2HK7A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with mercury at 2.5 angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
269
Chain Sequence
MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Shikimate dehydrogenase
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 83
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk7A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk7A01
1BXZA 4MVJP 1AGNA 1Y6JA 3NJ4A 2P4HX 2UYYA 1EVYA 3BMCA 5JDIC 3R6DA 1BXGB 2VOEA 4JXKA 3WSWA 4P4LA 3WGOA 3FWNA 4DC0A 2ZYGA 3OMLA 2GZ2A 2PA3A 1I30A 2QQ5A 3FPLA 4NU5A 1HDYA 3KRTA 2JKVA 4Q3EA 3GR6A 5HRUA 1UDBA 1QRRA 4J2HA 3UGKA 4J0EA 3SLKA 5L53A 1PZGA 2DKNA 5JMWA 1ZK2A 2Q2QA 3W4KA 3HFGA 2O48X 3DXFA 4J4TA 5TJ9A 3EAGA 4JJGA 1DEHA 1F17A 3GG2A 5JO0A 1DFGA 3VHRA 5C3MA 3G0OA 4Y8VA 1KY5A 1HKUA 1RM3A 4NBWA 2O3TA 3W1VA 3MEQA 3RASA 4E2ZA 4E5KA 1YB1A 3O26A 2J3HA 2FOIA 3B20A 1OMOA 3MJEA 3KYCA 3RU9A 4OO3A 3L0DA 3PTZA 1UXKA 1BG6A 5CG2A 3G1TA 5U9CA 5JE8A 4B79A 4NK4A 2IODA 2BFOA 2EV9A 3GEDA 4BGVA 1SAYA 4CQMA 1ENPA 3VTFA 2GNAA 3GY0A 5JAIA 4U8GA 2Y0DA 1WAMA 3L4BA 4CLOA 4FFRA 5AXCA 4WCFB 3TJRA 5L95A 2DPGA 2ZYAA 4OQYA 1OI7A 3AJRA 1NPTO 1XU7A 3QV1A 4WEOA 4CM8A 2ZTVA 4KWHA 1PJTA 1E92A 3BTVA 3CMMA 4GL4A 1QSGA 3E82A 4R9SA 4XGIA 4DVJA 1Z7BA 3C3XA 1K89A 1HZZA 4ZRNA 3PZBA 4AG3A 2BRUA 4TZKA 1FXSA 1E3IA 3BTOA 1BMDA 1E7RA 3WMWA 4AJHA 5IZCA 3SC6A 6LDHA 3INGA 2C5EA 4LCJA 1W73A 2TMDA 2C59A 2YFQA 4MOWA 1Z73A 4HV4A 3KEQA 2AQKA 3FCOA 4LW8A 4BO1A 3QWFA 2Y68A 5FI5A 4YT5A 4PLCA 3SBOA 1C1XA 4KMSA 1N1EA 4IIUA 1RPNA 1FDWA 1HL3A 1X7HA 1W6UA 3IQDB 3OJLA 3LQFA 3WB9A 2JL1A 4XR4A 4B8WA 1PQUA 4HFNA 2VT2A 3WSVA 4B7UA 5A4DA 3B1KA 3KBOA 5IZ4A 1O5IA 1PQWA 3H9UA 5IXYA 1JW9B 4KP7A 3RCBA 4RCVA 1YJQA 5F5NA 1YKFA 1E3LA 3GFGA 3ZNNA 4HNGA 5I8WA 2X58A 3WNVA 3GN2A 3OSUA 2GLXA 2AMFA 3WYBA 1JVBA 1ISGA 3ICCA 4B4WA 1YBAA 3MOIA 3UHAA 3GZ4A 2GPTA 4PLGA 3WXBA 1T2FA 3JD2A 5CPFA 3CZRA 4OH1A 1VKOA 3UAGA 4QQRA 2VUUA 3HADA 5F21A 4ZGWA 3UXYA 3CZMA 4RJTA 3N58A 5IF3A 2AEMA 3CSDA 3QJ5A 4ND3A 4TVOA 4BGEA 3JQFA 1V9LA 3WLEA 3BMQA 1EQUA 1HF3A 3AM3A 5KWEA 5JY6A 3NDRA 4ZQHA 4Z0TA 2OMEA 3D64A 3V5NA 3I9OA 4YACA 2GZ1A 3G1UA 3C1AA 2PR2A 1B15A 3EY4A 1IL0A 1IHXA 1I3LA 4E30A 1BW9A 1QP8A 4I9UA 2PH5A 3HWRA 1J49A 4ZVVA 3L4SO 5A3VA 4EZBA 4JJFA 1DC4A 1ZK4A 3DBHB 3I4FA 3QWIA 4M55A 4K6CA 1BDMA 1EVJA 2Y1DA 3E1KA 4JJIA 4RPLA 1EVZA 3TDKA 1KVRA 2R6JA 4UUOA 5JAMA 3FTPA 1MFZA 1A71A 4BNLA 5G0UA 4RPHA 4IPTA 2BFPA 3D0OA 3PHGA 1YBMA 1ZXLA 1GCOA 1E3WA 3ZV5A 1BGVA 4O63O 3H5NA 5JW6A 2HMSA 1Y8RA 4PG7A 1QMGA 1GZ4A 3B1FA 3JQFC 3QIVA 4BMVA 1GZ6A 4IDCA 2FP4A 3N7UA 5B4TA 1A7KA 1BRMA 5BT9A 3EVNA 4MP8A 4XYEA 2P68A 1E7QA 3WQRA 4A0SA 4S3MA 3PRJA 1NXQA 3IP1A 2VHYA 4I5FA 5JS6A 1I0ZA 3ZWOA 4ALIA 1TXGA 3HUDA 4CLRB 2QYSA 4RDHA 3G49A 2XXJA 3INTA 4HY3A 4TKLA 3OA2A 4CV1A 4MIEA 1TVEA 5T6BA 3ZWMA 3JQ8A 4UUMA 4WLVA 3MJ4A 1LSUA 4LMPA 5H83A 3NDIA 4DA9A 4EJ6A 3UH1A 2GN4A 2CFCA 4IJKA 1PS9A 1HT0A 1XIVA 1GTMA 2JHGA 2YV1A 1A4IA 1DIRA 3GF4A 4NDNE 3TPCA 3DONA 2UUOA 3FD8A 4Z9XA 5I7FA 2GCGA 1Q2XA 1LNQA 4OKIA 1WPQA 4WGGA 1YOVB 3FWZA 1GR0A 1Y8QA 3W8EA 3TSCA 1H2BA 3I6QA 3QVSA 2G76A 3SX2A 2JAHA 2PGJA 1K3TA 1XGKA 2HK8A 1BTOA 1U4OA 2DVMA 2P5YA 1E3EA 1KYQA 1P74A 3C8MA 1U9JA 5T8KA 3PJEA 1YL6A 2UUPA 5DNAA 3ROPA 1ID1A 3ZV6A 4J49A 2ET6A 1Q7CA 4CM5A 2J5RA 2PK3A 1DFIA 4XYMA 1ISMA 1U3WA 1NWHA 1GADO 4R3NA 3I5MA 4BNUA 2JFHA 1K0UA 2O4CA 4EI2A 3DAGA 1X15A 4BL5A 1G6KA 2VWQA 4PG4A 4CMCA 3IKVA 4X54A 5BSGA 5ICMA 5K6AA 4AJPA 1EDOA 3HG7A 2NU9A 3NTQA 1O9BA 3PJDA 4R16A 3SVTA 1I32A 1PJSA 2BGMA 2EW2A 3JQ7B 3KUXA 3QVWA 4GH5A 1D8AA 5G0SA 2Q46A 1XWFA 4WLUA 4BNXA 2FR1A 4BB6A 3AUSA 2JD0A 4WECA 3LDHA 3ZV3A 1HE2A 2C2YA 1ZJZA 1U2GA 3ZNPA 4B4UA 4HADA 1R37A 2EW8A 4ID9A 5G4LA 3HZZA 3O03A 2C2XA 5F3RA 5KJCA 2AE1A 3CKYA 1ENZA 4GX1A 4CLDA 4DL9A 5KNLA 2NU6A 1U28A 2V6FA 2Q99A 2V65A 2YDYA 1GPDG 1RM4A 1P33A 3KO8A 3WIEA 1OOEA 1PL7A 4E21A 1VJTA 4RVDA 4J2OA 4KDEA 1CERA 1Z45A 4OOFA 2HRBA 2NTJA 2RH8A 2JCYA 4CM3A 1YB5A 1PIWA 2Z95A 1U3VA 4UEOA 2WMDA 3FHLA 4XIYA 1HYGA 3KV3O 1FDTA 2H1SA 2YJZA 5T57A 4N5NA 2XPCA 3RUFA 5L7YA 1LDYA 3JYOA 5F1PA 1R4MB 2O3RA 2RH4A 2DPHA 1SCUA 1DIGA 2O3JA 3DZGA 3E5MA 4K28A 1LRKA 1M76A 2X7HA 4R4JA 4UEKA 4J43A 3ZHYA 4I5DA 1MC5A 3UICA 4Y9DA 4CM4A 3ULKA 1PU2A 2CNBA 3B70A 2NU8A 3GVPA 3ZHXA 5LC1A 4ZQBA 3IIEA 1QV6A 4PZCA 3ZCXA 3IS3A 5CEJA 1TT7A 3GUYA 4BGUA 1AUPA 4EDFA 1HE3A 2PFGA 5T67A 2B5VA 1EDZA 1Y9EA 1QYVA 4FS3A 1KEPA 1PJBA 1D7OA 3PFFA 4E2XA 1KBZA 4BNWA 1X1TA 1LX6A 4TRNA 4DIOA 3RUCA 3INRA 4WCDA 2UV8A 3ICPA 4KQWA 5A5EA 2VHVA 4BKRA 1NVGA 8LDHA 4Z3KA 1TA4A 1K5HA 1VSVA 2EKLA 2YDXA 1LTHR 3GDOA 3KLPX 1HYHA 3E5RA 4N54A 5LCXA 4BUCA 1I3NA 4WJZA 5EIOA 2Q1WA 3OJOA 4GWKA 2X0RA 1MG5A 4YQYA 4NJMA 4AJLA 4XD2A 3FSRA 3HB4X 1G0NA 1U4SA 4K1LA 4YJGA 4YJFA 1U3TA 3VH4A 3NV9A 4RF4A 1F8FA 4RVGA 4BQPA 1JKIA 1R66A 1PSDA 2EEZA 3IJPA 3JQBA 3ZU2A 4YAJA 3E9NA 1N2SA 4EBFA 2I6TA 2CY0A 5TLSA 1C1DB 4YJDA 1ISJA 5DZSA 2WYVA 4E33A 1VLLA 5KJ6A 2C20A 2Y93A 4AJNA 3OJFA 1HTBA 3ZH2A 1U5AA 3GRPA 1NQAO 3JQGB 4TQGA 4UULA 3P19A 3D3WA 2YYYA 4WLFA 3UCXA 4BOYA 3GGOA 4GKVA 4AJEA 3W8FA 4NFYA 1B8UA 2VRCD 4RO0A 4ONEA 3ADPA 3EYWA 5A5FA 2ZB8A 3DBLA 4U6SA 3QP9A 4CL8A 3DC2A 2B0JA 2HAEA 4XJTA 1GYQA 4DRYA 3WTCA 5A06A 3OFSA 4RPKA 4XR9A 3HNPA 4YT8A 2BI8A 4MDHA 3ZWPA 3K8ZA 2DC1A 3UOGA 2P5UA 4XWYA 2G17A 5AVOA 1V6AA 3I6IA 3WMXA 3S2GA 5BQFA 1D1TA 3FBTA 3NAQA 2F00A 1N8KA 4BO7A 1T1SA 1U7TA 2AQHA 3HN2A 4XIJA 4FR5A 4BO5A 2HMVA 1AHIA 1WP4A 6ADHA 1R6DA 4BNIA 4PIVA 1YDWA 2NVWA 4GMGA 1HDZA 2FRDA 1UZNA 4WOKA 3ZU5A 1NPYA 1YE3A 2B36A 1XYGA 2NVBA 5C7LO 1P9LA 4DGSA 5JYEA 2H63A 4KUEA 3HSKA 2DT5A 3BHJA 1UR5A 1DPGA 2IXAA 4R3WA 4J7CA 3DOCA 2ZQYA 2VWPA 3OH8A 3I3OA 2IDZA 2WDZA 1RM0A 1I01A 1H2HA 2DFDA 3Q2KA 3VZRA 2J3JA 4HFMA 4OL9A 4PZDA 1R4NB 1I10A 1Q7GA 2X0IA 4AJJA 5G0VA 3F5SA 1W4ZA 5EPOA 3MJSA 4M86A 1X14A 4KWIA 1BHSA 1EK5A 1VL8A 4FFOA 3P7MA 1PWXA 3KZVA 4NFHA 4PVCA 1L1FA 3RD5A 2GZ3A 3GFBA 3WLFA 2VUTA 4I08A 4CR6A 5BR7A 1Q0QA 2PH3A 5B12A 1MLDA 3C1OA 3HDQA 4XDYA 3KYDB 3H3JA 2X22A 1SB9A 4J0FA 4XYBA 4PN3A 3RFVA 4BO2A 4CUKA 3QWAA 3F4BA 5AOVA 1C0IA 2BD0A 5DCUA 4MIYA 4KDFA 2R00C 3X2FA 4CMGA 4I5GA 1V35A 3HB5X 4Z0HO 4L8VA 3AUAA 2W2KA 2FMUA 3GHHA 4YJHB 2D5AA 5AYVA 3LF1A 4IDFA 5KVQA 4FFPA 5L7TA 2B35A 1WZEA 2VN8A 1NHWA 1SOWA 3RUEA 4OXKA 4PLYA 5ER6A 4E2WA 3DAPA 3KM0A 3KOUA 1A9ZA 2JFFA 3ONEA 4Q3DA 1JVSA 3WYCA 4F3YA 1SC6A 1SEVA 1NASA 3QA9A 4BNMA 3JCZA 3PHIA 4JBGA 1GYRA 3F46A 2YV2A 3RC7A 3VKVA 3V2HA 3H9GA 4BO4A 3OECA 2GN9A 1ORRA 5KCZA 2OUIA 3IAHA 3BA1A 3RVDA 4EUEA 1H94A 4J90A 4BVAA 1V3TA 1HDOA 2BELA 2Z5LA 3A9WA 2VYND 1ZZEA 3SLGA 1HXHA 3ONDA 3UF0A 4GGOA 4PZEA 1MV8A 1GDHA 2P2SA 1DC6A 2OBYA 4BNTA 3S2IA 5KKCA 1BXKA 2NVUA 2QIOA 3MWDB 1LLUA 1ONNA 4DYVA 1IUKA 1XQ1A 3VAZA 5KVCA 3RUAA 3OP4A 1HDGO 4YR9A 1N7HA 4XKJA 4UVGA 3GGGA 3OQ1A 1E5LA 5CDTA 2I99A 1L7DA 4MKXA 1H5QA 4WNCA 2R2GA 3I9JA 3GEGA 3DEYX 1NVMB 1VPDA 4Q3BA 1LSOA 3VVBA 3MCVA 3SEFA 2EP7A 4EITA 1UUFA 1M6WA 3GA0A 4IGEA 3OBBA 4PLVA 2AA3A 4G2NA 3RWBA 2FSSA 3LU1A 5JDIA 2FPIA 1ZCJA 1ZVMA 4R69A 4DLLA 1YL5A 2CF6A 2NLOA 1KVUA 1C0KA 5G4KB 4NHEA 4WCFC 4CMBA 2AQIA 5A9RA 4Z6KA 5CDGA 1B2LA 2D4AA 3BYZA 4N7RA 3DAFA 4XCVA 5TX7A 5EMHA 3K2EA 3QVOA 1XCBA 4P4NA 4M49A 5A9SA 5L4SA 1KVQA 5KJEA 3DBRA 2Y0EA 4GI2A 5IXSA 3A14A 3OEWA 4F46A 3TWOA 1PGOA 4IZIA 4DMMA 3D5TA 1NWCA 2PWZA 4ZQFA 1GU7A 3VPSA 2EKQA 3RKRA 4KUGA 3OF2A 5I9LA 1SO8A 2IYOA 2O7QA 3E9QA 1JLLA 1QYCA 3ZNQA 2I9PA 4RPGA 2BMAA 4XA8A 4II3A 4M1QA 4FD3A 4DPLA 2RBEA 3ANLA 4LISA 4FIZA 2FWMX 4QUKA 2P91A 4C4OA 1ZSVA 5COBA 3JQ9C 1R15A 2EP5A 2JCVA 3LT1A 3NEPX 4Y98A 1MB4A 4YRDA 3GVCA 3ZU3A 2YUTA 3RC9A 3S55A 4CR8A 1T25A 5EN4A 4AL4A 4MP3A 2GF2A 1E5QA 1QORA 2ZK7A 1VL0A 2RAFA 2VHXA 3I23A 4OQZA 5KJ1A 2HKIA 1O89A 5TT0A 3OIFA 3GZNA 1CWUA 3GN1A 1JDJA 1FMCA 4BO8A 4EJMA 3LC7O 4FFMA 2Q1TA 5CP8A 5AQ1A 4YB8A 4YVFA 3V1TC 4UVDA 2A4KA 4RVSA 4CR7A 1JAXA 3PYXA 2DBZA 2HQ1A 2NQ8A 2DUUA 2Y1FA 3U4IA 5DP1A 1HSOA 3ZW8A 3WR5A 2BF7A 3RROA 1ADCA 3NJ8A 4UUPA 4CMIB 1O8CA 4TRRA 3QQPA 3L07A 4E12A 3ON5A 5U4QA 3WQQA 2E4AA 2HUNA 3T7CA 2JAPA 2D0IA 3GRKA 1MXHA 4D3SA 1F8GA 4LMRA 4AJ1A 1C14A 4CQLA 2EKPA 4TVBA 4NNJA 1FJHA 2DAPA 2SCUA 4DMLA 3E8XA 3PWKA 1ZH8A 1H6DA 3TRIA 2O3SA 1H6AA 4I9NA 3FNHA 1HDCA 2X9VA 3U5TA 3PYMA 3K30A 3WYEA 4ND4A 2PD6A 1V0JA 3O38A 1B14A 2O50A 3GLQA 4BKPA 2VUSA 1DXYA 3WWYA 1SZJG 2CDCA 2OP0A 3OQ6A 3PI7A 4XYLA 1TT5B 3WJAA 4CM7A 1ZBQA 2VNSA 2X9NA 3E48A 2DBVO 5DBIA 2XOXA 4NMHA 2QZZA 4B3JA 3TFOA 1HSZA 5LDHA 1OC2A 5JO9A 3RKUA 5CG1A 5DOVA 4QSMA 5DULA 4FOSA 3TL2A 2OFPA 2DQ4A 1VL6A 1B8VA 4OOEA 1B26A 5DP2A 1P0FA 3KSZO 2Y1CA 3RUIA 4J91A 2X9GA 4FBGA 5TNXA 4YBZA 3OIDA 4RF3A 3BMNA 2X0JA 2C7GA 1G1AA 3CMCO 3AI1A 5ICSA 4P22A 4RVUA 2ZJ0A 3QE3A 2QYTA 3AFMA 4B7XA 2IRWA 2QZ9A 3ETGA 3GOHA 3U49A 3QWBA 5JPIA 2O23A 1MC4A 2OORA 2YW9A 4IDAA 1HWYA 4NFSA 3WBFA 1LBEA 2VRBA 3RIHA 5TF4A 4BMSA 4IZHA 4C7KA 2QW8A 5JNLA 3WG9A 1ISFA 1OZAA 3R0IA 4N18A 2DTXA 5THQA 4PLWA 4B4OA 2Y66A 3X2EA 2ZB4A 3VPXA 3WNQA 3H65A 2NWQA 3BMCB 2O7SA 4XQGA 4YAEA 4XQEA 4LRSB 3W6ZA 1J4AA 3IUSA 4L73A 1LC3A 2CF5A 1PGNA 1YL7A 4BHTA 4D45A 2AG5A 1KC1A 1Y1PA 5HTOA 2GYYA 3I9LA 4BKOA 4IQGA 3HDHA 3GK3A 3GHYA 3KLMX 3O9ZA 1YBVA 3PDUA 4MVJD 1LUAA 1PGPA 1ZK1A 3LK7A 4LK3A 4E4YA 4IINA 3NTRA 1NTOA 5KIAA 3K9QO 3DQPA 2POQX 1OAAA 2ZTMA 2PGDA 1LDBA 3EHEA 3O8QA 3C7CB 4FQ8A 2OL4A 1P1JA 1X7DA 4BO9A 4IUYA 3WFJA 5FWNA 1ISIA 3RU7A 2NADA 1GQ2A 3DMTA 1YWGO 5I7EA 3KYCB 4URFA 4E5MA 5JAQA 5ADHA 4DQVA 3JD3A 4RPJA 3GAFA 1E6WA 4UVHA 1ZIDA 2Q2VA 3KB6A 1JN0A 2D5CA 3DZBA 2ZJ1A 2C82A 4CQMB 2JCXA 2EJVA 1EZ4A 1KEVA 4CMEA 1ZSYA 4FC6A 4DYDA 5F1KA 1ARZA 5KVSA 4CLOB 1QKIA 4OMUA 1ADGA 3VPHA 1DO8A 1EMDA 1DHRA 2HMTA 5C37A 3PLRA 5FFFA 4CM8B 2WJPA 4EEXA 4H3VA 1P1FA 4W9NC 2PNFA 3HJAA 3DZIA 1O0SA 2I5PO 1PS8A 4ALNA 4XZ3A 4GKBA 9LDTA 1U5CA 1W8DA 3AOEA 3B1JA 3P5SA 4XGKA 5COAA 3DMTC 3DO5A 1BSVA 2RHRA 4UREA 1IZ9A 1HRDA 4J4BA 1O94A 4L9RA 3DHNA 2DTEA 3PIIA 2GSDA 4M89A 3TNLA 3KEOA 4E5YA 1A5ZA 4P4GA 4CMEC 3KSUA 4M87A 3CXRA 2QHXA 3FTNA 1E1LA 1C1XB 1QYWA 4HUJA 2C07A 4B4VA 4O0LA 1E7WA 3HQ4O 1HE4A 3KTDA 1YO6A 4J1QA 2GUGA 5IJZA 4R5MA 4DQXA 2X4GA 1YB4A 1H0KA 2X8LA 3RUDA 2VTDA 1DJNA 5AXDA 4IDBA 5ITWA 3M6IA 4IDGA 4JBIA 2OGUA 2Y67A 2DUWA 3AOEC 2O3QA 1VM6A 3DFUA 1XELA 5FF9A 3GGPA 3Q11A 1JU9A 3W4JA 3S2FA 2HMUA 5LDGA 1T2DA 3A06A 4ALLA 4BNGA 3GNSA 4PG5A 3U4HA 3F9IA 4I1IA 1ENOA 3KETA 5COQA 4NZ9A 1GQQA 3H6KA 3NKLA 3AU9A 1P0CA 4N5LA 3ROMA 4BS9A 3BMQB 4INAA 2HJRA 4NI5A 3LC1O 4ZICA 1JWAB 1X13A 3GVHA 1NP3A 4QXMA 4XEHA 4F6LA 2ZB3A 3MTJA 1FDSA 1Z75A 3BMOA 3QRWA 3C1TA 3JQ6A 1NR1A 1D1SA 4WOJA 1BW9B 1CETA 1B16A 1ZUD1 4FJ2A 1DSSG 4MINA 1YS4A 3PQFA 2C7VA 3GEMA 1A4UA 4BNJA 5BSFA 3PHJA 4XB2A 1VKNA 5EQFA 4G81A 3EVTA 1KEWA 1T1RA 4IJUA 3TOXA 1CIVA 3VPFA 1H9AA 4ND5A 2VRCA 4ROSA 3L6DA 1X0XA 4R5HA 1V3UA 4E5PA 4BB5A 3GNTA 4CLHA 3JQAA 2D1YA 3G3EA 3AK4A 2ZTUA 4KUHA 4A26A 1E3WB 4QECA 2NM0A 4Z9YA 3OA0A 3DMYA 3WIDA 1Y8RB 3PP8A 1QG6A 4MVJE 2G0TA 5ES3A 4NH4A 4IXTA 4K9DA 1GL3A 3K73O 3PPIA 4IGFA 1WDKA 3OEYA 4LGVA 3VC7A 4A10A 4L74A 5CDSA 5MDHA 3F1LA 1ENYA 2BFAA 3GDGA 5CEFA 3V1YA 4MVJH 1T4DA 4RQUA 1UXHA 1XG5A 3ETEA 2WD7A 4I9HA 5JCJA 3UN1A 5GZ3A 1Y9AA 1UAYA 3I1JA 1CYDA 2X23A 3ROKA 4FFNA 5JSFA 2XAAA 2FZEA 4WPGA 5H82A 4DBVO 1QLHA 2HLPA 3HHPA 1VSUA 4PCVA 3JQ8B 3ITDA 3EDMA 3IDSA 3IKTA 3TZQA 4KZPA 1GUYA 3ITKA 7ADHA 1WXDA 2C29D 3FR8A 5T5QA 2QRLA 2ZKLA 1DOHA 4FJ1A 1GCUA 1UDCA 3K6JA 1PJLA 3AOGA 4RQTA 4DPKA 1DAPA 4NU6A 2X6TA 1PGQA 1TI7A 3GG9A 5HS4A 3UUWA 2B5WA 4MKZA 1P45A 3NTOA 1M6HA 4J7XA 4K6FA 2Y0CA 1PJCA 4PLZA 1Q0HA 3QVTA 2G82A 1Y81A 5C7OO 3ZI0A 3ROQA 4DTIA 1T2AA 1Y8QB 2B83A 3TOZA 4ZD6A 1QLJA 4CJXA 3DOOA 5AXAA 4E31A 4BNNA 1CF2O 3MJCA 1ZEMA 5BSEA 4PLPA 1ZEJA 5J23A 1P1KA 2ZCUA 3PK0A 3U0BA 2Q1UA 2FHSA 2WE7A 1S6YA 1GEGA 2BKAA 3U9LA 4B3IA 4E0BA 3LLSA 1PL8A 4NBTA 3BHMA 3CH6A 3IJRA 2AXQA 1XLTA 4U6QA 3JQAD 1UH5A 2OZPA 1KETA 1TLTA 1OBFO 2YHIA 5I8ZA 3WGTA 2BGLA 2I3AA 1PJ3A 2CMDA 4OJNA 1LDMA 4RL6A 4GX2A 5L45A 1H6CA 4U5QA 1NVTA 3CIFA 3JYLA 4MJLA 2A94A 1LDNA 1H93A 2HDHA 4K26A 4OSPA 4FOOA 4RVFA 1PJ4A 3BHIA 3DZJA 4DREA 1T2EA 3D4OA 3UFXA 2PZLA 2O3UA 5FYDA 4Z9FA 3FI9A 4WASA 3OQBA 5JCJD 1DC5A 3MJTA 4M54A 4QO8A 1ZO8A 3U3XA 5KJFA 1SBYA 4DUPA 4YRBA 2VYNA 1EEHA 4BGIA 3A4VA 3CE6A 4AVYA 2CD9A 1LLCA 1PQPA 3HE3A 3RSHA 3C7AA 1N1GA 1JA9A 1N9GA 1YQXA 2R00A 5I9MA 1N5DA 2WD8A 3F5QA 1D4FA 3H3FA 2VYVD 3NT4A 5B37A 1Z6ZA 3PQEA 4RVHA 4DPMA 4BNFA 1CRWG 1UZLA 4CM9A 2GO1A 1NR7A 3PGXA 5L51A 3U4CA 1LQTA 1VJ0A 3ABIA 2QRJA 2Q1SA 2G1UA 1EFLA 2Z1MA 2BGKA 1GQYA 4NR0A 3GMSA 1PJ2A 2V6GA 3RC2A 3GVIA 1JTVA 4NG5A 4XJSA 1WLYA 4RLSA 4PLFA 5G2OA 9LDBA 5GY7A 4H16A 4CLEA 5DBFA 4KQXA 3FN4A 1R16A 4LVCA 3ZV4A 1BXGA 1E7SA 3RFXA 3PVZA 2AW5A 5JDCC 3M2TA 5I7SA 3WX0A 2I3GA 1EQ2A 3H2ZA 1FDUA 2W98A 4IMRA 1JKJA 4CM4B 1XU9A 3TZHA 1ZJYA 3OETA 4TWRA 3WWZA 4BNYA 2O4UX 1JKFA 2BLLA 1IULA 3C85A 3TFQA 5K9ZA 1BWSA 4FCCA 2ILTA 4DLBA 1SOVA 4JP3A 4DQUA 2J6IA 4J6FA 3H9EO 1K6IA 2X5JO 5EINA 1RWBA 4MP6A 5ILOA 1UJMA 4IY1A 2CVOA 4JP2A 1YONA 1E1NA 3PLNA 2QRKA 3ANMA 2ZCVA 2AEFA 3JD0A 1BDBA 4JGBA 2WWRA 3DR3A 4GX5A 1E1KA 2VT3A 4A27A 1NYTA 1L7EA 4OSOA 2WTBA 3LSYA 1VE9A 1SMKA 3WGYA 4NJMB 1I3MA 4CL3A 5JFOA 3W4IA 3F47A 4IS3A 4LVUA 3VKUA 5A03A 2NV6A 1O95A 4YJGB 4YJFB 2FN7A 4I8XA 4PRLA 5DDIP 4MVJM 2D8AA 3KHUA 4HWKA 4WCFA 1AN9A 1GUFA 5CFZA 4R1NA 4JX8A 2WEKA 2PKQP 3EMKA 5DBGA 3W6UA 4BO6A 2HRZA 3WFIA 2UVDA 4CM9D 1U2DA 1NBOA 1EBFA 1LXCA 1LLQA 4A2CA 4G65A 4ZRMA 5TRTA 3Q0EA 3D3WB 3QW2A 4GMFA 1DC3A 1U7HA 5JLAA 3K31A 1DRWA 2FR0A 2X5KO 4XX0A 4BKUA 2D2IA 5BNFA 2LDBA 3DBLB 3AM4A 1S7CA 2GDZA 4BNKA 3JQ9A 3S1LA 2GRAA 2Q4BA 4UUNA 3KYBA 1GFSA 3GPIA 4NK5A 4CPDA 5IDQA 2OBNA 4BO3A 1U8FO 2D3TA 2H6EA 3QSGA 3EC7A 4L76A 3ST7A 1GYPA 1ZXBA 1PGJA 4J16A 2GD1O 1XA0A 3JYQA 3IP3A 2BHLA 1HLDA 2Y99A 1DJQA 3AFNA 4FJ0A 5I9NA 1W0CA 5JCXA 1WW8A 3PIDA 3I9KA 2NSDA 3L6EA 3OJ0A 3GDFA 2A92A 3ASVA 2XF8A 3ZWBA 2YQ5A 3WBBA 4CMJA 5HS6A 1LRJA 1RM5A 3RJ9A 1DRVA 1GV0A 2I76A 4P8RA 2DU8A 3GQVA 4B8ZA 5ILGA 4CV0A 1CQIA 4GLLA 4W4TA 1I3KA 1B8PA 1DRUA 2PY6A 1EVIA 1LRLA 2V7PA 3BTSA 2ZTLA 3PEFA 2EG9A 5L9AA 1WVGA 4D41A 2EJWA 5ENVA 2OO5A 4NPCA 4PFJA 4MPDA 3GMDA 4CUJA 4UAGA 2BI7A 3JSAA 5JC1A 4Z0PA 3TZCA 4NBVA 3H5RA 4R51A 1NQOA 4CV3A 5FEUA 1HZJA 1DLIA 1H6BA 5ENDA 5IDWA 3D4PA 2VWGA 3DBHA 3K96A 4UVEA 2AG8A 4ZA2A 4BV8A 5A9TA 3R1IA 1FDVA 1YVEI 1PZFA 2ZIZA 1QR6A 4IQ0A 4S1VA 1T24A 2DBQA 4NQZA 1HEUA 3M1AA 4YPOA 2G5CA 3EUWA 2ZQZA 2NTVA 3ONFA 3Q2IA 3GUCA 3WOHA 4ALKA 4RV9A 2VCYA 1DIHA 1P1IA 1WDLA 4QEDA 5C7IO 4ESOA 2W2KB 3EGOA 4EUFA 4J4HA 5TSDA 3H2SA 3WS7A 1PJQA 5B1YA 2FY8A 3DOJA 4IBOA 1PEDA 2B4QA 2HK7A 1NAIA 1DAOA 4BNVA 3DBVO 1WNTA 4GBJA 1LDEA 1EK6A 1U8XX 1UZMA 4R9RA 1SB8A 2PD3A 5CPBA 4YTEA 3MJVA 3I4CA 5JY1A 1PZHA 4EJ0A 4D3FA 4Q3NA 3HN7A 3ZHBA 3S2EA 3ENNA 1NQ5A 1BVUA 4WLEA 4YQZA 4NBRA 1XR3A 5A04A 4CLRA 1XQ6A 3D3EA 4GAEA 3I83A 3IL2A 4ND2A 4LRTB 2VOJA 4L4XA 2E49A 1DFHA 2DLDA 1HDXA 2GGSA 1ULSA 1YH3A 2RHCA 5DCYA 2Z1NA 1C0PA 1UXIA 4GSKA 2Q4EA 1KIFA 2W2LA 2E6UX 4MKRA 3V2UA 3JQEA 5KOIA 3TF5A 3RBVA 1QYDA 1DBVO 3F4LA 4CV2A 4MVJA 2VZ0A 2NVUB 4ZQEA 1RKXA 1U3UA 1MUUA 1AHHA 1WMAA 3LVFO 2UAGA 1T2CA 4GGPA 4AJOA 2JJYA 1EE9A 4RZHA 4J9VA 4IS2A 1YOVA 1ZW1A 2EWMA 3PWSA 1KEUA 2EXXA 3PHHA 4W6ZA 3AI3A 2XXBA 2J5KA 2Q45A 2RIRA 3NRCA 4XGNA 4O6VA 2AHRA 4YEDA 4OYRA 4O59O 5L4NA 1EE2A 1GUZA 1IPEA 3D7LA 4Q9NA 4RDIA 4FB5A 3WGHA 3P2YA 5F5LA 1M75A 1WZIA 3HDYA 3TQHA 4PRKA 2E48A 3L4BC 5B4VA 1UDAA 3NX4A 1EUCA 2GR9A 2P4QA 3KSDO 5MGBA 4ZHSA 3NDJA 4D42A 2C5AA 4TSKA 1Y7TA 4NJOA 2BH9A 4C7JA 1GAEO 1ZSNA 4Q3CA 3U4DA 4JN6B 1ZNQO 5A9SB 3DBRB 3IC5A 3ORFA 2IXBA 3Q3CA 4G5HA 3H9QA 4OAQA 3NGXA 2VHWA 5DCWA 5JC8A 3JQ7A 3L6OO 4GWGA 1E3SA 4ITUA 2O2YA 5IZCC 2Q50A 3WQSB 1B0AA 4FFLA 3S8MA 4CMKA 2NUAA 1LA2A 2PD4A 1HETA 3KVOA 1NFFA 3DWFA 2OP1A 1PL6A 2IYPA 3WJ7A 1R0SA 2RCYA 2D59A 1BVRA 3PYLA 1C3VA 3ZW9A 5A1TA 4XDZA 1LSSA 3N74A 3PFWO 3PQDA 4B7CA 3RAJA 4CQMD 4QT0A 2CDBA 2PLAA 4E5NA 2WM3A 4ZN6A 2EHDA 2YHUA 2EGGA 5KKAA 3ENKA 3LT0A 4RF5A 2VTEA 1MX3A 2W2LD 1NFQA 3WICA 4D7AA 3GZNB 2Y1GA 2Q49A 1M67A 1Z82A 3BTUA 3DL2A 1K6JA 5U1PA 2B69A 3AU8A 4NIMA 4W9NA 4WLNA 5GZ1A 3OHSX 4LN1A 4FN4A 2QG4A 3G17A 5EESA 1IE3A 1VJ1A 1ZKMA 3STHA 5EL0A 1Y5RA 5JYDA 1R4MA 4EW6A 3KXDA 4F45A 1R12A 1TEHA 4LSWA 4EGFA 3UVEA 4H7PA 1MFPA 3DZKA 3VOSA 2A35A 4OXNA 1AE1A 4EYEA 1QYXA 1LU9A 3U62A 4J3FA 4AJKA 3RI3A 4L4SA 4CUZA 3WGIA 3VPGA 3SJ7A 2V6MA 3AUTA 3CUKA 1JAYA 2DFVA 1YQGA 1P31A 2EGHA 4P38A 4AJIA 3BXXA 1AXGA 3DTYA 3LYLA 5JMPA 4CQLB 4TZTA 2X1HA 2P9EA 3HDJA 3PGJA 2WYUA 4ALJA 2CVZA 1IPFA 4KTVE 2PZMA 2W4QA 2JFGA 3ZWVA 3DB2A 4U0JA 3GNQA 3Q6IA 2HCTA 3AM5A 1CJCA 1Y5MA 5HA5A 3LLVA 3ZNOA 3F3SA 2NNLD 4JK3A 1LI4A 2FPPA 3JQDA 1Z74A 3DTTA 3I9NA 3K5PA 1PR3A 3RC1A 3JV7A 2V6BA 1RYDA 4R1SA 3RQSA 1ISHA 4RLHA 4GVLA 3M2PA 5G0WA 5DN9A 3NGLA 4CMAA 2C0CA 3EW7A 3GC6A 4FDAA 1E7YA 4R1UA 5GMOA 5TS3A 2ZATA 3VH2A 3UCEA 4E13A 3JTMA 3P2OA 1HYEA 3VZSA 1VC2A 1K6XA 1P77A 5IDYA 2VHZA 1CQJA 5CDYA 4AFNA 1HE5A 1LQUA 1JWBB 3ZU4A 1UP4A 3VH1A 4ZU3A 2OOSA 4JROA 5TC4A 3LT4A 1F0YA 1DIBA 3E6AA 3LC2O 1LEHA 1C1DA 2HJSA 1Q0LA 4BNZA 1NNUA 4R1TA 2BFMA 4IDDA 3ZGYA 2B4TO 5JAZA 3E18A 3ETDA 3SJUA 4JBHA 3JQGA 4R01A 2DBRA 4WLOA 5DOZA 1B7GO 2Y1EA 2P9GA 4IQ8A 3E9MA 4HBGA 2PZKA 1D3AA 4XYGA 3D5QA 2VWHA 3AY7A 2AE2A 1F14A 1E7MA 2Q2WA 4AICA 3ZHZA 3BMNB 1GV1A 5JBIA 4DLAA 4NBUA 2B4RO 3CPSA 4FGSA 4MVJF 1GY8A 3AY6A 2EF1A 1Q1NA 4YDRA 5IDXA 1R0LA 1ULUA 4ALMA 1I8TA 4BV9A 4JNKA 3GVXA 4TMFA 2W90A 4DIFA 4E3ZA 2J3IA 3CINA 4ILKA 4HFRA 1E6UA 4YYZA 1PS0A 1WWKA 4BNHA 3R3SA 4XQ9A 4JIGA 3TN7A 3RBXA 2PKQO 3TL3A 3F1KA 5BNTA 4TRMA 1TB4A 5T8KC 4PGFA 1QV7A 1WMBA 3H5AA 4EEZA 3WGZA 7MDHA 3VVCA 1DIAA 2VNAA 4W82A 5BSHA 5L40A 4II2A 3JD4A 3PJFA 3ZZNA 1VI2A 4EUHA 2DTDA 1E6EA 4YT4A 1UAGA 3C24A 1LSJA 4IXWA 3IOYA 5T64A 3PJGA 8ADHA 4WE3A 4D46A 4YWJA 1SPXA 2AQ8A 5K6AC 2Y1OA 4GVXA 2F1KA 3WGGA 1X7GA 3GPDG 3BZUA 1XKQA 1R4NA 4WK6A 2GN8A 3FNFA 3L77A 2E37A 1HLPA 3O8QB 3M1LA 1SNYA 4KOAA 4TRJA 4JLWA 3TZKA 4YT2A 3IUPA 2GN6A 3FRJA 3ZWNA 3Q9NA 4RZIA 1DB3A 3MOGA 3W8DA 1P1HA 5H81A 1A7AA 3KYDA 4YXFA 4R68A 2WE8A 1CDOA 3D4NA 4PVDA 3G79A 2OXIA 4DC1A 4FW8A 4UVIA 4GPD1 3ASUA 3DHEA 4HP8A 3T7EA 4AJ4A 4IMPA 2PKRA 3VDQA 1KY4A 1NHGA 4OHUA 2GASA 4BQRA 1B3BA 1CEQA 3CEAA 1G0OA 2VYVA 2AEJA 1ADFA 1KERA 3JQCA 1XHLA 4YJHA 3GAZA 1PX0A 4IJVA 2Q3EA 1ONPA 1PR9A 2CUKA 3A28A 3QLJA 1KC3A 3O4RA 5I7VA 4DIBA 5EQDA 2ZYDA 3MTGA 3ZWAA 1FF9A 3AI2A 2J5QA 1H9BA 5IAAA 4Y67A 1MA0A 5B4UA 3TZ6A 1YRLA 1DLJA 1X0VA 5A02A 4IIVA 1PZEA 4H15A 4WKGA 5DF1A 3V2GA 4W7IA 4PG6A 2O2SA 2EERA 2LDXA 3AY3A 3JYPA 1I24A 4JQCA 5L3ZA 1IOLA 3AUUA 1U1IA 2H5LA 1E0DA 1ZK0A 4KTTE 4CM1A 3RFTA 1O6ZA 1X1EA 4WEQA 3UCFA 2B37A 1I2BA 4YAKA 5ER9A 3T4XA 1E1MA 5BNIA 1KVSA 2WSBA 3ANNA 1R0KA 3JD1A 2YZ7A 4RORA 3ADOA 4HXYA 4XQCA 2C54A 2HK9A 5CHEA 1MP0A 3PXXA 1B3RA 5A3JA 5HWSA 4MIOA 2I65A 4LCEA 1ONOA 4A7PA 3ZWCA 3H4VA 2P9CA 5DT9A 3OICA 1I33A 4YAIA 3PWZA 3NUGA 2CDAA 4A03A 1VRWA 2FR8A 3UW3A 3COSA 5C5IA 1QXSA 5FI3A 5CEEA 4CODB 3WGQA 2YV3A 1MXFA 1XSEA 2IEBA 2IZZA 4L0QA 1M66A 4TROA 1A9YA 3QY9A 1E3JA 1NAHA 3DZHA 1IY8A 1EBUA 4IM7A 5IN4A 4FGWA 1I36A 1SEPA 3BIOA 1GPJA 4MO2A 4U0KA 5JDCA 1V8BA 5G4KA 1IHYA 4RF2A 1AXEA 4YCAA 4ND1A 5A05A 1ML3A 2OHXA 1NM5A 3R3JA 1GEEA 5CDUA 3JQBC 1J0XO 1M2WA 3DZFA 2GERA 1NQTA 4Q39A 3IMFA 3RUHA 3BMOB 3VDRA 1ZK3A 3GH3A 5ITVA 2X86A 4E32A 3VZPA 4YAGA 5EJ2A 3B6ZA 3Q1LA 1T4BA 2W8ZA 4FSHA 3MZ0A 2PTGA 4FC7A 4D3DA 5L4LA 4XRGA 1JQBA 2UDPA 4MVJI 5JXWA 5TT1A 4DBZA 3V8BA 5GZ6A 5IFLA 4WNIA 1ZMTA 4PLHA 1RYEA 1OC4A 3LZ6A 4IDEA 2X5OA 2JD1A 3JQAB 3RBZA 3ZDFA 5THKA 3PZRA 2DM6A 4Q3AA 5CAEA 1YXMA 1Q7BA 2NTNA 1NX6A 2IE0A 1XDWA 3AWDA 1LDGA 4Y6PA 1KVTA 5IN5A 3ZWXA 3F6YA 3DFZA 2WYWA 4QO7A 4Y6RA 4BMNA 4ZJUA 1F06A 2FZWA 3AW9A 4LSMA 4AJ2A 4DWVA 1DHTA 2TMGA 1E77A 4RGBA 2QX7A 3QVXA 4HKTA 3UKOA 4TKMA 1FK8A 2Y05A 2WD7B 4IJWA 3QWHA 3JYNA 1J5PA 3QHAA 2VQ3A 3EZLA 4J1NA 4PLTA 2HMWA 3DDNA 2YY7A 1UXGA 3Q9UA 1UXJA 3LT2A 4U7WA 4D43A 1NFRA 1RJWA 3ZWYA 1I2CA 1F12A 4L4RA 2PV7A 4CMIA 1EFKA 4YA6A 4N5MA 2EIHA 4O1MA 3L9WA 1KOLA 3FNEA 4O5OA 1HDRA 4YRAA 5HBRA 5L7WA 3WTBA 3SXPA 3I9MA 4QTZA 4E2YA 5EERA 3DHYA 2IZ1A 3OM9A 3A1NA 1WDMA 3FNGA 4D0RA 1I2ZA 3K92A 1J6UA 2YQ4A 3OIGA 4F6CA 4BKQA 1Z7EA 3FR7A 4OGWA 2JHFA 1GD1O 4HFJA 4XB1A 4GX0A 4MVJG 5F1OA 3U09A 2PGLA 2HSDA 1EUZA 2VZ8A 1ADBA 4GLOA 3T4EA 1YGYA 4WUVA 2NQTA 1LJ8A 2PZJA 5TJHA 4M8SA 3C7DB 1IZ0A 4R54A 2J8ZA 2IZ0A 4CLXA 5G0TA 1LC0A 4QFCA 1IYZA 3EK2A 1K2WA 3ZWWA 4CM6A 2A9FA 1T26A 2CZCA 2X0NA 3VH3A 1OFGA 3MWEB 5HM8A 4R41A 4D79A 3H8VA 1P44A 3V1UA 2H9IA 3FF4A 4J7UA 5K0ZA 4CMHA 2NACA 1UP7A 3OJEA 1LLDA 1I5RA 1A72A 4B3HA 1IB6A 4A73A 2YHIB 4A5OA 5KVVA 2I66A 1TT5A 3L9XA 2JD2A 3GT0A 3H7AA 4HNHA 2YFHA 3EZYA 4BIIA 1P3DA 2FPGA 3E03A 2HU2A 1UP6A 3SC4A 1P1RA 4J1SA 4XRRA 4PG8A 2IEDA 1KS9A 3NYWA 4Z3DA 5TQVA 2E82A 3VZQA 1YDEA 1C0LA 3NT2A 2NU7A 3PHLA 4W7HA 4W99A 2ZB7A 4OKNA 3ZN2A 4GSLA 1YJ8A 4HX5A 1GZ3A 4E6PA 2HO5A 3BAZA 2FSVA 4UEJA 5KTKA 1N92A 3I52A 1NPDA 4OIMA 3LF2A 5TIIA 2CVQA 1N9GB 4D44A 4OM8A 3PDJA 1EUDA 1XEAA 1YQDA 4OXYA 1V3VA 4I5EA 3RJ5A 3D1LA 4FPXA 4QX6A 5TGDA 2I67A 1N7GA 5AXBA 1PTJA 4JCOA 1PWZA 3FBGA 4BO0A 4D0SA 4Y6SA 4L75A 4J9UE 4ZQGA 5IG2A 1DDOA 2J3KA 3K2BA 3FPCA 4QFDA 1MGOA 1ZFNA 3CTMA 1ZMOA 3WDSA 3H9JA 2VZ9A 4J1TA 3VTZA 4DXHA 4GQAA 3HFSA 2CSUA 3NT5A 1MG0A 1A27A
chains in the Genus database with same CATH superfamily
3PCTA 3DOIA 3AUFA 1BXZA 1YHNA 4KGDA 2CLSA 4MVJP 4DVGA 4V1CA 5IVKA 1AGNA 1WL8A 2IIQA 1TE2A 2JLUA 2OHHA 1SUCA 1EVYA 5SZHB 2RE8A 5K03A 2O14A 4P4LA 1S4MA 4BUZA 1EQAA 2AFRA 1B43A 2P1RA 3OMLA 4YWHA 1N4DA 1MJGA 1QWSA 4OFWA 2GJSA 5L3QA 2YYZA 2GPBA 3FPLA 1XE3A 4DIKA 3DQQA 2N1BA 1HDYA 3G23A 2JKVA 1S2GA 4Q3EA 4YXWA 5LXTA 2C7OA 4LKOA 1WKCA 1JKJB 1QRRA 4J2HA 2Z6QA 3USZA 5DMHA 3QYPA 1AUOA 1D04A 3M6AA 4UXJA 1Q74A 1RQXA 3NR2A 4R2KA 3KSAC 3WDMA 5JMWA 4M1SA 1JDTA 4JOBA 5CT8A 1MR3F 5FQOA 3GRFA 5TJ9A 4BJ5A 3EAGA 2EBUA 2YWDA 3NU1A 4JJGA 5JO0A 1CQPA 1UFVA 5AT1A 4ZV7A 3IXQA 3VHRA 2RGWA 3KTAA 3PX7A 4Y8VA 4EB6B 1Q6ZA 3CRZA 9GPBA 3I2KA 3MBOA 5GIOE 3VJKA 4F3KA 4GXTA 5F23A 4GICA 3DLTA 4WFJA 2Q5QA 4CG3A 3MEQA 1ZM9A 4E2ZA 1YB1A 1J25A 4CKBA 3KYCA 1FNNA 3BG5A 5FLYA 3RU9A 5KBYA 3QPUA 4EATA 3G1TA 4XARA 1BJKA 4YJ3F 3BXHA 1XB2A 4RKYA 3NHAA 1GUAA 2PJRA 4MQ6A 3C74A 3KR0A 1D4ZA 1CNMA 1BDJA 1Q5PA 3GEDA 5AKHA 2WJIA 4C5AA 2NYAA 1A9XB 2P2ZA 2ZUFA 3B48A 3LY8A 3D8TA 4MV8A 4KXXA 4F3RA 4S04A 4TL9A 4TM7A 2ATVA 2OE2A 2OO7A 1JFLA 3TJRA 2V4MA 4FTWA 4OQYA 3TMYA 4PU0A 1OI7A 3AJRA 3GAAA 3TVTA 2ZJZA 3AUYA 1Y9ZA 3VYTB 2ZTVA 3VDMA 1I7DA 3RSCA 1E92A 1E60A 4ZI7B 2TS1A 5JH7F 3N2EA 2YXEA 4HRVA 2SNIE 4MUFA 4DVJA 1BGXT 2M2IA 3ZY3A 3M6XA 4GPBA 1HZZA 1ST2A 3PZBA 4ZRNA 2CXOA 1TFRA 3OZ7A 1DKQA 1S2IA 4TZKA 4YBRA 1QE5A 2JS7A 2PH1A 2R48A 2WAYA 3WIBA 1E7RA 5JZ9A 1FS4A 4X3PA 4Z7OB 2WQZA 3KZMA 2B2CA 4LCJA 1L7QA 1KA9H 2KPOA 2TMDA 1NJSA 3IP6A 1C8BA 3DE7X 1OGJA 1GP2A 5C34B 4HNUA 1Z73A 5C1OA 4IIJA 4C0QC 3KEQA 3PU6A 3PC7A 4KYUA 3EGXA 4XW2A 4BO1A 2JPDA 4ESEA 4DNQA 1X7YA 3FFBA 3TCKA 4IW3B 1LS6A 3PRKE 4IZOA 4YHBA 3SHWA 2FOLA 2H11A 4PLCA 5G1PA 5DRYA 3MXOA 4U7HA 4P36A 1DBWA 4IIUA 4X1OA 4WXEA 4YCJA 1A2QA 1FDWA 3KSMA 3AKZA 2QX8A 4ZGBA 5FPKA 1EXNA 2HUPA 3PFHA 4LZLA 1PQUA 1U0OC 1Z28A 3O1IC 3CO0S 1G8GA 1Y6RA 3VUEA 3GJ0A 1P1CA 4NYIR 3KBOA 3PE6A 3PEYA 2L19A 1ZL2A 1U0TA 2GAIA 2JRCA 4WKCA 5REQB 5IXYA 3QOYA 4CKWB 2NO5A 4RCVA 3TLGA 1YJQA 2JAQA 4LDAA 2I7TA 2BRUC 3H83A 3UMJA 3GFGA 3ZNNA 1DMSA 2VF8A 4GU5A 3GN2A 5IJAA 1IG3A 1NSFA 5KNCH 1ISGA 2R1TB 1VJCA 1J1ZA 2IEZA 3MOIA 1UK9A 3QENA 5CIYA 3GZ4A 4WXRA 2I22A 2RGYA 3DOHA 2GD6A 3QBEA 4C7MA 1NVDA 2AB0A 2VLIA 2QY9A 2XNDD 3CZRA 4OQDA 5CPFA 2M6KA 3WGMA 1HT3A 4ZGWA 2CLCX 4QYSA 4WXPA 4TVOA 3T1NA 4BGEA 3DPUA 3O8NA 1HF3A 2C98A 4LEIA 4MJ3A 1QR2A 3VSEA 3GEPA 2JIZD 2BT4A 3A3NA 4LJLA 3L7JA 2QMQA 4B6PA 3SQLA 5CK4A 1S2NA 3G1UA 2V9PA 2FQWA 4OVKA 3EY4A 1JR2A 2WF9A 3FLEA 3H1AA 4E30A 1BW9A 2HBQA 4I9UA 5EI5A 4AN0A 2BVNA 3DEJA 3L4SO 3FJ1A 2D4HA 2YCLA 4X61A 4ZVVA 4XWGA 4G0PA 3LUBA 3ZDBA 4M55A 1A8PA 1Y4DE 4Z86A 4Q4JA 5F73A 3T7AA 3E1KA 1T0PA 1ZMXA 4LZAA 3EB9A 2FB9A 1KVRA 1M3SA 1ZD9A 2BI4A 4TL8A 5C0OE 3TDKA 3KXPA 3IHWA 4JVNA 4UUOA 4F9FA 2YL2A 3OLCX 1R3UA 1ZHHA 1TJ3A 3SGLA 3V8NA 5A5GA 1BKSB 1X1QA 2OEPA 1D4OA 4PO3X 4AN1A 3WRXC 4H7HA 3MQFA 3BMXA 3DTVA 3VPBA 1BGVA 2IJGX 2YC2C 1E2DA 3LA6A 1DBIA 3IUMA 2ZW9A 2J3DA 4Q5IA 3C3MA 5MN4A 2IKSA 3QIVA 3FJOA 4PGAA 1GZ6A 2FYTA 2OORC 2RDMA 3L40A 2FXVA 5BT9A 4NOMA 1I6MA 1OX4A 4N40A 2PZGA 2ZETA 3N2NA 4XYEA 2P68A 1YB6A 3EVFA 1U0HC 1NA5A 1DG9A 1P0MA 4JI6B 1PFVA 4A0SA 4F6RA 3DBOB 4LDQA 3OPYA 4HH0A 4NMWA 2QRVB 3IP1A 3EDRA 1MHPA 1Q1EA 5EIHA 3KQHA 3K4PA 2D0OB 2EZ9A 3IUBA 1YD7A 2QYSA 3PVSA 4RDHA 4ZPJA 1NC3A 1OLOA 3CF2A 3O93A 3O3CA 4RA9A 4I1PA 4BTEA 2Z2JA 4CCAA 1TVEA 1B1CA 2HB6A 1GKLA 1Z7YA 1VMAA 3EAQA 3JQ8A 4PGMA 1U2ZA 2J3LA 4JEUA 1CUWA 1E2UA 1LSUA 1W4RA 2FF5A 1KHTA 2OZVA 2YMMA 1KFJB 3KQWA 3NDIA 3W3ZB 4DA9A 4IIYA 4BVBA 1TVCA 3V7UA 4JYMA 1WDTA 5DWVA 2CFCA 4LPSA 1MJHA 2O0HA 2FUG1 1YZUA 4UXIA 2Y77A 4ZO6A 3OLQA 1BMTA 1BQ4A 1N75A 1XDSA 4L8FA 3U3KA 2YV1A 1DIRA 3KD2A 4K6KA 4M8NE 1BFUA 1O5TA 4L08A 3D0RA 3QMPA 3IPAA 1EK2A 2BKXA 1L4KA 1QZUA 2QD3A 1SU4A 1YRAA 2V3VA 5JG7A 1RCFA 1LNQA 5FNVF 1WPQA 2VLBA 3OD5A 4EFDA 2OLEA 4ND8A 5B7QA 1Y8QA 1QHEA 2W5UA 1H2BA 1UBJS 4MVWA 3SX2A 4CL0A 1K3TA 3L7LA 3P9XA 3K0HA 4Y2GA 1NJGA 1Z26A 3PICA 4AG6A 1K7SN 1E3EA 5FWYA 2FSGA 2IHBA 4DG9A 3C8MA 4Z1MD 3VBCA 4RK5A 4NHOA 3PJEA 2E4ZA 2UUPA 4S0ZA 4U7JA 1ID1A 3FPAA 4UNQA 4YNBA 2PUEA 2PXHA 2RG1A 1AUXA 2ET6A 5JJCA 1E2HA 1KZGB 1FU8A 1R0ZA 3HZOA 2HW8A 4LC1A 4BMPB 1EUCB 3NAGA 4O33A 5CA0F 2VXCA 2IF2A 3C6MA 5HF6A 4G67A 1ORVA 3M70A 1A88A 1GADO 2TMKA 1K0UA 3TNJA 2GZAA 3BAFA 2JAXA 4KBYA 4NCHA 4QDTA 2R5FA 2VWQA 1CRPA 4PG4A 4C0BA 3IKVA 5BSGA 1KXJA 5ICMA 5K6AA 5HTKA 3TLKA 4AJPA 4CCYA 6NULA 2JFNA 3ZCRA 3HG7A 3SM9A 4LMBA 3BCHA 1U0NA 4HLUC 1VGRA 4R16A 1L4GA 3IBSA 2BUCA 2QA5A 1D8AA 3H16A 3GZTB 1XWFA 4WLUA 5H68A 2EFJA 3JAWB 4BFWA 1Q0TA 2JD0A 5KOJB 4D6XA 3QHQA 2R6FA 2J48A 4B4UA 5JJ5A 2X8WA 1JQLB 4G0YA 2AC4A 4MB2A 4YJ2A 3FDJA 1Y33E 2C2XA 2JLZA 1TKAA 3F3MA 2EWVA 3LZDA 1ZIYA 3WP0A 5EJ8A 4FEGA 2XGJA 1QZZA 1U28A 2V65A 3QELA 4BEWA 1RM4A 1P33A 3KO8A 4IJ5A 2QNBA 1P5RA 1PL7A 5M2QA 5CD1A 1ZRMA 4FONA 5F1YA 1M7BA 4RVDA 4BDTA 4J2OA 3FFAA 4ZP1A 1Z45A 3IB3A 4X20A 4FWTA 1MTOA 4I4TA 4A8TA 4MQFA 4JB2A 3QEMB 1P29A 4DCMA 4LJRA 1WCYA 2RH9B 4UE6A 5DGXA 1BH2A 2Z95A 3MTQA 2ZI5A 1U3VA 3MUFA 3FHLA 1FDTA 3AERA 1OFIA 3W7VA 3F2IA 4DZZA 1N3BA 3LBIA 5DYGA 3NEYA 2HRDA 4JHXA 3JYOA 3BORA 4XLTA 1T0JB 2H8KA 1PDWA 4PS0A 4JXZA 1SCUA 1TMGE 3TTUA 4KU4A 2O3JA 1G55A 2W6IA 5TE9A 4GYYA 4RH0A 3AHDA 2LCQA 2YMQA 1CUEA 4FCVA 2X7HA 5KNDA 1Y63A 3H4MA 3F0TA 4A6PA 2ZUTA 3UICA 1TJYA 1NIPA 2WHXA 4CM4A 5BUSA 5J5AA 2JLXA 3FX2A 1YDGA 3G6KA 3H75A 4ZYXA 3GVPA 2NTEA 5LC1A 3ZHXA 5KQPA 4ZQBA 1J1UA 2O6HA 5JISA 3IIEA 1GWNA 4PSDA 1DQYA 3V6MA 4IFTA 1DDGA 4A0FA 5CEJA 2JGJA 3CT6A 4Y2YA 2QSYA 3OZUA 1MO5A 2B5VA 4E11A 3BWDD 3ZV7A 1KDOA 1QYVA 1PJBA 2JA2A 4FS3A 3PFFA 4MKIA 3FBWA 4HG2A 4RSHA 3ZDRA 4BNWA 1X1TA 2DUMA 2IQ5A 4DIOA 1KKLA 2ODWA 3RUCA 1RQRA 4DWWA 3LE8A 4P34A 4WCDA 3IEKA 3FMOB 3ICPA 4H77A 4KQWA 4M9QA 4UD6A 5KAMA 2VHVA 3FMGA 4PR0A 2P40A 3VKGA 4WACA 4AXBA 2O6LA 3KLPX 5HE9A 2WQ6A 1BIFA 2QG9A 3E5RA 4L3WA 3EDQA 4GE3A 4P3YA 5LCXA 1ZHFA 2FPPB 1C9KA 1XROA 5KQSA 1A7UA 2H0RA 2ZG6A 3OJOA 1ZU5A 2GEJA 1UMDA 3DNPA 1KI3A 1MG5A 3LYAA 4YQYA 4B48A 1XVTA 2FWJA 5DCLA 4K9OA 1PSWA 4G4IA 5HOQA 3HB4X 1JEJA 1J1IA 5DTRA 3PQ7A 1G0NA 3KX2A 1OBHA 1Z7GA 2E1RA 2Q7OE 4QNNA 1APBA 1BA3A 1QHNA 3U31A 4XPIB 4YJFA 4AECA 5CYPA 2DPXA 1TYCA 1J24A 1W1WA 3ICWA 4JBYA 1USVA 1F8FA 2BWJA 5ALHA 3U3OA 4MHTA 1P62B 3IERA 3LX8A 1J2JA 1V16A 1XJ5A 1JKIA 3DV0A 4JUIA 4C30A 4A8JA 4BQPA 1T9CA 4EMBA 3D8RA 5I4IA 4DJFC 1R66A 2ECKA 1PSDA 1FSGA 1FYDA 3CUWA 3ZU2A 1OU4A 3TGWA 2W70A 3UZUA 4RGYA 4JZKA 5IP5A 2GAAA 1N2SA 2C2WA 4P93A 2YBEA 2PDAA 5DTQA 3V8QA 4V03A 1C1DB 5E7MA 3E4DA 1Y42X 1L8AA 4E33A 1TCUA 5H5JA 5KJ6A 1VTKA 1VSBA 4AJNA 3RK1A 3SZOA 3WL5A 3S1AA 4TQGA 4XM1A 1TX4B 3BDAA 4NARA 4RXUA 3VMFA 5JPCA 1T3SA 2WV9A 4JLUA 3T1HB 2OXFA 2O59A 5BY2A 3S8YA 2VPQA 6CHYA 1BX1A 3W8FA 5EP1A 2EFCB 1G2PA 3EUEA 5LP6A 3QVGB 4XSHA 2FNAA 2QM0A 1QNFA 3QP9A 1FP6A 3NVKI 1OXUA 2QF7A 2CJWA 4EG0A 4L3OA 1NJ5A 1GCIA 1SKBA 1U0FA 2B0JA 4M21A 1G8SA 1X8XA 1YNOA 1RLIA 4FZRA 5JXGA 2WJJA 3BH6A 2VFAA 5A06A 1ZD8A 3RH0A 1M0TA 2QMYA 1CPYA 4J94A 2RHMA 3CUYA 4QJIA 4HH1A 3I61A 2B1QA 5K4HA 1UDWA 3Q85A 3GLSA 2PWPA 4JUAA 5D2CA 5H16A 4QBTA 4ZEOA 3FBTA 3NAQA 2VO1A 4OYLA 1YQWA 1GA6A 1RXYA 2AG1A 1T1SA 3IA2A 3KJFA 2BJVA 4JIMA 5E1DA 5BYBA 3SOPA 3TQRA 2FHPA 4FR5A 1GPNA 7AT1A 3P9RA 4BLSA 2II6A 4BNIA 3H05A 1E99A 3D6UA 1QHYA 1W93A 2NVWA 2F1HA 2PS1A 4GMGA 721PA 4QG3A 2RGAA 2H85A 1Z07A 1KAEA 1UZNA 1DDIA 1NPYA 3GCDA 2EQBA 4HAWA 5E9JA 4RA6B 2H1RA 4KUEA 1NLMA 3KWFA 5KWIA 2Q3FA 4EJFA 2XJ4A 1GNLA 1UR5A 4S2EA 1DPGA 2PL3A 2PRJA 4J7CA 5KYKA 1P2VA 1AOXA 2JRLA 2XUFA 2IDZA 2XZTA 3G2IA 3OLZA 1ZJ5A 3OQIB 4FMDF 1RM0A 1E98A 2UYHA 2O5CA 2O2CA 1UXOA 1T4GA 2YV5A 3ENWA 3NONA 3P32A 3CRNA 3Q2KA 5J2UF 1LBSA 1JQDA 5AVQA 3LHKA 1K7FB 1YFLA 1I10A 2W6PA 1E9VA 2X0IA 3QTLA 3Q8WA 1GM5A 2GPYA 5THXA 2P6RA 3EEYA 4B84A 3JARB 3CRRA 3MJSA 4ETMA 1E0AA 1BHSA 3JTEA 1L4YA 4NFHA 4PVCA 5FWDA 1ORDA 1L1FA 4NYMR 3RD5A 4C21A 4BYMA 3GFBA 4CR6A 2VUTA 1NJ8A 4J03A 4DCNA 4WINA 1JECA 4TLLB 4C6HA 1T8YA 3QLUA 4G0NA 1JLMA 2PH3A 3G9UA 4LMAA 4N0QA 1MLDA 5CDFA 5B12A 2Q9BA 4MQEB 3GLTA 2AT1A 5EUCA 5FADA 1PZNA 3UTDA 2SBTA 2LKDA 4NCNA 3CF0A 4JENA 1BE0A 3WZ2A 3CU5A 1SB9A 4J0FA 4CG0A 2ZE5A 3RFVA 4CUKA 2CXXA 2RHDA 5I7HA 3V4PB 2BD0A 4M9SA 5AK5A 3REGA 4BV2A 4CMGA 1IJFA 4IIHA 2PPLA 3M3HA 4LOJA 2FDCA 3F7NA 4OXRA 1LTKA 3AUAA 1GA4A 3LLUA 3UAZA 1SXJA 3FYTA 1E2PA 3T54A 1GSHA 2FMUA 1XL1A 2D5AA 2IHJA 3O6VA 4LGCA 1U2QA 4QWWA 5AYVA 3LF1A 1KO7A 3JWIA 5F76A 3S27A 5CB8A 1WZEA 5DEOA 3SQNA 5CIWA 2ISQA 4N3NA 3JRXA 1RAEA 1Y8CA 2B4KA 2FQYA 2XLBA 3CE9A 3G8BA 1G7TA 4NICA 5DGHA 3RUEA 1U0BB 4EG7A 3DAPA 4ER0A 1X80B 2A0KA 1M1UA 4MXDA 4OHRA 5ALJA 1WMDA 1JYSA 4ZU1X 3AUXA 3ZE9A 4F3YA 4KYTA 1SC6A 4LHYA 1WV0A 4WKBA 1VKHA 5DX1A 1RS0A 3BUSA 1SR8A 3QFTA 3VKVA 3RC7A 1BJRE 1Y4UA 3EMBA 3MMSA 4NV3A 5JBNA 3O92A 3H9GA 2YH2A 3D6AA 2ZYVX 3OECA 4HXEB 5EUBA 5LJLA 3A9UA 2OUIA 4EUEA 1A5SB 5JYBA 4C0HA 3ILXA 2IPMA 4YRRA 5KTYA 4BVAA 4BLWA 1DXHA 3H13A 2BELA 2D2XA 4UHCA 2Z5LA 3A9WA 2VYND 3U1BA 1MVNA 1PX2A 1Z15A 4QTYA 3T3MB 2VAWA 5AW7A 3TD6A 3G2NA 1M2OB 3DE5X 3VO9A 1S0UA 3HZHA 3UF0A 2H7YA 2Z6AA 4FLEA 1GDHA 5A4MS 1DC6A 1T6ZA 5LLDA 3HYTA 1ECLA 2OD2A 4BNTA 3IIMA 1EB9A 3TK1A 1YCDA 3GQBB 1RJ9A 2QIOA 4I9GA 1KPHA 1TQHA 3CLSD 2OHVA 2XITA 4DYVA 3VOTA 2IC5A 1IUKA 4YCMA 3ACBA 5IHPA 4R9UC 1CY2A 2Q21A 2R7MA 1ZC4A 2C4HA 2HBRA 3OP4A 4ZRDA 4I50A 4C7VA 5LB4A 5F98A 3VNVA 2QNIA 1T3ZA 4UVGA 2CKDA 1KRHA 3OQ1A 3FYUB 5CDTA 2WM9B 2E6KA 2IYYA 1CR1A 2W2OA 3NKFA 4JVLA 3ETCA 1H5QA 4MKXA 4WNCA 2EG5A 4L0MA 3GEGA 3DEYX 3IJ5A 1NVMB 1XN1A 4Q3BA 2G6TA 4EITA 1ESEA 3MCVA 1XZCA 3P4UA 4MGIR 4X8MA 3TLZA 1JH9A 4Z4CA 4ZCTA 3AHGA 1CE8A 3HR4A 4PLVA 1UKBA 1X1CA 2FSSA 4ZAYA 1WULS 2FPIA 3SJAA 1ZCJA 1XPUA 3OEHD 4R69A 1ELOA 1S96A 5C4IA 1YL5A 3MGKA 1KVUA 2JVIA 2ZT6A 5IHXA 2E7ZA 2AQIA 3OWOA 4ZIRA 4I46A 5CDGA 3IP5A 4QJ3A 1B6TA 2D4AA 3RRZA 3KEGA 5ALNA 4N7RA 2ZREA 5GJWC 2H4WA 1GU1A 2H2GA 2ZYRA 4TOIA 3LKZA 3WK7A 1XCBA 4O2BA 4P4NA 2E3JA 4Y3UA 5A9SA 2QTZA 3AF3A 2Y0EA 4GI2A 4RS4A 1FYVA 1VLHA 3UV6A 5JXIA 2FSUA 3KVRA 5D5PA 2PBFA 3TWOA 2H3HA 1U2DC 3IAS6 3KAPA 4UHFA 5E4FA 2F43B 1R0CA 2HZ7A 4EHBA 2EKQA 3PSHA 3A36A 4KUGA 1D09A 3T5TA 2UKDA 1UMBA 1WPGA 1C9YA 4GBED 1F3LA 5H3CA 1U8UA 5KS2A 4DV3B 1ZVVA 2JJQA 1OXKB 2XYGA 4RKRA 4UU7A 4FD3A 1MQ8B 2RBEA 3DBIA 3VX4A 2YASA 4DPLA 1N78A 2VDQB 2VS1A 1ZVJA 4ZI5A 2YJ5A 2P91A 1UL1X 3TLJA 4F1JA 1R15A 5IYZB 5A6VA 4YRDA 3NEPX 1MB4A 2E5WA 2BW0A 4ZT3A 3GJXC 2B94A 5D7NA 1T5OA 5EWJA 3WHLA 2J9ZB 3DFMA 1SG6A 2Y1KA 4XDGA 3T12A 3ZE6A 3AYZB 1L4UA 2YV4A 4EL0A 4D25A 3GJSA 1E5QA 1XAJA 4OXXA 2ZK7A 4HQNA 2AN9A 1UBMS 4X1KB 3ES9A 5EE3A 3ZJYA 4OI0A 3FSGA 1PD1A 3MQ2A 2EWWA 4ZZ0A 5BN1A 2BFEA 1FMCA 1M9NA 3EVCA 3LUKA 2ACVA 2F48A 4M1YA 3RHTA 4BXOB 2XD4A 3EZGA 3OJWA 5FB3A 3PUVA 4RZUA 3LUFA 1T9BA 2ONZA 3BWMA 3NIDB 5E2IA 1I4WA 2WSYB 1M6EX 2G0NA 4YVFA 3V1TC 3PITA 2WHQA 1FFSA 1E9DA 5E4TA 5YASA 4RVSA 2OYRA 4OFZA 4B32A 3M1IA 4HWPA 3ZW8A 4C5BA 1ZR2A 1M10A 3KUDA 5AKIA 3FETA 4OQFA 7MHTA 3AVVA 3THWA 1HLFA 3VZCA 4GSYA 3UK6A 4CMIB 5DI3A 4KO4S 4TRRA 3H97A 3L07A 3B9BA 3EVBA 3QQPA 3FVQA 4E12A 4Q1EA 3WQQA 2XSZD 3PRHA 4BVJA 4K05A 4BBPA 2OO5C 3AHEA 4AO6A 1M1YA 1EP1B 2BGNA 3Q12A 4D3SA 1F8GA 1G8KA 4LMRA 4AJ1A 4C0XA 4DDWA 4RTNA 1C7IA 5DM0A 4X24A 2YZ2A 3V8PA 2Y0BA 4MW4A 1FJHA 3OT1A 4DMLA 4RH3A 4UUBA 3PWKA 5CX4A 1ZH8A 2VA8A 3QUAA 3BB3A 3CUUA 5A0VA 1WHSA 2WMOB 3MBKA 2QLBA 2J41A 3CV3A 2QRHA 1DXQA 2XTMA 4F5YA 1N25A 4QOEA 4P0TA 4YRGA 3FDZA 2X9VA 1S3GA 1YKSA 3BQ9A 3K30A 3LVRE 3WYEA 3H6GA 1LFDB 3VNUA 3NTLA 2F9LA 1Q7RA 5JQGA 1T2VA 3KU1A 1Y6GA 2HQOA 4UDYX 2VTVA 4EYSA 1KI2A 2OCYC 4UHBA 4XI9A 1RWXA 4OIFA 5FP0A 3BSYA 4X6LA 4Z2AA 5DIZA 3EJ6A 4KACA 1XRQA 2I4TA 2R1ZA 3QG1A 1SZJG 4FVTA 3WWYA 4F91B 4M8LA 4ENSA 3NHZA 3T3OA 5KWSA 1JR3E 5K4AA 2Y2UA 2JHCA 2QE6A 3PI7A 1YJCA 2YZKA 3QLEA 3VYWA 1X38A 4D9FA 1MIOB 3UHFA 1ACLA 1X9IA 1PLLA 2QY6A 4IOJA 2QP3A 3WJAA 4N03A 1ZBQA 2DBVO 3DXYA 2XOXA 3QFCA 4J29A 4B3JA 2W4IA 3FPEA 4WBNF 1B23P 3JAKA 5C8VA 4JWTA 3ZQKA 4B0OA 4OHZA 5CG1A 1IUOA 2PJZA 2A3RA 3FSGD 1I7SB 3ABQB 5TPZD 1KQGA 4PX2A 5ITSA 1CFZA 2D6FA 5AVUA 3NEAA 4I1YA 1VL6A 4H6PA 1SELA 2NU7B 3FKJA 4JT4A 5KVAA 4JP5A 2ASEA 2P6OA 4YIKA 5ICFA 1UPTA 4HN2A 3LH5A 2ORYA 2WUWE 3HK2A 3IEXA 2GOYA 1XD8A 2ADOA 1JDPA 2ZWAA 3RUIA 4B2IA 1YTUA 1U11A 4TV8A 3ABSB 2JGMA 5AI8A 2RARA 4IJQA 3U7HB 3K0BA 3N2ZB 4HMPA 5C9ZA 1ZNXA 3CMCO 2Q0HA 1NLZA 2WWTA 4P22A 2ZJ0A 5DHUA 2OYCA 5ICSA 2KS6A 3N8HA 3QE3A 4DWOA 4YUZA 4ZHQF 3AFMA 4JKIA 2G6BA 2QORA 2IRWA 3BRSA 3CUVA 3ETGA 3U1VA 2AEEA 1SG9A 2HDWA 3MW8A 5EYPA 3GU3A 1Q77A 4YO7A 4M9ZA 1OWPA 1EP9A 2BEVA 1WR8A 2ISSD 2YW9A 4B0PA 5KOHB 3FKSA 5FV4A 5TF4A 1ZI8A 3AVOA 1ZIPA 3V4RA 4EG3A 3EXHB 4F97A 2DY0A 3WG9A 1KIAA 3EZ7A 3MCUA 1J22A 3OHPA 4N18A 2EP8A 4MI6A 4S2UA 5GQSA 3UMYA 3FHTA 2PN1A 5GWXA 4KGVA 5LP1A 2WHPB 4RVCA 1EJ0A 4PLWA 1MH9A 4B4OA 4V1CB 1GKKA 2WINI 4V2UA 2XMPA 3WNQA 4YMIA 2Q9UA 5A3RA 1DKRA 1SCQA 2WWGA 1S9DA 1XMSA 1QCZA 2O7SA 3KHTA 4EO9A 4YAEA 4EH1A 1J4AA 4IOLA 2PX8A 5L3QB 2PYIA 1NJ2A 1EXDA 3UUGA 5LXTB 4UASA 3SQOA 1SUPA 5I8PA 4KW7A 5IWCA 3NOOA 1AURA 1Y1PA 4O4JF 5HTOA 4EZEA 3E0XA 1GLVA 1B41A 4BKOA 3L41A 1U9YA 1LPOA 3B9RA 2IOFK 4P92A 4L95C 1QFJA 3PDUA 1GZDA 5AM1A 2O20A 3V1MA 1QRUA 5CDUA 2X0KA 1LUAA 1F8YA 5A62A 3LK7A 4IINA 2D1RA 2FPLA 5KIAA 3KTAB 3W2GA 1V8FA 2ZTMA 3AMVA 5GONF 3EHEA 1LPSA 2PGNA 2XNCA 3WJ1A 5TV2A 1P1JA 3F7TA 3RU7A 4ANFA 2NADA 2GS9A 3WRWA 1KP2A 5HKOA 1QDEA 4FW9A 4CKBB 4R2MA 1N0VC 1YWGO 1A2BA 3KYCB 3HCFA 5JATA 4E5MA 5ADHA 3E3MA 3FMVA 3GLKA 4YALA 1IC6A 3GAFA 1U8YA 2VK2A 2XBLA 4GR9A 2Q2VA 4EA6A 3F90A 3EULA 4KO1S 5DYTA 3ZGOA 1TCAA 2IZ7A 4ZYWA 2FUG6 3O2JA 1MB3A 2VZEA 1EZ4A 1RAIA 2CHUA 1V71A 2YOFA 1VI6A 3GXBA 1AZTA 4YRFA 1JZSA 2Z5VA 4LTNA 3KIPA 3K8QA 1ADGA 1IEXA 2WIGA 4DQKA 1KARA 1GPMA 1WHTA 5I4KA 1OZ0A 2HMTA 3M0EA 5C1PA 4ZCIA 1OLXA 2WJPA 3IEVA 1ESMA 1UAAA 3MGBA 4I14A 1TD9A 4H3VA 1P1FA 5TMBA 4HRXA 1OWLA 3MSCA 1ZU4A 4PYRA 1QHXA 3B5EA 1QO9A 1O0SA 4ME6A 2I5PO 3HHEA 3H4TA 2QUAA 1KZHA 5JI3E 1M0WA 3U19A 1QVZA 1YMUA 2XOKD 4Q05A 3B51X 5G3YA 3T06B 3ZI7A 3HJUA 3KU4A 3P5SA 4XGKA 5CT4A 2YFKA 5COAA 2LXNA 3DO5A 3H5VA 1NV8A 2I4IA 1LCIA 4P32A 4MR7A 1UFRA 4ZI3A 3SK0A 1ZM7A 3NHPA 4IFIA 4L9RA 5ALUA 3UPTA 2H5IA 4RD0A 1ZOLA 1K9SA 1VKRA 4IIJB 4M89A 3UJPA 5LU9A 5DV9A 4YECA 1J7KA 4TQAA 5TS2A 5F35A 1EFDN 3WLQA 3EGXB 1EZZA 3KEOA 4S1WA 1SVKA 4JASB 1J23A 1Z22A 1X7YB 1KI1A 5FLEX 1MAHA 2QAIA 3BEDA 4CMEC 2QHXA 5KMGA 1U7XA 2FZGA 1QAQA 3FTNA 4M7OA 1P0QA 1ZLXA 5C81A 4B4VA 1BVYF 3ZZMA 1GO2A 2ZSIA 1ZL0A 3GLGA 4AMYA 1V5EA 1YO6A 4J1QA 1CUFA 3K1ZA 1YZKA 4R5MA 3N6VA 3OF3A 3H5OA 2X8LA 1SHZA 5HXAA 4IOKA 1KWGA 4G1BA 1XHFA 2DUWA 4FNGA 4NMMA 3TLGB 1VIYA 3AOEC 4IMJB 3ADDA 2WOOA 5FL3A 4G3XA 2HJ9A 4TMZA 1XCPA 1V95A 2AN3A 2WT8A 4NYJQ 3ZGLA 2F1RA 2Z8YM 4GPIB 3Q8MA 3NHSA 1D0SA 3F6BX 3S2FA 3VC2A 3CT4A 2HMUA 3IR7A 1PUXA 5LDGA 3ZLVA 3K71B 1W4CA 3BRCA 2Q4TA 3A06A 3DUFA 3W7AA 1UEIA 2YIVX 1M73E 2Q3CA 1DT5A 2HA0A 4IVPA 4UMVA 4Q1VA 2R8OA 4S05A 4MEAA 1XTPA 3M9WA 5COQA 3SMQA 3NKLA 3MIIA 4N5LA 1W76A 1QZTA 3QF7A 2O2JA 4NI5A 2JGAA 3A8TA 2ZJ4A 3RK4A 1X13A 3GVHA 2V6IA 4G4SP 4QXMA 2BFNA 2O8EA 3LFHA 4F6LA 2ZB3A 1E9SA 2QMZA 2ZUUA 4FOPA 1Z75A 1KQOA 4PR3A 3T7DA 3THSA 4U1RA 3ONWA 3V00A 4HD8A 4D4KA 3JQ6A 4Q1AA 4WOJA 1VJGA 1BW9B 1SIOA 4FCTA 4LF4B 1YR9A 3A05A 2WM2A 1FFYA 2ZM6B 2C7VA 1UKCA 2L0XA 4P4TA 5BMVA 3CYFA 5BSFA 2IA5A 1VKNA 5CFRA 4WZAA 2DF8A 2X3FA 2RHWA 2ZRQA 4Q4JB 3QPVA 4ZVPA 3SS7X 2VQSA 4PX3A 1I9CA 5AUPB 4DR4B 2FFQA 2RB4A 3KAKA 3GMIA 3VPFA 1H9AA 2VRCA 4RTOA 1X0XA 3KD3A 1XVAA 3MAAC 3RSOA 4F8EA 3FOBA 2Q1YA 2Q5LA 1PF7E 1WXFA 2OCLA 2C9CA 4KSYA 4ZV9A 3ZE1B 4E5PA 3LS2A 4UTRA 4Q6WA 2NYUA 3AK4A 1CJTC 3M5WA 3DTVB 2NO6A 1OB2A 5FTKA 3MTDA 3PFNA 3DMYA 1QG6A 2H4FA 2FFHA 4BBJA 2CCJA 2FEWB 1X8JA 1QIHA 3WRVA 1WDKA 2Z9BA 3I2IA 4AY4A 2ANBA 2EARA 2I4LA 4Q15A 3STTA 1Q7EA 3MGCA 1AKYA 1OX4B 2BFAA 3TRFA 1USGA 1RWVA 3UTCA 1Q17A 1SBIA 3W3AH 3EIUA 2HSJA 2YHSA 2O0JA 1PJZA 1DUSA 1S3FA 2I7DA 4L27A 3ETEA 3OM0A 4F6RB 3KJEA 2ON6A 1SU8A 3OPYB 4I9HA 2HMAA 2FZVA 1ZRNA 2GVDC 3K09A 4JFAA 4ZAGA 2BM8A 3K0EA 4H7EA 5K8CA 2GTHA 1U1DA 3PD7A 4FFNA 2XAAA 2FZEA 2JGLA 1FNBA 4RA9B 4WPGA 2GAOA 4NJEA 4EY4A 1NG1A 2PX2A 3IDZA 3HHPA 3WKBA 3EW9A 1YUMA 3JQ8B 1D1QA 1U1GA 5I01A 3ETLA 3C6ZA 3SDSA 1TIKA 1FTYA 2ZITA 3QITA 1RC0A 3TZQA 3M7IA 4D4MA 1CP3A 3QQ5A 1GUYA 3MCWA 2CHEA 3NPMA 1PJRA 2Q5CA 4XOUA 4NCJA 4WD3A 1WXDA 4Q01A 1YVDA 4EYQA 1RZUA 2JK1A 1K7YA 4YRCA 3H5TA 3OPVA 1WU7A 1PJLA 2D5BA 1RYBA 2C9MA 1WLSA 5J47A 4DV0B 3O8DA 3W06A 1SXHA 4BFTA 1DAPA 2XMRA 4ZKDA 2VTBA 3GG9A 3PGKA 2Y1LA 3NTOA 4REOA 4EX7A 5B3KA 1XF1A 1M6HA 2WPDD 3SYTA 2QM8A 2FTKE 2P3SA 2Y0CA 1FOEB 2YXBA 5FULA 3PL1A 5AKEA 3QVTA 4I4IA 1Y81A 4DTIA 1SUAA 4ND8B 1ZH4A 1Y8QB 3MLBA 2P9FA 4KGZA 4CIYA 3AVPA 1QLJA 1NUPA 2WIDA 3HJFA 1YC5A 3DOOA 1HR0B 1IBSA 1OI2A 3H2KA 4XFDA 4E31A 3KEFA 1ZEMA 4Z9AA 5BSEA 5FWYB 5LQCA 4BASA 5GIPE 3QX9A 1PK7A 4TPKA 4TQUS 4PLPA 3EOAI 1YQUA 1ZEJA 5J23A 2AXEA 4QXAA 3DAYA 4V0QA 4BP9A 4E14A 4B6EA 3U0BA 3I8SA 4Y6OA 3T9AA 5IT5A 2DCMA 2WE7A 4B3IA 5KYXA 2FZ4A 1K5PA 4RIGA 3BD8A 4I3GA 2XQJA 1XQ9A 3VA7A 4TLCA 4ZFNA 2OCIA 5DNDA 2PRYA 1P4JA 1MKYA 1NVVR 2ZANA 4RVOA 4YRPA 1TJ4A 5FH9A 1TLTA 4QRHA 1O6FA 1MV5A 3P0HA 3M4ZA 4LHZA 1XCLA 3HA5A 1QIEA 3LDUA 3CRW1 2XIQA 2PGOA 4KVFA 4PY2A 3UKJA 4KZKA 3ZLUA 4CCYB 5F4ZA 1FFBA 4LYEA 3VBEA 4U5QA 1HORA 3T52A 4H1WA 3PD1A 1E2MA 2B30A 4Z7JA 3X3HA 3DT8A 4FOOA 1AKVA 4B6RA 4RVFA 1ECPA 3SSNA 2H31A 3K6SA 4RLQA 4D4LA 1N0UA 3ESCA 3OQBA 5C5EA 3I9FA 4C0SA 4QO8A 5T3UA 1G2OA 1VDMA 5KJFA 1ORWA 4YONB 3ZJ5A 4OQNA 1NW5A 4YJ2B 1EEHA 3CZ4A 4BGIA 1WZNA 3A4VA 3CS3A 1W2GA 2WZBA 3GUZA 3CE6A 2CD9A 3JPYA 2YOGA 1TECE 1ZUNA 1N9GA 3NBZC 3QELB 4HQFA 4YCBA 4BCCA 2P2NA 1XP8A 1T9HA 4O4IF 1SC9A 5H1YA 2E4WA 3VAAA 1JJIA 1BX0A 7GPBA 1V47A 1A8SA 4M60A 3CEJA 1N5DA 4M3NA 1L4FA 2AZMA 1RHUA 3RIYA 4A6DA 1TGVA 4BRUA 4D4HA 4X20B 3NT4A 3SN6A 4DA8A 1AKTA 4I4TB 1WABA 3A7EA 3QUSA 4KXQA 4MQFB 2H18A 1P5JA 4H4EA 1P9WA 4TTRA 2XMDA 2DJ5A 2JZCA 3F6CA 3MRXA 1V25A 4DPMA 2QLLA 5L51A 1T35A 2C5FA 3FYUC 2PT5A 4TS3A 3AERB 1SPBS 2Q1SA 3OLWA 4JEIA 3SR3A 2BY4A 3NATA 4G5FA 4UBJA 3GVIA 1JTVA 3I12A 3ZDDA 4R31A 4XJSA 4CLEA 5JMTA 1SCUB 5IKPA 3N3AC 3H9CA 4JDUA 4QDKA 4UNRA 1VRVA 4V0ME 1V26A 2B7BA 3UFBA 1KY2A 2IYAA 2BM0A 1H85A 4E4RA 1NXXA 3PVZA 1UKAA 1W47A 3T5GA 2ORED 4DCCA 2XQVA 3HU3A 1T8SA 1NW9B 3ZVNA 1AK1A 3UW1A 4CM4B 1US8A 4CZ2A 3X44A 4XIFA 3TW4A 3TZHA 4CDRA 4R8MA 1NM5C 4DCOA 2DSNA 3V34A 2I87A 3OETA 4TWRA 5I6DA 2O4UX 1NRXA 1QWOA 3DYIA 2BLLA 2C8VA 3EC1A 3K9GA 1S3IA 5JRDS 1BWSA 1XK7A 1O96A 3UWSA 1E79A 3H2JA 3CBGA 4DQUA 5KQLA 4J6FA 2ZSBA 3P26A 1HT1E 2H52A 1K6IA 1R4ZA 2X5JO 2J0UA 3ZC3A 1HQCA 4MP6A 1KY3A 1UJMA 3R7WA 4JP2A 1FVFA 3KPUA 2QN1A 3TRHA 1RP7A 2I8CA 3AEKA 1G64A 1GAQA 3ANMA 4KIJA 3JD0A 2AEFA 4HMQA 1BDBA 4IZ6A 2WWRA 5JNVA 1DWUA 3CF4A 2QMOA 3LO5A 2ZEJA 2X42A 3Q7PA 2HNBA 1UMDB 4JC4A 2AJTA 4Y18A 2LD4A 2EF0A 2PMDA 1I3MA 1NKSA 3UEOA 3UOAB 3S8EA 1GNSA 4HQ6A 3BRWA 1Z4OA 3CVXA 1NURA 1NONA 3LUGA 4LVUA 4GXRA 5BSTA 5A03A 2BZ1A 2PGXA 4WY2A 1FLAA 4YJFB 4PRLA 4K9QA 4DADA 5IKMA 2F8LA 5MF6A 4HWKA 3UK0A 3OJCA 3OQOA 1R74A 3GMTA 2B4AA 1V16B 5I5GA 3DV0B 4LXUA 4A8JB 1Y80A 3DKPA 4J0HA 3OAAD 4IVRA 1U9CA 4JX8A 4EI7A 2WEKA 2TECE 4CU2A 4XWOA 4C14A 3BWEA 3W05A 5DBGA 3W6UA 3O4FA 3IV9A 1C81A 1DAKA 2WNIA 4HWTA 4ZO4A 4AZVA 2G77B 5CFOA 3KFXA 3SNHA