2HK7A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with mercury at 2.5 angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
269
Chain Sequence
b'MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate dehydrogenase
molecule tags Oxidoreductase
source organism Aquifex aeolicus
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
total genus 83
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk7A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk7A01
5AXBA 3CMMA 1V6AA 4BQRA 1CQJA 1ZKMA 4Q3CA 2I3AA 2F00A 4EUHA 4AJEA 2ZIZA 3B20A 4ALLA 2G1UA 1SBYA 2YQ4A 3EHEA 2QQ5A 4JROA 4R5HA 2EJWA 1XKQA 4J9VA 4NBTA 1ISHA 1ONNA 2BFMA 1ZNQO 3SLGA 3AFNA 3QJ5A 5EESA 4EJ0A 3PP8A 4BKPA 1X0XA 3GEMA 5C3MA 4LRTB 4RQUA 3TZQA 2V6BA 2EHDA 2OUIA 3MJCA 3MTGA 2JCXA 2PKQP 3EYWA 4JX8A 4MOWA 2ZYGA 5F21A 1C0PA 3JQGB 1F06A 3F6YA 4BO2A 1B8VA 1Q0LA 4MVJM 2UV8A 5JY1A 1ONOA 1TI7A 4WE3A 3CTMA 4YAKA 5H83A 5JAIA 1HDOA 1E3JA 1U8FO 4TWRA 4PCVA 2VT3A 2R2GA 1Z6ZA 3L9WA 3ZW9A 3Q2KA 3CZMA 2IXAA 4G2NA 5BR7A 1PZFA 3PGXA 4FSHA 2HAEA 1XG5A 1VC2A 5G0UA 3EUWA 4CV0A 1RM5A 4MVJI 2C07A 2NQTA 3C85A 1YQXA 2FZWA 3DZHA 2C0CA 4R16A 3IAHA 3RROA 4BNXA 4OGWA 3ZV4A 1MB4A 2BKAA 1AXEA 1GADO 5DNAA 1R0SA 3H6KA 1H6AA 4RVGA 2DBRA 2B0JA 3D3WA 4MO2A 1T2AA 3UH1A 2ZTUA 2E48A 4XDZA 1QKIA 2FHSA 3DMTC 2DT5A 3GDFA 5G0VA 3P19A 1Y5MA 3FR8A 3O03A 1YBAA 4CLHA 2FRDA 4BNHA 1I01A 2Y1FA 3EGOA 3I4FA 4LVUA 4F6CA 3KHUA 3DZBA 4CUKA 3ZU3A 1NPTO 1JKJA 4U7WA 3Q3CA 1PQWA 4B4VA 3BHJA 4DTIA 1KEVA 1WPQA 3CEAA 3BMCB 3ITKA 1VKNA 3AM4A 3ZV3A 4E5YA 4A7PA 4UVGA 5IDQA 1MLDA 1YB1A 1F8GA 1CYDA 3CUKA 2GN9A 1NX6A 1TEHA 3GG9A 1P0FA 4MIOA 2V6MA 3CIFA 2VWQA 3PYXA 4NFHA 3IKTA 1NAHA 4EJMA 3BTOA 4F45A 4O0LA 1ZJYA 3RD5A 4MP6A 3SJ7A 3R3JA 1R0LA 1SMKA 1DEHA 3JQEA 4RGBA 4CM8B 2EW2A 3KYCA 2Q2VA 1V8BA 4UEOA 5AQ1A 5DN9A 3JD3A 5IN4A 4YAEA 5HS4A 3G3EA 3NTQA 1SOVA 2PZJA 4J2HA 3WX0A 3TF5A 5JAZA 3DC2A 2F1KA 2UUOA 5B37A 1GUFA 2EW8A 3H5NA 1BSVA 4L0QA 2E6UX 1H9AA 1MG0A 3PWZA 2VHWA 3MCVA 4NQZA 5IDWA 1Z73A 1CJCA 3VZSA 1PJBA 2ZYAA 2Y93A 2PWZA 1ISGA 4D41A 4CLOA 4WK6A 3I9KA 2WD7B 2C5EA 4GX5A 4FJ2A 3NT2A 4TRNA 1EFLA 2FWMX 3GVIA 4XQCA 2BELA 3GNSA 5HBRA 3GY0A 5ILOA 5AOVA 4A03A 3QQPA 5TGDA 1DFGA 1IE3A 2X58A 4UVIA 1LRJA 1WLYA 1ZUD1 3WQQA 2FSVA 3IP3A 2O7QA 2PFGA 3ZU5A 1ORRA 3TZHA 3E8XA 1LDYA 1U2GA 1IZ0A 1ONPA 5T64A 1S7CA 3WIDA 3QWBA 5DDIP 1R4NA 1SB8A 3N7UA 1WW8A 1BDMA 4CM4B 3ROMA 4D3DA 1A71A 5DOVA 3DO5A 3Q11A 2VYND 1UR5A 3E5RA 3W1VA 4OAQA 3A1NA 5TT1A 1OAAA 1OI7A 1HXHA 4C4OA 3VPGA 4MVJA 2X8LA 3E18A 3AU9A 4ZD6A 3I23A 1DLIA 3PQFA 4J7CA 4U6SA 5JC1A 4E2WA 1K3TA 4IS3A 5JNLA 2POQX 5IJZA 4TZKA 1LTHR 1VSVA 3ZWBA 1TT5A 4DRYA 2GZ1A 3HZZA 1Z7EA 3DQPA 1LSOA 2O3RA 1Y8RA 3D7LA 4N5LA 5CPBA 3AUUA 4BNUA 4UVHA 1D1SA 1NNUA 1C3VA 4ITUA 2WWRA 1OFGA 4N54A 2WD7A 4E32A 1XEAA 4ZHSA 5JYEA 4YPOA 3P7MA 2PH3A 3NDIA 4XCVA 4CQMD 3IS3A 2AQHA 4KOAA 4S3MA 3ZNPA 1BMDA 1E3WA 4OMUA 5CHEA 4U8GA 3JQFC 5JDCC 1LLQA 3NJ8A 3WOHA 3ZWNA 1PR3A 3AWDA 1YO6A 8ADHA 1GV1A 2P2SA 2Q1WA 2R00C 2YW9A 1U8XX 1DC5A 3T4EA 5TNXA 3SLKA 4DQVA 1UAYA 4N7RA 3RI3A 3GHHA 4JQCA 3RUAA 5A9RA 3W6UA 1D1TA 5A3VA 1D4FA 4Z9YA 1NVGA 5KJEA 1EMDA 4XIYA 4H16A 1ISJA 4QSMA 1KERA 4CLDA 2ILTA 1EQ2A 5L9AA 3WSVA 3PWKA 4OL9A 4ZRMA 1Z7BA 5T8KC 3GG2A 5CFZA 5F1KA 1VRWA 4KDFA 1ULUA 4XDYA 4FFOA 1NQOA 4BNZA 5B1YA 1MXFA 4QTZA 1P45A 5G4KA 1UDCA 4GAEA 5A02A 3PHLA 3JQAB 4E6PA 1B8PA 3TRIA 4GX0A 3LT0A 4GX1A 3NYWA 3I6QA 2W98A 4PIVA 1YDEA 4FOSA 4NJMB 2GYYA 3ULKA 3TDKA 3UCFA 1DIHA 2CFCA 2VHYA 1LX6A 2HMWA 5KVSA 4UAGA 3TFQA 1GPJA 2OP0A 2ZB7A 3L77A 4JLWA 1C1DA 1ZSVA 1EVJA 1R66A 2A4KA 4M54A 2NACA 1A9ZA 3FNEA 2E82A 4JJGA 4PZDA 5ER6A 1JTVA 3IJPA 1U9JA 1NQ5A 2D59A 4BMVA 2GO1A 3LYLA 3OQ1A 2NVUB 3QVXA 1DDOA 3PGJA 2YQ5A 5KJ6A 5ILGA 1N5DA 4YJGA 2VUTA 3JQFA 4DUPA 1HEUA 1LDEA 1GR0A 1AN9A 3KB6A 1NVTA 3V1YA 4RF4A 3GF4A 2ET6A 3NGLA 1LUAA 4B7CA 4DLBA 1EUDA 5EL0A 2GASA 3GRPA 3GGGA 4II3A 1I3NA 4DLLA 3UCEA 1JQBA 4KUGA 3NAQA 2NM0A 1RM0A 3C1AA 3VDRA 3NEPX 3RJ9A 1MG5A 1QV6A 1R4MB 3BXXA 3IMFA 4BO9A 1K0UA 3GPDG 1PGNA 4BOYA 5ENVA 3PDJA 5ENDA 5EERA 1ZW1A 1Z45A 5JLAA 3IUSA 1RM3A 1GEGA 3PQEA 2Y1DA 3F46A 4NMHA 1GD1O 1R37A 3I5MA 3GEDA 1V3TA 2CVQA 4YBZA 4EYEA 4D0SA 1OOEA 3QRWA 1A7KA 4WLUA 3AOEA 2YFHA 3SEFA 4BO7A 4OJNA 2FR0A 2NTVA 4IDGA 2GSDA 3G79A 4A2CA 1Y81A 2PGDA 2D5AA 4MPDA 3HFGA 3IQDB 5JCJA 1U1IA 2W4QA 1M67A 1PTJA 3AI1A 1YBVA 3AM3A 4Y9DA 4IXTA 4YA6A 5CAEA 2D3TA 3CSDA 2QYSA 3PHHA 1HE2A 3DBHB 4NBWA 4NFYA 1KY5A 4OO3A 2OFPA 2JFGA 2JHFA 4FN4A 1TT7A 3NDRA 3ON5A 4K1LA 1EDZA 4WLFA 5COBA 5TIIA 2CDCA 3ANNA 3WYBA 4I5GA 3KEOA 1QYVA 4ZQFA 1YQDA 2D1YA 3DBLA 4FOOA 3VPHA 1ZO8A 5HWSA 1AHIA 5L95A 2Y99A 4PLPA 4CR6A 1SB9A 4BKRA 4CMIA 5C7OO 4R1SA 3MZ0A 4CMBA 1LU9A 1Y8QB 1MFPA 1GFSA 2WE8A 3QWIA 4NHEA 2DPHA 4IIVA 3C1TA 4R9SA 1R12A 4N5MA 2ZB4A 4P4NA 5ICMA 3GNQA 4XA8A 5JC8A 4P4GA 1C0LA 3JYQA 3TFOA 1Q0QA 4J1TA 4BMNA 4KQWA 1Q2XA 3LT4A 1DIGA 4FFMA 4CV1A 4XRRA 4CMKA 4DC1A 4RZHA 4NDNE 3VH4A 1GPDG 2AQKA 4CMJA 4FFNA 1PJLA 5AXAA 2W2KA 1B0AA 3VVBA 1DRUA 1J4AA 4O63O 2C82A 3OMLA 1ADCA 1I8TA 3AOEC 3TPCA 4BO8A 4BO4A 2AXQA 3UUWA 1KC3A 4L73A 1M76A 4R3NA 1I24A 4WGGA 3C24A 3WGHA 2IRWA 5A3JA 5EQFA 3D64A 1ID1A 1P44A 2SCUA 1ZVMA 2GD1O 3NGXA 4IDEA 4F6LA 5BSEA 5L4LA 2Y1GA 5THKA 5C5IA 2CDAA 2NTNA 2V7PA 2NWQA 3K31A 2Q50A 5TS3A 4OXNA 3ZWPA 1YJ8A 5KJFA 3ONDA 1IY8A 1VL6A 4NI5A 1LSUA 2AA3A 1LDNA 5CP8A 1R6DA 1R15A 2NQ8A 3CPSA 5GZ6A 1WVGA 2O4UX 4XYLA 3VZQA 5EINA 4NZ9A 3PRJA 1UZNA 4CM9D 1UUFA 4R68A 2Q46A 1DHTA 3H65A 1O89A 2CF6A 5CEEA 3JYNA 4ZGWA 4FJ0A 4DWVA 3EDMA 4PGFA 2Y1CA 4W7IA 1P1RA 3CINA 2FY8A 4RPJA 1H6BA 1HL3A 2ZQZA 3KEQA 4TSKA 3GN1A 4GH5A 1C14A 3INGA 2Z1NA 2BMAA 4AJPA 3ZNNA 4CM4A 4XYMA 3GAZA 3INRA 2G17A 1ISMA 4HUJA 4MIEA 3ZU2A 4IQ0A 2HK8A 2ZB3A 2P9CA 1F17A 1DLJA 3PPIA 3WMXA 3ZH2A 1E77A 5DBGA 1GTMA 2GNAA 4IDDA 4ZU3A 4QUKA 1P0CA 3INTA 3WDSA 1E3LA 1H2HA 1PJQA 4JIGA 2QX7A 4BNKA 5T67A 3KSDO 1V9LA 3K30A 3TNLA 2WYUA 1DSSG 4BNWA 3L4BA 4CM3A 3G17A 1N8KA 4GGOA 5JAMA 1AGNA 3I83A 5IF3A 1UJMA 3UOGA 4YDRA 1EE9A 3EZYA 4Z0PA 4DXHA 1MP0A 3DZIA 4PLTA 5I7SA 4CPDA 2X9NA 5EMHA 4L76A 3QVSA 1LA2A 1PGOA 1Z82A 3BTSA 5MDHA 1XU7A 1M75A 2O3QA 4YRBA 3OIDA 4AICA 3GR6A 1UXJA 2VOJA 3JQBC 4XJSA 1O95A 1J0XO 2PGJA 2PY6A 4QXMA 1NPYA 4GL4A 2AEJA 2DUUA 3WGOA 5FI5A 5L45A 4K6FA 1R4MA 3HUDA 1RM4A 2HLPA 3R3SA 1KVQA 2QRKA 3U4HA 1R0KA 5A9TA 4Y6SA 2AEFA 1H93A 3GVCA 5KIAA 1V3VA 3QLJA 4FB5A 3RC2A 1MA0A 1HLDA 1ADGA 5H81A 4D44A 2NV6A 3P2OA 3OEYA 1J49A 3PHJA 3GFGA 4UUNA 1JWAB 1PX0A 1KS9A 2BFAA 4KTTE 1ISFA 5F5NA 4DREA 1ENYA 3KBOA 4KDEA 2C7GA 4EUEA 3DOOA 3OA2A 5A5FA 1PEDA 3NKLA 1U3TA 1OMOA 2NU8A 2O3JA 4IINA 1YGYA 3PI7A 4L4RA 1EBUA 1LC0A 2YDYA 1DFIA 1E1MA 1NHWA 3RIHA 2FR1A 3DFZA 4UUOA 1N7HA 2BI7A 1DJNA 1GY8A 1H6CA 1U2DA 3UF0A 3AM5A 3E1KA 2NNLD 4Q3BA 3QWHA 2I6TA 1PJTA 4PZCA 4FC6A 3U4DA 3MJTA 4GQAA 4O5OA 1HDXA 1NVMB 4J7XA 4R51A 2J5KA 5IFLA 4QECA 4ALJA 4AVYA 1PIWA 4GLLA 1G1AA 1JN0A 3LK7A 2HU2A 2H63A 4E30A 3PFWO 2E37A 3WBBA 2OHXA 4U5QA 4JBGA 1NXQA 4OH1A 4H7PA 2FPPA 1FF9A 2C20A 3E5MA 6ADHA 4A73A 3O8QB 4CL8A 2PD4A 3HWRA 1ENZA 3PLRA 1IPEA 2W90A 1K2WA 3W6ZA 1YL6A 4XQGA 3O8QA 4OXYA 5G0WA 3KYDB 2EGGA 1LRKA 4DIBA 4XB2A 3PHGA 3AU8A 1P9LA 2I76A 4PLVA 3K6JA 4W9NA 3UHAA 7MDHA 1PJCA 5HRUA 3ASUA 5JO9A 1D8AA 2C2YA 3PLNA 5HA5A 5CEJA 4Z3DA 4PLZA 1NP3A 3EY4A 3L6OO 3NUGA 3G1UA 2Q1SA 3QWAA 2DAPA 2JD1A 4RLSA 4XX0A 2B37A 3DR3A 1SNYA 3VKUA 4OSOA 2A35A 3NJ4A 3ORFA 1BXKA 1HF3A 4HFNA 3RFXA 1EFKA 3QY9A 4TMFA 4LK3A 5BNTA 3ZHBA 4J1NA 2VYNA 2YDXA 9LDTA 1WWKA 1X14A 2NTJA 1LLCA 3U4IA 2O3SA 3RASA 5IAAA 4XGNA 3QIVA 1XQ1A 2E4AA 1FJHA 5DT9A 5I8ZA 3RBXA 4F3YA 3EMKA 1KYQA 2NADA 2YV3A 4R01A 4YRDA 4CLOB 3DAFA 4GLOA 3VPXA 1UZMA 1LDGA 1W8DA 3CKYA 3H3JA 4AJLA 1HSZA 1LLDA 1V35A 3WICA 5L7TA 3C7AA 2D8AA 1JDJA 2PD6A 3HJAA 1JVBA 3ZV6A 3KSUA 3RBVA 2BGKA 3FI9A 4OXKA 1PL8A 1Y5RA 2VZ8A 2I67A 3W8EA 3MEQA 1QYDA 3M2PA 3TJRA 3U5TA 2OMEA 1UDBA 4CODB 5L53A 1O9BA 1ZSYA 1GYRA 2BD0A 1PWZA 3RJ5A 3EVNA 4UREA 1QXSA 5FEUA 4KQXA 5CDUA 1W6UA 5TLSA 1XA0A 4Z9XA 3STHA 2B5VA 3KLPX 2IYPA 3VH1A 2O2SA 4J0FA 4L4XA 4BQPA 2W8ZA 4CQMA 3ETGA 2X7HA 4K26A 1JLLA 4E4YA 5AYVA 1WZEA 1YDWA 3VZPA 4A10A 2B35A 3LF2A 2VWGA 4XGKA 1LNQA 2P5UA 3H9QA 4B3IA 5B4UA 2WE7A 4D0RA 2HRBA 1W4ZA 3B1KA 3MOGA 1KBZA 3DXFA 4ALMA 3ZWYA 3A9WA 2WTBA 1IYZA 1HWYA 1N92A 1LQTA 4FFRA 4LCJA 5DCWA 1AE1A 3CE6A 1T1SA 4PG5A 4R3WA 4GI2A 4TQGA 5L7WA 1NTOA 3A06A 3C7DB 4YT8A 2NLOA 1U7TA 3FR7A 4BO0A 4BKOA 2FN7A 3OFSA 5B4TA 2X1HA 2DBQA 4JBHA 1F12A 4DPKA 1MGOA 3M6IA 3ZNQA 4K28A 3G0OA 1BW9A 1UZLA 3D5QA 5BNIA 2NU6A 3RVDA 3HN7A 2HDHA 3GA0A 1DOHA 3ITDA 1P1IA 5MGBA 5A04A 4UULA 5HM8A 1A5ZA 4NFSA 4EW6A 1XGKA 4TKLA 5L40A 3WIEA 3HHPA 1EVIA 2I66A 4Y6RA 1KC1A 4ZVVA 3O38A 4ND1A 3O4RA 3RU7A 3VC7A 2H6EA 1PS9A 2HJSA 2HMVA 4J0EA 4TRRA 1VE9A 3GMSA 4CM1A 4OOFA 3WXBA 1HTBA 2PGLA 3Q2IA 3EW7A 3PWSA 1M66A 4DVJA 2XAAA 1EUCA 3FBTA 3H7AA 3TN7A 5TF4A 4WJZA 1PL7A 3GEGA 3B70A 4I5DA 3OJFA 3D0OA 3SC6A 4YJFB 1JKFA 3L6DA 4IY1A 1E7WA 1SCUA 2GUGA 4W4TA 1B7GO 2Y66A 4TZTA 1XDWA 2EKQA 2HO5A 2B69A 2DQ4A 3CZRA 2EG9A 2V6GA 1DFHA 4FS3A 4KWIA 4NJOA 1PSDA 3FCOA 3NV9A 2H9IA 1I10A 3AK4A 5I8WA 1B3RA 2BHLA 3NDJA 3WG9A 3K8ZA 2IE0A 3BZUA 2EEZA 4AJOA 3H9GA 3QVOA 2P9GA 1GYQA 3TOXA 4FCCA 3PHIA 3RUIA 4IDBA 2VNSA 4AJ4A 3G49A 1HZZA 2Z95A 1GZ6A 1X7DA 3I6IA 5KTKA 4DPMA 5AXCA 3MJEA 4R41A 4ID9A 4IMPA 5C7IO 1GUZA 2YJZA 4AFNA 1UXGA 3ZV5A 2J5QA 2D4AA 4CLXA 4BS9A 3KTDA 4KUHA 2GZ2A 4YAIA 4ALIA 2YHUA 4NIMA 4ZQGA 3WGTA 1E7YA 1A72A 1H0KA 4I9NA 3H2SA 2DU8A 3DBRB 5BSHA 3RSHA 3BHMA 4WLEA 2WEKA 3GNTA 2PZLA 4RVDA 3ZWWA 1I0ZA 4NK5A 3ZWAA 5DULA 5KCZA 3TL3A 4J4TA 5BNFA 4DIFA 2EKPA 1E6EA 3WB9A 4BKUA 4EGFA 2OO5A 3RBZA 4GBJA 1IZ9A 1CF2O 3OIGA 4ZN6A 1QMGA 2VWPA 4FJ1A 1RWBA 4G81A 5FI3A 3ZWOA 1DIRA 2RBEA 4IUYA 4RDHA 1HE5A 3VPSA 3B1FA 2JKVA 1GUYA 1HRDA 3CH6A 2GDZA 1MC4A 3LLSA 5BSGA 2AQIA 1E1LA 2VOEA 5DBIA 2W2KB 2B36A 4A5OA 1A4UA 3S8MA 2DC1A 2QIOA 1ADFA 2G0TA 4XB1A 1NM5A 4KZPA 4QX6A 3U49A 1WXDA 1YQGA 2VHXA 3JQDA 2EKLA 2V6FA 3F1KA 2I99A 4RCVA 5KJ1A 3FNHA 5LDHA 1E1KA 4RF5A 5KVVA 1PWXA 3OQ6A 4YJHB 4RPHA 4FW8A 4LMRA 1H6DA 1I2BA 3GVXA 3GVHA 1PL6A 3OJEA 2VYVD 2GR9A 2CUKA 4CL3A 1F0YA 1LLUA 3N58A 5CPFA 1RJWA 1MUUA 1I3MA 3VDQA 1G0OA 2I9PA 4M87A 1LI4A 3N74A 3RUCA 4BKQA 3E6AA 4J91A 3I9LA 1DIBA 4XQEA 1YB5A 3AI2A 3P5SA 3I3OA 3RC1A 5FWNA 1LRLA 3M2TA 4RVHA 3HADA 1NAIA 4RF3A 1YXMA 4B7XA 1NR7A 2CY0A 1E3EA 3PZRA 3WGYA 2R00A 4I5EA 1X13A 3D5TA 2FMUA 3QV1A 3S55A 5KNLA 2OL4A 3CMCO 2YV2A 5U1PA 3ENNA 1G0NA 2PD3A 3JD4A 1HDYA 2HSDA 1EVYA 4RVSA 4DLAA 4HBGA 3PFFA 4TRJA 4ND4A 3Q1LA 5ADHA 4HADA 4E0BA 1I3LA 4GKBA 3JD2A 4XYBA 4HY3A 5T8KA 1B26A 1LDBA 1R4NB 1PU2A 3BYZA 3WWZA 3ETEA 3V2UA 3WNQA 1T24A 3PVZA 4PLWA 4ND3A 3D4OA 3HDYA 5T6BA 4B79A 2ZCVA 1DC4A 3OECA 1ADBA 3U0BA 3I1JA 3BMNB 4BGVA 4Z0TA 1HT0A 5TSDA 1LJ8A 4BNTA 2DM6A 3JQAD 3GZNA 3I4CA 4AJNA 4W7HA 4GMFA 3W4JA 4DBVO 2A94A 4L8VA 4ROSA 1ZIDA 1BXGB 5JCJD 3OH8A 4ALNA 4R1NA 4B4WA 1JA9A 4BO1A 3RUEA 1T2CA 4IPTA 4XYGA 3R6DA 2RAFA 1YOVB 4ZRNA 1EK6A 3UKOA 4BVAA 4BGIA 4FQ8A 2GERA 3UAGA 3SBOA 4IBOA 4XR9A 3Q9UA 1LSJA 4YRAA 3WMWA 3DBHA 4ILKA 4ALKA 4EZBA 1XQ6A 1KIFA 1Q7BA 1YKFA 5DP2A 2G5CA 3GOHA 5A1TA 2ZCUA 3OBBA 4GMGA 3COSA 1H94A 2JHGA 4I9HA 4J49A 1YBMA 2X86A 3WJ7A 1Q0HA 2CZCA 5K9ZA 5F3RA 3ZZNA 2X4GA 4CMGA 3DTTA 3GLQA 4MVJD 3KRTA 3F3SA 4EJ6A 5DOZA 3FN4A 4BO3A 4RPLA 5BSFA 4QEDA 2PNFA 4FBGA 3PXXA 3DZKA 1HE4A 2FR8A 1IHXA 3OF2A 1QORA 1U3WA 3K2BA 4L9RA 3V2GA 3JD0A 4M8SA 4PLYA 3PYMA 2UAGA 4RDIA 4BO5A 2ZYDA 5ITWA 3K5PA 3E82A 4XRGA 4IIUA 4BIIA 2EXXA 3Q9NA 2I65A 4CLRB 2Z5LA 2DTDA 2ZJ1A 3W4KA 1HDRA 4WCFB 4Y67A 4LW8A 3ROQA 2HMTA 3EAGA 4YWJA 1U5AA 4AG3A 4I1IA 5HTOA 4HXYA 4W6ZA 2FPIA 4S1VA 3S2FA 1K89A 3PEFA 1FDSA 3C3XA 2C59A 4C7KA 2GPTA 2WDZA 4XKJA 2EV9A 1X0VA 3JQ9A 3WWYA 4CMHA 2PLAA 3ZN2A 3JSAA 3HDJA 4CMEA 4YYZA 4R4JA 3U09A 3D3WB 3G1TA 2ZTLA 1Y6JA 3FF4A 4M49A 5IN5A 3HDQA 3SXPA 3H4VA 3B6ZA 5EJ2A 4FD3A 4JBIA 1C1DB 2BI8A 2QRLA 4FFLA 3WFIA 1O5IA 1EZ4A 3KM0A 1Y9AA 4DBZA 2VCYA 4J2OA 4NPCA 3GAFA 3KZVA 1E7SA 7ADHA 1CDOA 2GGSA 4WNCA 1MV8A 2YV1A 3DBRA 5IDXA 4K9DA 4YJDA 2GN8A 5ER9A 2NU9A 4J4HA 3DOJA 5JDIC 2FPGA 1KY4A 1P1JA 1VKOA 3F4LA 4WLVA 3ZU4A 1N2SA 3ZI0A 1FDTA 2EP7A 2IODA 4TVBA 2WMDA 2FOIA 4DIOA 1CIVA 3VZRA 3AFMA 4RJTA 5DP1A 2Y0DA 1X1TA 5G0TA 5LC1A 4DC0A 1WMBA 1UP6A 4E2YA 1SO8A 1LBEA 5KKAA 4PG4A 4WOJA 3EK2A 4PVDA 2DFDA 2AW5A 1ML3A 2IEBA 3ROKA 4MP3A 2CNBA 4HP8A 4Z9FA 2EIHA 1N1EA 4J6FA 2PA3A 3PJGA 4JGBA 3V5NA 2HRZA 4P22A 1E6WA 5U4QA 2Y1EA 1IOLA 1Q1NA 2PKRA 5DF1A 5IDYA 3WGGA 3I9JA 4IM7A 3DTYA 4BGUA 5J23A 3U4CA 4WKGA 3GZ4A 1GZ3A 1JAYA 4FFPA 2JL1A 4MKZA 3GGPA 3HB5X 3V8BA 4DYDA 3KXDA 2JCVA 3D1LA 3JQ9C 4NJMA 1WDKA 3WNVA 3QVTA 4GWGA 4CMEC 1N9GA 1LXCA 1E92A 1KVRA 4J16A 4DL9A 4RV9A 4ND5A 3I52A 1KEUA 4UUMA 3DZGA 4CJXA 5TQVA 2EGHA 3AY3A 4R1TA 3JQCA 2Y0EA 1DAOA 2OXIA 3NT4A 4ZA2A 1C1XB 1GDHA 2JJYA 2CD9A 4GWKA 4H3VA 4RORA 3FTPA 1J6UA 1I32A 4JXKA 1MX3A 2PK3A 1FDVA 3TZCA 1ZK1A 2H1SA 4WPGA 4BL5A 2VZ9A 2X22A 1TLTA 1I36A 5KJCA 1IULA 5DBFA 1S6YA 5JDIA 4OQZA 2CMDA 3TSCA 4OHUA 1ZXLA 4B7UA 3ONEA 4B4UA 3K73O 3WFJA 4C7JA 3FRJA 4Z3KA 2IEDA 4P8RA 5A5EA 2Q45A 4IDAA 2PZMA 1GL3A 3QA9A 4IDCA 1KOLA 1AUPA 4HKTA 3I9OA 5CDTA 2DBZA 3FWNA 5TX7A 5JW6A 3GVPA 3RFVA 3WGIA 4GVLA 4YXFA 3E48A 2RHRA 4BO6A 1X7GA 1U3UA 3HE3A 3Q0EA 4QFCA 4Q3NA 5TT0A 3U3XA 5G2OA 4IQGA 5KVQA 4YB8A 3SC4A 1G6KA 2XXBA 4CQLB 4KUEA 4YVFA 4CV2A 1DXYA 4E3ZA 2E49A 1K6XA 3UXYA 4Z0HO 4E2XA 5HS6A 2TMDA 2ZB8A 4LGVA 3OETA 3GFBA 1L7DA 3JQGA 4XIJA 1ZXBA 3KO8A 5C7LO 2HQ1A 3JQBA 2C7VA 3DBVO 3NT5A 1DC3A 3VOSA 2JFHA 3QP9A 5JO0A 3IUPA 1VL8A 3TZ6A 1B15A 2PR2A 4D7AA 1WZIA 3WYEA 1MFZA 2XF8A 4YTEA 1UXHA 2Y0CA 1GQQA 1QRRA 1CWUA 3ICCA 4HFJA 4N5NA 4YQZA 3PIIA 5JCXA 3LU1A 3S2EA 2AG5A 2DPGA 3VH2A 4D46A 4DPLA 3ASVA 2C5AA 4AJKA 4UEJA 3RC9A 5KOIA 3ROPA 3ADPA 3WLEA 1U4SA 3ZHYA 4W99A 2X0JA 3PIDA 2YYYA 4BHTA 3K92A 5I9LA 3RKRA 2Y67A 2EF1A 1PZGA 1LC3A 1RYDA 1I2ZA 3HDHA 1KEWA 1F8FA 4RO0A 1O6ZA 3ANMA 2DTXA 3BMQA 5A4DA 1P1KA 3JCZA 3LT1A 4RQTA 1PQPA 4E5PA 1PJSA 5EQDA 5L7YA 2Q4EA 1O0SA 4ZQHA 4BB5A 4E33A 1YH3A 3JQAA 5EN4A 2OBYA 1YS4A 1P74A 2HMUA 3UCXA 2HJRA 1NQAO 1IL0A 1T2EA 2ZTMA 2ZQYA 4TVOA 5K6AA 3LVFO 5JPIA 1QYCA 3FD8A 1FDWA 3NRCA 5DCUA 5JMPA 4KMSA 3X2FA 4D3FA 2Y68A 2FSSA 3PJFA 4Q39A 2O23A 4LCEA 2C2XA 1KVUA 3BAZA 2C29D 2X0RA 4WEOA 1ARZA 2UYYA 3NTRA 3IDSA 3FPCA 3F5SA 1FXSA 3E9NA 1BDBA 3RWBA 3FWZA 4YEDA 4CUZA 5L51A 1PS8A 4MVJH 5GY7A 2OGUA 5FFFA 3RQSA 1KVSA 2J5RA 1ZMTA 4NH4A 4RZIA 1E3IA 3K9QO 4XJTA 1EQUA 5DZSA 1YB4A 3ZHXA 4X54A 5TRTA 1YONA 4INAA 3KYCB 3WS7A 1U7HA 4J43A 4E13A 1YL7A 1NQTA 2VNAA 3MJVA 5ICSA 1E5LA 3RFTA 1M2WA 4FC7A 1DO8A 2Y1OA 2DUWA 3AUAA 5I9NA 3I9NA 3IKVA 3ZW8A 2H5LA 1XYGA 2O2YA 3PDUA 1NYTA 1HETA 1P31A 3JQ8B 3W8DA 3L0DA 3DHYA 2UVDA 2JFFA 5GMOA 3BMNA 3EVTA 4MVJG 3ZWCA 2YFQA 2NSDA 4HV4A 5CDYA 3UGKA 4OKNA 2D0IA 2LDXA 3DOCA 5KVCA 1V3UA 1ZCJA 3TL2A 1NHGA 3VTZA 4EITA 4DYVA 4AJ2A 4PG8A 2HMSA 2DBVO 4CR7A 4IZIA 5CEFA 3WSWA 4ZQEA 3GN2A 1L1FA 5GZ1A 3F4BA 2YHIA 4QQRA 1K6IA 4L4SA 3I9MA 1B14A 2VHZA 3OJ0A 3JYOA 3DMTA 5JS6A 1YRLA 2P91A 5B4VA 1LDMA 3OJLA 3IC5A 3EZLA 5K6AC 2X5JO 4RF2A 2IYOA 2NU7A 1TB4A 2Q2QA 4M1QA 3JQ7A 3JYLA 3OSUA 3ZWMA 3RC7A 2RH4A 1E7MA 2G76A 2IZ1A 2O50A 3DDNA 1D3AA 4LMPA 5LCXA 3WJAA 3FNGA 1JWBB 4QFDA 2NUAA 4NK4A 1C1XA 1PJ4A 1E3SA 4GSKA 1DAPA 1AXGA 3KYBA 1ZK2A 5G0SA 5AXDA 1OBFO 3C1OA 1HDZA 4TKMA 1B16A 2NVWA 5CG2A 3V2HA 3FSRA 1I3KA 3SVTA 1CEQA 2X0IA 1DRVA 2X9GA 2X5OA 3GUCA 4PN3A 1R16A 2AQ8A 1BVRA 2D5CA 3PQDA 1A9YA 3ZHZA 1JKIA 3H3FA 3GT0A 1Y9EA 2XOXA 2O4CA 3QWFA 5K0ZA 4WECA 1WNTA 2B4RO 4IGEA 3QE3A 4CM6A 1B8UA 3JYPA 4ESOA 4YR9A 1U3VA 4LSMA 3WGQA 4BMSA 3F1LA 4OSPA 3A28A 3H5AA 1XU9A 3F47A 4OIMA 1EK5A 1GV0A 1U5CA 2Q2WA 1E0DA 2X0NA 4HWKA 3WQRA 4YT5A 3DMYA 1UP7A 2WM3A 3T4XA 2ZK7A 4IQ8A 1PQUA 4YJFA 3F9IA 2WYVA 5B12A 3UFXA 5KKCA 1HLPA 3DEYX 3KVOA 4TROA 4YQYA 4R1UA 2BF7A 3TWOA 4MP8A 3K2EA 1HYEA 4A26A 1HSOA 3LC1O 1E6UA 5IZ4A 1Y7TA 4YT4A 2JCYA 3MOIA 3OP4A 3HSKA 4CM9A 2J8ZA 4DQUA 3DHNA 4WOKA 4RLHA 1WMAA 3ST7A 1ISIA 1BG6A 3TOZA 2EP5A 4B8ZA 4BV8A 1JVSA 4W82A 3MTJA 3PYLA 2A92A 4I08A 1W73A 4DA9A 4E21A 2IDZA 2Q1UA 1E7QA 1T4BA 4NBRA 1E1NA 3V1UA 4J1QA 3S2IA 1WDLA 5F1OA 3OHSX 3LT2A 1JU9A 2GCGA 4AL4A 1PJ2A 2TMGA 2XPCA 4KTVE 3D3EA 3OIFA 1UP4A 1XCBA 5G4LA 4CM8A 4F46A 2X9VA 1QV7A 4XQ9A 1M6WA 3AY7A 1QYWA 2AE2A 2DKNA 4NG5A 5ES3A 2AMFA 4MVJE 4U0KA 4K6CA 3KYDA 1UXIA 4UVDA 2OZPA 3LLVA 3ANLA 2O3TA 1PS0A 4E12A 5L4NA 2VT2A 3V1TC 3ZNOA 3DFUA 5G4KB 3GC6A 3GK3A 4GPD1 4DMMA 3O9ZA 2QZZA 4FGWA 2YY7A 3D4NA 3P2YA 6LDHA 1TVEA 4U6QA 4CMCA 3C8MA 4Q9NA 3ZGYA 1RYEA 3NTOA 5JY6A 1HE3A 3GPIA 4WASA 4J9UE 4WCFC 1NBOA 5JMWA 4IJWA 5LDGA 3FHLA 1I5RA 2GLXA 5A9SA 2J3IA 2BH9A 4AJIA 4OYRA 4XD2A 1ULSA 1ZFNA 4PLGA 1WDMA 4A27A 3M1AA 3UN1A 2QYTA 1F14A 1PGJA 2X6TA 1B2LA 5CDGA 3VVCA 2CF5A 4GX2A 2ZATA 3BHIA 3F5QA 4HNGA 2W2LD 5IZCC 1HKUA 4E2ZA 4R5MA 2ZKLA 3JD1A 3U62A 2O3UA 3RKUA 4D3SA 4WNIA 2R6JA 3GQVA 1ZBQA 3E9QA 3RUDA 3HG7A 1UH5A 4JJIA 1LQUA 4WUVA 3ABIA 3O26A 4LN1A 1Y8QA 2O48X 3RUFA 4O6VA 3GUYA 5JDCA 4XR4A 4ND2A 3VTFA 1RPNA 1VSUA 3BMCA 4ONEA 3L6EA 4AJ1A 2FZEA 1MXHA 5JE8A 1J5PA 5L3ZA 1YL5A 2VUUA 4IJVA 4IXWA 5BT9A 2EJVA 1UXKA 2HCTA 2GRAA 4FGSA 2B4TO 1YWGO 4MDHA 4I5FA 4R54A 4UUPA 5T5QA 1HYHA 3WTBA 2PTGA 1WP4A 1OC2A 3HNPA 1CRWG 5COQA 4BNLA 4MJLA 2P9EA 1Q7GA 4UVEA 4URFA 4EEZA 5I7FA 9LDBA 3DZJA 3D4PA 4Z6KA 5AVOA 4XEHA 3OM9A 3K96A 3TZKA 5TJHA 1DC6A 3KV3O 3GHYA 3EC7A 3KETA 4FDAA 3H9UA 2FP4A 3GRKA 4BGEA 3LSYA 3L07A 2YHIB 2AE1A 2B4QA 5H82A 4JJFA 4WCFA 1Y8RB 3FBGA 3NX4A 1V0JA 3A14A 3BMOB 2I3GA 2VTDA 3FTNA 1VLLA 1I33A 1XELA 1NR1A 4AJHA 3RCBA 1Z74A 4FPXA 2CVZA 1RKXA 1SOWA 3ETDA 4XZ3A 1T4DA 5JAQA 3DBLB 2YUTA 4DGSA 1T2FA 3QSGA 5JXWA 4CMIB 4JK3A 2GF2A 5A05A 8LDHA 1N9GB 1EVZA 5IZCA 1ZSNA 2VWHA 3DAGA 4CV3A 2NVUA 4ZICA 4I8XA 3BA1A 3JQ7B 5CDSA 2DLDA 1DB3A 1QP8A 4U0JA 1BGVA 4HFRA 4E5MA 2NVBA 5GZ3A 4YJGB 4BNYA 3OA0A 4BNVA 2HK9A 3U9LA 4WCDA 3LQFA 5F5LA 3RAJA 2OORA 1IPFA 3H9EO 2IXBA 4IJUA 3LZ6A 1Q7CA 1W0CA 4Q3AA 4EUFA 1OZAA 4CLEA 3QVWA 4PLHA 4B3HA 2V65A 3VKVA 2BGLA 4PLCA 4J3FA 2IZ0A 2D2IA 1SEPA 3L9XA 4JP2A 4NNJA 4EBFA 1B3BA 1VI2A 2I5PO 1ENOA 4O59O 4M55A 1KEPA 4GSLA 2P4QA 3E03A 4IJKA 4J4BA 1SZJG 5COAA 1BTOA 2QZ9A 3R1IA 3LF1A 2VYVA 3KSZO 5I7EA 3HN2A 3LC2O 1HDGO 4XGIA 1Z75A 3HFSA 4M86A 1NPDA 1VJ0A 4NBUA 3BIOA 2DFVA 1GEEA 4PRKA 1FMCA 5T57A 2A9FA 4OM8A 1T26A 1NFFA 5IXYA 2B83A 4NBVA 3ZCXA 1DHRA 3DL2A 1KETA 4B4OA 4CR8A 2GZ3A 2VN8A 1BW9B 2VRBA 4MVJF 3WGZA 1HZJA 1X1EA 3S2GA 1X7HA 4PLFA 1LSSA 2HKIA 4WLNA 3AOGA 1ZK4A 2W2LA 1YVEI 1O8CA 3ZDFA 3A4VA 4P4LA 3AUSA 4HX5A 3RUHA 4JN6B 2RIRA 4AJJA 1BWSA 3UICA 1E3WB 1XSEA 4E31A 2BFPA 3T7EA 2P4HX 4XWYA 4D45A 2VRCD 4TRMA 1GYPA 5CG1A 4RPGA 5U9CA 3WBFA 2QG4A 3GMDA 4MINA 1P77A 2OP1A 4RVUA 4PVCA 4BNMA 4MKXA 3L4SO 5EPOA 1MC5A 3DZFA 2VRCA 1IB6A 5IG2A 4IDFA 3W8FA 4J7UA 3Q6IA 4RVFA 4OQYA 4OKIA 4II2A 1QLHA 2X5KO 3WQSB 4BNNA 1PGQA 1LEHA 1DJQA 2Y05A 4IS2A 5A9SB 3IL2A 3RU9A 4BNJA 1ZJZA 1UAGA 5TJ9A 1EEHA 4CUJA 1BRMA 1E7RA 1P1HA 5L4SA 4IZHA 3FPLA 1SEVA 4YACA 2RHCA 3BMQB 2Q4BA 4FR5A 4B8WA 2EERA 3CXRA 2J3HA 1NWCA 5IXSA 1BXZA 4QO8A 1ZZEA 1H5QA 1XLTA 4L74A 1ZEJA 1ZK3A 3GH3A 1GAEO 1K6JA 2BFOA 4QT0A 4R9RA 2GN4A 3AI3A 1YOVA 4NU6A 2JAPA 3DONA 1T2DA 3WTCA 4BNGA 5JSFA 4XYEA 1N1GA 1GCOA 2OOSA 4PG7A 4QO7A 1DBVO 3VPFA 1KVTA 2CSUA 2RCYA 3DHEA 4YJHA 1BXGA 3TQHA 1EUZA 3OICA 1QG6A 1ENPA 5JFOA 1PZHA 1DIAA 1OC4A 3E9MA 4EEXA 3IOYA 1DRWA 1K5HA 2BGMA 2AG8A 2Q49A 3X2EA 2X23A 3PK0A 3AUTA 1TA4A 4P38A 1IUKA 5FF9A 2PV7A 2ZTVA 3B1JA 3VHRA 5KWEA 1EBFA 2UUPA 2PKQO 4LVCA 3PJEA 1BVUA 1C0KA 1NASA 2P68A 3BTVA 4J1SA 3QW2A 1BHSA 2PH5A 4LISA 5BQFA 1AHHA 2JD0A 1ZK0A 4D79A 4CM5A 3SX2A 3VH3A 4Q3DA 3JQ8A 3ZWXA 1IHYA 5THQA 1U4OA 2G82A 4M89A 4G5HA 4GGPA 1GU7A 2QRJA 2RH8A 5I9MA 3ADOA 1FDUA 3ICPA 1ZMOA 3ENKA 2VZ0A 4LRSB 1CQIA 4CM7A 2XXJA 1U28A 3IIEA 3PTZA 4MKRA 4Y98A 3L4BC 4BV9A 3MJ4A 1A4IA 4YCAA 3KLMX 4BUCA 4PRLA 2VHVA 1QLJA 1Y1PA 3H9JA 4O1MA 1A27A 1P1FA 3WYCA 1GZ4A 3HB4X 4Y8VA 1JAXA 3DWFA 3H5RA 2JD2A 2VUSA 3LDHA 3OEWA 5A06A 4Q3EA 3KUXA 4YT2A 2QHXA 2Z1MA 1L7EA 2JAHA 3MJSA 4LSWA 1X15A 1P33A 3BTUA 2GN6A 1E5QA 1N7GA 2YZ7A 4YAJA 1C0IA 2OBNA 1I30A 3SJUA 4CQLA 3LC7O 2VTEA 3GGOA 1H9BA 1JW9B 5ITVA 2BLLA 3WLFA 3GDGA 2HUNA 1I2CA 3HQ4O 2VQ3A 5DCYA 5I7VA 4KP7A 3ONFA 4BNFA 1QSGA 2QW8A 3H8VA 1VJ1A 4MVJP 4RL6A 4WLOA 1PR9A 1CERA 1HDCA 4JNKA 2DVMA 1T25A 1EDOA 4UEKA 1YJQA 3DB2A 3H2ZA 4Y6PA 3UW3A 2EWMA 2C54A 3PJDA 4PG6A 1T1RA 4FIZA 4G65A 3VAZA 1XHLA 4BB6A 5JYDA 3PZBA 3C7CB 1CETA 4GKVA 3MWEB 2J3KA 4IGFA 3JQ6A 4H15A 1TXGA 4ZQBA 2PZKA 4IMRA 4JP3A 1P3DA 2UDPA 4D42A 3GZNB 4PZEA 2LDBA 1VM6A 2CVOA 2Q3EA 1TT5B 1PZEA 4RPKA 3AW9A 3AY6A 3JTMA 3ZWVA 1XWFA 3FNFA 3OQBA 5TC4A 4A0SA 1FK8A 1M6HA 4EDFA 4JCOA 1VJTA 3R0IA 4B3JA 3T7CA 1EE2A 1QYXA 4DQXA 1SAYA 1XR3A 4YAGA 1NFQA 4NR0A 1D7OA 3KOUA 4I9UA 5F1PA 3UVEA 4HNHA 1A7AA 1PJ3A 2O7SA 3AJRA 1VL0A 1NFRA 4L75A 4OOEA 2WD8A 1GQ2A 2HK7A 4NU5A 5FYDA 4J90A 4PFJA 1QR6A 1WAMA 2J3JA 2Q99A 5A03A 3QHAA 3DAPA 4R69A 2WYWA 2WJPA 4E5KA 4W9NC 4MIYA 2CDBA 3IJRA 3IP1A 3W4IA 1NWHA 5EIOA 4GVXA 2IZZA 4D43A 1YE3A 4HFMA 4WEQA 2B5WA 2J6IA 3M1LA 4KWHA 2P5YA 2ZJ0A 1UDAA 4CMAA 4BNIA 1PGPA 1O94A 2WSBA 4CQMB 1SPXA 1HYGA 2Q1TA 3JV7A 3GDOA 2BRUA 3BMOA 1H2BA 3MWDB 4CLRA 4E5NA 4ZJUA 5C37A 4DMLA 4EI2A 1VPDA 3OJOA 1ZH8A 4N18A 2DTEA 1SC6A 1XIVA 1ZEMA 1GQYA 2AEMA 1GCUA 3WR5A 1DPGA 2AHRA 3S1LA 5JBIA
chains in the Genus database with same CATH superfamily
1B42A 1TVKA 3F98A 1SU6A 3WK4A 4EUHA 3D6AA 3NTVA 3HWX1 2QV7A 4AO8A 4LF6B 2G1UA 3Q7SA 2OG1A 2JLAA 5B3JC 1N2BA 1RXEA 3EHEA 5DYGA 1GGKA 2QQ5A 2FRDC 4R5HA 1OUMA 1EINA 2EJWA 4BV2A 2XYPA 4GPIB 5AK0A 1GT91 4NBTA 3UMGA 3D6MA 2YQZA 2PSEA 3LOPA 3AFNA 3CH5A 4M21A 3QJ5A 2H06A 2B21A 3CW8X 4RFSB 5ADWA 3IQIX 3B60A 1V6SA 3UMBA 1X0XA 2E5LB 3I1FA 4REQB 3TZQA 4EK9A 1AKRA 2V6BA 1KU6A 1WHTB 4XQ0A 1QVRA 1Y7IA 2AN3A 3TTSA 4DCSA 4UFPA 1Z5OA 3D8RA 1NI5A 2JCXA 2OO3A 5F21A 1QHHA 3JQGB 2XUKA 1X19A 1YU9A 1F06A 4BO2A 4YV2A 1B8VA 2RGEA 4MI9A 3T7JA 3LX4A 1CP3A 3SZRA 1CRQA 3F49S 3PUJA 4EVIA 4AYXA 4B35A 1JILA 5JAIA 4W1PA 1HDOA 3VDXA 4TWRA 1WR8A 5ICFA 1NVKA 1R64A 1U5BA 4MV3A 3FTFA 3NUZA 3CB2A 2R2GA 4GWLA 4PO9A 3S1AB 5JQWA 5EP1A 3ZLVA 1F2UB 5D3MA 2IXAA 3OPYB 5EXTA 4BX0A 1EP2B 3O8RA 4AI6A 4WZBE 1JLLB 3K09A 1EUCB 1T29A 5KYXA 1FFDA 2ZUWA 1E1YA 3A9RA 5JSZA 1NU6A 4MVJI 3CX6A 1NZFA 5I5GA 1X1DA 1USIA 1WIWA 2CCKA 2RHDA 3O75A 5REQB 3E8SA 4MUEA 5CLGA 1D2CA 1YQWA 1DUSA 1USUA 3MS2A 2G88A 3C6QA 4G0MA 4DWJA 4H6XA 1WU7A 2XCLA 1Y1TA 1UBRS 4R16A 2FCRA 4RKWA 4RKQA 1E58A 1U2SA 2QUZA 3IAHA 2J6BA 4DR1B 2I7DA 1W76A 5EEHA 3F8SA 3O1JC 2GAAA 2R86A 2V3WA 2FN9A 1R0SA 4CETA 2QTRA 3HVKA 6NULA 3A31A 2Z6AA 2CMKA 1T2AA 2QMOA 2WWFA 3RSLA 2IUEA 2D1SA 2ZTUA 1QKIA 4B2PA 3CN7A 3KQLA 2O59A 3TLCA 3B6EA 5CB6A 1PL0A 5J5AA 3G82C 3O03A 4OJMX 4CLHA 4CU5A 1M2EA 2Y1FA 3LXUX 3MNFA 4LVUA 5LYJB 5JRZA 2PDAA 2PX0A 2ZSAA 3DZBA 4CUKA 2LBPA 2Z2XA 3BS4A 4HDQB 1XXHA 1GILA 5FUYA 5ADVA 1PQWA 4B4VA 1K08A 3PXGA 3BHJA 4DTIA 1A5AB 1KRHA 4BASA 1KEVA 1SQGA 1G5FA 1GZSA 3BMCB 4NTZA 3IMKA 4C30A 1L5NA 3EVCA 3ZV3A 3FPKA 1AN0A 3CG0A 3A32A 1PG0A 2GNPA 3ANSA 3JATA 3N5KA 3RT7A 3AHDA 4F2DA 3RVBA 1I51A 1SC1A 2QIPA 4C29A 3HXQA 1CYDA 3CUKA 2GN9A 1J09A 5BSRA 5FLYA 1P0FA 1JQEA 2QRQA 4ENTA 5JROA 3R2JA 3EG5A 1C8KA 3PYXA 3HJCA 3WO0A 4M3NA 4AW9A 1W0JA 4C5AA 4D9CA 5KYYB 3O1HB 2Z2IA 3HCCA 4OI2A 3MT0A 1F8UA 4P7GA 5ALFA 1EWRA 3RD5A 2FSFA 3LPNA 1R0LA 2XNDA 3I9FA 3QF4B 3R3JA 3ZDYB 3JQEA 4RGBA 1AS2A 2FQ1A 3KYCA 4KQ2A 4O4IF 5F9FA 1WVMA 3MTDA 4A1OA 1ZVVA 3ZGNA 3UPUA 1GTSA 5IN4A 4YAEA 4E4RA 1GRRA 3U80A 1ABFA 2ECFA 2PZJA 4X63A 1OFIA 3MWGA 2CJXA 2J33A 2OVBA 4QDKA 2UUOA 1BS2A 3C5HA 3RABA 5K8JB 4XVUA 3DMDA 4O8ZA 1ZOIA 2E6UX 1MG0A 3IIKA 4LX8A 2FKAA 4GQBA 4JNCA 5L6LB 2XMDA 5K20A 3WLOA 4LY0A 3RB8A 2DLCX 5CYFA 1U81A 4XARA 3KVVA 2ZKIA 4FEEA 1DP4A 4I1SA 2GEFA 4QBHA 2JARA 3VZDA 4DHEA 1CJCA 1AF7A 4BJ1A 2UVPA 5ISMA 5EJGA 4QU5A 4YAFA 1I7PA 5IP5A 2IYEA 4K6HA 2OAQ1 1P2VA 3HP1A 1EHCA 4D41A 1JIJA 5EXPA 4E94A 1SBQA 1IJKA 1JMYA 5DXJA 4E14A 4E88A 1Q7RA 2V9ZA 2OAEA 3TKYA 1XMXA 4TRNA 1EM8A 3GFSA 3SXJA 4EFLA 4F3NA 1EFLA 3ZG6A 2H0QA 4LZLA 3G0IA 1RYBA 4QTXA 2PMEA 2JJ2A 3WGNA 3AFGA 3GNSA 3GY0A 5ILOA 1M34A 1HGXA 1TU4A 5TGDA 3W78A 1ZNXA 3P26A 1EUYA 2SKCA 3I9V6 4UVIA 1TO1E 2ZAIA 2Z56A 3LW8A 4M76B 1CT9A 4H59A 5EWLB 4Q18A 3V7FA 2IH2A 2VQ6A 1RQ2A 3E8XA 3TZHA 3WC4A 1Q74A 2YWCA 5TPWA 2ZIXB 5CLJA 1ZGZA 3I6ZA 3UQZA 1S7CA 1FYEA 2POCA 3OCXA 3HB9A 5B2ZA 2ZWOA 1WSBA 1R4NA 2B6NA 1SB8A 4JJKA 4B4DA 1K2VN 1TKCA 2SHKA 4NARA 2WHXA 1G4HA 1QONA 1SCQA 1BDMA 2WA2A 2X7JA 2Y1XA 3D2LA 2YVUA 3TAUA 1DIOB 3GJYA 3V4PB 2R7LA 2VYND 2WM2A 3HYRA 3W1VA 2TECE 3CNEA 4EFNA 1IBSA 5TT1A 4RD1A 4DF3A 3ESQA 4QRHA 4C4OA 3BXZA 4JJAA 5DGDA 4HWTA 5JAUA 3F6EX 3AU9A 1FX0A 2QXYA 4A82A 2I6QA 1DLIA 2LNDA 3PQFA 2ZIGA 1ZVKA 1DAKA 3FFWA 4Q16A 3BWMA 3PNSA 5E9AA 4IXDA 5LQJA 5DYNA 2POQX 3EOZA 2FI1A 5IJZA 4P86A 2HWXA 2OXRA 4TZKA 3ZWBA 3OPQA 4B33A 1JX6A 1ZC4A 4HDKB 4J0KA 3UHPA 2FNAA 5ALQA 2FMIA 2VPXA 3R6LA 1H5UA 1W29A 2PUVA 3F2VA 1MOQA 2K2WA 3AUXA 4MMYB 3DQPA 4DBLE 2VQSA 1SWVA 1LI7A 2D74A 2P7IA 4XFDA 3ROGA 1Y8RA 3MERA 2IBTA 1Y3BE 4LXUA 1CK4A 4M9RA 3FLBA 2IP1A 5FTNA 1TPYA 5ALKA 1OF1A 2J3EA 4ITUA 4IH1A 3IEIA 4P4SA 2JAWA 2HW8A 3ELUA 3P0RA 1BX1A 2PKCA 2J4FA 3X1MA 3P7MA 4G5FA 3NOVA 5JI3E 1X87A 3TNJA 4P98A 4S3MA 1T3GA 3ZNPA 1UL1X 3RUPA 2H1CA 2ZWAA 3ND7A 1GN9A 4QOFA 2P75A 4U8GA 5E4FA 5K0SA 3DHWC 1BFDA 2C3YA 4M7RA 3O8CA 3T3OA 1LLQA 1RRPA 1EFPA 1FYVA 2OCGA 4JLOA 1UBMS 4MQMA 1QHFA 3MTIA 3TG8A 3AWDA 3DPUA 5A6VA 5H3CA 3MQ4A 2RGNA 2WZBA 3PXUA 3ENQA 3WNCA 1I6LA 1YFLA 4XWTA 2ABWA 2Q9BA 2IYNA 4TS4A 3QUAA 4Q24A 5DFAA 1YHYA 2PJZA 2C03A 4HDRB 5IS2A 1GQFA 4CIAA 4YMGA 2C5LA 4NYIQ 4AZ0A 4V0OA 1EMDA 3GH1A 3GCXA 2BMFA 4QSMA 4X91A 4QGHA 5IF9A 3KUUA 3BBPA 3F0TA 4X71A 3SDSA 1HK7A 3MRSA 4EOGA 5JQGB 1DWQA 3ZH9B 2JFBA 3GG2A 5FNZA 2I8AA 3OPYA 1DRJA 1KOFA 1TMKA 2VPPA 5K4GA 1VRWA 1A5TA 1Z33A 4GUDA 3C5WP 4IV8A 1AURA 2GO7A 1ZN9A 3LGXA 3R3VA 4KDFA 4F5YA 1NQOA 3IEVA 3DYIA 5EE0A 2FPWA 1FLVA 1P45A 2GEKA 1UDCA 3GLHB 3SEZA 2DR2A 3PHLA 1WXFA 4IFTA 4W6QA 4MUAA 4I55A 4JWKA 1EG7A 2RHBA 3RU2A 4LJ9A 1LTKA 4GX1A 1ZS9A 2M1ZA 4K05A 1AX9A 4P9NA 3E0QA 5HP4A 1XQYA 4UBMA 1E2GA 1MC1A 2GYYA 2AFHE 3K9NA 1JF8A 3MT9A 5E4JA 1Q44A 3TDKA 1N6PA 4HQLA 4ZEXA 4HNSA 4NKRA 1KQ3A 1OI2A 3E3NA 1CY7A 1OXXK 3QPBA 3TFQA 3K0SA 1IOZA 4YRZA 4II7A 1O4WA 1D2HA 3CKKA 1H69A 4ARCA 1N57A 4M54A 4TMVA 4Q7JB 1A9ZA 2ZT5A 3FGOA 3FNEA 1I1HA 1U9JA 3I62A 1M34E 3ZCUA 2WVJA 3ER8A 2NVUB 5FNVA 4HGOA 5LYJA 4UUQA 3PGJA 5DT2A 1KYZA 3OZWA 5KJ6A 2XEXA 1N5DA 4YJGA 3R09A 4PSKA 4TV9F 4DUPA 1LDEA 1M10A 4FU0A 5HF5A 2XYVA 1NVTA 3T1VA 1XQXA 5DHUA 2P2NA 4HMPA 4M22A 4J3NA 3UXMA 1LUAA 2ZIUB 2O8CB 2IBSA 1EUDA 4QE3A 3DKRA 4II3A 4AN1A 1IN5A 2FZVA 3LX5A 1PQ4A 2D5LA 3E3MA 2IXTA 1PYOA 5FJIA 3QBDA 4MWZA 3NEPX 3RYIB 1MG5A 5C3UA 1BO6A 3B2EA 3IMFA 4KJZA 3GPDG 1CFZA 4MV5A 5BV7A 1YS2X 4XVQA 4YFVA 4N7JA 4B76A 4ECAA 1ZW1A 3QPDA 4IHQA 3CX8A 4RWZA 1ACMA 4MICA 5JLAA 3CUTA 5JRDS 1GEGA 1ZCBA 4HB0A 4MW4A 4KL8S 4BECA 2WRZA 1R0RE 3GLGA 1E2HA 1R37A 3CLVA 2ERYA 5DLEA 5DLDA 1X80B 4PW0A 1OOEA 3QRWA 4WLUA 3TQFA 2WJZB 3TTYA 3WK7A 1V8DA 2NIPA 2PJDA 4JI4B 1JHOA 3P5BA 4TLEA 4DLPA 2GSDA 2C5FA 3EVAA 3VR5A 2D5AA 4RJ2A 2AFIB 2REXB 3A6HA 3PE3A 1H1TA 4PM4A 3CCFA 4JQSA 1G8AA 1GZDA 1ZI9A 5TVGA 1U1IA 1U0BB 1JT2A 5CIQA 1B2RA 2W4QA 1JYEA 4LOHA 1E9BA 4HAIA 1ZAYA 2M6LA 3OX3A 3U3DA 1HE8B 3NBKA 3C4JA 3LXRA 4FX5A 3ET5A 2BUCA 4TMYA 1BH6A 2JA1A 4Q21A 2BBOA 1HE2A 4L7QA 4NBWA 4NDZA 5BQPA 2AKEA 4WFJA 4OO3A 5EXEA 4B74A 1QG2A 2QLTA 2ZRLA 2F4VB 3QLTA 5ICGA 3JARA 2QDXA 4MR8B 4G5SA 4QYWA 1ZM3A 4M53A 2AFHB 5TIIA 1D9ZA 1ZD1A 3DV9A 3F5MA 1IZ8A 2ZIXA 3AIOA 4QJBA 2LCQA 1D2AA 1N0UA 2D1YA 1DQPA 5BYKA 1BEUB 1UPUA 2GK4A 3MELA 1K27A 1JIXA 2IXGA 2R5WA 5FRDA 1RKQA 4JR0A 1LTQA 1SB9A 1F9EA 2D7DA 4GZ6A 4EKDA 3BBLA 5GGYA 3ZBTA 3QXGA 3MZ0A 4TLBA 1Y8QB 3A9UA 3OO0A 5J59A 2NUPA 4BLWA 4QEKA 3E0XA 4YCDA 3UA4A 1TFUA 2XGJA 3GNQA 1RWKA 5AKHA 4FVTA 4BFVA 3AXSA 3PF9A 1CNEA 3HU5A 5DVZA 3T3HA 1FX0B 1YZNA 1SQSA 3DVSX 3QF4A 4KQWA 3ESAA 4ZOQI 1Z5UA 5K3EA 3ZJ5A 5JPDA 4IIBA 3SR3A 3EARA 1YE5A 1G8HA 1NSYA 3COPA 1NUUA 4NDNE 5A4JA 1O4VA 3FHOA 1B0AA 3NHJA 1NI3A 1ZRSA 4MKHA 2QUBA 4QRIA 1IN4A 1U9YA 3P45A 4WKPA 1ADCA 3IDZA 3RTAA 2GN2A 2EBUA 4BO8A 4BO4A 2AXQA 2BFCB 2GYUA 4UTVA 5I48A 2ADFA 1I24A 4UHFA 2FEKA 1I3CA 3OQPA 3DAYA 2FSPA 1EGAA 4MQEA 1WCWA 2VH2A 2ZRFA 3KJEA 4QBTA 4L6IA 4X6LA 2XODA 5DE3A 4OGGA 5D6OA 2QL5A 3OLXA 4P93A 1NLUA 4R8VA 1JH8A 3QU4A 3OZRA 5L4LA 2Y1GA 4XUCA 3R6GA 5C5IA 3SKXA 3WKDA 3WLTA 2X4IA 4NAUA 4KX3A 1JQJC 2AXEA 4MJ7A 2NTNA 4UE3S 5TS3A 3ESBA 3ZWPA 1YJ8A 3BCRA 1PK7A 1QJ4A 1H4TA 4WOCA 1LSUA 2JIPA 3NC1C 4YRTA 3KPVA 1R15A 1E2KA 5HBGA 5AR1A 1PEKE 2GEJA 2ZRNA 4Q12A 1EFVB 3JZFA 3VZQA 3U4QB 1S8NA 1M2KA 4DV3B 1OH7A 2CB0A 3LE8A 3EA5A 3PUHA 4R68A 4YIKA 1SVUA 1YV9A 2YMMA 3C70A 3CLSC 3L8ZA 4DIUA 1SVKA 2VI5A 3ZYCA 3BCUA 2QE7D 4ZGWA 1J8QA 1GUAA 2R8ZA 4QGAA 3SF8A 4ZZ0A 4CKBA 5I3ZA 4BFLA 1N2IA 4UZFA 3ROTA 2PUHA 3N2KB 1XPJA 1UBCA 2XKKA 3CNOA 1HL3A 1SUEA 2CFRA 3B38A 4D2IA 2BTEA 4TSKA 1C14A 3INGA 3QFTA 2ATVA 3EIXA 2JPDA 4C2UA 5FR2A 3LTEA 1JFRA 1NRWA 2NSHA 2BM0A 3HKEA 4KKXB 3E2MA 1LVHA 1ISMA 4MIEA 3QX8A 3ZU2A 3UTDA 2GCNA 3OJCA 4PR3A 5AJXA 2P9CA 4L8YA 4J7AA 1USWA 4DV1B 2EQBA 1E77A 5DBGA 3KAKA 4ZVKA 2GNAA 4QPZA 3UJAA 4FLFA 4TWBA 3UJHA 3EVFA 1XVIA 4FMPA 4F5WA 2JLUA 1PI3A 1SRRA 4JBWA 4Z4EA 1H2HA 4BNKA 1L9KA 3GZJA 1DG9A 1UBSB 4BZQA 3KZXA 4BMYA 5JT1A 1AH2A 2ZSUA 2RK6A 5CAEB 3K30A 1W5EA 1CQJB 5CVUA 4A8JB 2JANA 4A1FA 2XMQA 4Y2XA 1FSPA 1HPLA 1IEVA 1IFXA 2HIMA 3O95A 5JAMA 3H97A 1AGNA 2J48A 3KBBA 4NNOA 3UOGA 5IF3A 5JANA 1NBMA 4D9IA 4NXNB 4FYXA 4IWYA 4Z0PA 1OTHA 4OUKX 5MGNA 1JIVA 2J45A 5ILQA 3UC9A 1KI1A 3FE2A 5I7SA 1XTTA 1RQPA 2OK8A 1L7QA 5EMHA 5ICCA 5DO9A 4JQZA 4HAZA 4C01A 4JV5B 3OIDA 1GPNA 3QKIA 1UXJA 2EC5A 2CFTA 3KKEA 4XJSA 1CFJA 1J39A 4RA6A 2X1LA 2UYCA 1TK3A 4KEAA 1QX3A 3V32A 2CV2A 1NPYA 4WRRA 2DUUA 1VYHA 3R7SA 3VV2A 4OX9Y 1XMIA 2ID8A 3NBYC 3E2PA 2PBZA 3CRQA 3ISTA 2P5TB 3PUZA 4MWBA 5H9VA 5C0OE 3R3SA 2JFYA 4KE9A 4FEAA 5EZQA 2ONJA 1R0KA 1JHMA 4H08A 4UKDA 2FX3A 1HNZB 1ND6A 1ZD9A 3MQFA 5EMNA 3RC2A 3IMGA 4DWWA 1ADGA 2VYFA 2V3VA 1NDQA 1R6VA 3C6BA 1DXHA 1II9A 3OEYA 4HT3B 4JP8A 4TYWA 4M36A 4LF9B 1PX0A 3G8YA 2PU7A 4KLCA 1ENYA 5H5JA 3R0VA 4HGPA 4YUZA 3AEKB 2C7GA 2IYSA 3NKLA 1W9HA 3D6HA 5ED0A 1OMOA 2NU8A 3HXOA 4IQ4A 1ZA2A 2O0LA 1DBQA 1OBCA 4GP6A 2QLLA 4L9SA 1LC0A 3IGFA 4XUEA 7AT1A 4CKWA 5K6RA 3HUFA 1W46A 1Y42X 3DFZA 1QMPA 1QYRA 1U2DA 3AM5A 3UB3A 2NPOA 2NNLD 2XWSA 3C14C 3HHEA 4RUKA 1CY8A 5CA0A 3X44A 2OFWA 4L6CA 1MDFA 4FC6A 4J0CA 4Y2PA 1NKSA 3UOAB 4LYAA 3BK1A 2GD0A 3WA7A 2EDAA 4QECA 1EDBA 1PIWA 2QTTA 1G1AA 1XLVA 1XT6A 2HU2A 2O1EA 3LK7A 1YRWA 3IKJA 4E30A 1R8XA 4ZYWA 1JDZA 2NAFA 4DNXA 4U5QA 1DG1G 1OREA 3HJNA 1WMEA 1I2AA 3KQPA 1SKAA 4ID3A 2FPPA 4O4HF 1FF9A 2GXQA 1WPRA 1MAUA 3E5MA 4AD8A 4ARBA 5DTRA 4AP6A 1S3SA 1WTCA 3EIQA 3PX3A 4WADA 5LVAA 2G4VA 2WSLA 3CQ9A 4KGVA 3TGPA 2W90A 2YV4A 1QO7A 3A6PC 2QVZX 1Y7PA 4NSNA 3N75A 1A4XA 4PPFA 4CE6A 4CYMA 5G0WA 1XV5A 1QHSA 1CUIA 2J0UA 3D9QX 1QB8A 4XB2A 3IE2A 5CGQB 1JLHA 4PLVA 2XB6A 5K0EA 3K6JA 4ZT7A 1RAEA 1XCJA 2UYOA 2RE8A 1D8AA 3B2QA 3AESB 1Y4ZA 3PLNA 3V1LA 4PLZA 2ENWA 4IG4A 1TKAA 2XVXA 3G0BA 1LB1B 3EY4A 3QWAA 4DG5A 3FY4A 2GM4A 4RLSA 1ZISA 1TVCA 2B37A 4XD7A 4XX0A 3U26A 5CD9A 1CQPA 3CLTD 2FW6A 3RFUA 3NJ4A 3R5SA 4GIBA 2R62A 2YIDA 1UC4B 3CGWA 5F76A 5LZ9A 4DV6B 4OYLA 1BXKA 2PT7A 4GYYA 3HM9A 2Z3VA 1QKKA 4U02A 3COWA 4LK3A 3HEBA 2J85A 1G3IA 3M6LA 1XAIA 3EC1A 3EOAI 3L7LA 2BAGA 2BV3A 3FJYA 1CQZA 1EJ6A 4ZVSA 1I7QB 2JBAA 1YIDA 5CB0A 1VLQA 2CN1A 1KJ8A 4QYIA 2EIXA 1DBSA 2ODNA 4LYFA 1YFJA 3DKPA 3MCWA 3OPNA 1APBA 3EIEA 2WMOB 5IAAA 4XGNA 3EMVA 4Z7NB 2BWJA 4BLQA 4QL3A 3EMKA 3PRKE 2NADA 1GPWB 1DXQA 1HKHA 1K7FB 4CLOB 4C4SA 4GLOA 1LDGA 1V43A 3CKYA 3OZSA 3WJ2A 2OCPA 1V35A 4QDJA 2PWBA 3KQKA 3C7AA 1CZNA 3OMXA 1AV6A 4UAVA 4HG2A 2D7CA 5J63A 3HJAA 2H2IA 3AFOA 3PL1A 3GJ4A 4TTRA 1Y37A 3RBVA 4ZEMA 3AVPA 3OZEA 3ITEA 3NAGA 1HTWA 2UZ1B 3CF2A 4MUMA 2C5GA 4GZ5A 3BXHA 4L57A 4YN3A 2AJ8A 1N7JA 1QYDA 3CLUD 3MILA 4HBZA 1CY4A 4NS4A 2WLTA 4CWAA 1ZJJA 3IERA 4C89A 1T9GR 1TU0A 5DI3B 4YRGA 1GYRA 2IEYA 4QJ4A 2AX4A 1QXSA 2UUBB 3M9XA 1GDDA 5LWQA 3LHFA 5K0LA 3T52A 1U1GA 1Z16A 4HMOA 1XA0A 3I2FA 4Z9XA 3UWMA 2XV1A 4FHDA 3NW9A 1L7MA 3STHA 1B93A 1FTGA 1TVMA 3EXG1 3VH1A 2ZRBA 3C74A 1E3TA 5FCDA 4R6XA 3SXUB 4ZMBA 1FJXA 1X80A 4NCBA 4R2XA 3S7ZA 4WXEA 1WZEA 3ZUPA 4V0SA 1DCFA 4FILA 1OV6A 1BFKA 1XA3A 2VWGA 3LF2A 1LF5A 5AI5A 1PZNA 3JR3A 2YJNA 2YRFA 1KH1A 1U8UA 3ZVNA 4Q7MB 4H1HA 5B4UA 2EFHB 4MA4A 3S5UA 2HRBA 1W4ZA 1CIPA 2ASVA 2ZDGA 3HI6A 3MOGA 3UW1A 2C7OA 1J70A 4RHCA 3H1BA 2IZ5A 2EHJA 3OCJA 1U0LA 2QK4A 3V7NA 3G9UA 2II6A 2AT1A 3RYHB 3WMEA 1IYZA 3T9EA 2JLRA 5BNWA 1N92A 4FFRA 4LCJA 2W2PA 1OW3B 2WTAA 2ADMA 4RIGA 2YBEA 2VJYA 1T1SA 1THTA 4R3WA 3GRAA 2CXSA 1F51E 4A0GA 5L7WA 1A4RA 3A06A 1REQB 6CHYA 5HQTA 4BLTA 1DCMA 1XWIA 4BKOA 1C4KA 1I6WA 4GGMX 1UT5A 4JBHA 3LUFA 1HDIA 4A0RA 2WD9A 3M6IA 1IG3A 4H7EA 1GT6A 1U0OC 4QLBA 2J4CA 2O14A 1BW9A 4GNRA 3P9XA 4INJA 3AR5A 3QQ5A 4M0FA 1ETUA 5AM2A 1NXTA 1P1IA 4LYEA 3E35A 3MRVA 5DH9A 2AEEA 1QUFA 5HM8A 1A5ZA 2QLJA 2O6HA 2ZZNA 4GRIA 2PSJA 2WF6A 2PMBA 4HGNA 3HHPA 2I66A 3QKWA 4ZVVA 5CM2Z 4ZU6X 4CKCB 2QRPA 3CVXA 1Q7EA 1FFWA 1M0SA 2V7BA 4N39A 3IKMB 4U3JB 5MN5A 1W44A 2P30A 5FAKA 3RU7A 2LW7A 3ANXA 1CCWA 1G8MA 3HVRA 3LWZA 4MGYR 2H6EA 2P0EA 1VOTA 1CUGA 5BY2A 4OOFA 1A9QA 1Q91A 1ZLYA 4XWWA 2PGLA 3Q2IA 2H65A 4DMKA 2OBFA 4DVJA 4JUFA 1LK0A 4N7BA 3H7AA 1J42A 2RAVA 4NXMB 3UWPA 2L17A 2QRUA 3DDZX 3A6DA 3OJFA 1XF9A 3S27A 2FUCA 2OBBA 3DE2X 3IMCA 1RC8A 2PANA 3IQEA 4IY1A 4Z9AA 4Z4FA 2GUGA 5DB4A 3TM4A 4AZWA 4JT2A 1DKNA 3F3KA 5HJ5A 1G8FA 2EKQA 1T13A 1Z9BA 3EVZA 2HO5A 5MFPA 2HWYA 3IDAA 1V8ZA 5FLKA 3BRQA 1QV9A 3FAKA 2WHPB 3G6KA 4LF5B 3FCOA 3HN6A 3FNBA 4ZEWA 2H9IA 5DM60 1Y1RA 1JA1A 4KB5A 1URPA 2VDLB 4N47A 1ZD5A 4YMLA 4LI3X 4BAZA 3FRIA 5E38A 2CZQA 2PT9A 2OXFA 4J0GA 5C2JB 2P78A 3B7GA 3RNOA 5JNUA 4KPEC 4KR7A 2WPDD 1NW8A 2EEZA 2W2OA 3BZUA 3C15C 4JBLA 4JQYA 3RANA 2HU7A 2SBTA 5HZGA 3JALA 1Y5NA 2OV1A 4DABA 1GYQA 3TOXA 1M8PA 3DCJA 3PHIA 1C7RA 4OFWA 4JYZA 2Z09A 1TVKB 3ZOZA 1OZGA 2OQIA 4AJ4A 3DDCA 1CZLA 1GZ6A 4I1VA 5KTKA 1U0TA 2FDRA 3MJEA 1E1RA 3O5AA 5K0FA 1F4PA 5CDFA 5C7IO 2JFXA 3R23A 2M6SA 3WISA 4AFNA 3EUFA 3ZLUA 2D4AA 2YJ4A 4BS9A 2RGBA 3AG5A 3KTDA 4AZTA 5JNRA 4KSYA 4KUHA 2GZ2A 2JIBA 4AULA 3Q1KA 4NF2A 4BVEA 3D2AA 1YZTA 1PSZA 2ISQA 4ZQGA 3GLFB 5ESDA 3WIUA 1CEXA 1A72A 1H0KA 3GT7A 3EIHA 4O2LA 5EWMB 5KYVA 4ND8A 3EPLA 1JI3A 4G8CA 1I1QB 5CLLA 5FADA 3NALA 1OFUA 1ZGGA 3B53X 3PRHA 2WEKA 5A7HA 4RWEA 2PZLA 4YJ3A 3ZWWA 1I0ZA 3ZWAA 1W36C 1G7RA 2A5DA 2NT4A 3A4IA 4J4TA 3U1TA 3WB9A 2ZU6A 4BKUA 1Y3IA 5AUOB 3RC8A 3AYXB 3OE5A 4INOA 1FYXA 2QP3A 3T5DA 1R5NA 4JI1B 1MDBA 2R48A 3OIGA 2B34A 1XRLA 3TE6A 1GZVA 4P3OA 3TLYA 1LBSA 1RWBA 2XYRA 4FJ1A 2N1MA 3AKYA 4G81A 4HAWA 3RRFA 1NW5A 2QTBA 2RBEA 4JYBA 4RDHA 2A57A 3A6KA 4RIIA 5CNMA 1TZJA 3UMRA 1GUYA 3VPSA 2GDZA 1MC4A 1YHNA 3RVMA 2AQIA 4QXAA 4XJVA 2DPXA 4R9UC 2NTEA 5DBIA 2PS1A 3NHLA 2W2KB 1EZ1A 4A5OA 4D8TA 2HA6A 2IHTA 3R41A 3S8MA 3ZJTA 2DC1A 4U7HA 3FVTA 5EMKA 1TF7A 2C31A 5K3FA 2KW5A 4F71A 1WXDA 5AW4A 3BRCA 2PCJA 3B5EA 1D03A 2WUVA 3LP6A 3IHLA 3MK31 3JQDA 3R7BA 4A8TA 4Z7OB 2V6FA 3F1KA 2I99A 3R3YA 5IZCA 3EZNA 3H4MA 3O8OA 1GTVA 1UJNA 5AKLA 3IAM6 4PGMA 5ECYA 5LDHA 5KVVA 1W25A 5THXA 2AOVA 5AKKA 1QTNA 3EFHA 3DMGA 1D4ZA 1EFCA 4B3CA 6Q21A 2IUYA 2BONA 4DCMA 3RF7A 4LMRA 4QBIA 2P0YA 3AY0A 3DVRX 2B9VA 2H1OA 1UK7A 1KSJA 3GVXA 4CL3A 5D7BA 1XZGA 3N58A 2OC9A 3EG9B 4CKCA 2NOAA 3NNSA 4N3NA 4ARVA 4BKQA 2IY7A 3E6AA 3KQHA 4J91A 4FI3C 1MZVA 4XQEA 1YB5A 4IWXA 3I3OA 1M72A 3RC1A 1LRLA 5E6RA 2PWPA 4W8HA 1PFWA 1TA9A 1NAIA 3B5IA 3HADA 1NURA 4B7XA 2CY0A 4A16A 3D43A 3QU5A 2E89A 3D5TA 4RL4A 4HGYA 4C05A 3H9CA 3FZQA 3QV1A 2R4QA 4QM7A 3T5PA 3KB2A 2OL4A 3AJ8A 3MD9A 1UFOA 3DE6X 3FPBA 2R6R1 2FQWA 5U1PA 3LAWA 2C97A 1Y33E 2HSDA 3EE6A 1EVYA 1PLLA 2XBMA 5K7SA 1EM6A 3G13A 2QSUA 1SXQA 2G36A 5LXTF 2D1FA 4D4IA 3H16A 3T95A 4ND4A 3ZYZA 1R0CA 4IJ6A 4G09A 5AHOA 4B3XA 3HXTA 3IUYA 4XYBA 2WB4A 1B26A 4PQYA 1PU2A 2RMKA 5H70A 1Z56C 3W2HA 1T24A 1U90A 1T5SA 3KTAB 4CEIA 1M2FA 1YQUA 5DTJA 4YHHB 1DC4A 2FPRA 3OECA 1JMVA 1ADBA 4ACBA 3I1JA 3QJYA 3X2SA 4BGVA 1KY2A 3G9TA 1GTG1 4KCGA 2R2AA 4ER3A 2FZ5A 5CXXA 2BGJA 4BNTA 4FNOA 1LNZA 3K9HA 3BQ9A 4LNAA 5EVJA 5KNCA 4BTVA 2DT8A 1UWCA 1L8AA 3B82A 1ZRNA 2IYYA 3W5DA 4RCZA 2Z08A 1UKEA 1IUPA 4EI7A 3OH8A 3KT8A 3TSZA 5JZVA 1JG6A 2PMDA 4BO1A 1JPJA 3RUEA 4IPTA 4XYGA 3VU1A 4ZRNA 1EK6A 2D1QA 3E61A 2EJTA 5LP1A 3W2EA 4FQ8A 3CLTC 4UNRA 5JH7F 1FFXA 1M74A 5E4TA 3KR0A 5D1HA 3RTCA 4PFSA 2B0CA 4TOIA 3DBHA 3H87A 4ILKA 1KFJB 3G2JA 4ALKA 4EZBA 2ZJYA 2EAUA 3VU9B 3JAKB 1V5EA 2UZ3A 4C04A 4W9RA 4NENA 4QTUB 4YJ3B 2I2DA 1CYEA 3GOHA 2ZCUA 3ZE0B 4GMGA 3N39C 3VKWA 1BHQ1 1T1GA 1W7AA 3U3OA 3T9CA 1CV2A 2XVZA 5JD4A 1FP1D 2CZCA 2JJQA 3NDPA 4DM3A 1XX6A 2C2BA 1AZWA 3DTTA 2O2ZA 2A1TR 3GLQA 4C43A 3W7AA 3KRTA 1AQNA 5AFSA 4CIXA 4WXPA 2H0RA 1J33A 2Q6OA 4QEDA 2R751 3NEJA 5REQA 4MV0A 4H18A 2F3SA 4EG6A 4R9NA 2FR8A 4BC1A 1IHXA 4MQLA 4L9RA 4K40A 1TOAA 3QYJA 4ABTA 4GOOD 1H4SA 4GPTA 3H1EA 2F7SA 2ESRA 4OMFG 5F4ZA 3E82A 1X74A 1U0FA 3TM5A 2I65A 3K94A 3P2KA 3LQQA 1EFTA 4WZAE 4OBBA 2ZJ1A 1HDRA 2L2QA 1Y5LA 2DH6A 2VHEA 4N6OA 4Y67A 2HMTA 1H9CA 1U5AA 3MCZA 1X1QA 4K6KA 4PXYA 1RQ7A 4URUR 4FYHA 4HXYA 4X8OA 2BCJQ 1ORWA 1JJ7A 2WSIA 2C94A 2F2TA 1FDSA 3OUTA 2C59A 4ZYXA 2GPTA 1FSFA 3KK0A 4YRRA 2L82A 4MWDA 2EV9A 1X0VA 2Q9CA 1E1QA 3WWYA 5KTPA 4M99A 4K9PA 3V8PA 1C1HA 4MWTA 1DX6A 4CMEA 4TMWA 4R4JA 3LP8A 3D3WB 4RTNA 4D02A 1FCJA 1WRBA 3LA6A 1Y6JA 1RI3A 1C9KA 5AVUA 1VJCA 4ZEVA 5IN5A 2VQEB 4RTKA 4JT9A 1MQ9A 2GJAA 5EAIA 3HDQA 4QDTA 4X94A 4COOA 5DHQA 1QPBA 1CIJA 4ZYVA 4BEBA 4B3FX 4JT8A 5I01A 1ODTC 1T2VA 2BI8A 2OLJA 1CUJA 2QRLA 4FFLA 4OQXA 3ICEA 4EMSA 1OI3A 3BF8A 5BMVF 1H3EA 3MMZA 1VXOA 2VDKB 1J90A 3PGLA 5DEOA 2F1RA 2VCYA 5KNDA 5KYYA 1M5RA 3KZVA 1E7SA 2V45A 4EGQA 2V55B 2GGSA 2J3DA 2YV1A 2ZIAA 3QW4B 4OD0A 3NFYA 4CG1A 5IKMA 4YJDA 1P5ZB 1W1UA 2DSNA 5HRAA 4D26A 3MCUA 2NU9A 2MOKA 4J4HA 3QF7A 5JDIC 3V55A 2FPGA 4GVPA 1QU3A 5ABPA 2OBLA 1QKJA 2YW2A 4XCXA 4XASA 5FQNA 4YAUA 2I87A 5F64A 2EP7A 1ZMBA 4FZVA 2X0DA 2WMDA 3WV5A 4DIOA 4WH0A 1DDGA 3D3QA 3AFMA 5EXDA 5DP1A 4ZKEA 1N5LA 3BDVA 2H1VA 5KKAA 4B32A 4PG4A 2WQZA 5CGZA 1NBWB 1RTKA 3GAAA 4BP1A 3EK2A 4PVDA 3AEQA 3ROKA 4YCMA 3SM3A 2VSFA 3EQ8A 1QNLA 2OV6A 2P7HA 4URXR 4C2AA 1N1EA 1NDUA 2JLBA 3G5UA 4JGBA 3QX3A 1L3BA 3QI2A 2HRZA 1PUXA 1F20A 1Y3AA 4H1TA 4D82A 2NNWB 4R8KA 5EHGA 1IOLA 4GMXA 1F7VA 1QTQA 3I9JA 3K8OE 5J23A 3EGDB 4FFPA 4RVNA 3TJZA 3U60B 1C7IA 3HB5X 2AFIA 3L7MA 2CWDA 3PT9A 1O97C 1UWVA 5BWCA 4NJMA 2HJWA 1FTSA 4JU8A 5CFOA 1OKKA 1WKBA 9MHTA 3R5FA 5TMPA 3HVUA 2IV7A 2FHPA 1N9GA 2F4NA 2QTHA 5C1OA 1LXCA 5KAMA 3PQ3A 3NHBA 4DL9A 2EJUA 3CX4A 4UUMA 4IO0A 4BJ5A 1S7GA 5EPUA 3AY3A 3G0GA 4KE8A 3IDQA 1DAOA 2H0AA 4GS5A 1MW9X 2PHZA 3K20A 4QDZA 4Y2YA 4J07A 5DN6A 4KR2A 3VUEA 3E3LA 2JJYA 4GE3A 1G60A 1WKVA 3D6NB 3DCYA 3Q3VA 2PBFA 4GWKA 4H3VA 4LF7B 3PQCA 1C7JA 1NX9A 2O2JA 3CX3A 4JXKA 1B4DA 4F2WA 3KJQA 1YB7A 1OR8A 1ZK1A 1OZ0A 2Z9CA 3TZCA 3NVKI 4N0MA 1SRQA 2E4WA 2GCPA 2X22A 4KR9A 2CMGA 1EPUA 1KJ9A 4IHJF 4WTOA 4BDTA 4TKVA 5AKJA 5KJCA 4RE5A 1SG0A 1Z36A 3RLFA 3R4VA 3PUVA 2ODAA 4PAWA 2Q4TA 5DBFA 2ZREA 1S6YA 3AZOA 3TI9A 2GKSA 2W11A 3DL0A 3ZIAA 5JS7A 3OQHA 3T38A 4MWGA 1KGSA 2AG1A 1H4VB 1NXSA 1TPZA 2AZDA 2HBYA 2ZG6A 4UPVA 2Q28A 3S0JA 1I80A 1T5BA 1L1QA 2NXEA 4B4UA 5F12A 4CF5A 4RMNA 1A5SB 2QKYA 2OV4A 4RZXA 2W6CX 1T10A 2O2IA 2VLBA 1RADA 4RM2A 4IDAA 3RVOA 3GB9A 3QA9A 1KOLA 3T9DA 3I9OA 1C3EA 5BUCA 1YDMA 1JR3A 1WDWB 3JSXA 3GVPA 2GM3A 5GV7A 3OOYA 4LYGA 4YXFA 4KW7A 4L95C 4WZZA 3H6HA 2CHEA 1LV7A 4QBFA 3L3BA 4BO6A 4DLWA 5FOQA 4QFCA 1C8BA 5DSTA 3CTPA 3M1IA 5BPFA 5TT0A 5DMHA 2F1HA 5G2OA 3ZCTA 1G6KA 1LWOA 1J2YA 4LWQA 4TL6A 4KUEA 1ICIA 1YA4A 3L02A 2H4FA 2B1RA 5J9FA 4QJ5A 1C9DB 2AG0A 3BERA 4XLTA 2QBYA 1K6XA 5D86A 1XK7A 3A3OA 1S2GA 1NJ5A 5EMLA 5A1JA 4KO1S 5AKEA 1UOPA 3GFBA 2GBFA 2YBDA 1J20A 2I7CA 3KO8A 3L0OA 2HQ1A 1DAIA 3WAKA 1POWA 3DBVO 1H8EA 4LJKA 1DC3A 3ORYA 3OLWA 1KO1A 4JBXA 4K8RB 5ALPA 4MR8A 3SSNA 1MX1A 3FLMA 2Q8QA 5JO0A 1A8IA 4EW1A 2OV2A 1AQUA 1B15A 1VCHA 4RIHA 4ITRC 4BMOB 4EGJA 7REQB 4LIPD 5HZMA 2C78A 4WK4B 3W0LB 4MYRA 2XF8A 4D98A 1YNSA 2JGRA 1D6NA 1UXHA 4Y3UA 1E4VA 3QPUA 1TTHA 2FSHA 2Y0CA 3HSSA 1GQQA 1J56A 1QCYA 3AO0B 3HU3A 3ICCA 3PUWA 4HFJA 4N5NA 3PIIA 4ZO6A 3LBAA 3LU1A 4D46A 2AG5A 2DPGA 3EXHB 1XO1A 1J7KA 1HG0A 4YI3A 1EGVB 2X6QA 4AJKA 2C4TA 2I4LA 5FWDA 3RC9A 1JEDA 2G0AA 4QPPA 5AW6A 3HGQA 5KOIA 2RC6A 4HVLA 3MBIA 3WLEA 2HF2A 1V47A 3BIJA 3BXOA 4XIFA 4BWYA 3F2IA 5E1BA 1IK6A 3CWCA 3G7UA 2X0JA