2HK8A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
266
Chain Sequence
MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords Shikimate dehydrogenase
total genus 88
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk8A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk8A01
1HKUA 4WLEA 3H5AA 3V2UA 3A4VA 1P45A 4I8XA 1GTMA 2CVOA 3ZH2A 3LT2A 3ADOA 3QA9A 3OH8A 3ZU5A 2ZJ0A 3JQAA 2AE1A 2W8ZA 1I2BA 3I4FA 1UR5A 4KUHA 2B5VA 3AUSA 4GSKA 1PIWA 4GWGA 4WLVA 2HQ1A 4WE3A 2YV1A 4AG3A 1W4ZA 3B6ZA 2NVUB 1G0NA 2R6JA 4ND5A 4BQPA 1VE9A 1EBUA 2NU8A 2QG4A 1X13A 1Q7BA 4FFPA 3UCXA 2O4UX 1GYRA 4XR9A 4GAEA 5T6BA 1A5ZA 4RJTA 4I9HA 1ISHA 4R1SA 1MX3A 2FHSA 2X58A 3H9UA 1S6YA 1N9GA 2PZMA 3DZGA 1GYPA 1UP6A 4YWJA 4XB2A 1EFLA 1B0AA 2CZCA 1DIGA 3ENKA 3LZ6A 4J16A 2X5KO 1QYWA 3D3WA 4JJFA 5B4TA 3O26A 2XF8A 5C7IO 5A9SA 3QIVA 4YAJA 1Z7EA 3EW7A 3F1LA 4TRRA 5A02A 1H9AA 1YBVA 1PL8A 4K9DA 2VQ3A 1PJ4A 2FZWA 5JNLA 2OFPA 2NACA 1E1NA 1N92A 2HSDA 3PPIA 1ZVMA 1ISMA 3QWHA 3OIDA 5BSHA 1BW9B 3GR6A 3UGKA 5GZ1A 4RORA 1NQAO 2HKIA 2X23A 1NXQA 4E3ZA 1ZSNA 4K1LA 2DKNA 4YT8A 3ANMA 3JCZA 1QLJA 2AA3A 4D41A 4F6CA 5C3MA 2I6TA 4XYLA 2IYOA 4OSOA 1FDVA 4OKIA 1F12A 3I6QA 4GMFA 3VPFA 4F46A 4CQLB 3UVEA 3ZU2A 4XYEA 4AJNA 2PV7A 1DRUA 2O7QA 4QQRA 1HWYA 3V5NA 3VH3A 1NX6A 1E3WA 4NPCA 3TN7A 3BXXA 2Q1WA 3D5QA 3OFSA 3JQFC 3AWDA 1VKOA 4FDAA 1R0KA 1ISGA 4ALLA 4IDDA 1U5AA 4CLOA 4UUOA 5DCYA 2OBNA 4IGEA 4XJSA 3M2TA 4KDEA 2QX7A 3L6DA 3WTCA 2I99A 1RWBA 1NQ5A 1MG0A 4DGSA 1QLHA 3JYPA 3GZNA 1I24A 3KEQA 2VCYA 4N5LA 1EMDA 4TQGA 3L0DA 2LDXA 3BYZA 1VL6A 1EUDA 1E7QA 4YJHA 4ZN6A 2PD3A 4OQZA 4IQGA 2GRAA 3GLQA 1PQPA 2B35A 3Q2IA 2GERA 2DPGA 1DRWA 3RC9A 1GZ3A 2BELA 1Q0HA 2JCVA 3LF2A 4GBJA 1AGNA 3O9ZA 4I08A 3ZN2A 3E9MA 4HXYA 4YEDA 1UAGA 4AJ1A 1PTJA 2GD1O 1DJQA 2D59A 2RBEA 5T8KC 3PFFA 2Q50A 4UUPA 3V2HA 5JXWA 1PL6A 2C54A 2OOSA 3H2ZA 1I32A 5A5EA 3VVBA 4L4SA 4L74A 3R3JA 4D45A 3DFUA 1U1IA 1VL0A 1JAXA 1C14A 1DBVO 3PYMA 1T25A 3QVOA 3STHA 4JP2A 4OKNA 1LSSA 2FN7A 1JU9A 3LC1O 5AXAA 2JCXA 1QKIA 3PQDA 3COSA 4PZDA 3MTGA 5JE8A 3WYCA 4TRNA 2EKPA 3OMLA 4J2OA 1IPEA 1GPJA 4JP3A 1ZCJA 3DTYA 2GDZA 2H63A 1Y8QA 4EEXA 4QUKA 1NWCA 3W4KA 4MVJI 4L8VA 3K8ZA 3NGXA 3SC4A 1I2CA 3OSUA 1P77A 3PVZA 4I5FA 2A4KA 4BB6A 1UDAA 5EERA 2EW8A 1Z7BA 4WLOA 1M6WA 1OC4A 3TFQA 4DLAA 3EMKA 1OFGA 5EINA 1N8KA 4U0KA 4GKBA 1X14A 3FHLA 2V65A 1XDWA 3F9IA 1TXGA 3I9OA 4J91A 3HDHA 3CMMA 4RPJA 3QY9A 1E1LA 3IDSA 5TNXA 3PEFA 4DPMA 5L51A 1X7GA 2EKQA 3PLNA 4KWIA 3FCOA 3EVNA 4O6VA 3QLJA 3SXPA 2CY0A 1X15A 5JC8A 1SOWA 3SJUA 1KVUA 4ZRNA 5JDCC 1P33A 2YY7A 1R12A 2HDHA 2J5QA 4I9UA 4G5HA 4RVGA 5IDYA 3HE3A 4QECA 3AY7A 4ZICA 1LDEA 5AVOA 4Z6KA 1QORA 2HCTA 3HB4X 4CM4B 3VH2A 1Y8RA 1M6HA 2P4HX 1DPGA 4Y6SA 1E3LA 4IDCA 4BNUA 3IOYA 4LMRA 1PS8A 2G5CA 3QVXA 1WXDA 1K0UA 1U4SA 2J3HA 4BO7A 1W6UA 1A72A 1ZZEA 4D44A 4XQ9A 4D43A 2G82A 2NM0A 2IXAA 1PWZA 3JV7A 1PJ2A 3GVCA 3KM0A 3GMDA 4J49A 3OECA 3QRWA 2W90A 4I5DA 4EJ6A 4LCJA 3S8MA 1ZEJA 2VZ0A 4CMCA 3KETA 2G1UA 3OP4A 4CUKA 3CPSA 2FRDA 3HHPA 1N1GA 4I1IA 3KO8A 3WG9A 3K2BA 5EJ2A 2D0IA 3RI3A 3AM3A 1WZIA 4BNXA 4C7JA 1W73A 1QR6A 3L77A 3IKTA 1LDYA 3PWKA 3GRPA 1TEHA 1K5HA 4CM7A 3SLGA 4NG5A 1EE9A 3AM4A 2VTEA 1P3DA 1HZZA 2Y1EA 1O94A 3BHMA 2J6IA 3HDJA 5TC4A 2X0IA 5A1TA 4EEZA 2HJRA 4DLBA 4N18A 5G0WA 5HRUA 3UXYA 1E7RA 5A04A 1RYDA 3F4BA 2H9IA 3C1OA 3HNPA 5KKAA 1NM5A 2WYWA 2D1YA 3QWIA 4L0QA 1MV8A 1MG5A 2NTJA 3VKUA 1HDYA 3BMCB 1XHLA 1L7DA 2P9EA 3L4BA 5EQDA 4JNKA 2CDAA 3AY6A 1U9JA 2IE0A 1NQOA 2YHIA 4J90A 8LDHA 3GG9A 2Q4BA 2UYYA 5HBRA 2OGUA 4GKVA 1FDUA 4BO1A 4LW8A 4XCVA 3GFBA 3ROKA 5L7TA 1KEPA 3JYLA 3G0OA 3VPGA 1LSJA 4O5OA 3GDOA 4KMSA 4DTIA 1HEUA 4J4HA 3C1TA 5B37A 1YL7A 3FNGA 3PHGA 4WECA 5I7FA 1U3WA 4ND2A 1E7SA 1ID1A 1QMGA 1FDWA 1X7HA 3Q9UA 5KVVA 1LLUA 3ON5A 5G2OA 1KY5A 3DFZA 2X9GA 4FC6A 1BVUA 7MDHA 4J1SA 1QSGA 3RJ9A 4W9NA 5JY1A 2Q2WA 3TF5A 2GZ2A 3DB2A 2C5EA 3HFSA 4JXKA 2HRZA 1VI2A 4TMFA 5DCWA 3DMTA 2X5JO 4CMIB 4OSPA 2D5AA 1N7GA 4CM1A 4TZTA 4OXKA 4YAGA 4CV3A 3DHNA 3OEWA 4E31A 3ANNA 1GPDG 2EERA 4YYZA 1GDHA 1YE3A 1I30A 3PP8A 3H9GA 2O3RA 4LSMA 3GG2A 3H2SA 5KJCA 3LDHA 4CQLA 4PLFA 5JFOA 2YV2A 4Y67A 4CMBA 4OM8A 1EZ4A 2NV6A 5HS6A 4QEDA 1AHIA 3E5RA 3D0OA 5I7EA 4CMEA 4BNFA 4YXFA 1IZ9A 3RUCA 1LLQA 3WB9A 3CXRA 2J8ZA 2VOJA 4WASA 4B3JA 4MIYA 4MP8A 4A27A 1UXIA 3BHIA 4N5MA 2BFPA 4OJNA 4TKMA 4TSKA 2B37A 1DFGA 1ONPA 3CMCO 1O8CA 1YOVB 3SJ7A 3RUFA 1N1EA 3WS7A 9LDBA 4BO5A 3GRKA 3KOUA 2D8AA 4BNLA 1IHXA 2VRBA 4GSLA 1SBYA 1QV7A 2ZQYA 4ALJA 1LNQA 3VZPA 1PX0A 4AJJA 4CM4A 1C0KA 3ETDA 1N9GB 1MXHA 4AVYA 4BO2A 3CKYA 2GN8A 4HY3A 3I9JA 5GZ6A 3D4PA 1F0YA 4BO3A 4E2WA 4I9NA 4IDAA 2VUUA 3M2PA 4L73A 2ZYDA 3I1JA 2PKQO 5ENDA 1KOLA 4CR6A 3JQFA 2X6TA 1MA0A 2AQ8A 2O50A 3GC6A 3WICA 3JQ7B 3U3XA 1YDWA 4PGFA 5K9ZA 1Q0QA 1VL8A 4UVDA 3GT0A 4WEOA 4IGFA 1LRKA 2YJZA 3G49A 4I5EA 3ZHYA 4RVSA 3DBRB 2DT5A 1ZMOA 4R3WA 1WLYA 3OHSX 1N7HA 2V6MA 1G0OA 3PYXA 2F00A 4IJWA 2X0NA 1P1FA 5CEJA 3GPDG 1BGVA 1PGPA 3QSGA 3ZU4A 4IY1A 3VAZA 3VH1A 2OXIA 3W8FA 3NTQA 1I3NA 2Q4EA 4DMLA 2PKRA 4H3VA 1ML3A 1GAEO 1BVRA 4M89A 2YDXA 4ONEA 2DTXA 3KYBA 3IQDB 1DC5A 3ITDA 3OICA 4RVFA 3NAQA 5DF1A 2PWZA 1DO8A 2GF2A 1YB4A 1E3IA 1LDMA 1T26A 3KSDO 2UUOA 4KQXA 4BKPA 4D46A 4OMUA 2EJWA 4IDFA 5CEEA 3RKUA 3I9KA 2B4TO 2E49A 2FMUA 3WDSA 2WYUA 4A10A 3CTMA 2AG5A 3CEAA 5TT1A 4JQCA 2OBYA 4IQ8A 5AOVA 5JDCA 4R1UA 2EEZA 1YQDA 2DBZA 1HDGO 4BGEA 4RV9A 2W2LA 1QP8A 4MVJM 4XDZA 4XWYA 3MJTA 4NFHA 3B1JA 2P91A 4M55A 3RFTA 3VPHA 2DPHA 1GV0A 3U4IA 1T24A 3ROMA 1U7HA 1BW9A 2B0JA 3FI9A 5JAQA 2ZB8A 2PZLA 1NP3A 3UW3A 3BTVA 4KP7A 2PH5A 5CFZA 4II2A 3ROPA 4CMJA 1F14A 1DAPA 5FI3A 2W2LD 3WBFA 1WMAA 4BNNA 3GOHA 3NT4A 1LEHA 1IULA 4LGVA 4MVJD 2PNFA 2X4GA 3I23A 2NTVA 3RBVA 4AJPA 1I10A 2VTDA 3TL3A 5I9NA 1SC6A 2O3TA 3EDMA 1NFRA 1CQIA 2ZYGA 4JJGA 2TMGA 1LDNA 4NHEA 4D79A 4CM5A 1DC4A 4ZQHA 3GDGA 4Z9YA 2NU7A 3DZHA 1R0LA 2ILTA 1A9ZA 2VHXA 2Q1TA 5L7WA 3TSCA 3RSHA 4RGBA 5TRTA 1U3VA 2EIHA 1XWFA 3K92A 4DVJA 3CIFA 1WVGA 2AG8A 4J1QA 4LISA 5K6AC 1S7CA 3PHIA 1Z6ZA 5DBIA 1DIAA 5THQA 2DU8A 1UZMA 4BO8A 3BHJA 1EK6A 2OO5A 3A06A 3RCBA 3DBLB 4A73A 1YXMA 4IDGA 1I8TA 5G4KB 3SVTA 1BDBA 2AXQA 3P2OA 5JYDA 1EVJA 1VLLA 4CODB 1Q7GA 4YQZA 4CL3A 7ADHA 3FWZA 3A14A 1JA9A 1H93A 1SCUA 3U4HA 2B5WA 1R4NB 2UDPA 4P38A 4L76A 1J0XO 2IDZA 1P0CA 4IMPA 1C0PA 1Y81A 3UFXA 4N5NA 5T57A 1GU7A 4PLYA 2I3GA 3RFXA 2JD1A 3ONFA 1C1XB 3SC6A 2HO5A 2DLDA 4FFOA 5ER9A 3ZWOA 3UAGA 5LCXA 3LT4A 4UAGA 3QJ5A 2ZTUA 4WK6A 4CMEC 2AQHA 5I8ZA 1LDGA 4R69A 2VHZA 4ITUA 3QE3A 3FRJA 3SX2A 1Q1NA 3L9XA 2A94A 4JX8A 4RF4A 4XGKA 2JKVA 4J9VA 4B8WA 1KEWA 4ZQBA 1ZH8A 4BNZA 3JQGA 3TNLA 4G65A 3VZSA 4NDNE 3F3SA 2DTDA 3C1AA 1A27A 4BKRA 4U8GA 1KETA 3RU7A 4IQ0A 4YB8A 2D4AA 1E6EA 3MOIA 3ZHBA 2ZKLA 4ZRMA 2FSVA 2X1HA 3GGPA 3ZV4A 2I3AA 5IN4A 2JL1A 3H7AA 3JQGB 2BKAA 3ADPA 3EY4A 3DOJA 3JD3A 5B1YA 1HYEA 3ROQA 1X0XA 3ZU3A 3ZWMA 1TT5A 4OOEA 3AUAA 1NFQA 3NJ8A 1BDMA 4XEHA 1VSVA 3LU1A 4PIVA 4K6CA 4RPHA 4URFA 1LLDA 4W7HA 4MJLA 2DBQA 1SNYA 4B3HA 2O48X 3WWYA 2OZPA 2Q1UA 4MVJP 1OAAA 5L53A 2BRUA 4AJEA 4UEOA 1C1XA 2C5AA 1UJMA 4YTEA 3ZV3A 4CV0A 4ZJUA 3ITKA 4S1VA 3OQ6A 3ZCXA 4KZPA 3IP1A 3AU8A 3L4BC 4R4JA 4IUYA 1U3TA 3RQSA 4CL8A 1K2WA 1DJNA 1PJCA 2FWMX 4Q3EA 3RAJA 5CHEA 4Z9XA 3DEYX 1UDBA 3VHRA 1PZGA 1E3SA 2GZ1A 3GZNB 3NUGA 5KVQA 2JD2A 2FSSA 1H6CA 1Z75A 3GEDA 3WNQA 1PZHA 3FN4A 3NYWA 4B3IA 3E48A 4DIFA 5IZCA 3GGGA 4BKOA 4OO3A 1JVBA 1FJHA 3O8QA 4OH1A 4GX2A 2C7VA 3NRCA 4CM6A 2AW5A 4DC1A 3IUSA 4NBUA 4ZU3A 4BNVA 3GVIA 4Z0PA 3IS3A 4E5YA 2BI8A 2VUSA 4S3MA 3RBXA 2Q1SA 4UVIA 2A35A 2CDCA 1YS4A 2B4QA 4GLLA 3H8VA 3I9LA 1P44A 4LK3A 3IIEA 1R16A 2GN4A 4E5KA 3GN1A 4IZHA 4JBHA 4FFNA 4DIOA 3I83A 1V8BA 3TZ6A 3B20A 3TFOA 5B4UA 4J7UA 4KDFA 2X22A 4M87A 5ILGA 1BXZA 1SB9A 1U7TA 1HYHA 3DZFA 3JTMA 3TRIA 4J3FA 4DBVO 2XXJA 1TT5B 4NZ9A 5AXDA 3Q11A 3DWFA 1ADCA 1DIBA 4HADA 2FY8A 2VUTA 2ZTMA 5EL0A 2ZQZA 4Q3NA 3IP3A 3WBBA 1NHGA 2HMVA 2GUGA 2O4CA 2I76A 2UVDA 3KEOA 4J4BA 5U4QA 5A06A 2Y1DA 3DOOA 1WWKA 5TIIA 4II3A 4XD2A 3JQAD 5CDSA 1X0VA 4P8RA 5BSEA 2WMDA 4JIGA 5KJ1A 3VVCA 5G4LA 1HLDA 1SB8A 1GQYA 4ALNA 2ZCVA 4EBFA 4U5QA 1NHWA 4P4LA 1R66A 1LRLA 3MOGA 4ZVVA 2QRKA 4BNYA 1E6UA 2DFDA 1P1HA 1U3UA 3DTTA 3PI7A 4UREA 3BMNA 3JQDA 3M1AA 3LT1A 4XGIA 3B1KA 3X2EA 4BO6A 1GEEA 1H5QA 3ZHXA 3VPXA 1HT0A 3V1TC 2VT3A 1EVYA 2Q2QA 1PR9A 1XCBA 2HU2A 4LVCA 3F46A 2RH8A 1HL3A 1K89A 2O23A 5IDXA 4Q3CA 4CM8B 3ZWCA 1ENPA 3A9WA 5IDQA 1DC6A 5JPIA 4XQEA 3RVDA 4JJIA 1R4NA 1XYGA 1SMKA 4IINA 3S2FA 4IS2A 3E03A 3FD8A 5COAA 3C7AA 3E5MA 4AJ4A 4BL5A 4J1NA 3PZBA 4BNIA 4WJZA 3LSYA 5F1KA 3BMOB 1KVRA 1TT7A 4GX5A 2C59A 1IHYA 3OJEA 1AUPA 1HSOA 4RQUA 1A7AA 2Y05A 2DQ4A 1VJTA 1LSOA 5IJZA 3NT2A 3DHEA 1GUYA 1T2EA 4PLWA 1CEQA 3DZKA 5KIAA 3H3JA 4CMKA 2NNLD 4PFJA 4NIMA 3ZNNA 1NAHA 2BMAA 4W7IA 3TJRA 4E2ZA 4GVLA 4WLFA 3E9NA 3NX4A 2JJYA 2W2KB 3AY3A 3MJVA 1EUCA 2EG9A 1BRMA 4BHTA 1EE2A 5CEFA 3PDJA 4YDRA 1K6XA 2Z1MA 2F1KA 1TVEA 2B4RO 2O3SA 5IAAA 3D7LA 1UH5A 1XR3A 3O38A 4RDIA 3ZNQA 1O0SA 2X0RA 1ZNQO 2EWMA 3DONA 4W4TA 4E0BA 3KZVA 5F21A 3PYLA 2DM6A 1EQ2A 4Y9DA 1ZUD1 2GLXA 1ZW1A 4EGFA 3E9QA 2W4QA 4AICA 4BNKA 4U6SA 4Q3AA 3WMXA 2WJPA 1KERA 2WD7A 2WWRA 1A7KA 2A92A 1LXCA 1NQTA 4PVCA 3C8MA 4CUJA 4YR9A 3FSRA 1UXGA 1MUUA 1YGYA 5JAZA 4CLRB 1G6KA 1P9LA 3L6OO 4OL9A 3GAFA 1JQBA 1Y7TA 1YJQA 4UUNA 2G17A 1V35A 4M54A 1XSEA 3EVTA 2WDZA 2WE8A 5KJFA 3ORFA 5FYDA 2V7PA 3HFGA 4Y8VA 4UVGA 1PGOA 1LLCA 1T1SA 3RC7A 4E5MA 1D7OA 1NR1A 3W4JA 2P2SA 5JS6A 2VWPA 5DULA 2IEDA 1PR3A 1ZK4A 4WPGA 5DZSA 2JFFA 5U9CA 4DRYA 4JBGA 4L4XA 5FWNA 3SEFA 4OYRA 3GVXA 5IN5A 4ZQFA 2CD9A 1VC2A 3JD4A 1E3JA 3JSAA 4FD3A 2HRBA 5CP8A 1ZJYA 4FJ0A 5L7YA 3F47A 4E2XA 3KYCB 3KYDB 3ENNA 4WLNA 1PJLA 3H9JA 4HNGA 4R01A 1Z45A 3FBGA 3A1NA 3MTJA 5DT9A 1HZJA 1HSZA 3WR5A 2ZATA 1ZO8A 4CMHA 3GFGA 1SEVA 2IEBA 3QP9A 4LRSB 3C85A 1P1RA 3AI3A 5HM8A 2NVWA 5KCZA 1E3EA 3C7DB 4E5NA 1M2WA 4BKUA 3DO5A 3T4EA 2PY6A 3E82A 2IRWA 3ZWVA 1ADBA 3EZLA 1JKIA 3D1LA 4D42A 4KTTE 3B1FA 2WTBA 1VM6A 4IJVA 3RU9A 4CMIA 3TQHA 4J4TA 4YCAA 1DDOA 1ZSVA 2BD0A 3E18A 4UEJA 3Q0EA 3D4OA 4AL4A 2I9PA 1B3RA 1BMDA 1R37A 3LYLA 2XAAA 2VN8A 2QQ5A 1ZIDA 3GGOA 1RYEA 3WYBA 2PKQP 3MCVA 1GV1A 1UP4A 2FPPA 1QYXA 1VRWA 3ZWWA 1WW8A 3WNVA 1BG6A 2X0JA 3LK7A 4P4NA 1WP4A 4XZ3A 2PZJA 1P1JA 4PLGA 3KB6A 3UF0A 2UAGA 4EUHA 1M76A 5AXCA 1TLTA 3ZZNA 4PLTA 3R6DA 2H6EA 4TKLA 4DC0A 4ZQGA 4MIEA 3WJ7A 4J43A 2HMTA 4LCEA 3VTZA 1PS9A 2Y0EA 3OA0A 1IYZA 2EGGA 4DUPA 2A9FA 1NASA 1ZK1A 2W2KA 2POQX 1O6ZA 1GR0A 3WLFA 3INTA 5ICMA 1DC3A 1Y9AA 5EQFA 4IIUA 4IBOA 3CUKA 1EFKA 1QYDA 4E6PA 1I3MA 1C0IA 1I5RA 2AEFA 2IZ1A 3Q9NA 5CPBA 4PZEA 1PJSA 5I7SA 3VH4A 3EAGA 3PJEA 2DUWA 2EGHA 4X54A 4HFNA 4HV4A 3ULKA 3PHLA 1WDKA 1SEPA 1P31A 2EF1A 5JYEA 2C7GA 1MC5A 3KRTA 1T2AA 4KWHA 3U5TA 2P4QA 1PZEA 5TSDA 4BUCA 4FGSA 1AXGA 3PJFA 4LSWA 3K73O 3Q3CA 3ZW9A 2LDBA 3OF2A 1H2HA 5DCUA 1O89A 1ENOA 1A9YA 1ISFA 3JQAB 5DDIP 3DC2A 4EUFA 3ZWXA 2PLAA 4IS3A 1V6AA 4DYDA 1V3TA 3PTZA 3E1KA 4BV9A 4DA9A 1SAYA 5JC1A 2X9VA 2J3IA 3K30A 1E1KA 3I4CA 2ZJ1A 2YFHA 1I2ZA 3PDUA 4QO7A 4WEQA 1WMBA 3IUPA 4U7WA 1SO8A 1DIHA 2Y1OA 4J6FA 3W8EA 2CVZA 2H5LA 3BMCA 3NT5A 3PIDA 1E7WA 1C3VA 2OUIA 5BNFA 3ZWPA 1ISJA 3OBBA 3GEMA 3WOHA 1TI7A 3EZYA 3HN7A 4R68A 3C7CB 3ZW8A 1RJWA 4D3SA 3ST7A 4WKGA 4WLUA 3CZMA 2RHCA 2Y93A 5COBA 1KVTA 1HDCA 1GQQA 1ADFA 2PH3A 3VDRA 1ULSA 5A9TA 1K6JA 3H3FA 3KUXA 4CM9D 1GYQA 1UXHA 3TL2A 1JKFA 1KYQA 5BNIA 4OGWA 4PVDA 1YDEA 3DBLA 4PG7A 4AFNA 4PLCA 3ZHZA 1HTBA 1DHTA 1E77A 2BHLA 2UV8A 3RBZA 5IFLA 3OJFA 3INRA 3BTOA 3FR8A 5EPOA 4YVFA 5TLSA 3IJRA 1RM4A 2J3JA 2O2YA 1GUFA 3HADA 4XRGA 1DEHA 2O3QA 3S2IA 3ZV6A 4A03A 2FP4A 5DBFA 2P5UA 2JFGA 4E32A 3ZWBA 1KY4A 1Y9EA 2E82A 1GCUA 5DP1A 1PJBA 2PGJA 3HG7A 3ONDA 4R5HA 3U4DA 4E5PA 2Y0DA 5I9MA 3R3SA 1EQUA 2OMEA 1LI4A 1ZK0A 3UH1A 2DUUA 3RC2A 4CM8A 2BGKA 4DYVA 3VZRA 1ZKMA 2QIOA 1KIFA 3NTRA 4QFDA 2GO1A 4YQYA 3U9LA 4EJMA 3DXFA 4RPKA 3LQFA 1Y5RA 4FIZA 4R9SA 4PLZA 1IB6A 1YVEI 5ER6A 1ONOA 5DNAA 5DOZA 4HNHA 2NLOA 1HETA 3HDQA 5GMOA 3WWZA 5CDUA 5TX7A 2FPIA 2VZ8A 5U1PA 1LUAA 4A5OA 4BNJA 5IG2A 4Z3KA 3PK0A 1LA2A 2E6UX 4ESOA 3PLRA 1W0CA 3U62A 2AMFA 3R1IA 3G1UA 4Q39A 4XGNA 2O2SA 2RIRA 1JLLA 2CUKA 4HFRA 3F5QA 2ZCUA 1E6WA 4PRKA 4B4UA 1B7GO 5JCJA 4L4RA 4YA6A 4MIOA 4GX0A 3FNFA 5KKCA 3FF4A 3JQ9C 5G0SA 1IZ0A 3EGOA 4FFRA 3L9WA 4FQ8A 1AE1A 4IMRA 4RLSA 1RPNA 3QVTA 3RWBA 4ALMA 4QXMA 1E3WB 4BO9A 5A3JA 1DB3A 4CLRA 3I5MA 1NBOA 2WEKA 2PD6A 3D3EA 5CAEA 4Z0TA 4A26A 3ZDFA 4FN4A 3AK4A 5L4NA 4XYBA 2ZK7A 3FPLA 2GNAA 2WD7B 3KLPX 5JCJD 3DR3A 2O3JA 3JD1A 5C7LO 5F5NA 1YJ8A 2JAPA 4XKJA 4IDBA 5JW6A 2YYYA 4L75A 3WXBA 4CLDA 4F3YA 2DBRA 1KEUA 3GUYA 3EK2A 4OXYA 2YV3A 3D64A 3GMSA 2Z1NA 1PJ3A 1Y5MA 1B2LA 4FBGA 3WLEA 4W9NC 4FCCA 3V1UA 4A7PA 3MJCA 1TA4A 4R1NA 1GCOA 1QG6A 1YKFA 2VYNA 2RCYA 3TWOA 1NVMB 4BKQA 2HK7A 3DBRA 3MWEB 1Y8QB 1ZMTA 3TZHA 1H6DA 2BFMA 5IZ4A 1LDBA 2Y1GA 4BB5A 1M75A 2ZIZA 1FDSA 3INGA 1UZNA 2BLLA 4YT5A 3T7CA 3BZUA 2Z5LA 6ADHA 1RM3A 2Y1FA 3P19A 4Y6RA 5JSFA 5F1OA 5LC1A 1PGNA 1UUFA 3NTOA 3UUWA 4UVHA 5EESA 4TWRA 4DPLA 1XU9A 2NQTA 3IJPA 1SPXA 3K5PA 3L4SO 2NWQA 1ISIA 3AI2A 3IMFA 1YWGO 4XIYA 1Q0LA 5DBGA 1ARZA 3QWBA 5L3ZA 4IPTA 4UUMA 3PQFA 5IF3A 2BGMA 2CNBA 1JW9B 2Y0CA 3NKLA 5JDIA 1Z74A 3E8XA 1LTHR 5AYVA 4CUZA 2OORA 4NR0A 4FW8A 4MVJA 4D3FA 4BGIA 4MP3A 1R4MA 3Q6IA 2YFQA 3WGYA 3NJ4A 3P5SA 5G0VA 3ZWYA 4CQMB 3UN1A 1NWHA 4M8SA 5GZ3A 5L40A 2RAFA 1R4MB 3AW9A 4E33A 4LMPA 3ZGYA 5F1PA 2Y1CA 1FXSA 4R3NA 4XA8A 3AFMA 3MZ0A 1MGOA 1ENZA 3FTPA 1HXHA 1V3UA 3P7MA 4CQMD 2JHGA 1YB1A 3H5RA 1NVTA 4DL9A 5HTOA 2Q45A 3H65A 1PSDA 5T8KA 3C24A 3ONEA 3GN2A 1T2CA 1WZEA 3ABIA 3PHJA 4RLHA 1HF3A 5THKA 4R41A 1E7YA 1AHHA 2HMWA 4R5MA 5BSFA 3D3WB 4J7XA 4MDHA 4YRBA 4EITA 1KVQA 2EJVA 1BXGB 1RKXA 2BFOA 2PGLA 3RUDA 3VKVA 2I65A 1J4AA 4IXTA 1L7EA 1EDOA 1ULUA 4E4YA 2AQKA 2FZEA 4Y6PA 2HJSA 3I9NA 2CF6A 2DVMA 2VWQA 3B70A 3A28A 4W82A 3ASVA 3WTBA 3GA0A 3QQPA 3VDQA 4A2CA 3EHEA 3Q1LA 5TQVA 4JROA 3C3XA 4NFSA 4R54A 4YPOA 2NVUA 3UCFA 3H9QA 1H0KA 2C07A 4HWKA 1G1AA 1HE5A 4FPXA 1FK8A 2PR2A 5CG2A 2GCGA 3RFVA 2QRJA 5FFFA 2OL4A 1D8AA 4HUJA 3WIEA 3TZKA 3ZWAA 2PGDA 1KS9A 1NR7A 1T2FA 3GEGA 1CF2O 4XIJA 1Y6JA 4CMAA 5JBIA 1XGKA 1QV6A 3WSVA 3PJGA 1YRLA 1P1KA 4B8ZA 1DLIA 3WFJA 4E30A 1OOEA 2C2YA 4NU6A 4FOSA 1A71A 1UAYA 4MO2A 5B4VA 3I9MA 5HWSA 3ANLA 1I33A 1K3TA 4HFMA 4RPLA 1C1DA 4MKZA 5L45A 2OHXA 3TDKA 1GY8A 4B7UA 1WPQA 4AJOA 1C1DB 1UP7A 5AXBA 2TMDA 1PWXA 1HRDA 2JFHA 3FTNA 3ZNPA 3FNEA 4P22A 3G3EA 3JQ9A 3WGZA 4AJLA 3T7EA 5I8WA 3QWAA 3CZRA 3OIFA 2D3TA 5TJ9A 1LSUA 8ADHA 1LC3A 1LC0A 4BO0A 3RUEA 2B69A 5HS4A 1V3VA 4HX5A 4RPGA 3PJDA 1CWUA 2J3KA 5AQ1A 2VYND 4PLVA 1F17A 2EV9A 2UUPA 2X9NA 5T5QA 3X2FA 2DBVO 4I5GA 1P0FA 2G76A 4Z3DA 2GPTA 3DBHA 3MJEA 4NBWA 4BMSA 2DAPA 3AM5A 4BVAA 1GD1O 5FI5A 4EW6A 3RIHA 1B8PA 4BOYA 1AN9A 1BXKA 4HP8A 2Z95A 3PRJA 1BTOA 4K28A 5A05A 4XX0A 4FJ2A 1R0SA 2R00C 4NBTA 4NMHA 1F8GA 2C82A 1I3LA 3BTSA 3N74A 3QVWA 5IXSA 3PHHA 5G0UA 5TGDA 3WGGA 1IUKA 3V8BA 3FR7A 5CDTA 4CM3A 3GK3A 1QXSA 5ITVA 1ZEMA 1EK5A 4B7CA 3ZV5A 3G1TA 3JQBA 4QX6A 5IDWA 4R51A 1VKNA 3D4NA 1R15A 1B26A 3JYNA 1PQUA 2J5RA 2H1SA 3WGOA 5L95A 3H5NA 3RUIA 2C29D 3LC2O 3DMTC 3WYEA 3W6UA 4E13A 3RJ5A 3DBHB 4CM9A 1NFFA 4NI5A 1MP0A 1LQUA 1PJQA 4INAA 2Q3EA 4RO0A 2CVQA 5JDIC 1B16A 2YHUA 4Y98A 3BA1A 4CQMA 2XXBA 4ZQEA 2IYPA 3LVFO 4IXWA 2R2GA 3S1LA 4M86A 4MVJE 1DFHA 3WMWA 5I7VA 4RVUA 4FGWA 1D3AA 4GQAA 4DREA 2ET6A 2CDBA 2RH4A 1XEAA 3RROA 5LDGA 3KHUA 3L6EA 2BGLA 4JN6B 4WCFA 1X7DA 4B79A 1CQJA 4ILKA 1JVSA 3TZCA 5TJHA 1DXYA 2BI7A 4HFJA 4LVUA 3GZ4A 3F6YA 4ND3A 3GHHA 4WCDA 3WGIA 3MEQA 3RD5A 1M66A 4OQYA 1Y1PA 4AJ2A 1XLTA 4U0JA 4D3DA 5ICSA 2B36A 1IPFA 3EYWA 4YRAA 4D0SA 5H83A 4XRRA 4NFYA 2P9GA 4PLHA 3HJAA 3JQ6A 2C0CA 3F5SA 2NUAA 5EIOA 4DQVA 2BF7A 3VC7A 5KVSA 1XG5A 3GNSA 4RZIA 1NAIA 2I66A 1R6DA 3LLVA 4ND1A 3PWZA 5K0ZA 3HWRA 3S2EA 4F45A 2IZ0A 4DIBA 4RCVA 2VWHA 2AHRA 4KQWA 3GHYA 3CINA 2HUNA 2YHIB 4BGUA 4MKXA 2V6FA 4CR7A 4J1TA 1FDTA 4GL4A 3WGQA 4RF5A 4DXHA 4ROSA 4RVHA 3G17A 4W99A 3KV3O 4K26A 5EMHA 1BHSA 4CLEA 3G79A 3AUTA 4M49A 4TVOA 4FJ1A 1Z82A 2EHDA 4DQXA 1KBZA 1YONA 1J5PA 4YJHB 1HDXA 1CYDA 3OJLA 4YJGB 3WQSB 4J0FA 3HN2A 1RM0A 4HBGA 5BQFA 5KTKA 2X5OA 2Q49A 1CERA 3H6KA 5MGBA 4O63O 1DLJA 1NNUA 4TZKA 3UCEA 2YQ5A 2NTNA 3AUUA 3EUWA 5G4KA 3OQ1A 4KUEA 1T1RA 2X8LA 4CLOB 1HDOA 2W98A 2PK3A 4R1TA 2IXBA 4RF2A 1J6UA 2QYSA 1LX6A 4BIIA 1IOLA 1T4DA 4AJHA 3CH6A 1HDZA 2AEMA 3H9EO 4HKTA 2JAHA 4Z9FA 4J0EA 2YUTA 4O1MA 3JQEA 4OOFA 3WQRA 5B12A 4NH4A 3NDJA 1YH3A 1Z73A 4XYGA 2Q99A 4B4WA 1U2DA 2JHFA 3KYDA 4H7PA 2EW2A 1I0ZA 3LT0A 2GR9A 4PG5A 4QT0A 4YBZA 1JAYA 3NDRA 5DP2A 5KJ6A 3H4VA 5JLAA 3WIDA 5A3VA 1B8UA 1I3KA 1N5DA 1U2GA 5J23A 1CIVA 2AQIA 3DHYA 5DOVA 3ICPA 4QFCA 3WX0A 3PFWO 3PWSA 4WNCA 4D0RA 3U0BA 2QYTA 3NEPX 1X1EA 3RUHA 3DZBA 5KOIA 5A9SB 5H81A 1U8FO 4GX1A 5A03A 1PQWA 1I01A 1PL7A 3DZIA 2ZB3A 4PLPA 3W4IA 3S55A 4FFMA 4YJFA 4RQTA 2G0TA 2C2XA 2R00A 1YBMA 4O59O 1ZXBA 3GAZA 2YW9A 3FWNA 2WE7A 1QYCA 2FR0A 2ZTVA 3HZZA 1LRJA 3WJAA 4H15A 5K6AA 2ZB7A 3ASUA 3U4CA 5A5FA 5H82A 4G2NA 3AJRA 1YOVA 2IODA 5TF4A 5ILOA 3OJOA 1AXEA 1B14A 4PCVA 4CJXA 3JYOA 3DQPA 1EVZA 3FPCA 1H94A 4ND4A 1DOHA 3DDNA 4BMVA 4XB1A 5LDHA 5JY6A 4K6FA 4P4GA 2NU6A 2EKLA 4LRTB 1VJ1A 2HAEA 1GEGA 2EXXA 4B7XA 1UDCA 1ZJZA 3GPIA 4J7CA 4ZD6A 3VOSA 1KC1A 2B83A 3OEYA 1EDZA 2PZKA 1GL3A 4GMGA 1F8FA 4PZCA 5A4DA 4BNGA 1O95A 3N58A 3LF1A 3DZJA 1P74A 1E92A 1B8VA 4LN1A 4FB5A 4YT2A 1IY8A 1PEDA 3JQ7A 4MKRA 4OAQA 4WCFC 3NV9A 2VOEA 1D4FA 1MB4A 3MWDB 4IM7A 1C0LA 1GUZA 3NGLA 3ZI0A 3M6IA 3RC1A 5COQA 4GPD1 1MFZA 4DWVA 4RDHA 4GWKA 2ZTLA 3UICA 3QVSA 4Q3DA 3JD2A 1OZAA 2FR1A 2ZB4A 3GY0A 2XPCA 3P2YA 3IC5A 1DRVA 2GZ3A 2FPGA 2EP5A 1XKQA 1PU2A 1Q7CA 4CV1A 4CV2A 4N54A 2GYYA 1CETA 1D1SA 3F1KA 1YL5A 2PFGA 2VHVA 1Q2XA 2AEJA 3FBTA 2OP0A 2GN9A 3KYCA 2OP1A 2GN6A 1OI7A 3EC7A 4GI2A 1GFSA 3GVPA 3OETA 4UEKA 1CDOA 5C5IA 1VSUA 5C7OO 1NYTA 2E48A 2PD4A 1O9BA 1E0DA 1U4OA 1X1TA 4JLWA 1DFIA 3V1YA 4MINA 4DBZA 5KJEA 1EVIA 4XQGA 1ZK3A 2I67A 4OHUA 1H6BA 4U6QA 4YAEA 4QTZA 4YAKA 4CMGA 3K2EA 3QWFA 3V2GA 4EJ0A 3Q2KA 1A4UA 3TOXA 3AOGA 2Y67A 3IAHA 1T2DA 5CPFA 3IL2A 1WAMA 5GY7A 4ALIA 1YL6A 2HMSA 1IL0A 4RF3A 3W8DA 3GQVA 3VPSA 4GH5A 1J49A 3ZWNA 2QZZA 3GUCA 4ZA2A 4DQUA 3S2GA 1NPDA 1JWBB 2AE2A 5L9AA 3K31A 4NBRA 3WGTA 3M1LA 4ZGWA 2IZZA 3PIIA 4YJFB 1E7MA 1OC2A 3WFIA 4H16A 4JGBA 2VWGA 3JD0A 4BV8A 3HUDA 3AI1A 1V0JA 2VT2A 4CLXA 5CG1A 4N7RA 1XIVA 4BGVA 1V9LA 4PN3A 2HK9A 4UULA 3JQBC 1PJTA 4W6ZA 4PG8A 1FF9A 1MXFA 3OM9A 2YDYA 1JKJA 2I5PO 4MVJH 2V6GA 5KNLA 5JMWA 1H9BA 1YBAA 4PG4A 1DAOA 1GZ4A 3AOEA 2CSUA 3U49A 5KWEA 1EUZA 4G81A 4O0LA 3KVOA 2WD8A 3DAGA 1DHRA 5FF9A 4TRMA 1VPDA 1KC3A 2GASA 3D5TA 5I9LA 4PG6A 4DLLA 1HE4A 3KXDA 1ZSYA 1E5LA 1ZXLA 3OA2A 2JCYA 4A0SA 4CR8A 1QYVA 3K6JA 4WOKA 1TB4A 1ZK2A 2X7HA 4TROA 2RHRA 2DFVA 1UZLA 1W8DA 1OMOA 4XYMA 3O8QB 1YB5A 5F5LA 5A9RA 2NU9A 3ZNOA 1GQ2A 2VHWA 2Y68A 4RL6A 5IZCC 3K9QO 4R16A 2J5KA 4MOWA 1XQ1A 2VNAA 3AOEC 1EBFA 3PQEA 4IZIA 4JBIA 4JCOA 1B15A 5ITWA 4ZHSA 2E4AA 4KUGA 3GH3A 3O03A 2SCUA 2Q2VA 4BNHA 4IIVA 2GSDA 4FC7A 4GVXA 1DIRA 5C37A 5G0TA 5ES3A 2D2IA 2JD0A 4J9UE 2BH9A 4MP6A 2HLPA 4EUEA 3RASA 4IJUA 4MPDA 2E37A 1GZ6A 1U5CA 2YZ7A 3AU9A 3LC7O 1XU7A 1JN0A 1NTOA 4BNWA 5DN9A 4EI2A 4WNIA 3F4LA 4WOJA 2Y99A 1FMCA 1YQXA 3WSWA 1NVGA 3CE6A 4NK5A 4OIMA 1F06A 3AFNA 1CJCA 3L07A 4R9RA 4NU5A 2QHXA 4IJKA 1ZBQA 4CPDA 3QHAA 3TOZA 4FR5A 4EDFA 3BTUA 3MJSA 4NBVA 1XQ6A 3KLMX 4FOOA 2VHYA 4MVJF 4UVEA 4F6LA 3SBOA 4AJKA 2XOXA 3UKOA 4RZHA 4E12A 4C7KA 2DTEA 4E2YA 3HDYA 4BMNA 4FSHA 2WYVA 1ZFNA 1T4BA 4BNTA 5F3RA 1PZFA 3E6AA 4Q3BA 2FOIA 4DMMA 5BSGA 1MLDA 1K6IA 5CDYA 4ID9A 2QW8A 3BMQB 4B4VA 3BAZA 3BMOA 4BQRA 1RM5A 5T64A 5BNTA 3VTFA 3DAFA 3K96A 1O5IA 2EP7A 3T4XA 4FFLA 1N2SA 2WSBA 2QZ9A 5JMPA 1JDJA 4GGPA 1YO6A 2VNSA 1HYGA 1H2BA 5T67A 4NQZA 3OJ0A 1ENYA 3WQQA 1SOVA 3QV1A 2NQ8A 3I52A 1KVSA 3RUAA 6LDHA 5MDHA 4IDEA 3JQ8B 2BFAA 1U28A 4YACA 1WDLA 1PGQA 2Q46A 2VRCD 3N7UA 4KOAA 4NJMB 3RKRA 2O7SA 4AJIA 1U8XX 1A4IA 4XR4A 1UXKA 1JTVA 2X86A 4YT4A 5IXYA 1E5QA 1ONNA 2NADA 3KBOA 5JCXA 4Q9NA 3GNQA 2CF5A 3MJ4A 5TT0A 1BSVA 3TZQA 3BMNB 5ENVA 4EZBA 4L9RA 4YRDA 4WUVA 1I36A 1WDMA 2QRLA 1DSSG 2PTGA 3DAPA 3SLKA 3KTDA 1H6AA 2VRCA 2P9CA 1LJ8A 4XJTA 2ZYAA 3PZRA 3TPCA 1VJ0A 3ETGA 4PRLA 3NDIA 2V6BA 4YAIA 1E1MA 4CLHA 2CFCA 3IKVA 3QW2A 5FEUA 1CRWG 2WM3A 3JQ8A 3JYQA 4YJGA 5ADHA 1GADO 1ORRA 4YJDA 1KEVA 2FR8A 3PXXA 3PGXA 5JAIA 4D7AA 1NPYA 2VZ9A 3OIGA 3JQCA 3BIOA 2HK8A 3CSDA 1PGJA 3VZQA 3W1VA 4NNJA 1LU9A 3DOCA 2NSDA 4TRJA 4J2HA 4NJOA 2PA3A 1UXJA 1EEHA 5KVCA 3I3OA 4M1QA 4MVJG 4NK4A 1HDRA 4EYEA 3FNHA 5L4LA 5JAMA 3O4RA 1MFPA 1QRRA 4BO4A 2GGSA 3BMQA 1HE2A 3OQBA 3ETEA 5EN4A 1WNTA 1L1FA 4B4OA 1BWSA 1IE3A 3HSKA 4GLOA 4XQCA 4QO8A 2YQ4A 5L4SA 4WGGA 4BNMA 3KSZO 5BR7A 4XDYA 3U09A 3WGHA 3I6IA 2Y66A 3DBVO 3PGJA 1XA0A 4TVBA 5HA5A 2CMDA 2P68A 5JO9A 3UOGA 3LLSA 3W6ZA 4C4OA 1Y8RB 2VYVA 1JWAB 4ALKA 4QSMA 3KSUA 1MC4A 1BXGA 1M67A 1XELA 5JO0A 1NPTO 3DMYA 3HQ4O 5CDGA 3DL2A 3UHAA 2D5CA 2DC1A 4DPKA 1LQTA 4Z0HO 1PS0A 4OXNA 1HLPA 3HB5X 1HE3A 1B3BA 1SZJG 4KTVE 2NVBA 1ADGA 1OBFO 2C20A 2O3UA 4GGOA 4JK3A 9LDTA 3GF4A 3GNTA 2HMUA 1LBEA 2VYVD 3ICCA 2P5YA 4WCFB 4FS3A 3GDFA 3GVHA 1P1IA 1YQGA 4E21A 4BS9A 5BT9A 1D1TA 4NJMA 4RVDA 3R0IA 5TS3A
chains in the Genus database with same CATH superfamily
1UPAA 1EK2A 2QLTA 1K9SA 2A5GA 3A4VA 1IJBA 3KKZA 4LV8B 2A9VA 5KQRA 4H0CA 2NYAA 1QH0A 2WHPA 4I8XA 5FOQA 2WKRA 1JDPA 4TV9A 4WBXC 3TIVA 2Y27A 3ADOA 3EXIA 2ZJ0A 3DE1X 1SUDA 1E8DA 3SXUB 1SUWA 1ZIYA 3I4FA 3UMYA 3QUCA 1IONA 1J8QA 1TLFA 4N3GA 3UJBA 1Y9ZA 2RHBA 2XZDA 3JASA 4GSKA 2FSHA 4GWGA 3I42A 4KVAA 1G6HA 5LDDC 5C2JB 4ARCA 1G9TA 1THZA 2JBAA 2NVUB 3CPJB 4BQPA 1Q15A 2R6JA 1VE9A 2C4MA 4UM9D 2CZGA 4OKSA 3EEFA 1VZ3A 1QTQA 1JEEA 2ZSDA 1HURA 5E2AA 2O4UX 4P3XA 1TF7A 1GRNA 5KPJA 4GAEA 1RIIA 2Z08A 1UBEA 3I5AA 3EUAA 3I45A 2QENA 3C16C 2FWAA 5EJMA 1MX3A 4HH4A 1G66A 4QFMA 1WCWA 1FVOA 4HGNA 3MT0A 3O4JA 1F3OA 2PZMA 1N9GA 4M1ZA 3ZXYA 1GYPA 5JZBA 4UQOA 4GDMA 3KHKA 2Q5QA 5AUOB 4RH3A 4MULA 4BQNA 2DH6A 5LA6F 1OF1A 3UMFA 1MQSA 4J16A 3OQOA 1SQ0A 1QYWA 3N8GA 4ANFA 4L22A 1B6TA 3O26A 1JEAA 4N47A 1EX1A 5C7IO 4B6GA 5A9SA 1QVAA 3QIVA 4YAJA 1M73E 4K6OA 1F4VA 4RJLA 5KTNA 5A02A 3CX7A 3GRAA 1H9AA 3C3AA 3C8ZA 4JOCA 4PC7A 4Q03A 2J0EA 2G1JA 1QFZA 1QGDA 5GWXA 1UDRA 1ZGCA 3Q6MA 4NH0A 5FT9A 4DJEC 5JAOA 2OFPA 1QIFA 1JI0A 3CURA 3PPIA 3QWHA 1HMPA 1ISMA 1YHNA 2WUFA 4D98A 3OIDA 4DKJA 4II7A 1SC4A 1BW9B 2QRVB 3GR6A 4X8MA 5KYUA 1NW9B 2GPBA 3H8JA 1OWMA 1IK6A 3DL4A 2F43A 3HCPA 3J80A 9MHTA 4DLZA 3B53X 4JP5A 3V4SA 4CDNA 4C7XA 4XTRA 2DKNA 3TQRA 1YDHA 3ANMA 4D41A 1QIDA 2CL0X 2FZKA 3B3JA 2GJAA 3QTLA 2IYOA 5C3MA 2NO7A 1EVEA 1GPNA 3CRVA 4M0KA 4OKIA 2BGWA 3IEIA 1VHLA 1DDGA 2W6JD 5CTAA 1RRCA 2JASA 1QYIA 3ZU2A 2WT9A 3SHOA 3WIOA 3K15A 1CQZA 2PV7A 2O7QA 3CPEA 2BUCA 5AW9A 4BFWA 5LLDA 1U6KA 4N76A 4W9RA 2Y6UA 1O0CA 3K8QA 3P9IA 3TN7A 3I2JA 4MV8A 4L9SA 1BJRE 2G8LA 3FZQA 1F6WA 1GTZA 3CR7A 1VIDA 4HLNA 1VKOA 2HWXA 3LG2A 4QD3A 3MELA 4YCMA 1ISGA 4ALLA 1U5AA 1E1YA 4WCVA 3E4DA 3VJMA 2OBNA 3AVXA 3H13A 1EB9A 3UIEA 1MG0A 3HP1A 1E89A 1QLHA 3JYPA 2IS6A 1GAQA 4N5LA 4C0HA 2VSNA 5JI3E 1Z4MA 3SBEA 5F51A 1IXRC 1ACMA 1OIWA 4H7HA 3FUVA 2WQZA 4DMHA 3HR7A 5L3RA 1N0IA 1CRPA 3NFRA 3KLOA 1JHQA 2IU0A 4J03A 3MWFA 4Q21A 1B0PA 1U2EA 4X1IA 3IBSA 2Q3MA 2XQIA 1KZHA 1N3LA 1DRWA 4HNAB 1P62B 1Q0HA 2JAQA 2JA2A 2QXTA 2Q7XA 3MWLA 3A4TA 5EE1A 1JLRA 1O96B 1YJXA 4GBJA 4O8ZA 3TOSA 3ZN2A 3PEEA 2O6HA 4DDHA 1NXSA 1OILA 1ZN8A 3PUWA 4GXTA 4YEDA 3ZWQA 3F73A 2GD1O 1DJQA 5T8KC 2FEWB 1FVXA 3DO8A 5B1IA 3KHSA 5IAKA 5JXWA 3CJTA 3UKDA 2K87A 3S99A 1Y6RA 2WSSA 3BA6A 1X3LA 1W47A 3FE2A 4RZQA 5NLLA 5A5EA 3K35A 2XOKA 4L4SA 1GTVA 2GF9A 1LFAA 1OYWA 1GPWB 3FDXA 3HABA 1OFUX 1W1WA 3MJHA 1VL0A 2VPWA 4QLBA 5CYPA 1ODIA 2CXNA 2ZG6A 4B6QA 5FH9A 4OKNA 2VDRB 3NOQA 4S1WA 2A86A 2ZUBA 3LC1O 2JCXA 4X61A 4DIDA 1QKIA 4LV6A 4I6JA 2R6AA 5JE8A 3VOBA 5CJ2A 5DO9A 4BDSA 1MEJA 4KYIB 3OMLA 1R9GA 2B98A 3WO1A 4NXNB 1YVDA 4X1OA 1ECBA 3T5DA 3DTYA 5LU9A 3DA8A 2H63A 1GKIA 4PZLA 5LXTB 3V4RA 4V1CB 3KLBA 3ONVA 4OYHA 5AR1A 1XMJA 3EVGA 2YYZA 2DGDA 2ZE6A 4KPFC 3TW8A 4EG7A 5KNBA 1VE6A 4TVSA 2A4KA 4D1YA 2ZVJA 3BIFA 1NVAA 3SIPA 1ZJ5A 2CCGA 1Z7BA 2BGRA 5CA0A 4EGAA 1KFEB 3LKBA 1R0CA 4DLAA 2NTEA 3HSSA 4DCSA 4MW1A 1E3DA 1VCNA 2BAGA 2E2WA 1IY0A 4HPJB 1VHDA 2XCOA 1AHPA 4GKBA 1G8AA 2CYCA 3IAAA 3O94A 3LQYA 3MGGA 3FHLA 1UOOA 5TR9A 1FNCA 3TO5A 3DMNA 4N8SA 2XKBA 4HJXA 4HK4A 3I9OA 3OE7A 5CX1A 3FHTA 5BR4A 4BWYA 1XLVA 4DLUA 3HDHA 3CMMA 5CA1B 3IEKA 4RPJA 3M89A 1V47A 1O95C 3ASZA 3IDSA 1QHEA 2CJYA 4JL6A 4L5JA 4BTVA 3PEFA 4RHFA 4X1YA 4NESA 5L51A 1QF6A 5AOCA 2EZUA 4H60A 3PLNA 4HQKA 4U2GA 5DYIA 4KWIA 4DFDA 2G63A 1ZNWA 5JIBA 1OHHA 3ZWWA 1ZM3A 5JC8A 5HP4A 2VJYA 3I12A 4JUCA 2X19A 5ALOA 4Y9TA 2R96A 4PHCA 1PNRA 5HTKA 5EKTA 1QVVA 1OQAA 4NF2A 5CCEA 4G5HA 1YZTA 4JLPA 3U44A 2P1ZA 4HUQB 4UQPA 3HE3A 1ZM9A 3VZCA 3AY7A 1BYIA 4O25A 1QQTA 3C14C 3ZI7A 5AJXA 1XZQA 4YPVA 4YV1A 2VHTA 3CLSC 5KSOA 4U63A 3BXPA 5FHRA 3VH2A 2FE1A 3P8ZA 3W2EA 1Y6ZA 4Y6SA 4BMOB 5D1NA 1E3LA 1LBHA 1LPNA 1U2QA 2HCBA 4FI3F 4OBXA 1B6GA 4BNUA 2GN0A 3L93A 4O5AA 4EUNA 2J6CA 2R66A 3E9EA 3I9V1 1U4SA 3C45A 2FJUA 1A72A 1ZZEA 3FNIA 4D44A 3EX7C 3ETJA 4UNRA 4R6WA 5C4GB 5FJJA 1NC3A 1PJ2A 3AX6A 2DJ5A 2PX8A 2FEMA 3K72B 3BWEA 4G9GA 1R0XA 4KK3A 3MIZA 4MQFB 4B34A 4DDWA 3D54D 3S8MA 2EJCA 4YMLA 2VZ0A 2WIGA 3A1WA 3CB2A 3KKNA 1FTSA 3T5CA 2Z04A 4ZVPA 1H2XA 3DG9A 2AUTA 2G1UA 4KMRA 4IIGA 2D06A 4IV0A 3T5AA 1N1GA 5IANA 1I7QB 3HGMA 3VHXA 1KARA 3WG9A 4WESB 4G0PA 3HU1A 1E1QA 4J0HA 2YZ2A 2QTGA 8ABPA 2XB4A 2OO5C 4B73A 3R5TA 4ZT7A 3N8NA 3W8NA 2GKSA 3L7NA 2DFTA 1V2HE 4G25A 4ZZ1A 4IJMA 3GRPA 1CLEA 1DI0A 1Y7IA 3O2QB 2DSNA 2QRMA 1P2VA 5ILQA 1VXRA 4PSAA 4CM7A 4LJSA 3N0TA 3LHKA 3SLGA 1PWHA 1SBCA 3DF7A 4I1UA 1EE9A 3JW8A 4P58A 3RTBA 2Z2JA 1FVHA 1P3DA 4G1FA 1T6BY 2B78A 3LRPA 1T35A 3NIGB 1FX1A 3B52X 3BZWA 5I45A 1UOEA 1KJ9A 1H1LA 3B7WA 4G8BA 4ZDWA 3EEBA 3FNRA 5TC4A 3ZQ6A 3IEUA 4JBNA 3EXG1 1TJPB 1ZDMA 3I39X 4PC3A 5DRYA 5G0WA 4D5EA 4EEZA 1HORA 4WI1A 1H66A 3M4NA 2TMYA 2RKOA 4HLUA 5E8RA 5A04A 3G9TA 4NOKA 1K4KA 2H9IA 2WC1A 3FUCA 2OBXA 5CDFA 1V37A 2WYWA 3KXLA 2D1YA 1Z5UA 3OEHD 1VG9B 3AHJA 3QWIA 5CUQA 5F76A 3TSZA 3WYAA 4ZT4A 1KZ7B 2NTJA 2F3SA 1M0EA 3WHPA 3TIIA 1QHHB 1NNEA 1II8B 3JWJA 5MN6A 1GT6A 1GA6A 3NFYA 2CDAA 4IKOA 5B7NA 1U9JA 1J1UA 1H2EA 3F74A 4H18A 2WQ6A 4URXR 3EDYA 2BTOA 3ESXA 2W2PA 4HQLA 1NN1A 4AUMA 3I64A 4WKPA 4C78A 1XJQA 2VSYA 4GKVA 5SICE 3GFBA 3NHFA 4NAUA 3JYLA 4MW0A 3G0OA 3ETLA 1SU4A 3VPGA 3WADA 2G88A 5EKSA 3MLAA 3RT9A 5FWDA 2FJPA 5B37A 4WECA 4PWZA 3VKFA 2FG7C 4LNHA 2QTWB 4ND2A 3B2EA 1UEJA 5M2QA 5DM1A 3KUUA 2FV8A 3BKXA 1JJBA 1UKYA 4O8CA 3IEXA 1N78A 5G2OA 4D9EA 3R4CA 1JI3A 1PJ8A 3K0CA 4EBBA 1ZCAA 1I7DA 2KS6A 5JY1A 4DM7A 5JAPA 3TNJA 4CQJA 3TF5A 1XDGA 4N6NA 3DB2A 1U11A 2QPOA 3O92A 5ARDA 3HFSA 3A0UA 1M10A 2HRZA 1P91A 2ZI9A 5ESWA 4HVAA 4ASUD 1TUBB 2X15A 4OSPA 1E4VA 1USGA 4ZGGA 3U37A 1BA2A 1ZP6A 1KP9A 4JNCA 4KXNA 5T7BA 2NP6A 4QYIA 4H1UA 2ADMA 1MT0A 2EKDA 1W59A 1G8PA 5HYVA 2DFKB 1ACJA 3HDTA 4L3OA 4ZYTA 5ALPA 3GG2A 1XAHA 1XRJA 2GJ4A 5KJCA 2CK3D 3PIRA 5IWAB 2NXNA 4MS4A 3TM5A 4OM8A 3UQYS 2XVZA 2NV6A 3QYFA 5EP4A 2O8CA 1ZJ4A 1IHPA 4QGGA 4CDRA 5JNTA 4JIMA 3QUTA 5KTOA 4BNFA 1M8FA 1ZR4A 4BJ5A 5K0SA 5DLYA 3H4TA 4A8HA 1Z15A 2F62A 3LXMA 1E5XA 2VOJA 4B3JA 1EFUA 1PEKE 1YQUA 4C0JA 4TPKA 1SUCA 2ZWMA 3EPPA 2HEGA 2E7ZA 3E23A 2BFPA 1AKMA 2C98A 4OJNA 2G7ZA 1SU6A 3AIIA 3AR5A 5AVUA 1YIOA 2QN3A 5F9FA 4ENQA 2QEQA 3GLFE 2Q9BA 1KFJB 4RPCA 2AFIE 3K7EA 4H6VA 1VIVA 2CLSA 4LOKA 5IM5A 5KX5A 3K71B 3HYCA 5AKXA 3RNOA 4EG0A 3RUFA 1PHPA 2IYNA 2OCGA 2FXVA 3EDCA 3MBIA 4MR8B 3KOUA 2VRBA 2VH1A 1YI0A 2FZLA 3NAZA 3GI1A 4ALJA 1DEKA 1PX0A 2IV2X 2ZE7A 3A9UA 4J0JA 1ZLXA 2IYLD 3O84A 3UFBA 2R7MA 5HNKA 4KDRA 5T3YA 4HY3A 4K3VA 5DTRA 3D4PA 1F0YA 1FFSA 1INLA 1SVWA 3D3KA 4JU8A 4PSCA 3ROEA 4BO3A 2GZSA 4I9NA 4E2WA 1L9KA 3I1JA 2CVPA 2PKQO 1FU4A 1Z25A 3DP7A 3DT9A 2AD1A 5ENDA 2X6TA 1KOLA 4YMHA 5GV8A 3TVYA 4TZ6A 1PFVA 4IWXA 2I2CA 4RCYA 4GT1A 4BEBA 4E03A 2Q3JA 3FKJA 2PM8A 2AX3A 1VKZA 5K9ZA 1OWLA 1S2OA 4PU0A 3RWOA 2HA2A 3G49A 1CZNA 5HF9A 4JVLA 3ZHYA 4UTOA 2E5LB 3LGAA 4IF6A 3QLEA 5HOEA 3IP5A 1PV1A 1POXA 2FXIA 4L8FA 4HWGA 4ZVMA 5FL7D 5ALFA 4BFUA 5IVIA 1G0OA 2F00A 4IJWA 4CIBA 4AX8A 5CEJA 1H0HA 5IK2A 4HYEA 3ZU4A 1F0KA 2WHQA 3ZU6A 4IY1A 1MIOA 3WK4A 3V8PA 4ABTA 2BDTA 1GFIA 1G2PA 4HWSA 5K3EA 1FYDA 4DMLA 1JT2A 4ZCRA 2GJKA 2ZRIA 1VKJA 3UANA 1O0BA 4LHWA 2F1JA 4GOJA 1YR1A 1C9YA 2AR0A 2DTXA 4NMXB 1Q0RA 2B4YA 2QX9A 2I62A 3NAQA 4CWAA 3FWPA 3WLIA 2GF2A 3DPIA 4GBED 4E51A 4EYSA 1KE1A 2DZDA 3O83A 5KDOA 2UUOA 4MRAA 4PGAA 4D46A 5IKXA 2RGCA 1GQRA 2MT9A 1W4RA 2I4LA 4RKWA 1Y34E 3V8MA 1O57A 4O4HA 1QHNA 2ONCA 3ZVLA 5FADA 4P2BA 3HJHA 1BS1A 1YR9A 4JQOA 3L05A 4PPGA 3KAJA 3A26A 3UG6A 2ZJFA 1QP8A 4XDZA 3O8OB 4JLMA 4NFHA 3I5XA 3SNKA 3ICEA 4M55A 3WA7A 1MB3A 4TLEA 3VHXB 3M5WA 3ZIUA 4GG1A 4AUEA 2LPMA 1BD3A 1U7DA 3GLVA 4Q1CA 2VP0A 3CNBA 3JYHA 5E7IA 4RNCA 2FUNB 4K05A 3ROMA 2FW6A 3A2MA 1NUSA 1QJCA 4W5HA 1OFVA 4MR9B 1EWYA 4B3MB 1WX1A 4KP7A 4P7KA 4TWIA 2J30A 1QOQB 3ENZA 2FK7A 4CMJA 5FI3A 3A1VA 3CEJA 5H59A 4EVSA 1PR2A 2KBFA 1N0UA 1V9SA 4AO6A 1LEHA 1IULA 4MVJD 3GEPA 1CDEA 2NTVA 1L7RA 5EP2A 4S2EA 4MYRA 4QHYA 1I10A 2Y2VA 2EWWA 4ZEXA 4AJPA 5I9NA 2HQOA 3FYSA 4TV8A 2AR9A 4JJGA 1BMQA 2ZYGA 3F0TA 1LDNA 3LY9A 4CU5A 2Z5VA 3GDGA 1DEOA 1VCOA 2NU7A 3RFFA 3TSOA 1J8DA 5C8XA 3R0QA 1A9ZA 3IAS1 5T4HA 4ZYLA 4FT4A 2CLDX 1ULBA 2ZS9A 3RSHA 2AB0A 3PNVA 4J3JA 3QMMA 4I4CA 4DVJA 3IJ5A 3EXAA 1D2AA 4XGQA 4LISA 4J1QA 3BFKA 5LMCA 1M0WA 5LQNA 2VTBB 1S7CA 1Z6GA 1L5OA 3HU2A 1Z6ZA 3IIKA 1ZVJA 4KIJA 4WACA 4EHKA 2JJ1D 4V1CI 2BP7B 4LBYA 2Q2OA 3I2FA 2MTBA 1DV1A 2OO5A 1JQLB 4FCVA 4FW9A 3GXBA 1G5FA 3DBLB 3L02A 4GPZA 1KPGA 1I8TA 5G4KB 3LVRE 3EISA 3LWNA 1K86A 1Q95A 4TT3A 1R18A 3QE4A 4RZ2A 2F55A 3I1YA 5TGTA 1EUYA 4CODB 2PWBA 1Q7GA 4IRMA 3SCZA 2D0DA 5ALEA 4CL3A 3A14A 1TMGE 2QAGB 2XXAB 4HS4A 3HPRA 2IWHA 2I7VA 1AQYA 4GSYA 1UBOS 1R4NB 1T9BA 2B5WA 3IODA 3QXCA 4L4UA 1VE3A 2C9BA 4P38A 3F8SA 4DLYA 1LNZA 1P0CA 4GIBA 3EXIB 2BEVA 3PUJA 3ACBA 1Y81A 1ZUNB 1GU7A 2I3GA 2I4TA 1EAYA 3SC3A 1N2HA 1C1XB 4MB6A 2VDJA 2DLDA 4XOUA 5ER9A 3TR6A 3VC2A 3ZWOA 5IPFA 3RV3A 4QDXA 2XUGA 3FLEA 4PICA 5CB6A 2JIZA 2AQHA 2F48A 2VHZA 2AI1A 1E5DA 1RLUA 2ORVA 3T7KA 4LVNA 2FEXA 3U7QB 5I7UA 3V3KA 1EEXB 1DT5A 3SX2A 3TW8B 2M2IA 3V6MA 2A94A 4JX8A 1NXOA 3OT1B 1M6VB 2HA4A 3TAXA 5HKBA 3ZVRA 1YK0A 4BNZA 1DCTA 2AMYA 3AJAA 4G65A 3TGWA 3PQ7A 1Z4OA 3C97A 5I7RA 3E2PA 1B8OA 2AS0A 4E4TA 1E9BA 1VDZA 1NV9A 3GRFA 4BKRA 1KETA 3BQNB 3IGFA 3CVWA 4B5KA 4HSEA 2P75A 3ADKA 3REFA 3AFGA 1UMDB 3SHQA 4IQ0A 3K9FC 3QFRA 1AJEA 2D4AA 4TS9A 1U9IC 1N6LA 4O2LA 2FSVA 4GM0A 2A0FA 4I3FA 2GETA 5I47A 4EG5A 4KSBA 1MABA 1BMFD 3DE3X 3ZV4A 5IN4A 3D3NA 3IV7A 4JDUA 2BKAA 3K3PA 4G8DA 4CHTA 5B1YA 1UT5A 1WTAA 3UC9A 3KXIA 3M49A 1XRPA 4HNRA 2JBHA 3BRWA 3LNTA 4UC0A 3RFUA 3ROQA 4PQFA 4AKEA 2FPSA 1FPMA 3MWYW 4I14A 4RFSB 2QRGA 2B8WA 3I09A 3NV7A 3ZWMA 3F3YA 1NFQA 4Q4JB 5C8VA 4XEHA 2VJNA 3OX4A 1G19A 2IEIA 4R8LA 4RPHA 4PIVA 1C7JA 2XUJA 4Z2AA 2P6PA 5BPHA 1MRSA 4L4YA 1CQPA 3ZE0B 1AO0A 2JI8A 4HI0E 1VSTA 4B3HA 2C9CA 4HNUA 4DV7B 3IAUA 1X9IA 5LD2C 2BRUA 1W0KD 3TINA 4ZJUA 4BVBA 3OTOB 4JJ6A 3AXSA 2FN4A 4WXMA 3W79A 3ZCXA 1LK5A 2V3WA 2WAAA 3L4BC 4IIJF 2EQ5A 2OFFA 3AERA 4IUYA 3RQSA 2EFYA 2O8CB 2YZNA 1K2WA 1DJNA 2FWMX 2X9QA 3B89A 3NLLA 4MZXA 1WMFA 5JSYA 4PM4A 3VR2A 5BOSA 1B8NA 1IC6A 2Z57A 3QPCA 2QG6A 2R1VA 1PZGA 2VRNA 2FWPA 4ZWNA 1E3SA 3VBCA 1P9WA 4QOGA 2FSSA 1U8UA 1Z75A 4LG1A 1LGYA 3GEDA 3UT5B 1RPJA 2O14A 3NYWA 4B3IA 1BD4A 2WAXA 4D8UA 3KR2A 3GGGA 1XCPA 1Y82A 3KQYA 1WCIA 1FJHA 1GP2A 1TAHA 2GZHA 1EI9A 2DUNA 4D9FA 2B6NA 3QPWA 4ZCIA 5BORA 1T43A 2FI1A 3T3DA 3TTXA 4ZOBA 4ZU3A 2G3YA 3E3AA 2V7QA 1GSHA 1AO3A 4QSHA 3EASA 4E5YA 5TY0A 1ADJA 3WNBA 3GJ0A 2IOQA 1JDTA 4U2FA 4DUGA 1M9NA 2ON6A 2Q28A 2CDCA 1YS4A 5IAEA 2YBDA 4GLLA 4LDQA 3A8TA 3I9LA 4OAOA 3MUEA 2BONA 2GHRA 4LK3A 5IJ9B 1SVNA 1ODSA 1L7NA 3FH0A 3G0GA 4GEKA 4D9BA 1KL7A 4MMXB 2BFDA 2QTVB 4NP6A 3TZ6A 2J9RA 5ICEA 4EAAA 4O2AA 4NWIA 1UXOA 2ZI4A 2X1LA 2X22A 3DHVA 3KWLA 4J7UA 1TC1A 4KDFA 1NRXA 3MMPA 4ZU6X 2X0DA 3UV3A 5LWQA 3THWA 4OX9Y 1HYHA 4MV6A 3SE0A 1DO0A 4O4JA 3NH9A 3OLZA 1ECFA 4J3FA 4NECA 4WZZA 1N33B 2N0SA 3AEYA 3CZ5A 3KB8A 4HDKB 1RWWA 5AXDA 3DWFA 2R1TB 4ML3A 4D25A 2EBUA 4YHBA 2ZQZA 5AI9A 2HMVA 2UVDA 1MOZA 2GUGA 1ATZA 3L7MA 4KIGA 3HBAA 3DMDA 5U4QA 3T38A 4JLUA 2Y1DA 3DOOA 4QPZA 1D5CA 3EMVA 5AKKA 1ZJWA 4UBNA 1AF4A 2R8YA 4II3A 1OA0A 1JG4A 4XD2A 4FEAA 5CDSA 4RSMA 4EG3A 4ZO8A 1DBWA 2C2GA 4B35A 1EM8A 4PBRA 5B1SA 4BLSA 3EGXB 3O3NB 1RAGA 4JIGA 4NKRA 4B3XA 5CMLA 4FBMA 1SB8A 1T36A 2TS1A 1KU0A 4AY4A 3EFOA 4C0KA 3BICA 5HUJA 3RS9A 1G5RA 4DG9A 1V7PC 2H8KA 3KALA 1BVYF 4FZJA 2J3MA 2ZSBA 1EGMB 1R66A 1LRLA 3OOSA 2BP7A 2W0SA 3PD1A 5T4EA 3TD2A 3D6FA 4HAZA 3PB3A 4IKEA 4UREA 1G16A 4B6PA 5LBIA 4A8JA 3M1AA 4UHHA 2VYCA 1L5YA 3Q72A 3TKYA 1DAEA 2JGNA 1GEEA 2Y4OA 4JAVC 4ZVSA 3JX9A 4P36A 2J48A 4MMZB 1GFWA 1T91A 3PRKE 4M8IA 1QQ7A 4A0QA 1Z07A 1PR9A 2B2XA 2Q6LA 4TV8B 2HU2A 1RKUA 4LVCA 4ZQHA 4TV9B 4E15A 1MVOA 1P0IA 1XC7A 2XNJA 3GJ3A 1RADA 3UGTA 1HL3A 4OMCA 2FFJA 3DVQX 4YMTA 5CXSA 1SVIA 2GCNA 3R5FA 4G5QA 5E9QA 4NPAA 3WK9A 3ONWA 4OL0A 4R2LA 4Q16A 4JJIA 5JD5A 1E1CA 4QNMA 3KUDA 4IS2A 4JI8B 1C30B 3H4MA 3QX7A 5TV2A 4KPEC 3OLXA 5IUKC 3QMPA 4J1NA 1QE3A 3PZBA 4BL5A 3LJKA 1MTOA 3LSYA 5F1KA 3A1SA 5A3RA 3WK6A 3ZHSA 2RH5A 4JI7B 2C59A 5HKAA 1A7AA 3QKSA 5CBPB 1GSOA 2DQ4A 5IAOA 1R9NA 2HZBA 2OG2A 4DIMA 4JGIA 4KGVA 2GTPA 2XWBF 5J58A 1EH5A 1LVHA 1XJ0A 3G5UA 1HO3A 1ZU4A 4LX8A 4ZYXA 1CJTC 1E0SA 3WAGA 3LHDA 4I1PA 1Z7GA 3J7TA 1JHUA 3R20A 4XWWA 1Z6YA 2JLUA 3WLMA 5L3SA 2B1GA 1TJYA 2IEZA 3VHLB 1KFBB 1W581 3DEAA 4UFNA 3KB1A 2ZRLA 2P5TB 3BJEA 3FTCA 3QVLA 5KNBH 1X1CA 2Z2KA 1O54A 1CXZA 3AY3A 2W2KB 3IQFA 3N75A 1Y9JA 2EG9A 1BRMA 1Z6QA 4H4EA 4BHTA 4N5HX 3GEIA 3QVKA 2R7AA 2VJOA 2Z1MA 4PIPA 4UAVA 4CKWA 1N8SA 2OUKA 4Y7CA 2IOFA 3D7LA 4MUGA 1W1UA 5ECYA 3O38A 5SYAA 2CNKA 4IG4A 4HDNA 3DONA 2I1WA 3A6DA 4HYTA 4N5DA 4UCFA 1W5EA 5DTEA 3CNQS 2ZITA 1V1RB 2PUWA 2I2BA 5BSRA 3O3CA 3UHJA 4AX4A 1O8BA 4YUAA 2BFWA 3CU5A 5DN6D 2C2KA 2A67A 2GBPA 4EGFA 3ETCA 4BNKA 2XYHA 4PGMA 4AQ7A 4KVGA 1LD3A 5G1OA 3HMKA 1NA5A 2WWRA 5KWSA 4GXRA 4YRTA 5K7SA 4PNZA 1GPAA 3A3KA 3C8MA 5JRDS 4S12A 3ZBTA 1UXGA 1VMDA 4A16A 5FXMA 3RTDA 1ZNYA 3N2KA 2G7MC 5LLTA 1S2NA 2BHTA 3C3JA 4WIAA 3L6OO 1EFAA 2N46A 4OL9A 1NW8A 1E2PA 1YJQA 4R3UC 3SF8A 2WOOA 1GN9A 3V34A 4IOJA 1U4NA 2XDAA 1H65A 4OATA 3BH6A 1RCTE 3UOWA 5FYDA 1E9AA 3KJNA 1LF0A 2QK4A 4G07A 4LY6A 2IYYA 3TG2A 5IVHA 3HFGA 2F67A 4UVGA 1PGOA 1ODJA 3HP7A 4BFVA 5JROA 2ESRA 3UPUA 2J3QA 1D7OA 1GUDA 3W4JA 2O7NA 2VWPA 5DULA 1QM5A 2Z2IA 5JS6A 4WPGA 1DBRA 1R0YA 5DZSA 1Y33E 4DRYA 1Z2AA 1UBUS 4JBGA 3AEZA 4ZRDA 3ZLBA 1OB5A 5FWNA 4WQMA 4OYRA 3GVXA 3M8KA 4F3RA 2VJKA 1RRMA 2XVMA 1IXSB 1YB7A 2P5SA 2P2ZA 2X3YA 2XYVA 3ILVA 1V5GA 1PTKA 3JD4A 1E3JA 1JECA 1O96A 2NO5A 1SVOA 1ZGJA 2OCYC 3L6BA 2QGZA 1SZCA 4GS5A 1V43A 1NN0A 4MUYA 5HFJA 4E2XA 4N48A 3C6KA 4PSDA 1KO1A 3LP8A 2PYZA 4WLNA 3D3JA 2F3RA 2QAJA 3KWMA 4IOKA 5DSZA 1AGRA 1Z45A 5H3LA 5FOXA 5SZHB 1QWSA 3BGWA 1ZA2A 1YU6A 3FFXA 3MTJA 4HRAA 4N3NA 5PGMA 5A5GA 5HSGA 1HZJA 1HSZA 4RSHA 3F49S 1GNLA 3LUBA 4XPIA 5FPYA 1AMNA 2ZATA 4XJVA 1I4OA 4CMHA 2QTMA 2N9UA 2RHJA 3C85A 1W75A 3W6NA 4L8GA 3MINB 2NO4A 3ZZMA 4ATNA 3TDNA 3O8RA 3AR4A 3AI3A 4R1OA 1PJAA 2PTHA 1FLVA 4MS4B 2BFFB 2NVWA 5I9IA 3C7DB 4E5NA 1M2WA 3ZE8A 1BIFA 2I91A 3DO5A 2WJYA 3QI2A 3K09C 2PY6A 3EGWA 3EMDA 2OZVA 1P7VA 4DS3A 4ARIA 1QAQA 3ND8A 3EZLA 2FW0A 1YACA 5H4HA 3ITNA 1VM6A 3K0BA 4CMIA 1C81A 4J4TA 5HR5A 1QVZA 4DWWA 3BHNA 1NYQA 1ZSVA 4RY2A 3E18A 1JL3A 4EKDA 1MHTA 4QDZA 4R2WA 2VHEA 4AECA 4DA7A 4AL4A 1ETUA 3HB9A 3K0SA 3WLOA 2I9PA 1R7RA 1W52X 1YVUA 2O0HA 2GHIA 3N5CA 2YV5A 2QQFA 2XAAA 4HB3A 4CCAA 1OZGA 2XIQA 1CUXA 1RYEA 2REXB 3CBGA 1XV5A 4RK7A 4RKEA 4HGQA 3UTDA 4B17A 1NYLA 2XMQA 4OGGA 4MIKA 3CX6A 1VRWA 3ZR4B 1WW8A 1BG6A 4P9NA 5G1NA 3MTBA 1CUFA 4A91A 4BLPA 3GRYA 1P1JA 2AR7A 3IA7A 4IFBA 3U3OA 5A4MS 3KB6A 3N2GB 4UAJA 4WNYA 2I6FA 1T3TA 1U63A 4IH9A 4UXIA 4XI9A 1FBTA 2GPSA 1PHRA 4FCWA 2IYWA 1BOOA 1NW4A 4X1KB 3R6DA 3T1QA 5LMUB 4DC0A 2VSOA 4DLTA 2V9PA 2CMGA 3LUHA 4H31A 5AOBA 5CVTA 4J43A 5FV7A 1VBFA 1X1DA 1PS9A 2FGJA 3CLRD 1T0HB 4AZ3B 1B41A 1NASA 1ZK1A 2W2KA 2EU8A 1O6ZA 5CW1A 1FXWA 1Q83A 3G0CA 4Z1MA 3U3KA 4FB4A 2AOWA 1CRLA 2VQEB 2IOFK 2PRZA 4RLQA 2XMSA 4G5RA 4AKHA 2JVIA 5EZYB 5HMMA 1I3MA 1C0IA 3QPVA 2DUJA 3Q9NA 1IBSA 5J2UA 2LRHA 2BLNA 4PZEA 2QYOA 4GP9A 1JIJA 3SEQA 3VH4A 1QF9A 3EAGA 3PJEA 5EOVA 2G5PA 3ANTA 4LEIA 4X54A 1GZUA 4HFNA 4WY2A 2CHVA 5BN5B 2YWXA 4Y2RA 5FBZA 1C3EA 5FBQB 2FG5A 1HMYA 1RLJA 3F8TA 3KR1A 2GESA 5JYEA 4JLBA 1DADA 1MC5A 1RZVA 1KOGA 5AJUA 5DGDA 2FN8A 4IO1A 1NDQA 4QJBA 1DQPA 1GVHA 3D02A 1VBNA 4U7FA 4BUCA 5ADVA 3OM1A 3UT0A 3HA7A 2XDYA 3PX7A 1OV4A 1HKHA 3KCQA 2ZXEA 2WVJA 3OF2A 4YK7A 1SXGA 1H2HA 1XD2A 4K81B 4Z99A 2IBMA 1ENOA 5D01A 4YHHB 2Y2UA 4R8RA 5DSTA 2NMVA 1DOAA 5E6RA 3PTZA 1MW8X 1B43A 1D1PA 3H18A 1RDFA 1T5OA 5JC1A 5BV2P 1C7IA 2J3IA 2VHJA 1JF8A 3RE1A 4L08A 4UE2A 4WEQA 4EM6A 2Y1OA 3UXMA 3W8EA 4R2KA 2CVZA 2H5LA 3BMCA 3D7KA 3ZWPA 1C3VA 3C39A 3RSQA 3ZQKA 2BEUA 2R8BA 1QC5A 1W2WB 1U99A 4GYJA 4I2VA 4BVKA 3WOHA 4EY8A 4KREA 3R77A 1TI7A 3EZYA 3HN7A 1Z5GA 3ZW8A 4G4GA 2K7ZA 1RJWA 3P9ZA 4EH1A 4RKRA 3ZDQA 4EWLA 5CVVA 4HZIA 1PNVA 2NQ2C 4HZGA 2YOGA 4IQFA 3T9AA 4DCGA 3O8CA 1TTTA 4QHTA 3FLAA 5C8YA 1CQWA 1HDCA 1RWMA 1P4HA 4QBGB 3PUXA 4QYIB 4YAWA 3V4VB 1GYQA 2WIAA 4B3BA 4Z3OA 4HMQA 4Z4IA 2SICE 1QHYA 3CZPA 1V26A 1R88A 2LR0A 4RJIA 1P2FA 2IS4A 4JB8A 5AM2A 1SFRA 3DBLA 1AA6A 2V6JA 4FZRA 2HM7A 3ZHZA 3PFHA 1VOTA 2E89A 1HTBA 3GBVA 1E77A 3NP9A 4KGXA 3RBZA 3T54A 1BAPA 2VDLB 1BQ3A 1QUEA 2VQ6A 3VO8A 3UMSA 2HGZA 1YUBA 4YRLA 5J4KA 4YVFA 4KR6A 4A6XA 3R3XA 2XUPA 1K5GA 1UPUA 4I4NA 4XWTA 2O2YA 4FQ5A 4JYMA 2XAUA 3LTEA 1GUFA 3PXEA 4XRGA 2WAYA 3QKWA 1YDFA 1RJGA 1K2VN 4AZWA 1C80A 2O3QA 3LWBA 4A03A 2UZ1A 5K8IA 4JJ4A 1FTYA 1LV8A 3W5VA 3M83A 4HBZA 4UCWA 4C7MA 4E32A 3VR1A 1JG2A 1JEDA 3O75A 1HNXB 3DQQA 5DP1A 3STXA 3HG7A 3OPNA 3ONDA 1XMSA 3KP1A 2Y0DA 3LHIA 5DWQA 2YCLA 1KI6B 1NI3A 1C4WA 4D4IA 1YR2A 2ID8A 1GNPA 4I8IA 1W19A 1ZKMA 2MR5A 4DWJA 1KIFA 1K27A 2GO1A 1I3CA 2A58A 2QL9A 1KORA 5LKRA 3UB4A 1XCMA 4G97A 1RRVA 2VA8A 3R0VA 4PLZA 4ZQIA 5ER6A 3L8MA 1IB0A 2XODA 4EARA 3P0HA 4HNHA 1AZLA 1HETA 2NLOA 1JHPA 2R25B 1L5KA 2VPQA 3O3OB 5TX7A 1KP3A 2DPLA 2JF0A 4HLDA 1FA9A 1JR3A 4LJ4A 1RHQA 4A5OA 4BNJA 3PK0A 1QHFA 1NSTA 2QSYA 1Q1BA 2ODNA 1F8YA 2W6CX 4RVOA 1W0CA 4ESOA 4UKDA 3EB9A 3NANA 1ZD3A 3G1UA 4XGNA 1T6ZA 2O2SA 2CUKA 4B4UA 3F5QA 2ZCUA 4ACAA 3TQOA 2KI5A 4MUAA 5JCJA 1E63A 2O2HA 5KKCA 1DARA 5C8ZA 3HYTA 3EGOA 4EHLA 2C83A 3CVUA 3QVTA 5A3JA 1KO5A 1SZPA 1KRHA 3D3QA 2WEKA 1GGHA 2PD6A 3D3EA 1TM4E 2XRYA 1W0JD 3N0XA 4FN4A 1TYZA 3I30X 2PGXA 4BFYA 4DAOA 3KQPA 1ZGBA 3M5CA 1N25A 2GNAA 2IPXA 2WD7B 2XT9A 3DR3A 1AUVA 2JAPA 3EF0A 2OGTA 4CLDA 2BBOA 4JEIA 3VR6A 1PR5A 4Z54A 2AZXA 2QD1A 3EK2A 3GUYA 2YV3A 3SZUA 4QXQA 4A0GA 5KYWB 4CM9D 1OH5A 2GEKA 3NP7A 4DJDC 1Q2UA 3EXEA 1Q1EA 3V1UA 2QLLA 3ORQA 3MJCA 3EHDA 4QG3A 5LPNA 3H05A 2HSEA 2RCYA 3RVSA 1CY7A 3M9XA 2R6FA 4Q1BA 4EDHA 2VJPA 2WJVA 2FZVA 4LPSA 4XDHA 4HT3B 3LVQE 1P6XA 1ZMTA 1PLLA 3RU2A 1K75A 3WRYC 2WJ6A 4G1MB 2Q27A 2ZSEA 3FFAA 2F64A 4BTEA 5IT4A 4UZSA 1KJ8A 1KA9H 3ETHA 4N9WA 1PTJC 2ZIZA 2BKVA 4ZMRA 3L1HA 1W5TA 3INGA 3O74A 1NXXA 1K63A 1NLUA 2H08A 3H75A 4PFKA 5AM0A 3T7CA 3T6KA 5EG5A 1RBZA 1X80B 1YCFA 2D4HA 2GYVA 4AS1A 1QZTA 3KD2A 1N8NA 3THOA 3IUYA 5J2TA 1PGNA 2YRFA 4DV0B 2FDCA 1OXVA 5DXFA 3EWAA 4EPRA 2O8DB 1TGVA 1XMQB 3UUWA 1NR5A 4TWRA 1GU0A 2Q6IA 2DR3A 3CO0S 1SHUX 3AEKB 1SPXA 3FETA 3GJ7A 3G6KA 3K5PA 1ISIA 3H5OA 4PQEA 3TXXA 3TQQA 4E1BA 4M0FA 4ZTBA 1YWGO 1W7AA 1WBBA 4BCCA 4OMFG 4DCNA 5DBGA 2QPTA 4DN6A 1J5XA 4F93B 2PE5A 2ZBFA 3VAYA 3EBLA 4IPTA 3W05A 4UUMA 3PQFA 4IQ4A 4ACBA 1Z74A 1KZ1A 1LTHR 3QKTA 2HHHB 1YD7A 1JU4A 5C35A 4FW8A 3E7FA 1FRVA 4MVJA 4D3FA 4MP3A 4P93A 2Y0BA 1R4MA 3Q6IA 3LQRA 5A6SB 3DEFA 4TWAA 2HDNB 4Q34A 4JBWA 2WHPB 2V3VA 3REQA 3T4UA 3ZWYA 5GZ3A 4BASA 2FMFA 1PE0A 4PCAA 5K0TA 3CQ9A 3AW9A 1IOVA 4F6RA 3MGCA 1KAOA 3T34A 1FXSA 1TVCA 3EXHA 1PLJA 3QK7A 1KSHA 4TTVA 2FK8A 1SKQA 5AMXA 5H70A 1RC0A 3I2IA 4B75A 5DYYA 5J47A 1EUQA 1E59A 4AF7A 3L8YA 1ZITA 4LQ4A 4F5ZA 1W6RA 1HXHA 5BSTA 2CL5A 1C7ZA 2CLOB 3H65A 2ZRDA 1S4MA 5KYWA 2YJ5A 3GN2A 2XRMA 1WZEA 4MI9A 3GDHA 4E88A 3MHTA 1R3DA 3ABIA 2KWIA 2YIDA 1N9KA 5FA5A 4R41A 4GPTA 5LXTA 2HIMA 2O0JA 2Y9PB 1R8JA 3N0VA 1LH0A 1VG1A 2XT6A 4J7XA 1PNOA 1ZH0A 1KVQA 1N34B 1WMEA 1D2NA 2EJVA 4NEHB 4P5PA 4BUJA 1NVVR 3HNOA 4HDMB