BO0A 1HYGA 1PTJA 3MOIA 2YV2A 4IJWA 4MVJH 3UW3A 4BGVA 4CV0A 1PWXA 4JX8A 4RVDA 3WIEA 1E6EA 1WW8A 1QP8A 3BA1A 2UV8A 4Q3DA 1LX6A 1OAAA 2WDZA 4PFJA 4I9NA 1WDKA 1ZK1A 1PGOA 4RVGA 4YJFA 5JPIA 4MVJP 4BV8A 3HUDA 3WGOA 2HQ1A 2W8ZA 2AW5A 1DAPA 3TPCA 1P1HA 3ZHZA 4NU5A 3GR6A 2W98A 1A7AA 1X15A 1NAIA 1BDMA 1GUYA 1L7EA 2GF2A 4Y6RA 1QYDA 4HFMA 5JNLA 4BKOA 2V7PA 2CNBA 1ML3A 3WMWA 2B69A 1VJ1A 5BSFA 3PI7A 1A72A 5I7EA 2VWGA 3IUSA 2Q3EA 2WE8A 3MJVA 4OH1A 2BFMA 4XWYA 4PRLA 4RCVA 3WS7A 4BNUA 3RBVA 1TXGA 1T2CA 3DB2A 3OJ0A 4PLTA 3NTOA 4KOAA 1WLYA 2GNAA 4RPKA 5BSHA 4E5MA 3WFJA 1E5LA 3DTYA 3I83A 5A4DA 1N5DA 4IDBA 3WGQA 1UZLA 4ZD6A 2VHXA 2P5UA 2NTNA 4M1QA 1ZZEA 4UEJA 5HA5A 3WYEA 2FWMX 1RPNA 3KYDA 3IS3A 4O59O 2UDPA 3K2EA 2C59A 1HSZA 2BGLA 3DZHA 4KTVE 1DC5A 1P1KA 2HMTA 4PLWA 3K30A 5DP1A 3RC2A 4CMJA 3JQ9C 5A3JA 3JD0A 4L73A 3AUAA 3AM5A 4BL5A 4KUEA 4UREA 2H5LA 1KBZA 1ZFNA 3DOCA 3RQSA 1I3NA 2O3JA 2EJVA 3DO5A 1TT7A 2B36A 2C5AA 4CV2A 1RM3A 4ZJUA 4DTIA 1EQUA 4C7JA 4FD3A 1UAGA 3OICA 3DC2A 1KVSA 3GOHA 2DFDA 4GBJA 4R1SA 1WMBA 1F8FA 5TJHA 4Q3EA 1I3LA 4WLVA 1H9AA 3QVTA 3RVDA 1BHSA 1BWSA 5JAZA 4BKQA 4JQCA 4GSKA 3ZWBA 1LTHR 2OXIA 3RC7A 4BS9A 3AI1A
chains in the Genus database with same CATH superfamily
1R37A 4F9TA 5JD4A 2A1UB 1HT0A 2CK3A 3ESCA 4LJ4A 1ENYA 2DQ4A 4PG4A 5KYVA 4A4DA 4D0NA 4EZBA 4YQFA 3JZFA 1OT5A 2BIFA 4MEJA 5J47A 2EHJA 2F1KA 2FK8A 1MG5A 1WSWA 1LJ8A 3I5UA 4FR5A 1RWKA 1SVKA 2MINB 1U1GA 2NYVA 4TQAA 1UBEA 3X0DA 4L5JA 1IDN1 2I71A 1WMEA 1Y7LA 4F56A 1GUZA 5KQLA 2PWPA 8LDHA 1X6VA 1SEVA 2FW9A 1SN7A 3K31A 2PH7A 3CZQA 4KLRA 1QVAA 4ZV9A 4KYTA 2OD2A 1GG9A 1VBNA 4C7VA 4CKYA 1V1JA 1DEOA 1T0JB 3O8NA 1ZEMA 3KJIA 5F7XA 3UGTA 2OUIA 3I6ZA 3P9YA 5M29A 5FLXA 5KS2A 3CVXA 1V16A 3A06A 4X1YB 1EDOA 3UCEA 3DVRX 2WSSD 1VSQA 4BFYA 1U0RA 3E5HA 4Y7CA 2FX3A 3GJ8A 4YUWA 2JAUA 4IVPA 3K5PA 5DN6D 2Q9UA 3AY3A 4WKPA 1I2MA 1XQYA 2Q3LA 2C5GA 3G2QA 3FVQA 3O7MA 1A8UA 3T7SA 3WV4A 2AI1A 5F4BA 4D02A 2YOGA 1KDZA 1MX3A 3RWOA 3PDIA 5TS2A 4FYXA 2E5LB 3MQFA 1CYEA 1SJ9A 4HDAA 3RW9A 4RV4A 3A05A 1N2CA 5L9AA 3VDMA 3OMWA 1NX6A 4EHBA 3WWCA 4WL0A 3T99A 3X44A 5KTSA 3P97A 2QTHA 4HDNA 3BKWA 4JC0A 5K6AC 1O94A 3MS7A 4DLTA 3EAQA 3AXTA 1QG4A 2B1QA 2GK3A 3DKIA 5AVUA 2I29A 2X19A 3SJBA 2G76A 5EIWA 2GBCA 3OJWA 4MGIR 3WL6A 4AJ4A 2Z4TA 4BLWA 4ZYZA 3NHKA 1XD8A 1PUXA 1SCKA 4I4NA 3LW7A 2XDQB 3ZDZB 3JALA 4DV0B 2OO7A 4M0PA 2Q07A 4OHOA 1NQWA 3FNFA 1WU7A 2O8NA 3EK2A 2NYAA 3SQOA 1JPUA 3ZJYA 4HS4A 3RPEA 5HNKA 3S29A 1P91A 2P6PA 4WA8A 4UM9B 2I3DA 4YV1A 4GDFA 2V0NA 1O89A 4EGQA 5BOSA 2XA9A 5C8DA 5IMSA 2C8KA 4PY2A 4K9MA 2M6LA 1PG5A 5E0KB 3SHOA 1YB2A 1OGYA 4BMXA 3WFIA 3T7JA 3T9AA 3GY0A 1OLUA 1RQ2A 3K53A 3HUTA 3UOAB 1U2TA 2X5NA 1A2KC 2Q49A 3UB3A 4UUQA 5JECA 3IQXA 5G53C 4OJMX 2RDMA 3OWOA 3UO8B 4TMVA 4C7KA 2X7HA 4C4ZA 1RYBA 4JLOA 2GN4A 4QBTA 2Q6LA 4Z9XA 1HNNA 3P9RA 1X87A 2NV6A 1KQNA 4CHTA 2XUHA 4Q3KA 2WAAA 3F3YA 1ZD8A 4JXKA 1GL9B 1ESZA 3EBOA 3AEQA 2A4KA 3CUEF 5C8VA 4DHWA 3KQNA 5J2UF 1TA0A 4ENPA 4BO3A 3JRNA 2H0AA 3AERB 4OFXA 5EEHA 1CHNA 5EJ4A 1ZQ9A 1I1OA 2QTBA 1QBKC 2EBUA 1P39A 1I4DD 3UJ6A 1QXSA 1F2VA 1VL2A 2ZRGA 1ZITA 3I4FA 2QLTA 2O3RA 4TS1A 3BFKA 1IZ8A 3A3KA 3QQPA 1XD2A 4QARA 3KZKA 4ESVA 1Q77A 3K0EA 3FTCA 1HDEA 4MS1B 1I0IA 3ERCA 5CFRA 4FSDA 3PG5A 1I4LD 4NXMB 1CP3A 1NDHA 3I2KA 3ABRB 5CHYA 1ETUA 3OCCA 1Y8QB 4XVHA 4DXDA 2DEUA 4BP3A 2CYAA 2RK3A 1JLSA 5KJ6A 4LCJA 5BW4A 3DE4X 5M5BA 1QH8A 4HTAA 4RD0A 1M1NB 3PSHA 1QLJA 3WLKX 1LPNA 3SYNA 2W0MA 4BWGA 4JA0A 4UUOA 4A8JB 3LY9A 5CLGA 1D0VA 3F49S 2X5XA 4KQJA 1J99A 3RFUA 3KD3A 3NEPX 3UAVA 1GVHA 1YC2A 3NUQA 4M54A 1UXHA 2FW8A 3TLZA 1JHAA 4OHCA 3GH1A 4LVCA 3V1MA 4LOKA 3G9UA 5KNCA 1QR6A 4XX1A 5CBPB 3UQZA 1KYXA 1R1DA 2VTDA 2Q2OA 2RIRA 4UQPA 4QAQA 1L1FA 3SVTA 4YR9A 4EUSA 1U31A 2Y77A 1O6ZA 1DRKA 3KJQA 1PZXA 1A7UA 1XA3A 2FUEA 2ZJ4A 3OJFA 1I7DA 1LDYA 3GAZA 2ZRPA 3ZIAA 4RXMA 3QJYA 4A36A 1KAHA 4BVHA 3WLFA 1Z18A 1VGVA 4IIEA 5JH7A 4RFVA 1N32B 1YS9A 1I2BA 1FSGA 5I7RA 4MJ3A 2R751 4F84A 1KOFA 4Z7OB 1I5EA 1MH1A 1NU6A 1Q7EA 2OO3A 4K40A 2IHJA 5DK4A 2ZPTX 3BRSA 3KKKA 5H70A 2O8DB 3OI7A 4DWVA 3KYBA 1MG0A 4OJYA 1ZUWA 2VCYA 1QGAA 3AB3A 5I4BA 3F8WA 4E6EA 1XTVA 2QTFA 3QELB 5JOQA 1Y63A 3BRWA 5EHIA 3PF9A 3NASA 3HJBA 3OQMA 4AZ3B 3R7FA 1XU7A 2GILA 2GK7A 2YZGA 3N8HA 1N33B 4YJDA 1MJ5A 2QRGA 3SJAA 1KTIA 4HGNA 3N9IA 4D8TA 3PKJA 1ZNWA 4KXMA 3TSAA 3A4IA 2I6TA 3HB7A 3S2EA 2XDYA 2DP4E 3SVLA 1M2KA 1LK7A 1YZHA 3SYKA 5HZGA 2FMTA 1BE6A 1G18A 1L7RA 3BSFA 3TAUA 3D3NA 2QKYA 4Y0NA 4B6EA 4XB1A 1GCUA 3ZDRA 4QG3A 4YRDA 4GE3A 2EVWX 3HCPA 2P78A 4ZV7A 4C87A 3LIIA 2OGWA 1JKMA 3H8WA 2KJQA 4K1XA 3T1NA 1GO2A 3WLAA 2F9MA 4B47A 3ZDEA 3ELBA 5K8VA 4NLLA 5DASA 2JKYA 4PO1A 4P3KA 1WUTA 3GT0A 4YWJA 4MKFA 4BNDA 3K6SB 3OLZA 1LWOA 5J23A 4YYZA 5IT5A 5G0UA 3TNLA 4BWYA 1KEWA 4PHHA 5AI5A 4AUMA 1NL3A 3NHUA 4W8HA 3RO7A 4D8WA 3R3SA 3ZYCA 5AKKA 2HRBA 2CLDX 4C3ZA 1D5CA 4M8NE 6GPBA 4Z4HA 2WIFA 4EI8A 1NU8A 3EMKA 1WCV1 2AQIA 4RJLA 2IU6A 4KK3A 4HFNA 4A8HA 3VH4A 3I92A 4LHXA 3VI3B 4EI9A 3X43A 1TM1E 1H22A 2RI1A 2PUTA 3IDOA 4FI3F 2F2TA 4B4KA 4EHKA 2XT9A 2HJWA 1N3LA 721PA 1NONA 1VXOA 4ZI7A 3C97A 4AKGA 1DV2A 3H9CA 3B9BA 3VR4H 1IEQA 4DDMA 4DLYA 2NU9B 3FPSA 3MRXA 1CNEA 2VP6A 2YJGA 4H08A 5DK6A 3H7AA 5T3UA 4RZIA 1DAGA 5E2BA 3P9IA 4W7SA 4KGDA 1P29A 4HH4A 1QGDA 5I4IA 4J76A 2VZ9A 1A71A 3PHHA 5CVEA 4YQYA 3ZGXA 3KU1A 1SAYA 4IIJA 3UJNA 4L4UA 3Q2KA 4X8MA 5DHPA 1O8BA 4LXTA 3WK6A 3HU3A 3R6WA 1R3DA 4M7WA 3O4JA 3ELDA 2QT0A 1X38A 2NYUA 3QEAZ 3PF8A 3K1JA 4PNEA 5CFQA 5BUQA 3TBKA 1VGQA 3OO1A 2ZTUA 1PW5A 3HHPA 3EXIB 3HA2A 5COQA 4R9RA 3OZIA 3OTIA 1E2MA 1PYDA 2BTQB 5D01A 4BEJA 4HJXA 1F1BA 3X2EA 4NXNB 3ODPA 4MAFA 5K0CA 2EX1A 4GPIB 4EX7A 5ALTA 5JTTA 1HYEA 2IU3A 2FPSA 1QRAA 1R74A 1JALA 4S1VA 1YJ8A 2GEBA 2W48A 5L3QB 1CT9A 1X7XB 1K8ZB 3GJTA 4ARIA 3TXYA 1ZMTA 4BU1A 4ED9A 1YR7A 4KVAA 4N9WA 3DC7A 1JDSA 5KREA 1CQPA 2PLAA 1EH5A 3AU8A 3UK2A 4WY5A 1ZWLA 1SXHA 1M0EA 4R1MA 1E9SA 4C21A 4LDAA 3N59A 1B15A 2IOQA 1IZ0A 1GPWB 4FHEA 4AJIA 3DZIA 2FGJA 4JGGA 1SG6A 4LJSA 4CLHA 4ES6A 2R85A 4P82A 1T15A 3QBVA 3QJGA 4L5YA 4XTRA 5EXXA 3TCKA 3LUJA 4OKIA 2XXAB 3S8MA 3LY5A 1WBBA 1DC3A 2VNJA 4IQGA 3PK0A 9LDTA 3CLUD 3QXSA 1XI2A 2EL9A 1V35A 3GAMA 3QEOA 4J0DA 2WZQA 4JKOA 1SHUX 2NV2B 4RK6A 4FONA 4FR0A 2SKCA 1VMKA 4IIDA 3NYWA 5A03A 1HWYA 4XUGB 1H65A 1ZZGA 1S2IA 3KVVA 1VM6A 1VMDA 2HADA 2GPJA 3GCXA 1DEXA 4KSBA 3ZWMA 3SPXA 1PUJA 1S5PA 2D1TA 4QO8A 2GPWA 5FTWA 5KQMA 1F12A 3GMIA 3B1FA 2I0FA 4B4UA 1G8JA 4MICA 1BXKA 1EFDN 4MVJI 3ZW9A 1T6NA 1RYEA 4O5AA 5GVRA 5B37A 2DPHA 1CR4A 4V38A 3SKVA 4BNHA 4JY7A 4NCAA 3FCEA 5JZVA 2SCUA 3SC4A 3JQGB 1D1QA 2JNWA 3LGSA 5EKUA 1H2YA 3WL8A 2MSWA 3RREA 2DB3A 1N6OA 2J4FA 4RD4A 5FORA 1P9LA 2F4NA 2YJ4A 3EBLA 3K96A 4O3FA 5IH3A 3FWHA 5B4TA 3BE5A 5KNBA 1KY5A 3R0IA 1GAEO 1GZVA 1N4DA 1YD7A 1JFVA 2B37A 1YU6A 3CNLA 2CXOA 4WGGA 1EYZA 3FKQA 3WRYA 2NUAB 5FL7D 4D3FA 2IZOA 4LOIA 2XDWA 4GLOA 5ALQA 2BFDB 4A5SA 4B3IA 5LM3A 1UKAA 5B12A 3AUKA 4CEJB 1BU8A 5KEIA 1FP6A 1OLXB 3GFTA 2XZOA 2HSWA 3NKVA 3O47A 5FNVB 3BXFA 4PIPA 3UK0A 1KZ9A 1Y5MA 3AJAA 1EFVA 2SNIE 4WJZA 3ZV3A 2HR1A 1TLFA 1H5NA 1WMDA 2OXFA 4GGPA 4RBNA 2BZSA 3HFSA 2OB2A 1H2BA 3F8SA 4OAQA 3JQEA 2WYUA 1BGWA 3V55A 5CBKA 5K0BA 3NVKI 5JYDA 5T8KA 3LNCA 4BBJA 5KIAA 4MO2A 2YDXA 5DH9A 1LSSA 1XPRA 1N0HA 3IDZA 5LMCA 3HXMA 3FIUA 1JE0A 2UVPA 3W6OA 5K03A 5HX7A 1TEHA 4I4IA 4BNMA 3N8IA 3FLBA 1XU9A 4DLZA 1Q95A 2FHSA 4GZMA 4JEMA 3VU3A 4W63A 2OXRA 1VLJA 1HYBA 3L06A 3WV5A 3C3EA 3H2JA 3FYTA 4LDRA 3L1HA 3EXHB 3PUZA 4L02A 1DGQA 2IUFA 1UDWA 4BRZA 5C51B 1CCWA 4K88A 4ALNA 4UE3S 2IYFA 1XCJA 3PWKA 1P62B 2VXOA 4DAEA 4E30A 2JA1A 3A2KA 2RHBA 1OASA 2FA9A 3SJCA 3WGGA 4RKEA 1W48A 2AQ8A 1FDWA 3H2YA 1S9DA 4EQ6B 4CEHA 4OQLA 5A6SB 3EIFA 3I8XA 4H6WA 4D9KA 2QMOA 3JQ6A 3WKCA 2ZRBA 1L7BA 2Q1UA 3P0EA 2B4QA 1NQVA 5GPBA 5EHXA 1I3MA 2B25A 4RJIA 1XMOB 2C2KA 1I36A 3FYUC 3G2IA 3KQPA 3QVLA 4AN1A 1TMGE 1ID1A 2C0CA 3FMOB 5TQ0A 4YGXB 3MWGA 4LVNA 5IXYA 1EI9A 2XRFA 3U3OA 2VNAA 4BP1A 5JI2E 2W43A 5H8WA 2PZGA 2C1XA 3ESZA 3P94A 4H3KB 4TMFA 5CYPA 1JA0A 5HQJA 2C4UA 1EFPA 1W5BA 3CN7A 4G3XA 5BO5A 3OSUA 4ZEXA 1YKGA 2ZXFA 1K9VF 4UM9D 4B0PA 4O08A 2HK6A 1ZN2A 2B98A 3GG2A 4KXUA 1NVDA 1RE1A 2BBSA 2C7PA 4P38A 1NM5A 2BEVB 4UOQA 1IXYA 3J7TA 2ZB3A 4HWTA 3P0RA 4X1OA 2O1XA 1XHEA 1RJFA 3N2EA 4BE9A 2ATEA 1EDEA 1LU9A 4B71A 1J8VA 3MTEA 2A9VA 4RGVA 1X9IA 1J8FA 4A16A 4Q6BA 2VLIA 4DY4A 3WHIA 1V3UA 2RKWA 3DDZX 4BNXA 2XYGA 2YIJA 1ABEA 4KIJA 1Q92A 2VNSA 3I52A 3QUBA 2H3EA 1ZNZA 2JASA 2RJNA 5AJHA 1K7YA 521PA 1QE3A 4MRPA 1NMZA 2HU8A 2DKNA 3GT7A 4IJKA 4TZ0A 1DPFA 4LYYA 3F7MA 1E77A 3TVTA 3TW6A 1R0YA 1RTTA 9ATCA 4KAJA 1TQ4A 5EJIA 2P5SA 3DDSA 3ZD7A 3LY7A 1U8UA 2R3SA 4AL4A 6ABPA 1TECE 2PMKA 3EH1A 4XWKA 4BLUA 1IUNA 4WNIA 4S3MA 3TD9A 1TYBE 1E2LA 1C9NA 1JYEA 3RTCA 2V7VA 3TUJC 4BZQA 4EJ0A 3SQXA 2B83A 4PBTA 5HRAA 1MHTA 1PYOA 2OE2A 3TX2A 4CG3A 1PHRA 3Q7QA 2BE9A 1YZUA 2ENWA 5AKXA 4CM4B 3R9IA 3KLBA 4QASA 5JFTA 3JQCA 1X9HA 3LU1A 2YVLA 3ABSB 1HZZC 2ZBUA 3KO8A 1HDIA 4KWTA 2A6PA 2CNOA 4F2HA 4RS4A 2FPLA 3C5EA 4RWEA 1ZH4A 3KWJA 4MVWA 3RIGA 3ZDBA 1VPLA 2Z9DA 4D56A 2O6LA 2GQ0A 3GDHA 1JPJA 4KRYA 1Y8RA 4KO4S 2WVHA 4J4TA 1N1MA 4A1FA 4P22A 2NXNA 4WNAB 4HAXA 1HY3A 2FNAA 1G7CA 4FFOA 4QDUA 3OESA 2A5JA 1N6KA 3LBHA 2C4WA 3HKEA 4DA9A 1N2SA 2P1ZA 3R0VA 1C0EA 3OT1A 1NULA 3MGCA 3AUUA 1W34A 3HUEA 4HTFA 5C3MA 5FWYA 3PVZA 4J0EA 1MB4A 4EUHA 1KYWA 4ZI5A 2IODA 2G5CA 2ZIVB 1Y3HA 4IGIA 1X0VA 5BSWA 2NU8B 3QXJA 1CUHA 3R4CA 2W70A 3G0BA 1CY4A 3T9FA 5F23A 4BFXA 1L4HA 1F4LA 4JBNA 3DEKA 3ZWPA 2PMCA 5D51S 4KR7A 1EHYA 1RM4A 5L3SB 2RIPA 3M34A 1A8SA 3OKPA 1E9DA 3JATB 2C3OA 5ER6A 2FOLA 3JQ7A 4C2TA 1CBUA 3C6QA 4S12A 1M0WA 3ZPXA 4DCNA 2LKDA 1EG2A 4Q01A 1HFJA 3GUCA 1CUVA 4DMHA 1L5SA 1JEDA 3L84A 1TD9A 5E9JA 1O1YA 5F76A 1HDGO 2AD5A 5CLIA 1F0KA 4N40A 3W4JA 2BFCB 2VDVE 1DKMA 1KI8A 3TN7A 4NF2A 3MWEB 4RL6A 5G0VA 4YIHA 3WAJA 2PGDA 4D6YA 2ZRJA 1SZDA 1YS6A 2NP6A 4O2BB 2XOXA 3OFSA 2HJSA 3BB1A 3GEEA 1C29B 4XGKA 4OY3A 5FQNA 1IN8A 1P1FA 1F3OA 4RHTA 3UH1A 4H27A 3S81A 3WFZA 2D7JA 3SM3A 3UYKA 4P7FA 3T7TA 2QYHA 2ZWMA 3EEFA 3QOFA 4PZ9A 4N54A 3HBAA 2GPNA 3X1DA 1E2UA 3P9QA 4LWOA 4NZ9A 5E1MA 1GNSA 1WB4A 4LZLA 5DHAA 4RTOA 1HLGA 1VSTA 1N8KA 4O63O 4TV8B 4A0HA 4C88A 5FNVF 3F6YA 2XUFA 3G2NA 2CF5A 4WCFA 2DMRA 1GL6A 2PM8A 3HY4A 1N78A 1NOJA 4KQXA 3FOEC 4CEIA 4LYFA 2PUBA 3A1SA 3FOAA 1G4UR 1B1CA 1G98A 3A14A 3A7DA 1C9EA 3BWCA 4XIGS 2F43B 1Z82A 1K6XA 2NO4A 4HLQB 1WRBA 4XYBA 2Q5IA 4XIFA 1FTGA 4ENVA 4NAVA 1JBKA 3WISA 2EW1A 1IJBA 4C14A 2LVBA 4IIFA 1DAIA 1WDMA 2XB8A 2Z5VA 4UTZA 1WZEA 1QIHA 3IOYA 4YRQA 3URMA 1NJSA 2QNIA 1CYDA 3ENWA 4A6EA 5A1TA 2DR0A 1XMVA 2YFKA 2QLJA 3L9WA 1W87A 3T41A 4N9QA 1NFFA 2YWDA 3PPWA 5EPOA 2B7BA 3L2OB 3P9KA 4TROA 3TNJA 2JIQA 4MR9A 1Z17A 1FP4A 2VBCA 3I0MA 4W99A 3VNBA 2NVUB 5E6SB 3R7LA 1T34A 4BYGA 1E1RA 1KFKB 5JFOA 1ZHOA 4JJGA 5K8UA 2ZYGA 3DOEA 3H4MA 1K8XB 1V7QA 1E3QA 4XYLA 2C7OA 3VTFA 5LMNB 2XE7A 1YSCA 3PRKE 3ZCTA 4IFBA 4P86A 3EOAI 4LYJA 2AYZA 3PYMA 4FZJA 1ISRA 4RE5A 4MITA 3E84A 4B9EA 4EJSB 3CRVA 5BQ3A 5TX7A 4N18A 5L7YA 1NLZA 1Y9JA 1T8RA 1T5SA 3HMQA 3KXIA 4MK4A 5B6JA 2EAUA 3GA7A 2YFHA 2GFIA 2IYSA 2JFFA 3V3TA 4K9QA 2EJWA 4OH7A 2J3DA 2EARA 4DS3A 2OZLB 4NMXB 1B14A 4RO0A 3NNDA 3EGOA 1YCDA 1JI3A 4PNHA 3UMCA 4R98A 2ATXA 1E98A 2BFBA 3A6JA 3K15A 4E11A 2Q62A 2QJWA 4AS2A 1BIFA 4Z4CA 5KDDA 3K71B 2O6HA 1GITA 1EDBA 1QZTA 4MGYR 4O4LA 5ALKA 4A3SA 3PJRA 4TTQA 2W2PA 2N9UA 2D5LA 1R6VA 4BYMA 5DGCA 1YJBA 2EFHB 1KWKA 3COVA 3IJ5A 4HDOB 1CE8A 1BXGB 4P1ZA 2JDIA 4Q9NA 4MGEA 4EKGA 2R0QC 4ZCMA 5K3EA 2I34A 4GP7A 3UUFA 1YRYE 4MEBA 4X64B 2V9CA 3BMCA 4RENA 3BZUA 1TZJA 1UPFA 1GQQA 2G28A 4HX2A 1G59A 2RHWA 3IUPA 4I1YA 4URYR 3GLQA 2GWRA 3EGVA 3R41A 1FS6A 1G7TA 2QW0X 2YNMA 3ETHA 3A3PA 1T2EA 3LOQA 4K6GA 1EM6A 4PYKA 1IMJA 2FAXA 3TTWA 1PL6A 5E8JA 2DC1A 3I2GA 3NNNA 3Q1KA 5ECYA 5IKPA 4JVLA 5P21A 1HKUA 3NT4A 3EZ7A 2V4ZA 4OIFA 4ASUA 4FCCA 4IJUA 1ADFA 1JP7A 4E1VA 5JISA 1B16A 1UZUA 1SCNE 3U37A 4LRYA 1RACA 4PXAA 4Q93A 2DHRA 2W6ZA 4M6WB 4XUCA 1EBFA 1E2KA 5TPWA 3V8QA 2Y2VA 4AMBA 3EVGA 1MABB 1RXCA 4CTJA 1W9MA 4BXOB 4R4JA 3KDSE 1RQPA 4QTTB 3G6WA 5LZ5A 1Z15A 2OKCA 3BGWA 3U4IA 2XUQA 1COWD 2X8BA 4LDPA 1KJNA 1YZKA 3EF1A 1SKYB 3OEHA 4IH4A 2B2CA 2G25A 1IVYA 2GFQA 3LDHA 4FYIA 1ZHHA 4F71A 2ZROA 2G09A 3OETA 5D7BA 3V1KA 3FN4A 5CK4A 1Q0QA 1Q1ZA 1SOVA 1ZM3A 4LXIA 2BKVA 4LSMA 4P93A 3FYHA 4A26A 2H5EA 3LBFA 1KDRA 1KOLA 3G1TA 4FIDA 5AHKA 1Z35A 2JAHA 2WM3A 2J87A 3G02A 3KVOA 4PCAA 1NUSA 2C2GA 1QB8A 3QOXA 3ZW8A 1Q0HA 4EVSA 3V4OA 2HSEA 4NCIA 4R68A 3PC4A 1NPTO 4J07A 5TGTA 4HYQA 4UARA 1H2WA 2VATA 4JC8A 4YACA 1RWNA 2XADA 4FGUA 1KH1A 1L7AA 3CNHA 1VKRA 4MS3A 1OXVA 4DR2B 1HKHA 1M2NA 1IN7A 3FA2A 4HNQA 4GPTA 4RLHA 1QK3A 1JLKA 5K3DA 1B1AA 1W4RA 4Q3BA 3E3LA 4M22A 3LQFA 3WI7A 5DHQA 4ZRMA 5H5JA 4ZZ1A 1E2FA 3NPAA 3KSMA 4C4OA 3RVKA 2XYRA 2R6GA 3HB1A 4JLNA 4E7OA 3ZGNA 3V4RA 2VJMB 5HXAA 1II8A 2BKXA 4QFBA 4XGIA 3UMVA 1FLVA 2PVCA 1K5HA 4PV7A 3RYCA 2R1TB 2W6ID 1HM5A 3N7UA 4RQBA 5LA6B 3ZLBA 4AIIA 1FY2A 3LY8A 4MZDA 5BWOA 4OHUA 2CUKA 2PGXA 3NDRA 4G1EB 3SEAA 2ORWA 3DDUA 3QUQA 2PR2A 3CZMA 4ZYYA 5BMVA 5DYNA 1TU0A 3FRJA 2X1HA 5TMEA 1NE7A 2BJHA 3AY0A 3GLHA 4JP5A 3TSYA 2X0NA 1C14A 4YYEA 2YS6A 4YALA 3N58A 4QHYA 3UB4A 3RC9A 1JWAB 1NNI1 3J81A 3Q7RA 2C82A 5K8LA 2EWWA 3L8HA 4O2BF 1A9PA 4X71A 3WKAA 4C0HA 4LHZA 2XTJA 2G9UA 5KU7A 4S04A 4G0ZA 3VHRA 4B73A 4JOCA 2O8FA 1YHNA 5E1OA 1JIIA 3K0AB 2HCRA 1V2GA 4CM9D 3QEMA 2YVUA 4FGWA 4JYMA 3ZI0A 4NVRA 3JV7A 2PXCA 3SYMA 1U3TA 4RKRA 2VHQA 5AM0A 4B1FA 4V1CA 5KC9A 2ZUFA 4GKKB 2QRLA 1B43A 3DHEA 2IDMA 4AUKA 4DANA 2VKQA 1RHMA 1NXOA 3ED1A 1C4KA 3T3GA 4TV8F 5C37A 5DVZA 2OFPA 4N0MA 1O03A 2J9GA 3S55A 2H29A 1N2IA 3CVJA 4N5NA 2JIBA 4H0FA 2QEQA 2DTXA 2NO6A 3DCYA 4UD6A 1CVLA 1FNCA 2Z56A 4E5KA 4IOMA 3GN2A 3CZ4A 3FR8A 4IW3B 4NOJA 4UTXA 2IU0A 3B5IA 821PA 2ZIXA 4XLLA 1DP4A 1GPNA 4B0OA 3OWXA 3PEVA 1T8UA 5ICSA 1DBRA 5BV8A 4TLCA 2OYCA 1EDDA 1Q17A 1Y7IA 2QMUA 1PLKA 2OV2A 4LQLA 4JXJA 3OJXA 1U0OC 3NHAA 2KHZA 2ODPA 4C6TB 3IQFA 1G4AE 1NRJB 3VYRB 4LBYA 3KZOA 1E1NA 1ZN8A 2ATIA 5I45A 3BVPA 3WMGA 3GD5A 4KPYA 2G7ZA 2WAYA 4X54A 5JMWA 2I1QA 3M9WA 1WHTA 3KJZA 2MSLA 4UMDA 1DBPA 2IW1A 3ICWA 4EL5A 1JDPA 4EHIA 5IM4F 1JH8A 1P9RA 1YDEA 1QYXA 1Z6XA 5IAEA 2WIJA 3TDNA 5HK9A 2R7LA 1II9A 3SXUA 4PYJA 4LHYA 4W5WA 2IWHA 4EJFA 1CY1A 3IUBA 3QX9A 1Z73A 2VSFA 2BWJA 1BDJA 1G2OA 4DNQA 7REQB 2P9FA 1AB5A 4QZVA 1TQHA 1J0BA 1W88B 2ZYWX 4XOIA 3KKQA 3GCWA 3V00A 1UQRA 4DV7B 4Z1MD 2QRNA 3V7NA 5HF8A 1BVHA 1PT5A 5CNJA 1HEUA 2VDMB 1M6HA 4UEQA 4WZZA 3FKSA 4G0MA 5MFZA 3QBJA 5E1DA 3RUFA 1UBSB 2CXRA 1ZH2A 3BB4A 4HMOA 2H1FA 4HUJA 1KC3A 5D3MB 3JYLA 5ITSA 4JYZA 2GAIA 2N3ZA 4M36A 5ENVA 4BC0A 2B1JA 1MW8X 2R62A 5M04A 2YW2A 2B1IA 2W90A 3IMEA 2BE7A 4U3JB 3W90A 4AYWA 3GJ5A 4XDZA 4L4RA 5FBLB 4Q3NA 3W3AH 4OXYA 2HGSA 1MNAA 3OP4A 1DINA 1KBQA 2Q5OA 4ZRNA 3MT9A 3RD5A 1GG2A 3SMVA 3PX3A 3K05A 3CSUA 5DTRA 3K4QA 1FDTA 1U94A 5L6LB 3PCTA 1C1XA 3BQ9A 1RHQA 3TQSA 4NMLA 2ETXA 1K8YB 4KHPB 3RCBA 5LDHA 4GWKA 2OAEA 1I4EB 3WICA 5GIOE 4MV0A 4CHGA 2CFCA 4OX9B 3BUSA 1IXKA 3O2SB 2GCOA 3U7IA 4FZ5A 1CQZA 4HWKA 1RE0A 2QUBA 3LSTA 5F1PA 2RONA 4P0TA 4WFQA 3P52A 3H1TA 4JLKA 2J3JA 3A6FA 4IMIB 5DN9A 1XELA 2HCBA 1PP4A 2ET6A 5C4MA 3PB3A 2FUG6 1MGOA 2IH5A 1C8KA 1ECCA 1VCMA 2BZGA 4BO1A 3HHEA 4BQOA 3VBCA 4Q82A 4CM1A 5E4TA 3JYOA 4G5OA 2F1IA 3AR4A 2ZB4A 1NUUA 4QYMA 5DHUA 1X19A 3O7WA 1GPKA 2ZRNA 3CPHA 1Y7TA 1R4MA 1IWPB 1VPEA 4G0NA 1IEWA 2EIXA 1HUQA 2H51A 2ZU0C 5TGDA 4DW8A 1RABA 3UMGA 1VYUA 1NVKA 2WSMA 3HDQA 3HY3A 4IIHA 1ISJA 4L51A 2HJVA 3RUAA 2JI6A 2A58A 1GKLA 1MDBA 1TCAA 2OP1A 3LO5A 4FGKA 1IY0A 1HL7A 1IRXA 3IEIA 2WHQA 4PBSA 1D8TA 4Y3UA 5CNIA 4EZEA 1LBTA 4NV3A 3VPSA 3ZY6A 4CMGA 1FVXA 1L4NA 3F7OA 2CMKA 4M9SA 2ECOA 3RUCA 2HLDA 1RWMA 1P1JA 2HAEA 1MOPA 4JT4A 1F6WA 4JP1A 1XAJA 3IKTA 1BMQA 3VYVA 4LOAA 1FZTA 1EX1A 2YWFA 1GWNA 2ANCA 2C9BA 3TM5A 2PV7A 3MINA 1F4VA 2A5YB 3IKVA 5CP8A 3Q72A 3FZQA 1JFLA 4GF5A 3DFKA 4KQMA 1UXJA 4M46A 1MH9A 5I7AA 1NY6A 4Z9AA 1CY0A 1PJQA 2X77A 3RVSA 4YREA 3U6BA 3KVYA 3F6RA 5LA6F 4CWAA 2Y27A 3UMBA 4GWLA 4P7BA 1V9LA 4DYDA 4OXXA 1L5MA 1MMFB 5FBRB 2WQ7A 2Y0CA 2BFEB 3ZI4A 1QQ7A 4GLJA 1ZGHA 2J5RA 1BWPA 2QOEA 4L4YA 3SFTA 1XMPA 1ZXBA 2P4EA 3R3HA 4IXWA 3Q10A 4EVRA 1I7QB 2SHKA 3U6KA 5TQ2A 1SB8A 5KTPA 2P27A 2WTEA 2VDNB 2CWWA 2WT4A 1DRJA 3HDGA 4JBLA 4JEUA 2VYNA 4MWTA 2NU6A 3VI4B 5B4VA 4MB6A 4KVFA 1NN1A 1VCIA 4Y1GA 1VKNA 4EELA 1KO7A 4ZVKA 2WG1A 1VMAA 1JEOA 2PRKA 5FUYA 4NE7A 3SC2A 4EF4A 2YN2A 1EG7A 3ABQB 4K3VA 4Q7MB 3K0CA 3MSCA 4B6GA 1QPGA 4DA6A 4DQDA 2J09A 1IOZA 3MJRA 5KJ1A 4LK3A 2BMEA 3DL2A 2X9LA 3MOSA 4RXUA 5IUNC 1JE1A 4HNUA 2D7DA 2J0VA 1RIFA 1IH8A 1H6CA 2HL6A 3B1YA 1X7YA 3D7RA 5I7WA 3M4XA 3D6HA 3HY6A 4CF6A 1SXJA 5GMOA 4B75A 1YFLA 4OKSA 1CDEA 3B8HA 3AUSA 5LCXA 3OQJA 1YOVA 2CMGA 4ZQIA 3ZCSA 2AG0A 4LE2A 1XNJA 2D54A 4XAQA 5ALLA 3Q3HA 3U4GA 2PY6A 5EL0A 3GWZA 1E79D 3WHPA 4DCTA 5E6UA 5JRZA 4H16A 1FP2A 3STWA 2Q5EA 1ZBDA 3MHPA 3LP5A 2GO1A 4UCWA 2IOFK 3QM1A 1GM5A 4OU5A 1E9FA 4WINA 4FYHA 3WL3A 4NYJQ 4KV7A 5KQRA 2RAFA 1L5RA 2H1RA 2PN1A 2DBYA 3C8ZA 3D8HA 3I2IA 4BNVA 2JHGA 1YAJA 2ON6A 3T0GA 2JCYA 3R9KA 3EVFA 2ZSFA 3EQ2A 3KQOA 4RMJA 3EYWA 1EKXA 5IT9A 1IDOA 5DEOA 1SUBA 2Z09A 3OUUA 4M0KA 1M1XB 3GUZA 4MKZA 1TPZA 2H11A 1D5WA 4Q3CA 2D2FA 1NYLA 1CERA 2O8CA 1EWQA 1HRKA 4NONA 2YHAA 5P8WA 4FN4A 3U26A 4G0YA 1M2VB 4LFCB 3KZVA 4KFCA 4LF4B 5ITZB 2J6BA 1OZHA 2ZP1A 4IUCS 1XZ8A 2WOJA 5D8DA 3ZU6A 5KQSA 3GLIE 3IIJA 1G9SA 3B8EA 1OC4A 4M1ZA 4YRSA 1U8AA 1XDBA 2VDOB 3ODGA 1U8XX 1M6NA 4MVXA 2X86A 2OV8A 4TZTA 1JJAA 4W5HA 3UJAA 2Q8QA 4N01A 4FFDA 5AO9A 3IP7A 4UVGA 4KXXA 3DP7A 4NDNE 5DV9A 3VAAA 2ACVA 1USGA 3W5BA 4YAWA 4Q39A 5KB3A 2PSFA 3IQIX 3NUZA 1C1DB 3I72A 4XQGA 4QOIA 3ZOZA 3LBYA 3F96A 4TWAA 4J16A 4ODIA 2YWRA 4D0GA 2EZ9A 4C6RA 3COZA 1IZ9A 3SXPA 5KYWA 2Y1GA 1U6IA 3JD2A 1EQ2A 1M1YE 4EA7A 2V59A 1A96A 1XZIA 2KSQA 3IBCA 1DADA 1Y33E 1THMA 3EN0A 1Z7BA 4LAFA 4UUPA 3BSSA 1NTRA 4PXYA 5G0TA 3U4MA 1CUXA 4X3OA 1TQ2A 5C8YB 2WVJA 2VZ0A 3K92A 1VLLA 3BD7A 3PJEA 3AF2A 4HQNA 2RGBA 4GPD1 3S28A 1T1EA 3DDNA 4RORA 1RHUA 2W42A 5CA1A 2AUNA 2LDXA 4DNOA 3CBGA 1RMQA 2GCNA 3OZTA 1MXHA 1SKAA 4B17A 3RGWS 5F51A 1NVGA 1T9ZA 2VQDA 3ITEA 3SQLA 4CLDA 4LJAA 3KNZA 1XVAA 4OXIA 4XR4A 3FSJX 2I55A 2QD2A 1FX1A 1JMVA 5KHLB 2HBQA 1GQYA 1E59A 1TJNA 3AIKA 3HEAA 4CMEA 5IZ4A 1YCGA 3UPUA 1W0KD 4NEQA 3S1AA 1DXQA 2PT9A 2BGWA 4M0CA 2ZKIA 2W6JA 2Q4BA 3QWAA 5DTIA 2WP8J 4C30A 4EA8A 2QIPA 4GICA 2A78A 2IHVA 4V2IA 4C20A 4BLOA 1D1TA 2XT6A 2GKGA 1KQPA 4BV3A 4EENA 4H1WA 4KJZA 4U7GA 1B6GA 1U4NA 2OFOA 3H1GA 1TEXA 4I5GA 5JEEA 1Z88A 1A0OA 1BCSB 3KWMA 4X66B 3PGJA 3RTAA 2RHHA 4ADSG 2XVMA 1O8CA 5E7MA 2B8NA 3ZXIA 3DVQX 3FJYA 2JCXA 4UNNA 3LW8A 2BUBA 3W8RA 3S1SA 1XEXB 2HUNA 1RDFA 2PZJA 3TI7A 4RTSA 4X60A 5HM8A 2JHCA 4PO8A 6NULA 3ICQB 1L5HB 1KH3A 2IDJA 4JJEA 2TSYB 3AW8A 2P91A 3PGXA 1ZG3A 1OXKB 3ZBPA 4D6XA 1P7WA 3OF5A 3MB8A 1AMUA 3KALA 1BOFA 2FSGA 3K1ZA 4KXVA 4Y9UA 2KMLA 2AMFA 1KAEA 2G40A 3BBLA 3JW8A 5G4KA 3P9ZA 2XQGA 4GAEA 5CTAA 3JQ9A 4PO9A 3PNVA 2ZBPA 4J0IA 3ZHQA 4AY3A 1VLMA 4ZCLA 3ANNA 5BT9A 4G4IA 4ZEVA 1FU8A 4MYTA 2WG2A 4UJ3A 2C3MA 5IP5A 1UWLA 4JNCA 2C94A 2QU8A 1THZA 3N0RA 4R8RA 3CUVA 3K9LA 4MQ5A 5H9VA 3FKJA 2FPRA 2WWFA 3N75A 4L4ZA 5DMXA 1MIOA 1RWQA 1UXKA 2J6HA 4NS4A 5FLYA 1XWFA 3V7FA 2D0IA 4QGFA 4CM5A 4DSNA 3NHZA 5IBCA 1AMNA 7ABPA 2OM6A 1N9ZA 4LTNA 2H08A 1PN3A 3PTLA 2FZ5A 4UFPA 4LDZA 1MP0A 1YR9A 2X15A 4D81A 3CT4A 5IJWA 4TMYA 4TRRA 4RAQA 5EKDA 1W0JD 3BX1A 1DB3A 1ZVJA 2W2QA 3DL4A 2FJPA 4M1WA 4WOJA 5CA0A 2V3WA 1RRKA 4BO9A 1Q0RA 1V1MB 2BLNA 3REGA 3H9QA 3BJMA 2IF0A 4MLZA 3H8JA 1GPH1 3TX6A 2LPMA 2OQ2A 3AJ9A 4BFZA 2N1MA 2R00C 2FZLA 5ALHA 1YL6A 4PAQA 5EJMA 4CQLA 4CKCB 1DX6A 4BLRA 1HTBA 4KQFA 4XRGA 1MEJA 3AYXB 1T1GA 1SU8A 2XMGA 4LOJA 4CIWA 1K5GA 1BVRA 3I1JA 4RE6A 2JRLA 5ECWA 1N0VC 3UEOA 1IAQA 2HH9A 5DEIA 3KBOA 4MDEA 4Q9IA 3EA0A 5ALGA 1D2EA 4AP5A 4B84A 2QE7D 4RQUA 2BFWA 3PR2B 1L4FA 2BD0A 1B00A 1R6UA 3TTVA 4PTLA 3ZEAA 4F7DA 1V26A 3GF4A 3IBYA 4LOLA 1ABFA 3RS0A 1ISSA 1P75A 1T10A 2QUIA 4LDQA 4O4HB 3B9PA 1VI5A 5CCDA 3S1LA 2Z9BA 4EHHA 3WOHA 3O8OB 2XB4A 3N39C 3C70A 3RBXA 1VIVA 2R65A 5FAKA 1F7UA 4WKCA 1FRNA 1T2AA 4JAVC 1IUOA 3SF8B 1DDOA 4P8RA 5IYZB 4MKIA 1Q11A 3OIGA 2WSLA 2M1ZA 2EP7A 2IIQA 1C0PA 4I8IA 3E3AA 4P4LA 4AF7A 3PE4A 1CWUA 4HUQB 3OLCX 2OBMA 3VNAA 4AZVA 5D00A 3IB3A 3OAAD 1J5XA 1OV6A 3GJ4A 4QFCA 2QMEA 1J07A 2R6AA 2Y71A 4FFVA 2BELA 1KI1A 1YDHA 1R0XA 1TVKA 4ZVMA 8GPBA 2FPMA 1I14A 4N49A 1KO1A 1S1CA 4QU0A 4QLAA 2IKSA 3I61A 1SWWA 1N0UA 3KHSA 5JNSA 1IG0A 1TLLA 2R47A 1HEYA 2VPXA 2YY6A 5ARCA 2G9NA 3U3ZA