2HK8A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
266
Chain Sequence
MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate dehydrogenase
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
total genus 88
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk8A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk8A01
3TNLA 2I9PA 3OQBA 3C7DB 3HN7A 4GBJA 1I30A 4GKBA 4L73A 3AU8A 3DBLA 1I3KA 4BNZA 3GG9A 4JJIA 1MGOA 4R1NA 3UVEA 2NQ8A 3DZKA 2NU8A 1DHTA 3TJRA 4RF2A 1XA0A 2AQHA 4Z9XA 4GLLA 1G6KA 2DBRA 3PHJA 2ZB7A 1NP3A 1KC1A 1PL8A 1PZGA 1XG5A 4MPDA 3WLFA 5I7FA 4J9VA 1FDVA 3BMCB 3SC6A 4F6CA 1BMDA 4E5NA 4JCOA 4BNYA 2CDAA 4J1SA 2IZ0A 4YR9A 2BMAA 4E3ZA 3ZHXA 4EUEA 2X58A 3L6DA 3RKRA 4D7AA 2PZJA 1H94A 2CY0A 4OQYA 5T64A 1DFIA 4OH1A 4EYEA 1HWYA 4XGKA 1PJCA 4RPHA 3GVXA 3AY7A 1VL0A 4B4VA 3GN2A 1WZEA 1W4ZA 4FW8A 4JQCA 3RFTA 5I9LA 3PXXA 2WYWA 3OQ6A 4R9RA 3M2PA 1LC0A 5IN5A 1R6DA 3PQFA 2YY7A 4CQMD 1YL6A 5I8WA 3Q11A 2HMVA 3JD4A 1QRRA 1CETA 4HXYA 3JQCA 2BKAA 1LBEA 5JO0A 3TN7A 3ZNNA 2GN8A 5TT1A 4E5PA 4E5MA 1V3VA 1ZJYA 2O23A 3GH3A 4ZA2A 1FK8A 4CM6A 5DCYA 3CMCO 5HS4A 3S2FA 4JXKA 4CMIA 3DAGA 4PG5A 2QIOA 5TJHA 5CFZA 4PZDA 3QRWA 3NKLA 4ALKA 4M89A 1Q1NA 4A0SA 1ADBA 5AQ1A 1NPDA 3WGYA 2JCXA 3AFMA 3ROPA 1O6ZA 2YDXA 2ZK7A 3CZRA 3IKVA 2R00A 1DC3A 2YDYA 4EUFA 4YT8A 3I6QA 5IAAA 3G1TA 2FRDA 3ZGYA 2ZCVA 1H93A 1GDHA 4J2HA 5KOIA 1NNUA 2AXQA 4DC0A 3LC1O 2E49A 2XAAA 5L7TA 1GCOA 1E3IA 3GPDG 3Q9UA 4NR0A 3G0OA 3V2HA 3KO8A 3T7CA 3UKOA 1GPDG 2C59A 4OOEA 4XZ3A 4YRAA 2YV1A 3DR3A 3CTMA 4L9RA 2NTJA 4GLOA 1Q7BA 3PYMA 2Z5LA 4IDGA 3VPFA 1L7DA 4QEDA 8ADHA 1NWHA 2Q4EA 2UAGA 3KSZO 2R00C 1O89A 1AUPA 1VPDA 3ZU4A 4BNVA 4PN3A 1V6AA 3JYLA 1N92A 3JD2A 2YHUA 3GOHA 4DIBA 4IQ8A 1DIGA 1NWCA 3FWNA 3A9WA 1E6UA 2Q1TA 1E3EA 3IAHA 4BGIA 4OKIA 5U9CA 5F5NA 2Y1GA 1B7GO 3T4EA 3DBHB 4IDEA 4PVDA 4FD3A 4CQLB 1YDWA 4J7UA 4AJ2A 5G0WA 3MJ4A 1IE3A 3S2GA 3TQHA 1BW9A 3PFWO 4JGBA 1K6IA 3ZWWA 3JD0A 3LU1A 3PQDA 1RYEA 4G65A 3B70A 3KXDA 4JBHA 5BNFA 3ZV4A 4U0JA 1F0YA 3TZKA 1Y8RB 3LYLA 3DZGA 4AJIA 3PFFA 3H65A 1LSUA 4CLOA 4I9NA 4RO0A 2NVUB 3D4NA 2HMUA 1C1DB 3Q1LA 4DVJA 3HN2A 3WDSA 1DDOA 4B3HA 4DMMA 2PZMA 4I9HA 5JCXA 4MP3A 4ALIA 3C8MA 5L4NA 4ND1A 4CUZA 3ON5A 1M6WA 3C1AA 1B16A 2IYPA 4XQGA 5I9MA 4BNJA 2VRCA 5B37A 3GEDA 1R0LA 4E13A 1NHWA 3AUAA 3EW7A 1DOHA 1E1KA 4TVBA 4I5FA 3CEAA 5DNAA 4BKUA 2PGDA 1M76A 4G5HA 1SEVA 1LLDA 5I7SA 3WXBA 3KETA 3NGLA 1W73A 3VKUA 4UEJA 2V7PA 2W8ZA 3GMDA 2UYYA 3I1JA 5DDIP 5CAEA 3VVBA 1X15A 1SOVA 2B0JA 2LDBA 2AG5A 4RL6A 4YAEA 2H63A 1ZIDA 2ZYGA 4RJTA 5FWNA 1E7QA 4EZBA 4CLEA 2D3TA 3A1NA 1NQTA 1QP8A 4E31A 4FC6A 5FI5A 3LT0A 1ZK1A 2FZEA 3D0OA 3DAPA 3QIVA 1T24A 4JROA 3E8XA 1NPTO 2QZ9A 3GR6A 2A92A 5C5IA 4M49A 1Y81A 4J1TA 3R3SA 1LI4A 1P33A 3AW9A 2YZ7A 1B0AA 3FR8A 3QY9A 1PJ2A 1I10A 4BMNA 4DQXA 5TIIA 2PD3A 1IZ9A 3DTTA 4DPMA 4KZPA 5IXSA 1Q7CA 1RM4A 2ZIZA 4ZQHA 4OAQA 1BHSA 5B4TA 1LSJA 3IJPA 1GZ3A 1UXJA 3RC7A 1E3JA 1NR7A 3IIEA 4RVHA 4RDHA 1K5HA 4P8RA 1WNTA 4Y8VA 5G0TA 4B7XA 4I9UA 3DAFA 3FCOA 4NI5A 4CMJA 3OJFA 3FD8A 5F5LA 3OH8A 4UULA 2VTDA 1FDUA 3E9QA 3C1OA 3R0IA 1PS0A 3PWKA 3ZNPA 1KIFA 2JD1A 2O50A 5TQVA 2QQ5A 5A05A 1HSZA 1IB6A 5A9SB 3PI7A 5THQA 4CM3A 1OAAA 5KJ1A 2JHGA 4PLVA 2VWHA 4MVJH 4XD2A 4JX8A 5U4QA 3ZW9A 1EQUA 2ZTUA 4ROSA 4CLHA 3AM4A 1B14A 5KKAA 4YAIA 2YV2A 3M6IA 2Y05A 4D41A 4IUYA 1LSSA 2FWMX 3MTGA 4BNKA 5KVSA 3PJFA 5KJEA 3N74A 5IDYA 3FF4A 1QYXA 4B7CA 4FFPA 3WGGA 3WYBA 3QVSA 4DYVA 4AJEA 1YRLA 5G4KA 2VWQA 1MB4A 5CPFA 3QE3A 2I3GA 4R68A 4E5YA 5JCJA 2AEFA 4U5QA 1MV8A 3GVIA 3JQ8B 3OIGA 4TKMA 4ZQGA 2XXJA 5T57A 1U5CA 2W2LA 3AOEC 5IXYA 2Q46A 3O26A 3JQEA 3W4IA 3PJEA 4B8WA 3QV1A 4R01A 4XR4A 3LC2O 1XSEA 1HF3A 3F5QA 1CRWG 1GU7A 1P0FA 4I8XA 4M8SA 2D5AA 2DPGA 2G1UA 3JYPA 4B7UA 1EVJA 2OBNA 2Q2QA 4CMGA 3ITKA 4XB2A 1B8VA 2IYOA 2HJRA 1HDYA 4DTIA 2C0CA 4D0SA 1ZJZA 1ISJA 1NASA 2CD9A 3O8QA 4UEOA 3E6AA 5CEJA 2DPHA 3PZBA 4LCJA 5C7OO 4ILKA 4BB6A 3M1AA 4MOWA 3HQ4O 4GI2A 4XJTA 1TVEA 1EMDA 3STHA 4J0FA 1JW9B 1D4FA 5L40A 3U5TA 4I08A 5EN4A 2B5VA 1D3AA 1E7YA 3U0BA 1DAPA 3MJTA 4CUKA 4DYDA 5EESA 3VPXA 2FY8A 2GRAA 4CJXA 4IJKA 1U9JA 1Y1PA 3I5MA 3MEQA 5K9ZA 5ITVA 3ENNA 2QYTA 4QUKA 5J23A 3FNFA 3K2EA 3INGA 5L45A 2ZYAA 2GUGA 4JIGA 3SJUA 3GFBA 5JDCA 3AUUA 1I3NA 2OP0A 4LGVA 4BO8A 2WE8A 1KEPA 4CV1A 2Q2WA 1YB4A 1ENPA 1GAEO 2ZJ0A 1U3TA 1LUAA 5TT0A 3U4IA 2F1KA 2VTEA 4D44A 3TF5A 4CR8A 2C2XA 5TRTA 2C7GA 1GEEA 5FEUA 1ZBQA 4UVEA 3SVTA 3UICA 1KBZA 4R3NA 4L4RA 3ROQA 3R1IA 1IUKA 1Y6JA 5BSGA 2C5AA 1HE5A 4XYBA 1D7OA 1JKIA 1U2GA 3GDFA 3ANMA 3KZVA 3U62A 2PNFA 3ZCXA 1ADGA 1A72A 1QV6A 2YQ4A 3NDJA 5JDCC 3H3FA 4O6VA 1LQTA 4LK3A 3F1KA 3BHMA 3ROMA 5H83A 1U4SA 2AEJA 2BFAA 1PWXA 1VM6A 1SAYA 2FZWA 2J3IA 5F1OA 2VRCD 4R3WA 1ONNA 1LDEA 2DFDA 1MG5A 1A27A 1SMKA 2HLPA 3C24A 3QVOA 4IXWA 2XOXA 1C14A 4ALNA 4RPKA 4DXHA 4BKOA 2EW2A 1LLQA 1RPNA 4BO7A 4I5GA 3MOIA 5KJ6A 3KEOA 5ICSA 4OGWA 3WLEA 4C7JA 3BTUA 3ZH2A 4WLOA 1HLDA 5T8KC 2QRLA 2X9NA 3U4HA 4ALLA 2IEBA 2WM3A 3V1UA 2BGLA 2D5CA 4L4XA 4KUEA 3BMQA 4CM4B 4AG3A 3CUKA 1XU9A 4NU6A 3V8BA 5BNIA 2EWMA 2JFHA 3JQFA 3F46A 5T6BA 4NK5A 4XYLA 1HT0A 5JC8A 1OOEA 1BG6A 4LMPA 1EQ2A 3WWYA 4MVJM 2P4QA 1M75A 3AY3A 4NPCA 2JFGA 1XCBA 4B4OA 3CXRA 2Y1FA 1H6BA 2DKNA 4N5NA 4OSPA 4HNHA 1UP6A 5C3MA 2W90A 4NBUA 3FPLA 3ZWBA 1U2DA 3ONEA 4J91A 4WLEA 4B79A 2P5UA 2VOJA 1GTMA 4NBTA 5DCWA 3WYEA 1N9GB 5L53A 2BHLA 3ZWXA 2GASA 1VSUA 2CDCA 5B1YA 3JQFC 1H6CA 4DQVA 1OI7A 1W0CA 3ADOA 3QWAA 4WCFC 4Z0TA 1V0JA 3D4OA 3HFSA 3CZMA 2YFHA 2HRZA 3ZNOA 3CSDA 3RC9A 3ZHZA 1QXSA 2JCYA 3KLMX 4MP8A 1C3VA 3JQAA 4GWKA 4TWRA 4WUVA 7ADHA 1WP4A 3FWZA 3Q3CA 4AFNA 4KQXA 4RQTA 3MOGA 2BF7A 3VH2A 3DBRA 1BGVA 3EHEA 3KLPX 1FJHA 5KTKA 3H3JA 2GDZA 1EFKA 3I9OA 1I8TA 1ONPA 5L4SA 3C1TA 4OM8A 2Y1EA 4YJHA 1DPGA 3I83A 2J3JA 1YO6A 3VH3A 3TZ6A 4OQZA 4PG7A 4QECA 3DZJA 4TSKA 4XDYA 5F21A 1KOLA 4ZRNA 3S55A 1B3RA 3HDYA 4UUPA 3QWHA 4QFCA 1PX0A 3CMMA 4R5HA 5H82A 3JQ7A 4B4UA 5JCJD 3LZ6A 3NUGA 4IDCA 4BO9A 5JSFA 4D0RA 4XQ9A 1B2LA 2HMTA 2NQTA 2WE7A 2W2LD 3PIIA 3U49A 3S1LA 3HJAA 1PTJA 4FOOA 2YV3A 2AMFA 3COSA 4IGFA 3GNSA 1V3UA 3IUPA 2EKLA 1M66A 4IMRA 4YAJA 1BVUA 2AQ8A 2E4AA 1DRWA 3QA9A 1I3MA 4NHEA 4EJMA 2Q45A 1PJBA 4HP8A 2A9FA 4QX6A 1PJ4A 4IS3A 3VZQA 4DIOA 1MFPA 3K8ZA 4MP6A 1X0XA 5JAZA 4GSLA 3OEWA 2XPCA 4I5DA 3ASVA 2FSVA 1Y8QA 2OHXA 2ZTVA 3GG2A 4PG6A 1DBVO 3GZNA 1HE4A 4Z9FA 2D4AA 3DMYA 4I1IA 5GY7A 4UREA 3TDKA 5JE8A 3NT5A 4WGGA 1LLUA 3H2ZA 1H2BA 3INRA 1ZK4A 1L7EA 1E7SA 4WNIA 3W4JA 5JFOA 4RV9A 3EK2A 5EQFA 4Q3EA 1TT5B 4BNHA 4KQWA 4AJKA 1SNYA 3ZV3A 1KC3A 1I2BA 2LDXA 3M2TA 5BR7A 1FF9A 2W98A 4WECA 1VLLA 2ZQYA 1EK6A 3ICCA 3V2GA 1WW8A 1PJ3A 3BMNB 3T4XA 3WBFA 1DRUA 1ORRA 3GC6A 1P31A 2CVQA 1SO8A 4XYEA 3PYLA 4QFDA 4BO5A 1HE3A 3SLGA 4QSMA 4UUOA 1WMBA 3F9IA 2P5YA 1NVTA 1YOVA 2O3JA 1UXGA 5IJZA 4XX0A 2BGMA 1PR3A 2C54A 4Q39A 3DHYA 1HZZA 4H7PA 5U1PA 2PH5A 2I5PO 4FR5A 1MA0A 4TKLA 2DVMA 2YQ5A 2CF6A 4XYGA 5A3VA 3RKUA 1P3DA 2HRBA 2X8LA 5DF1A 3K6JA 4NFSA 1JTVA 3WFIA 3EAGA 1YS4A 3O03A 3RUFA 4MINA 1TB4A 2PWZA 2WMDA 1DC5A 4NU5A 1MP0A 5JAMA 1DC4A 2BH9A 3Q2IA 2JCVA 4X54A 3I9NA 5JYDA 2SCUA 2FPGA 1SCUA 3RASA 1AN9A 2QRKA 3RC1A 4YT2A 1B8UA 1U1IA 1MG0A 3EVNA 3P2YA 4Z6KA 1CWUA 5DBGA 1PL6A 1ONOA 1R15A 2WSBA 3RVDA 5L4LA 1ISFA 1GYPA 5A5FA 3GAFA 3INTA 2O7SA 4KUHA 4Z9YA 4PRLA 2NVBA 3DOJA 1JWAB 4D79A 3AM3A 5A04A 3GY0A 4E2YA 1LRKA 4J3FA 4YJGB 2AA3A 3BYZA 4UVDA 1HKUA 3AFNA 8LDHA 1Q0HA 4YJFB 3BHJA 1U3UA 2DBVO 3B1KA 3HG7A 3L4SO 1DLIA 4FFOA 3WGTA 1CYDA 1Z82A 1DHRA 3OA2A 3WICA 1WXDA 4ID9A 4HV4A 2PA3A 4B8ZA 2BRUA 1AHHA 1NFQA 2VHWA 4TZKA 4II3A 5EQDA 4J90A 4TROA 3QP9A 4Z3DA 5TNXA 1R4MA 1OC2A 2B83A 2VHZA 1L1FA 4LW8A 3OJ0A 3VTFA 1PJTA 2O3UA 3RJ9A 4BV8A 1Q2XA 3MJEA 2PD6A 4B3JA 1PJSA 1DFHA 3KYCB 5BNTA 3DMTA 2A4KA 2GSDA 4E2ZA 3GDOA 4O59O 4BO3A 5B4VA 1T1SA 3WGHA 3JTMA 3JQAD 4FBGA 2PR2A 1E0DA 3AUTA 1PGOA 3VPGA 5KIAA 3K30A 1KS9A 2HAEA 3PDUA 4IZHA 2AQIA 4BNXA 1YKFA 3TZQA 2GLXA 1T2FA 1LEHA 2ZB4A 2VZ8A 3PGXA 4KWIA 3I9JA 2DU8A 2B4RO 2HK8A 1ZNQO 1BDMA 1C0KA 2HCTA 4QO8A 3DFZA 9LDTA 3TL3A 1V9LA 1RM3A 3TZHA 3U4DA 1DIBA 1U7HA 5A9TA 4DIFA 2AEMA 4K9DA 4NJOA 2XXBA 3VVCA 1Z45A 4YBZA 3PHHA 2EGGA 1KVSA 2C2YA 5JYEA 1J0XO 3K96A 5TJ9A 1U5AA 3FI9A 3H6KA 1KETA 2I3AA 3SXPA 1WVGA 3HE3A 1UDCA 3IDSA 1NVGA 4CLXA 4TRNA 3ANNA 3FN4A 1EK5A 2Y93A 2ZCUA 2X9VA 3B6ZA 5BT9A 3RIHA 1LDNA 1Y7TA 1M67A 5K0ZA 1GR0A 2X22A 1SZJG 4ZICA 2VHXA 2IXAA 3A28A 1UH5A 4FJ2A 4RPJA 3WB9A 2NTNA 1X7HA 3GAZA 3DTYA 4J7XA 5ADHA 1FDTA 2NSDA 5DT9A 4BQPA 1T2DA 2V6GA 3E18A 3WIDA 4TVOA 4LSMA 4LVUA 2UUPA 3MTJA 2EKPA 2HSDA 4ZQEA 4D46A 1EUDA 4ZQFA 1T25A 3MJVA 3KTDA 3VZSA 2VOEA 3L6OO 2Y0DA 2PH3A 1RM0A 4NJMA 4IPTA 4H15A 4LN1A 2VHYA 1HDXA 2HDHA 4CODB 4YWJA 5I8ZA 3OQ1A 4WASA 1I3LA 5CDSA 4GX1A 4RDIA 1J49A 1YB5A 3ZN2A 4WCFB 1GQYA 1U28A 1HDOA 2IEDA 2OXIA 1HRDA 4O63O 3JYNA 2PGLA 3GT0A 1HYGA 1UXIA 2P9EA 1ZXLA 5CDGA 1NBOA 2VT3A 3JYQA 4XYMA 2WWRA 3PQEA 1GADO 1WZIA 2I6TA 2CNBA 3ETGA 5IZ4A 5IF3A 1BTOA 3S2IA 1T26A 1R4NA 2WD8A 1Q7GA 1LTHR 2DUWA 3IP3A 3F3SA 5I7EA 2VN8A 5A06A 4AJLA 1PSDA 4CM8B 5LDGA 3MZ0A 3KUXA 4FGWA 2B69A 2EIHA 3GUYA 1ZEMA 3H9JA 3AI2A 9LDBA 3PJDA 2O4UX 1N1EA 3KYDB 3I6IA 2CMDA 1VRWA 1W8DA 1X13A 4JBIA 5ER6A 4CQMB 5LDHA 3NX4A 3LSYA 5IFLA 1IL0A 4UVGA 4R5MA 1V3TA 1QLHA 2UV8A 3P19A 3QVTA 1XHLA 1Y9EA 1YBMA 4FPXA 4LRSB 5EJ2A 1OZAA 3DB2A 4E32A 4AL4A 3WTBA 3ADPA 2C29D 1ISIA 3H7AA 1FDSA 2BELA 1E1LA 3KEQA 4G2NA 1DAOA 4PIVA 2WDZA 3PWZA 1TI7A 2C07A 3BMOA 5I9NA 3GRKA 3N58A 3ONDA 4K26A 3VDRA 3NDIA 3EDMA 2X5JO 1C1XA 2PTGA 1I24A 3PJGA 4K6CA 4C4OA 2FMUA 2V65A 2ZATA 3GNQA 4DQUA 1MUUA 3OM9A 3KVOA 1WDKA 1VL8A 3GDGA 4KDFA 1IOLA 1BXGB 1C0LA 2BLLA 4FJ0A 2QG4A 4E5KA 1JKFA 4FSHA 3E9MA 2Z1MA 3PK0A 4PRKA 2DLDA 3H5NA 3PVZA 3W8FA 4LRTB 3ZV5A 3F1LA 2B36A 5KVCA 4XWYA 3LF1A 4RLHA 1UDBA 1WAMA 2E82A 1UUFA 1V35A 3H9UA 1G0NA 1LC3A 4NH4A 3H9EO 5ENVA 4WLVA 4AVYA 1WWKA 3O38A 4F6LA 4UVHA 1IYZA 3WGQA 2AHRA 3ZWCA 4D3SA 3IKTA 4JP2A 4YJDA 2VWPA 4QT0A 3H4VA 3TFQA 1A4UA 2EF1A 1H9AA 5DP1A 1GUFA 4CMHA 4W9NA 1I2ZA 4URFA 1XQ1A 3UXYA 1XQ6A 1B15A 4CUJA 1OMOA 1QKIA 3BA1A 1TXGA 2VZ9A 4GKVA 5AXDA 4AJJA 1JKJA 1QORA 1X7GA 1N8KA 5K6AA 1IHXA 2YW9A 2D59A 1KY5A 3CE6A 1E5LA 5HM8A 1I32A 3AWDA 2DBQA 3IP1A 3D3WB 4CMEA 5I7VA 1A9ZA 5T67A 3DBVO 1P9LA 3I9MA 5A3JA 4NMHA 4R1UA 3CPSA 4W9NC 2DAPA 4PVCA 2WD7A 4CM9A 4NBVA 5ILOA 5KJFA 4FDAA 5JC1A 4GX5A 1BDBA 1VJ0A 1VKNA 1E3WA 1HZJA 3VOSA 3KV3O 4MVJA 3ZWMA 1K3TA 2OBYA 4FQ8A 3D5QA 4CLRA 5K6AC 4DGSA 3ZU2A 2CSUA 4YQZA 3EGOA 4Y67A 3LLSA 1E1NA 2EEZA 3Q2KA 3GEMA 4PGFA 2W2KA 3L4BA 4JK3A 3QQPA 4WPGA 3ZI0A 4CMEC 1XR3A 3UGKA 4JBGA 3KSUA 2OP1A 4OJNA 1NXQA 5JXWA 3WNVA 4BO6A 5HA5A 4YXFA 3E03A 1HDRA 1PGPA 1E77A 3TPCA 5A5EA 2O48X 1LDBA 4AJ1A 1T2EA 2YFQA 4K28A 5F1PA 3NV9A 1TA4A 5COQA 5ITWA 1ZUD1 2DQ4A 1DLJA 4D45A 1CQJA 1HDZA 3NDRA 4HFMA 1KEVA 3F4LA 1YL7A 3X2FA 5FI3A 3IL2A 1P45A 1ZSNA 2FSSA 3HUDA 3OBBA 2NU6A 3BMCA 4EJ0A 1K0UA 5GMOA 2P9CA 2EV9A 2GN4A 3G79A 1IPEA 2OORA 2YUTA 4XA8A 3RQSA 2OFPA 4AJ4A 1F8FA 5CDYA 3DBLB 4KOAA 4DRYA 1KEWA 4R9SA 2ET6A 4TRRA 2IRWA 4ND5A 4RVFA 5JY6A 3ZW8A 3Q6IA 1GCUA 4O1MA 3PHIA 3UOGA 1Y5MA 1NQ5A 4ITUA 1VJ1A 3F6YA 3KOUA 2C7VA 5KCZA 2QW8A 4FFLA 4IS2A 1DB3A 2G76A 3JQ6A 5JBIA 1KVTA 4W7HA 1F12A 1N2SA 2GZ2A 2Q1WA 2NV6A 1RM5A 5JS6A 4PLTA 4FIZA 3OFSA 1EVIA 4M87A 4DUPA 3D1LA 1LA2A 3CINA 1D1SA 2WTBA 2PLAA 5JAIA 1IY8A 4MJLA 1O95A 2V6FA 3BZUA 2J3HA 4J43A 1QYDA 3RWBA 1T1RA 4CMKA 1HDGO 1TT7A 2CFCA 4KMSA 3BIOA 2IZZA 4J4BA 2NVWA 1ZW1A 1P1RA 4NFHA 1DO8A 2VYNA 2XF8A 4YAGA 1AHIA 4XIJA 5HRUA 1SC6A 3UCXA 3FSRA 4GGPA 4TQGA 5H81A 2YYYA 3NTOA 4EI2A 1I33A 3A14A 2J8ZA 3NAQA 4OIMA 4RF3A 4YB8A 2VUTA 1UXHA 4Y6SA 5T5QA 3JYOA 1XGKA 2A94A 4XEHA 3ASUA 1NYTA 1ISHA 4BMSA 2EJWA 3BHIA 4ZD6A 4TZTA 2HMSA 3QVXA 4IY1A 4BNTA 4YEDA 1F14A 4ZN6A 2D1YA 3LC7O 4FFRA 4CMIB 2H9IA 4QQRA 4L76A 1QMGA 1QSGA 2VT2A 1J5PA 3ZZNA 4A5OA 2IZ1A 4HNGA 4Q3BA 4CMCA 5EIOA 3ENKA 3FBGA 3FR7A 3PLNA 3PP8A 5CPBA 2UVDA 5L51A 3WMXA 3HDJA 3QJ5A 1ZH8A 5JPIA 3PYXA 4R41A 1IPFA 2EGHA 4IDFA 3EVTA 3L9XA 4EW6A 2HMWA 2O3RA 2QRJA 3MWDB 1GQ2A 4BNMA 2AE1A 4YTEA 3ANLA 1NQAO 4PLZA 2Q2VA 4KTTE 3G17A 4FJ1A 4GSKA 4PLYA 1RJWA 2NWQA 3RUHA 2EERA 1ZSVA 4UVIA 4M55A 1ZK0A 3GF4A 3PGJA 3QSGA 2RHCA 3MJSA 1EBUA 5C7LO 2NTVA 2GO1A 1FDWA 2E48A 3DBHA 1B8PA 3H5AA 4CQLA 1PGQA 4IZIA 2VZ0A 3ZWNA 1PL7A 4RVDA 1DFGA 4W99A 2BI8A 1NTOA 2FPPA 3GHYA 3OIFA 4RF4A 1Y8RA 1GZ4A 4P4LA 3TOXA 2FN7A 2NVUA 4HWKA 3RSHA 3W6UA 4BGVA 5CG2A 3GMSA 2EP7A 2VQ3A 1C1DA 3OJLA 2O3QA 5CDTA 5ER9A 4E30A 2Q1SA 1BW9B 2DM6A 3V2UA 3RFVA 4MDHA 1BVRA 3ZU5A 3D3EA 1OC4A 5AXCA 4CM9D 4CR6A 4CV2A 1GFSA 1NM5A 1LX6A 4FFMA 4FFNA 4BUCA 4DC1A 4HBGA 5BQFA 4S1VA 4CLOB 1VL6A 4M54A 4EGFA 1E92A 4MVJD 4OSOA 1XDWA 3AUSA 4WEOA 4XDZA 5JMPA 2VNAA 4E0BA 4HADA 3K9QO 5DP2A 4GWGA 5L95A 3ETDA 4ZRMA 1Z6ZA 2EKQA 1XWFA 2O3SA 1YGYA 3F47A 1CJCA 1SEPA 2RHRA 4NG5A 5KKCA 4A10A 4E21A 1LRJA 4E2XA 4Q3AA 1XEAA 3PTZA 2Y1OA 2OMEA 1LXCA 3OHSX 2IODA 3ZWAA 5BSEA 3OSUA 1PS9A 2GZ3A 4L74A 5DCUA 2G82A 4II2A 1Z75A 1X1TA 4OMUA 2UDPA 3RFXA 1MLDA 1N7HA 1A9YA 5ENDA 3DHEA 2BD0A 3UN1A 1I36A 3AM5A 5EERA 3WX0A 4DA9A 3WOHA 1NX6A 4INAA 3HDHA 4OYRA 1P1KA 5DOVA 1H5QA 3OEYA 2X23A 1UP7A 1EDOA 4GL4A 1XIVA 2CVOA 4WE3A 3HFGA 3TSCA 1MX3A 3LT4A 3ONFA 2Y0CA 1DEHA 4XR9A 1UZNA 4U6QA 4YDRA 4ZVVA 1ZEJA 2FHSA 3DOOA 5HWSA 2FPIA 2Z1NA 3EUWA 4E4YA 1D1TA 3SJ7A 3ICPA 6LDHA 4ZHSA 3NT2A 4OXNA 3OECA 4RZIA 2Q1UA 4A2CA 2WEKA 2OOSA 1QLJA 3H9GA 4IXTA 5G2OA 4WLUA 4U8GA 1EDZA 4EBFA 1GPJA 3W8DA 3SBOA 1E7RA 3I9LA 5A9SA 1PS8A 3P2OA 3VKVA 1YDEA 1PU2A 4E6PA 1UAGA 1YQDA 2GN6A 2Q50A 1JQBA 4PLHA 3TFOA 3M1LA 4KTVE 1RKXA 4QXMA 3FTPA 2D0IA 2ZTLA 3VC7A 1BXZA 2R6JA 1NPYA 1ID1A 4OXKA 4IIUA 1F06A 2Q99A 2EXXA 1YB1A 4N7RA 2R2GA 4IQGA 2DTXA 2EW8A 3KM0A 1ZZEA 5DZSA 2D8AA 4NQZA 3JD1A 1H2HA 2VYND 3JSAA 1FXSA 2OL4A 2BGKA 4PLWA 3ZWVA 1QG6A 1J4AA 3LF2A 1OFGA 3CKYA 3HNPA 3UH1A 5B4UA 2WJPA 3MJCA 4NBWA 1N1GA 2O7QA 3K2BA 4RVUA 5DULA 1SPXA 1ZO8A 1JLLA 1A5ZA 1GY8A 4BGEA 1LQUA 2G17A 3L9WA 1P1JA 3RBXA 4IJUA 1GD1O 4DPLA 3NEPX 3QW2A 5COAA 3C7CB 4N54A 2PD4A 5G4KB 3WJ7A 4DLLA 3P7MA 3E82A 1EEHA 1GUZA 3OF2A 3DZHA 4FB5A 4XCVA 2PZLA 4BS9A 3GVPA 1X0VA 4WK6A 4GPD1 4D43A 1WDMA 3JCZA 2HU2A 4C7KA 5JDIA 2DFVA 2X6TA 5ICMA 3R3JA 1E3LA 5IN4A 2AW5A 2PY6A 4MVJE 4FCCA 4K1LA 5DBIA 4F45A 3W6ZA 2PKQO 3GPIA 1EE9A 2YJZA 2B4TO 3WQSB 4AJHA 4MKRA 2FOIA 2FR0A 1P74A 1YVEI 1JAYA 1R0SA 2Y1DA 2VNSA 4AJNA 4ALMA 2X0RA 3DQPA 4KP7A 3O8QB 3RUIA 1OBFO 3QVWA 4J7CA 4U7WA 1LRLA 1ZK3A 3FRJA 3ZWOA 4RPLA 2IDZA 5JDIC 5HBRA 1LSOA 4AICA 1YONA 1E1MA 1PQUA 4MVJP 1KERA 2ZQZA 3RI3A 4J4HA 3UHAA 4D3FA 4R1SA 5L9AA 5EMHA 1LDMA 4N5MA 4WNCA 5G4LA 2Y0EA 4WOJA 5CG1A 2RBEA 4ONEA 4WLNA 4YQYA 1ARZA 1PJQA 3RD5A 4N18A 4A27A 1KYQA 1A7KA 1NHGA 3NJ4A 1PZEA 4YT4A 2PKQP 3AI1A 1N5DA 3ETEA 3QHAA 4PLCA 4BMVA 3CIFA 3G49A 4NFYA 4YRDA 1YQXA 1XLTA 3WGIA 4HX5A 1X14A 4BNUA 1RWBA 2RH4A 4BKRA 4JJGA 4GX2A 4E12A 4XKJA 3K5PA 2VHVA 1H0KA 2QYSA 3NT4A 3DMTC 4NK4A 2X5OA 1R16A 2HQ1A 3UCEA 4YA6A 5THKA 4BL5A 3EZLA 2NNLD 4PFJA 4Q9NA 5HS6A 1ENZA 3VPHA 3HSKA 2BFOA 3LLVA 5DN9A 3H9QA 4QTZA 3RCBA 2C82A 4UUMA 3PIDA 4CM5A 2TMGA 5AYVA 1K6JA 3RBZA 1NR1A 2Y1CA 1R37A 2ZKLA 3I23A 4W6ZA 2GERA 1ZKMA 4HFRA 4RCVA 5A1TA 3OMLA 2VRBA 3OETA 1K6XA 3WGZA 1YH3A 2H6EA 4CM4A 2EHDA 3RUCA 4YACA 1P77A 3L0DA 3TOZA 2RCYA 5TC4A 3EY4A 2ZB3A 3EMKA 3PDJA 4P4NA 5F3RA 4MIOA 3MCVA 3EC7A 4RF5A 3E1KA 5BSFA 3FHLA 1NVMB 4FGSA 4IGEA 5GZ1A 1C0IA 2J5RA 2P68A 2JAPA 2V6MA 5COBA 3GGPA 3GUCA 4ALJA 4HFNA 4EDFA 1NQOA 1WLYA 2YHIA 3BMQB 3BTVA 4L8VA 3IMFA 2PFGA 3GVCA 3V5NA 2ZB8A 2NLOA 1W6UA 2Y67A 3G1UA 1JA9A 1CERA 4NNJA 1N9GA 3DO5A 3WIEA 2Q49A 3FPCA 1ADCA 1H6AA 3HADA 3DEYX 1HSOA 1E3SA 1PIWA 1DXYA 2H1SA 2QX7A 4M1QA 4IBOA 4YAKA 6ADHA 5MGBA 2BFPA 1NAHA 1X1EA 4KWHA 4OHUA 4GGOA 2CUKA 1VSVA 2CZCA 3AOGA 4YRBA 1A71A 4BO1A 4J4TA 4E2WA 4ND3A 5A02A 4GMFA 3UAGA 1PZFA 3D4PA 3MWEB 2FP4A 1NAIA 3FTNA 3N7UA 3NYWA 4PZEA 1DC6A 1DSSG 1LLCA 3WWZA 1QYCA 3B20A 1SOWA 1ZXBA 1YBAA 1UXKA 3HB5X 3LT1A 2ZJ1A 3JQDA 4NIMA 1WDLA 3RAJA 2CVZA 1X7DA 3JQAB 4CMBA 1R66A 1GYRA 2V6BA 5TX7A 1ZMOA 3DZIA 5L7YA 1DIAA 4N5LA 1XELA 4L4SA 4PCVA 3DBRB 4OOFA 5KWEA 1JWBB 4CM7A 1J6UA 1A7AA 1B3BA 2IXBA 1P1HA 2ZYDA 2B5WA 3DXFA 4YJHB 2X0JA 4XRRA 4EEZA 1WPQA 3UW3A 3ZHBA 1U3WA 1ZVMA 2AQKA 3E9NA 2VYVA 4BNWA 4JJFA 2X5KO 5A03A 4J1NA 1R0KA 2FR1A 3VZPA 2I76A 2WYVA 2GGSA 2GZ1A 2OUIA 1YXMA 4MIYA 4BHTA 1MFZA 3OJEA 4BVAA 1KVUA 3JQ7B 3ST7A 2UUOA 4HFJA 3H8VA 4JN6B 4R54A 2X86A 4CR7A 3TWOA 2GN9A 1M6HA 1HDCA 1PZHA 3I4FA 3JD3A 3UUWA 3GHHA 4GAEA 4XQEA 3UF0A 1VKOA 3RU9A 1VJTA 1Y9AA 3A4VA 3AK4A 4FS3A 4A73A 4ZJUA 2P4HX 4UAGA 3EYWA 2GD1O 4XIYA 1HLPA 1UAYA 2QHXA 1F17A 4CLDA 1SB8A 4E33A 1HYHA 1P44A 3I9KA 2O4CA 4O5OA 3NGXA 4IDDA 4CV0A 3FNGA 3GEGA 5AOVA 3D5TA 4BO2A 4CV3A 1MC5A 4B3IA 3U09A 2G5CA 1TT5A 1Y8QB 3JQGA 3W8EA 1V8BA 4AJOA 3H2SA 4CM1A 5CEFA 3GZNB 4MKXA 3BMNA 1PEDA 4W7IA 4WLFA 4NZ9A 3K73O 3QWBA 3DZBA 1LDGA 1UDAA 4WCDA 4J49A 3SEFA 3JQBA 3G3EA 3ZWYA 4TRMA 4Y6RA 5ES3A 3LVFO 3PZRA 1E5QA 3VH4A 4DLBA 1JU9A 4OXYA 1O94A 2NUAA 4EITA 3VTZA 4L75A 2I66A 2GNAA 2JAHA 4EJ6A 1YJ8A 1PWZA 4IIVA 5TF4A 2HKIA 1XKQA 2AE2A 2BFMA 1R12A 4EUHA 3S2EA 3BTOA 5JLAA 1UR5A 1YE3A 4RLSA 5HTOA 3CH6A 2OGUA 1N7GA 3H5RA 2X9GA 3WQRA 1YOVB 4BNGA 2QZZA 1CQIA 1F8GA 3DWFA 2C20A 3B1FA 3I3OA 1DRVA 1I0ZA 1I5RA 3GGOA 3JQBC 4IINA 4LCEA 4LISA 4R69A 2E37A 1GUYA 3RJ5A 2P2SA 1D8AA 3AOEA 4EEXA 1ULUA 4J1QA 4DPKA 1I2CA 2IE0A 2X1HA 4B4WA 3KRTA 3WSVA 1UP4A 2P9GA 4RGBA 1EBFA 3HDQA 4F3YA 4UUNA 4WJZA 2C5EA 2VWGA 1SB9A 1E7WA 1RYDA 2X0IA 4P22A 4Q3NA 3OA0A 4XGIA 5GZ6A 1K2WA 5F1KA 1NFRA 1ZK2A 3GN1A 4RPGA 3GFGA 2GR9A 4BO4A 3P5SA 4WKGA 2PGJA 1VI2A 5L3ZA 4YJGA 5KVVA 1EE2A 2DC1A 1Z74A 4YJFA 1Q0QA 1Z7BA 4XGNA 3FBTA 3L4BC 4Y9DA 3DHNA 1K89A 1ZSYA 2PKRA 4J2OA 4JP3A 1CDOA 3W4KA 4GVXA 3AJRA 4W82A 1G1AA 3KB6A 1U8FO 5FYDA 3LK7A 1T4DA 2PV7A 4MKZA 3ABIA 1Z73A 4WEQA 3VPSA 4WOKA 1O9BA 4DWVA 2EP5A 4F46A 5JMWA 5IZCA 1GYQA 1CEQA 4MVJI 2NM0A 4BGUA 2J5QA 3WG9A 2VUUA 3TRIA 3DC2A 4LVCA 3IQDB 2EJVA 3PRJA 3KYCA 1HXHA 3EZYA 3NTQA 1TEHA 4HKTA 5JNLA 1I01A 1TLTA 4KUGA 3ZNQA 4ZGWA 2JJYA 3SX2A 1BRMA 4CL8A 4DMLA 5BSHA 1R4MB 5TSDA 3FNEA 3DL2A 1DJQA 4BKQA 2ILTA 3I52A 3SLKA 3PWSA 2G0TA 3NRCA 1C0PA 2VCYA 2VUSA 3F4BA 1MC4A 4OO3A 5IZCC 1VE9A 1EUZA 3WQQA 7MDHA 3OIDA 3O9ZA 3Q9NA 1IHYA 4ZU3A 5CHEA 3RUDA 3W1VA 3ZV6A 3ORFA 1LU9A 3LT2A 2B35A 5IDQA 4RQUA 2POQX 2GF2A 3SC4A 4CPDA 1QYWA 2CDBA 1YWGO 3KSDO 1PGNA 3IUSA 5C37A 3TL2A 3WTCA 1SBYA 3OP4A 3QLJA 3VH1A 2A35A 5T8KA 3L6EA 1Y5RA 2VYVD 3AU9A 3VZRA 4CMAA 2NU7A 3Q0EA 1ULSA 3DFUA 3WMWA 1KVRA 5TLSA 3QWIA 4RZHA 3DONA 3IJRA 5ILGA 4R16A 2ZTMA 1EUCA 1YBVA 2NADA 2Q3EA 3A06A 3WGOA 1G0OA 3VDQA 2OZPA 5EINA 1E6EA 1O0SA 3DZFA 4YYZA 1NFFA 1MXFA 2PZKA 3PHLA 2JL1A 1EZ4A 2J6IA 3ITDA 4KDEA 3VAZA 3K31A 4L0QA 4D3DA 4IDBA 1P0CA 4GH5A 3UCFA 4R4JA 1O8CA 4ND4A 4Q3CA 1AGNA 1GZ6A 3U9LA 1LDYA 3JQ9A 3WS7A 1JVBA 3ROKA 5B12A 3ULKA 4MVJG 4P4GA 3KHUA 2F00A 3PPIA 2BI7A 2JD2A 5JY1A 1A4IA 5AVOA 1JN0A 1FMCA 2O2SA 3C3XA 5MDHA 4JNKA 2X7HA 3GLQA 3NTRA 2WYUA 1HL3A 4I5EA 4WCFA 3WJAA 2E6UX 5IDWA 3WBBA 3NJ8A 2FR8A 4P38A 3KBOA 5G0SA 2Y99A 1Z7EA 1AE1A 5A4DA 3IC5A 4BO0A 4NJMB 2YHIB 5AXAA 4HUJA 4GQAA 3V1YA 2X0NA 5EPOA 4YPOA 1LJ8A 2O2YA 3HWRA 4NDNE 5KNLA 1U8XX 4ND2A 3JQ9C 4DL9A 4M86A 4DBVO 4XRGA 3WSWA 3U3XA 2DT5A 2B4QA 3IS3A 3O4RA 4CM8A 2O3TA 5CEEA 3U4CA 2J3KA 3AI3A 1ENYA 4K6FA 1MXHA 4XB1A 4Z3KA 3L07A 2RAFA 3L77A 3KYDA 1GV1A 2EG9A 3WFJA 1P1IA 3HZZA 3GQVA 4CQMA 3S8MA 1R4NB 1JDJA 1EVYA 1M2WA 3RROA 3GZ4A 2HK9A 2DTEA 1EFLA 3HHPA 4LMRA 2NU9A 3PLRA 4RVSA 4Z0HO 3D7LA 1KEUA 3AY6A 4BB5A 4R1TA 4H16A 2P91A 4MIEA 4S3MA 1BXKA 1T4BA 4GVLA 3C85A 1DIRA 1ZMTA 1ML3A 1Q0LA 1AXEA 4HY3A 1U3VA 5JO9A 5GZ3A 5IG2A 2CF5A 3D64A 3QWFA 3ZU3A 5TGDA 5G0UA 1ISGA 1S7CA 5CP8A 3OJOA 1E7MA 3RC2A 1YQGA 4XQCA 1JVSA 2PK3A 3T7EA 3PHGA 1T2CA 2HJSA 1CIVA 3GRPA 1YJQA 3OICA 4H3VA 4DBZA 2I99A 3BAZA 2GCGA 1BXGA 2I67A 5DBFA 3VHRA 3BMOB 5CDUA 4J16A 1XYGA 3GK3A 2H5LA 1DJNA 2DBZA 3WNQA 1E6WA 1C1XB 3KYBA 4DREA 4PG4A 1GV0A 4W4TA 5JW6A 2Y68A 4FN4A 4PZCA 2JKVA 1HTBA 1HE2A 3B1JA 5EL0A 1ADFA 1VC2A 4BQRA 4IM7A 2J5KA 3X2EA 2TMDA 4TRJA 4YCAA 3ZHYA 4CL3A 2D2IA 4LSWA 1IULA 1BWSA 4TMFA 5LCXA 4MVJF 1UZMA 4BNFA 1O5IA 4AJPA 4RVGA 3LQFA 5TS3A 4BV9A 4YVFA 5LC1A 4J6FA 1HEUA 3HB4X 1LNQA 4BNIA 4FC7A 2DTDA 3GNTA 5DOZA 1HETA 2HK7A 2GYYA 4Q3DA 2Q4BA 1GEGA 2OO5A 4Z0PA 1B26A 1KY4A 4FOSA 4A26A 3IOYA 2JFFA 3DOCA 4OL9A 4Y98A 2RH8A 2RIRA 4NBRA 2JD0A 4OKNA 4A03A 5JAQA 4PLFA 2JHFA 1PR9A 3E48A 4BNNA 3JQGB 2HO5A 3JV7A 4PLPA 1JAXA 3D3WA 4Y6PA 5AXBA 4GMGA 1PGJA 1PQWA 3GA0A 3RUEA 4UEKA 2Y66A 3RU7A 1AXGA 1DIHA 4QO7A 4U6SA 2B37A 3ZDFA 1ZFNA 4PG8A 1KVQA 3E5MA 1S6YA 1H6DA 3E5RA 4PLGA 3ZWPA 2HUNA 4DLAA 2GPTA 4G81A 1YL5A 5FFFA 3BTSA 2DUUA 5G0VA 4IDAA 3I4CA 5A9RA 5IDXA 1T2AA 3BXXA 1ZCJA 3R6DA 4IMPA 1QYVA 5L7WA 2X4GA 4MO2A 3JQ8A 4BIIA 2NACA 1ENOA 1WMAA 3FNHA 1CF2O 4IQ0A 3V1TC 2WD7B 3LDHA 4IJVA 1GL3A 1UZLA 4ZQBA 4BOYA 4ESOA 1GQQA 1IZ0A 3K92A 1QV7A 4RORA 5FF9A 1ISMA 3WYCA 1H9BA 1P1FA 3DDNA 1E3WB 2Z95A 1XU7A 3RBVA 5KVQA 3TZCA 3UFXA 1QR6A 1EVZA 1UJMA 4CLRB 1PJLA 2I65A 4GX0A 1HYEA 3GGGA 4A7PA 4BNLA 1U7TA 3RUAA 2AG8A 2W2KB 4YT5A 4D42A 5KJCA 5C7IO 4BKPA 1PQPA 4XJSA 4U0KA 3PEFA 3C7AA 1BSVA 1U4OA 4R51A 3F5SA 3GVHA 4JLWA 3WR5A 4J0EA 4J9UE 2W4QA 4IJWA 4O0LA
chains in the Genus database with same CATH superfamily
1PJRA 3OQBA 3OCVA 4G1CA 4JB0A 1N32B 5FORA 4IIBA 3PFIA 5DEOA 1N7IA 5EJ7A 4DSNA 1Z6XA 4JLBA 4R1NA 2JATA 1J22A 1KSFX 3DZKA 4XLTA 1P7VA 2DGDA 4RF2A 1XA0A 1XZIA 4Z9XA 3KPJA 1W5AA 4GYWA 5IARA 4DWOA 4EG1A 2ZB7A 3NPMA 4EDHA 1NP3A 1PZGA 3AHHA 5I7FA 1T35A 1E2DA 3B9QA 1N2CE 1R5BA 2A86A 5GM2A 3W7VA 1BMDA 4F6CA 5BUCA 3EGDA 1QHIA 2QTMA 4HVAA 4JCOA 4BNYA 1OFTA 2NSYA 2GPSA 3I12A 3KWMA 5KZMB 1Y42X 1E66A 4PGMA 4E3ZA 3ZHXA 1FIUA 3SM3A 2HI0A 1A9PA 1W36C 2QLTA 2X58A 3FTEA 5BVHA 2H08A 4URHA 1H94A 2DY0A 3MJDA 2ZWVA 4AG5A 2AZDA 4KQ9A 3I61A 3DDZX 4I9FA 2BT4A 4HT3B 3DT6A 3QITA 4PAWA 4XIGS 3KKLA 2FP3A 4EKIA 2HJ9A 2HU5A 1LK7A 3KL4A 3KQYA 4KXFB 3AY7A 2CLIB 4PQGA 5EUMA 3IV9A 3ZCUA 5LWQA 1W581 3IE1A 4OHWA 3RFTA 3DDHA 1OX4B 1P5JA 2ODAA 2QPTA 4R9RA 5C4IA 3JARA 2PGIA 4PY2A 2RE8A 1LC0A 2Y4NA 3O8DA 5CXQA 1XQ9A 2YY7A 5EPUA 4PIPA 4BBPA 4E7PA 2CXXA 3KPVA 4K9NA 1I9GA 1Q5PA 4EB3A 1WE2A 1CETA 4HXYA 1YQUA 3PNYA 4V0KA 3ZCQA 1DJMA 2BKAA 5IU6A 1LBEA 4PNPA 5EKSA 4H35A 3TN7A 2PS1A 1AQYA 2C99A 1RKVA 5TT1A 3G5TA 1DV2A 4Y1EA 5BW8A 2VAVA 1Z8FA 3L7LA 1UJ4A 4WOBA 4CM6A 1CQPA 3L1VA 3CMCO 2GZAA 3NOVA 3S2FA 3LUPA 1Y6QA 2P30A 1AS0A 3VR6A 1ZJ5A 621PA 2QY6A 2QIOA 3RSQA 4YECA 5CFZA 2CL7X 2Q5IA 3QRWA 3T5BA 3NKLA 4QHSA 4M89A 2AX4A 4WT7A 1Q1NA 4K8OA 1A97A 4QWMA 4A0SA 4DQKA 5MFPA 1VPWA 4J0DA 5ALNA 3R7WB 1PWEA 3FMFA 5BORA 1VCIA 4GZ3A 4RJ2A 1HORA 5GV8A 4BATA 1HY3A 2XTAA 2GMWA 3TECE 2PN1A 3CJTA 1DC3A 3GJ3A 2M6LA 2G08A 5DHSA 4MWZA 1ZPDA 5IAAA 2Y27A 4U2KA 3Q10A 1XJWA 2HF8A 2WVHA 3CF4G 3UMVA 1MVLA 2AXQA 1RBMA 4EW3A 5KOIA 1GSIA 4YLGA 1KJZA 1D0VA 4WHMA 4HNAA 2J3MA 3WDKA 3IELA 2H7VA 1ZG3A 2V7WA 4P34A 4WKOA 2QQ0A 2VIIA 2YWXA 2E1PA 3PVSA 4UM9D 4US1R 3THRA 3V2HA 1T6ZA 1JR3E 3GFQA 3PA8A 4UTVA 2B0CA 4QM7A 2AKYA 2Q7DA 3T7CA 4POAA 1SUPA 3HA7A 1F9EA 2YXNA 3IRUA 4X3OA 4YRAA 4WQMA 1UT6A 1YR7A 3ZXYA 3I6YA 1T3ZA 4D98A 2YXEA 3KTOA 2PA0A 2I4MA 4ZO4A 3UC9A 4X3CA 4AT1A 3NBUA 2UAGA 1YRQA 5FOWA 2WMYA 1VPDA 3MRXA 1V6AA 2C7BA 2PAAA 4WKNA 1JFFA 1FYEA 2FRDC 4QAJA 4XSHA 1DIGA 1C1HA 2IQ5A 3MMNA 4PZPA 4DGQA 3A9WA 3FYTA 2TSYB 2ODWA 1F48A 1WHTB 4KE9A 1IWPB 4QDJA 2ZYTX 4R2LA 2PMCA 4KSBA 2BLNA 1C3OA 2DECA 4M0PA 5DJ5A 3H4MA 1OV6A 3U81A 3AGQA 5C52B 4GXQA 3T4EA 3BPSA 3AESA 4IDEA 3UGJA 3R5HA 4HNRA 3TI9A 5K0LA 2CUZA 3IGFA 2E6KA 2ZSUA 2OFOA 5FYQA 3AJAA 1NBMA 1GXSB 4QOIA 2JLXA 5ELXA 4KLCA 3U7FB 1XCMA 1YSCA 2WSMA 4HEA6 5EWLB 3BOSA 3E58A 3LU1A 3B70A 3RLFA 4XYBA 4U0JA 3QEOA 4TMYA 1Y8RB 3W2GA 1JXOA 2ZE8A 5KS2A 4ZVUA 3G7UA 1KYIA 2C3YA 2NTEA 2OCGA 3D4NA 2EHJA 2HMUA 3PGLA 4KQ1A 4WSOA 2J9XB 2ZCJA 1G5FA 3DVAB 3HN2A 4B3HA 1PV1A 1X7ZB 1DAGA 1ZM2A 2PZMA 4I9HA 4C5BA 4MP3A 4L5IA 1L4MA 4ADSG 4ND1A 1SQ6A 2L0XA 3H2BA 3ON5A 1M6WA 4HAVA 3TBKA 3UWPA 1XXHB 1DAKA 3C1AA 4DV6B 1HKHA 1CCWA 1GGVA 2H8GA 5A3SA 2RG7A 4YS6A 2X5NA 1R0LA 5DLYA 4E13A 2OKGA 2ZJ8A 1DOHA 4TVBA 5JADA 5JIBA 5JYBA 2ISQA 3G13A 4KRXA 3O2SB 5DNAA 3UATA 2XYPA 3L04A 5I6DA 2OD9A 1UBCA 3TUIC 4C2BA 2WWYA 3LQKA 1SEVA 4Q01A 4HDNA 3SQDA 2ZRDA 3NGLA 1CXZA 4Z8YA 2YV5A 4L15A 4LWZA 1W73A 3WV5A 4LY9A 3QBTA 3BL8A 4UEJA 2W8ZA 2C3OA 3HBJA 1PV2A 4OA5A 1XMSA 4W7SA 3UK1A 3GJRA 5DDIP 5IVPA 1TJ3A 5F2OA 1Q3KA 5J2TB 1RR6A 3DL4A 4O4HB 2JJ2A 4MUGA 5KVAA 3AWIA 1IDN1 5AD1A 1DG9A 3Q3HA 2O57A 3HKCB 5FWNA 2XDYA 4EZBA 2IYWA 4CLEA 4D25A 1SCBA 1MQSA 1NQTA 2B6NA 1FDIA 1U81A 2VYFA 3MWYW 4X85A 1W36D 2PO5A 1Y80A 4M8LA 3RNLA 3VUFA 1O5OA 3H4TA 3RH0A 4LWQA 3WQHA 4DIEA 5F7OA 5IMBA 1ZDMA 4Z1MD 1CY8A 2DFKB 5DBOA 4M9CA 2BBWA 3MUEA 3I2GA 5EQJB 3FAKA 1K1EA 1NSYA 2C3UA 2YZ7A 4B31A 4GZ6A 1UANA 3GJ0A 2BJHA 3NAZA 3CN7A 2IBSA 4ZZ1A 1SCKA 2O7RA 1QIDA 4IMIB 4KZPA 1OJ7A 4U00A 4TV9B 2P6PA 5IXSA 4BX0A 1TECE 4ZQHA 4P0QB 3BQNB 3HM2A 2EJCA 3RC8A 3UJ3X 3ZGXA 3K0KA 3BWXA 2JF0A 3TR5A 1DG1G 1D2RA 3UUGA 2ZE7A 4E3WA 1GZ3A 2C92A 1US8B 3A4YA 1R74A 3OJXA 2IEIA 5JQWA 1S4QA 3WE7A 2AJTA 2R87A 4RDHA 5G0TA 3ZOKA 3O82A 2IOYA 4K6KA 3M8KA 5EIXA 4G67A 4RHUA 1T1IA 1ZHHA 3OJFA 4CMJA 1C8BA 2I2WA 5IXJA 2PWBA 4LF7B 1JXMA 2WM2A 3L7NA 4G36A 1FDUA 3E9QA 2OFFA 1KAGA 2UXBB 4KVZA 2VPYA 1PS0A 3L40A 3PWKA 5TQVA 2BMJA 3FPJA 1BJRE 2BE7A 1HSZA 2IZOA 4BVEA 4GP9A 5JJCA 5LL6P 3QEAZ 1OAAA 3UJ9A 4PQYA 2CMFA 1MOPA 3LJKA 4YAFA 4XSGA 5DTMA 2VTBA 4OHFA 5CW2A 2QR2A 3T41A 2HQOA 2VNKA 3CX8A 4IEIA 4QTXA 1EQUA 2ZTUA 2AFRA 4I4TF 3IT2A 4F2PA 5FOTA 1VECA 1JBQA 5FV7A 1U9CA 3HVJA 1TJPB 5KKAA 2C3MA 3WK5A 1X2EA 4E7OA 2Y05A 4LHYA 1E2MA 2PGAA 4G5SA 4BE7B 5AIAA 2BOVA 4IIJB 5AW6A 5KJEA 3N74A 5IDYA 1NUAA 4XOUA 1Q0PA 3OPXA 5IK2A 3WYBA 1Q0TA 2FK7A 4N4AA 1STOA 1W0JA 1OQAA 3FMIA 1S02A 4MTCA 4NBNA 5G4KA 3FFBA 2JFVA 3QE3A 1R6XA 2P0YA 3Q0IA 4N0DA 5JCJA 1RWVA 4YMUA 1MV8A 2YXLA 5DE3A 3G6WA 1WHSB 4TKMA 3FJ1A 1GPAA 1SRQA 1NUPA 2QI9F 3LIPA 2FFJA 2W6CX 4ZQGA 1U5CA 1VYHA 3CUEF 4GKAA 2A9QA 5JBNA 1JLLB 1ACLA 1JLKA 1X8XA 1TGYA 1Y5LA 1SBQA 1SQSA 3D2LA 2W6MA 3O26A 4ANFA 3PJEA 1BKSB 5JZ9A 2TRSB 3QV1A 2ZYVX 3DAOA 4YDQA 4XR4A 2A9PA 4EY4A 5KCMA 2ZETA 2QTGA 1CRWG 5EZYB 5LA6B 4GPEA 4I8XA 5CDFA 4Y2QA 2PM8A 1EX6A 1T9KA 1YK1A 3JYPA 3B85A 3IQWA 2Q2QA 3SZ3A 4XB2A 1B8VA 2IYOA 2ZE5A 1C7JA 1DQNA 1HDYA 2WVAA 3C6ZA 1BMFD 4FHGA 1QH9A 1S8AA 1NASA 3AUFA 3KPWA 4IL5A 1Y1SA 2ALJA 2Q8QA 3E6AA 4X7RA 4L02A 5D84A 4LCJA 4KR0A 2DUNA 3GEIA 2PRSA 2QXTA 3FRIA 4BB6A 1JWLA 1JR6A 1SXIA 3GYGA 4MOWA 1LCIA 1M10A 4L5AA 5EE3A 1OHHA 1GFZA 1T9DA 4TSRA 4A5SA 2BBSA 3HO6A 5CVTA 3VC3A 4FEEA 2JBAB 2B5VA 3CRNA 5H3HA 3MJTA 1YAJA 5CNJA 4AMBA 3WO0A 2ZT6A 1RWOA 2ISCA 3GLSA 1VFNA 3K1ZA 3U6BA 4IJKA 1U9JA 1ZI6A 4JT2A 3RF7A 4OHKA 4AN0A 4BV2A 3U17A 1OZ0A 4QUKA 4CDMA 4Y2YA 421PA 1KKUA 2LNDA 1MF7A 4YONB 5HKBA 3TW6A 2JJ1A 5JQGA 2ZYAA 3CR8A 2Q4TA 2J7KA 2F1RA 1R0ZA 3LIIA 2DPYA 3AH8A 4X1KB 1MAVA 4UE2A 1T91A 8AT1A 1JQEA 3AP1A 3O8RA 3AP3A 1F2UB 2QBYA 2GAAA 1KEPA 4HQNA 3QIAA 4CV1A 5DW0A 4D8TA 1CC1S 1ENPA 1ZJ4A 1L3IA 2VAXA 2GBLC 2ZJ0A 5DK4A 1U3TA 5BP7A 3SYKA 2CV0A 2IYLD 3HKEB 5TT0A 1QFZA 1FFGA 1WG8A 2ZRCA 2F1KA 4CTNA 1MD9A 1B6RA 3LOPA 3OE7A 4Q9DA 2C2XA 1Y4SA 4AKHA 2X5XA 1FRVA 1WW2A 1TMYA 3FPAA 4X20B 5ECWA 5H02A 1QX3A 1ZBQA 4UVEA 3SVTA 3ROQA 5BSGA 1R7RA 1QS0B 3C97A 3KZVA 4AM8A 3F9RA 3E9ZA 1DJOA 1A72A 1YR6A 1AKMA 3NDJA 5IWCA 1B4DA 3LWDA 4MYDA 3SC2A 1JUDA 1XTQA 2OSBA 3ZCTA 4LXYA 4BQQA 2BFAA 2HTEA 1SAYA 2J3IA 2VH2A 2VRCD 1ONNA 4IGKA 2DFDA 5EKTA 4B6FA 2HIGA 4KQ2A 3IOCA 2HFKA 1GP2A 1OREA 1A27A 1XTIA 3BRCA 3P4UA 4KRYA 4Y1RB 4A23A 2XOXA 3L8ZA 1CJSA 2EZTA 3F7NA 5CT5A 4AQ7A 1EFRD 4DXHA 2A1UA 4IVPA 1R00A 521PA 4CEHB 3DPUA 1EH5A 1RPNA 1U2GC 1XCGB 4D9FA 1NVFA 1T1GA 2MDTA 3AFHA 2P2LA 3DXYA 4ITRC 4RMIA 4C7BA 3IQZA 2FNAA 4ZV9A 1HNZB 2YHAA 4F4JA 5JAUA 3T52A 4BJ5A 4NVRA 4MR8A 1R8JA 3FCSB 1HLDA 2YJGA 5T8KC 4PXAA 2XT6A 3RSLA 2G67A 1B42A 3GBPA 3M33A 2RKOA 3I72A 3SR0A 3WRYA 1Y3BE 1GGEA 2QP3A 2G5GX 3BSYA 3G2NA 3OTOB 2HXYA 3HPRA 4D1YA 5DIZA 1ZD5A 3V8BA 4QGSA 2GD0A 2M6RA 4BP9A 5BSKA 5CK4A 5T6BA 1BE0A 1HT0A 5JC8A 1OOEA 1TF5A 2C2HA 4LMPA 2MYTA 4CKWB 1EQ2A 5FUMA 2AFIB 4CDNA 1MR3F 4MVJM 5A6SB 3QKRB 1M75A 1TC2A 1JG2A 1FP2A 1U04A 3LCUA 2O14A 3CXRA 4DABA 2FSIA 1OIVA 1UMDA 4R3UC 4TWJA 5CLJA 4YRNA 3HJHA 3KSBC 1U0GA 2IV7A 4EW2A 1CQWA 5C3MA 4D82A 1NXPA 1I6KA 4J94A 1GZVA 1YJ5A 4ARUA 1J09A 1U2DA 1Z6TA 3AEQA 3C3BA 3LCMA 3PF8A 4J91A 2VOJA 1CY7A 1KJ9A 4ND8B 4WLEA 4TYWA 5BV2P 3QLTA 2CNLA 3IUYA 1ANKA 2BHLA 2ZE6A 4DIKA 2GASA 3TRJA 3FX2A 4LNHA 1U6IA 2X3UA 1WCXA 3AR7A 3IMEA 5B1YA 1ZD8A 4DLVA 3R4VA 4FS8A 3GUZA 1QHXA 3JQFC 3TINA 2Z9DA 5IEJA 1W0CA 2P0AA 1Z5ZA 2H57A 2O2JA 5JH7F 4M1TA 4TQUS 4TTVA 4B2PA 3LLCA 3CZMA 3LY5A 2COUA 3R2JA 4GUAA 3RT7A 2I91A 3PNLA 5CM2Z 3CSDA 3RC9A 3ND8A 3TMAA 4N0PA 1YVUA 2JCYA 2P11A 3IT3A 4JC8A 2FPKA 4GWKA 4MP8A 2AYYA 1SUDA 2G70A 1WP4A 3FWZA 1D2AA 1UM9A 1YI0A 4IDPA 4O4IF 1KRWA 1PZXA 3FOZA 3PPVA 4CI0B 1CZNA 3NWJA 3UBMA 3I9OA 3IMGA 4MR9A 2GETA 2D2FA 3O4GA 4JNCA 5K1ZA 4K87A 1USWA 2Y1EA 1KFBB 1GPUA 3SHQA 1U5BA 4KQIA 1YZQA 2PXCA 2QTVA 2CUTA 1F2TB 5F21A 4EF5A 3A1VA 4JITA 2R79A 4LRQA 1EJ2A 3P2KA 1E2HA 1IXSB 3WHIA 3SI7A 3CVVA 2B4KA 2BM9A 4MULA 2I29A 5H4GA 1NBME 2VRNA 2WWTA 3TLYA 3ZE6A 3U9SA 1OFUA 3R8XA 4BC0A 4GDFA 1TRHA 3GB9A 2W00A 3CMMA 1Q3HA 3H04A 3T1YB 2NIPA 1M7BA 3ZKAA 4WL0A 5E1BA 4JI5B 4BO9A 1Q2UA 3JX9A 3TR6A 5JSFA 3RG2A 2NQTA 3PIIA 2W2LD 3U49A 1JKXA 1JTFA 3Q12A 5DGCA 3M49A 1NSFA 4IOMA 4ZT5A 2V5AA 4DG8A 3HWWA 3KHTA 4HH1A 5EJGA 3H5TA 3HKDB 4YAJA 2WU8A 2QW0X 2YWHA 3BRWD 3BKWA 4G09A 2YOFA 4IRUB 2AQ8A 4EKDA 4NHEA 3ZXUB 4L7VA 1RPAA 5IT0A 2ODPA 1QH1A 2QRQA 4O3FA 1IMJA 1L1EA 4OLHA 4F1WA 1MFPA 3A2MA 3K8ZA 3EXG1 4M53A 1D1QA 2ZUVA 4XASA 3SS7X 3QFSA 4LJRA 4HDOB 5JAZA 1TQ8A 3BIWA 1ISPA 5B64A 4H4EA 1C29B 3GG2A 1VP3A 4D9GA 3H87A 4WY5A 4Z9FA 3GZNA 3LDAA 2PSJA 4ZYZA 2XIJA 2VP2A 3KKKA 5JNVA 2HIMA 1MC8A 2C2BA 4B6JA 2OCKA 2R65A 1R9NA 3INRA 1G291 3BZBA 5JFOA 2PH1A 3ROZA 1MAHA 3VR3A 3OX3A 1K97A 4N3AA 4AJKA 2F59A 5M2QA 1KC3A 3CLKA 1QZXA 5H5JA 1Z16A 1YOBA 3AHFA 2ZQYA 3U44A 2XWJI 2GHRA 5EHQA 4NS4A 3DYVA 4BAZA 4CDRA 3VHQA 4U2FA 1SO8A 3HKBB 3FCUB 4WDRA 5AM5A 1V1JA 4QFDA 1HE3A 3SLGA 4QSMA 5K3DA 4BO5A 1WMBA 2WWXA 4UW9A 3PS9A 2P5YA 4PTLA 3QF4B 2OO5C 4FDUA 2R97A 4HB4A 4QU5A 1BGXT 2W0MA 1TU4A 2O3JA 3IODA 2XYHA 4MV1A 3BE6A 1UXGA 4J3NA 3WMGA 4EO9A 5IJZA 4XX0A 2RC5A 2BGMA 5FUQA 1PR3A 2C54A 4G4JA 2R0QC 4PQFA 5D5PA 4F7DA 1XEFA 2IYSA 3WB2A 3UXEA 2I5PO 4FR5A 5LYJF 3DFKA 4WVFA 2I4IA 3MPOA 1KE2A 1X8KA 3CWCA 5U4XA 2XJ9A 4XYGA 1Z8HA 1ODFA 2PSFA 2WT9A 5DF1A 1C9NA 4DOMA 1T36A 5EGNA 4CNBA 2IH4A 2ZXEA 2JARA 3D6JA 3UB2A 4KQ6A 3RUFA 1Y6GA 3HJUA 3EODA 5FJJA 2ZZKA 3BH7A 1DC5A 2ASEA 1E2NA 2H18A 2V5VA 3CRVA 2IJGX 3KVYA 4FLFA 2YFYA 2JCVA 3BB3A 4LG1A 4V02A 3F6RA 3T38A 1W30A 1Z2PX 2IIQA 2W2QA 1HZZC 3JYHA 3P9SA 4MI3A 4R31A 2SCUA 3T5TA 2FPGA 3RASA 2WC1A 1AN9A 3HB7A 2HGZA 1BA2A 3QPDA 4YT2A 5BUZA 2G80A 1U6JA 3EVNA 1H2ZA 3E3AA 4B8YA 2JDID 2NZXA 3FETA 5DBGA 1E96A 1R15A 1NQUA 2I54A 2QD1A 4DMRA 2OHVA 1NXXA 3RF6A 2NVBA 4HXEB 3N2GB 4GBED 1JWAB 1VJRA 4YQEA 5ESWA 1EP2B 5C0OE 3QE0A 4E2YA 4EI9A 5FT9A 4YJGB 2XLBA 3TQRA 1ST2A 1XA4A 2QR3A 3AFNA 4M1YA 1F8UA 2QRPA 3GLHB 2W70A 4YJ2A 1FJ2A 1ZAKA 2EBUA 3MMZA 5L3RA 3AL0C 4BX3A 1DJPA 1JHVA 3WGTA 1XRLA 3ZCVA 3WICA 3OA2A 1TA9A 1E9RA 4HV4A 2PA3A 3I8OA 1OF1A 4Y2TA 1AGXA 4B8ZA 1TZKA 2BRUA 3KQUA 3AJEA 1ZRMA 2W8BB 3HB1A 1EE1A 1RBYA 4ZVPA 5EQDA 3L7IA 4ZWNA 4OUDA 5TNXA 5LPNA 2DWUA 4DDVA 4AD8A 2R6HA 5J4LA 1YDGA 1MORA 1RI5A 1JKMA 3HCEA 4LEIA 2QMHA 4LW8A 1QH8B 5J5CA 4F06A 5BWLA 4HQ0A 4BV8A 3RJ9A 3SQOA 1JDVA 2PD6A 2GCPA 2F3PA 4IX9A 2EQBA 1GUAA 3MCTA 3PI6A 3ITNA 4GZLA 1HFKA 4FKZA 4I2NA 2GSDA 1HEIA 4YBRA 5KYKA 5FNVF 2RGXA 2VHJA 3IVXA 2L17A 3Q15C 5L6LB 1T1SA 2JI4A 4CNQA 1XDGA 3JTMA 1Q95A 3JQAD 3OESA 4FBGA 4N5DA 3ILYA 2CEKA 1PGOA 3VPGA 2VDJA 2Z43A 4IZHA 4P4UA 4OJYA 4BNXA 2AQIA 5CNMA 4YK7A 2FSFA 1OXTA 1TTHA 2VZ8A 4KWIA 5EXDA 2JLUA 5DX8A 5JFTA 3OE1A 2V8BA 3IEPA 4GPAA 3BXPA 2B4RO 2IYYA 1ZNQO 3AL3A 5C8YA 3EC1A 1C0KA 4MWOA 2HCTA 2JB9A 1YCFA 4ZCRA 5A2QA 1HM5A 1VKZA 2F3RA 3AJ8A 4E5DA 2HH9A 5LZ5A 3CNHA 4RD4A 1U7HA 2X2OA 3KTAA 4K9DA 2W6ZA 1Z45A 3EVFA 4FWIB 3PNPA 5C8ZA 2Z5VA 2F8LA 1KVSA 1T4CB 1OGIA 1J0XO 3EE6A 4RDCA 4C5CA 1RYZA 1V7QA 5TJ9A 3FI9A 2NUTA 4C6TA 4CVNA 1U80A 2I7TA 4KV9A 5HRAA 4RV4A 2FQ1A 4DE5A 5KNBA 1YZHA 3KZMA 3SXPA 2J0EA 1KFJB 1W4BA 1WVGA 2PYDA 3RBAA 1U0TA 1ECPA 3HE3A 2C9BA 3IDFA 3SQLA 1NXVA 4HB2A 2BCJQ 1NVGA 2QEQA 3GRZA 2IF0A 2ZCUA 3I5XA 4BWVA 2QX4A 1LDNA 4DG5A 5DH9A 2XWPA 2JA2A 1GR0A 3CNLA 2X22A 3DGEC 3MTEA 1G2PA 3EZNA 2RHWA 1SZJG 3NHPA 1OX6A 4UAJA 5IC5A 4KPUB 3UB4A 2C4TA 2OZEA 3COPA 1KAHA 4PHHA 4F3CA 1RXUA 2NTNA 3G5LA 4OL0A 5LNK1 5ADHA 3ZUGA 3P0FA 3UC5A 4DA6A 2REQB 1L5VA 1T2DA 1UOEA 2V6GA 3QLEA 4RD0A 1P7ZA 4BQPA 1KORA 2CMKA 4TVOA 4MNTA 5KNCH 4NDAA 4Y9SA 2DF8A 3MTJA 4P5EA 1GL7A 3FGZA 1AO0A 4FM9A 2HMAA 2AZMA 4EYKA 4OJTA 1EUDA 2ONJA 2I6XA 3F6PA 3KTDA 3VZSA 5H3CA 1L5RA 5E1MA 3L6OO 1SBNE 2D2VA 1WCYA 2Q3LA 3WL6A 1IFXA 4P4SB 5K4AA 2N46A 1A2KC 1RE0A 3I04A 2E5WA 1M1YA 3AKYA 5HDQA 1MZPA 1R2QA 1MJHA 4MW4A 3K0CA 4Q4CA 1Y4AE 1QZ3A 5CDSA 2QM7A 2RGCA 1J49A 4GX1A 1OVGA 4UZFA 1YTLA 5DIFA 3TVDA 3PV0A 3ZN2A 4WCFB 4AN1A 1VHDA 3N9IA 4ZOEA 2IEDA 5GWXA 2QRMA 2Z4TA 2CL6X 5AJTA 4U7JA 1ABEA 2HXSA 4FX5A 2R44A 4Y2SA 5CDGA 4RIIA 1W29A 3JYQA 5CB4F 4G0VA 3PQEA 1HNWB 3BSWA 4RPIA 2I6TA 1H4QA 4MWBA 2O8DB 4B33A 5TMBA 2B1JA 1ZIXA 3R44A 3S2IA 1T26A 1PHPA 1WETA 2BFBA 3UANA 4JJAA 3RS2A 5L3SB 3FG9A 3HV2A 2IPOA 1VE3A 3F3SA 5HKKD 4LI0A 4AJLA 4CM8B 2O8BA 2J33A 2ID9A 2IWHA 3MZ0A 3IRVA 1GU1A 4FGWA 2FHPA 4P3XA 4P80A 2DH6A 3FOEC 1U28C 3AF3A 9LDBA 3PJDA 3BD8A 2GVNA 1N1EA 2R8EA 3KYDB 3LUGA 3I6IA 1CUEA 1FBNA 2Z4SA 4ZHQA 2WJVA 1W8DA 1AF4A 1W96A 3GLGB 1EXDA 4OP2A 5LDHA 1F6BA 1H5NA 1JPVA 5IFLA 2I4OA 3OOJA 4Q1VA 4TSFD 3VDMA 3K1AB 4KODA 3K0FA 3QVTA 4HDMA 4URZR 1Y9EA 5FQOA 3H0KA 2BZGA 2GKSA 5ARDA 3U13A 2CCJA 3ZXIA 2BH2A 2XNHA 1W94A 4BB0A 4FFVA 3T9DA 2OSVA 1GRNA 2C9OA 4LJ5A 3H7AA 3CRMA 2Z56A 3GJYA 4HDRB 4NYIQ 5FH9A 2CVPA 1E1LA 4G2NA 1DAOA 3OCJA 3AJ9A 3PWZA 1AN0A 1TI7A 3DPSA 3NEYA 4HAWA 4OREX 5EUBA 3GMIA 3ACDA 4UPEA 2ICAA 5JVDB 2DYKA 4ARVA 4K6CA 4AMZA 2ZUFA 2A5JA 2FMUA 4DQUA 2EZ4A 5EHXA 5B3LA 3N28A 2CFOA 4RA9B 4C0AC 2YUIA 3VI4B 2YJ3A 3KVOA 2C84A 2GPWA 3SVLA 2ORED 2ODBA 2YC2C 1P6QA 3BFXA 1EVLA 3D31A 1BKDR 4AYTA 1G19A 5DGIA 1VL8A 2GXUA 2GI4A 1IOLA 4FJ0A 1B1AA 1CR0A 2BLLA 2QG4A 2V9CA 4NOLA 2CXSA 4QVGA 2JI8A 4TTAA 1U0BB 2YFKA 3FYSA 3LCCA 4FSHA 2RGWA 5JNUA 1RXVA 4QOEA 3ZIAA 4A91A 3V4FA 2QRVA 2Z83A 5EMLA 3F1LA 1G20B 4XWYA 5CA1B 4CTMA 4PX2A 3FHCB 2I22A 1D1PA 1XCOA 3L41A 3LRPA 5AQEA 3VYUB 4QDOA 4WN9B 2JGMA 4Z49A 2CV1A 4WZBB 5ENVA 1WWKA 1UFQA 2YZKA 1J8FA 3K15A 2FWRA 4UVHA 2AHRA 3NIFB 3ZWCA 3K9BA 3IKTA 1MCZA 4JP2A 2VWPA 2GAOA 1AURA 2N42A 3G0BA 2V59A 3RU2A 1A4UA 5DP1A 1XPOA 4B40A 4J0HA 4GD3Q 2JVIA 4LUCA 1VBMA 4URFA 4CMHA 1M34B 1RT9A 2QQFA 3DW1X 4CCWA 2A30A 4MV8A 5LOVF 3CUUA 1FFDA 4FCWA 2PIAA 2Y0PA 4WX2B 1ZD2P 3QEKA 4NYMQ 3VDXA 1YI8A 3JWPA 5AW7A 5CT4A 2GAJA 4Q7EA 3L0SA 4WV3A 1N8KA 3AXSA 5K6AA 4II7A 1X7WA 4D5EA 2QPAA 5EE0A 1U0NA 1QX4A 3EWIA 3O93A 3R3YA 3WYNA 3CE6A 1E5LA 2A78A 1SUIA 4Y6LA 2GN2A 2W6NA 4K9KA 1G21A 2DSTA 2C2KA 2QUBA 4N7BA 2VT6A 3WYAA 4AXXA 2J5BA 1A9ZA 5KQMA 3URMA 2F6RA 2QNIA 5LB2A 5A3JA 1TDJA 2Y76A 4M9ZA 3CPSA 4W9NC 5FEMA 2DAPA 3FTDA 4NV0A 3DZCA 5CA0B 3HR7A 3HUFA 2A67A 4UEQA 1THTA 4GX5A 5E7MA 4CIWA 2I3BA 3GFVA 1VJ0A 4D6YA 4FU0A 1W48A 3V3TA 4L4UA 1NR5A 2NO5A 2P6RA 2XMSA 3GRCA 4BUZA 3H0EA 1DBRA 4Q6WA 2VJLA 4E09A 3VOSA 4RTKA 1EWTA 5EMKA 4DY6A 3LW8A 3ZWMA 1KPHA 1K3TA 2C98A 2OBYA 4MV9A 4CLRA 1XHFA 4TT3A 2RHBA 4H1UA 5EMJA 3EGOA 1TM4E 3LLSA 1E1NA 2EEZA 3DE5X 3Q2KA 1EP9A 1YI1A 1YNSA 1P8JA 4RAOA 3Q98A 2QTWB 3NEJA 4WPGA 3WFZA 4CMEC 1TIKA 4BBZA 3RIMA 2BE9A 1LPMA 1ZGZA 2H4FA 2CVHA 1RZUA 3FIUA 1YHNA 3JRNA 3KS9A 3OF3A 4OJNA 3WNVA 2IYRA 1NQXA 2PE5A 4A8JB 3L3BA 4EAAA 3PJRA 1PUXA 1HDRA 1PGPA 1E77A 3AGPA 2FEOA 3FCYA 4KK4A 2BSQA 2PVPA 2C95A 4O1IA 1G7TA 4DARA 1KTIA 3L8EA 2G4VA 3E8MA 3NG1A 1PW7A 1FE8A 1NQWA 3HR4A 2YFQA 3DWIA 4K28A 2LV8A 1NY6A 3F5DA 4P7FA 4LJSA 1ZOLA 1UC5B 4TM8A 4DYHA 2DQ4A 1QRDA 1TZJA 2NYVA 1XTPA 5HP4A 1ETUA 4GICA 1HDZA 3CKLA 1FU4A 4HFMA 3ZTYA 1N3IA 4JOCA 4AKEA 2O8FB 2P79A 4OSEA 3X2FA 3FOWA 3BL6A 5EEGA 3IL2A 4UUBA 1P45A 2N1MA 5F2EA 3TLBA 2VLBA 2VH5R 2E2WA 3HUDA 4MX8A 4DADA 3OBBA 1CUHA 2NU6A 3BMCA 1JBKA 4EJ0A 5JROA 1SZPA 2JGEA 5CDFE 2V96A 5GMOA 1JAZA 2QROA 2ZJFA 3RQSA 5HX7A 3BGWA 4AJ4A 1KOFA 1RHMA 2IV2X 3AR9A 3EMDA 4TXMA 1G6HA 1SY7A 3DBLB 3ZDQA 5H3LA 4OXRA 1EQAA 4MV7A 4RVFA 2HUPA 4DQDA 5MHTA 3ZW8A 1N57A 1P9RA 3UV6A 3Q6IA 1VIVA 2CE2X 5HTKA 4F8YA 4O1MA 4P36A 4NAVA 3UOGA 4HYEA 3RWMB 2XE8A 4Y30A 3F6YA 4EGQA 1UKYA 3CJQA 5EAIA 1BCSB 4FFLA 1T1EA 3EPJA 4ECAA 2QT1A 3G0DA 3GGDA 4C7VA 3AVXA 4UOQA 3BB4A 1N2SA 3G2MA 2NV6A 1A8PA 5JS6A 4QOGA 2QJOA 3BC1A 4WNYA 1K86A 3JVVA 4YCSA 5H9WA 2WK1A 4JVLA 1LA2A 2X0DA 4B82A 2HPVA 3G7NA 3PDIA 5DYIA 1EX7A 1IY8A 2WR8A 3D8SA 1ZHFA 1O95A 3ND7A 3PGVA 4MJLA 3KCNA 2ZRLA 3H3XA 1SU4A 1BU8A 2J3HA 4J43A 1YU9A 3N7AA 5G53C 1ONSA 3TW4A 2PWPA 2JLQA 1HDGO 4DVGA 1RLIA 2CFCA 1GA4A 3W6PA 2ONYA 3QI7A 3BIOA 1P7PA 3GLTA 4A6DA 2NVWA 1VLQA 1W47A 1AB5A 3AFIA 3MT7A 4NC9A 3R7AA 4Q93A 2VYNA 2IHZA 2X6RA 3FCCA 3VU8A 4AS3A 5CCEA 3P9XA 5CT9A 5YASA 4I99A 1C4KA 2CT8A 4BXOB 2BM0A 1UZAA 5E6SA 1R0YA 1U7DA 1YNOA 4AG6A 3A6KA 4C4TA 5BWOA 4RY2A 5H81A 1RQGA 2IIPA 2UYQA 2IP1A 4EI2A 4BVGA 1KI9A 1RMYA 3HH8A 4REQB 5B2ZA 4DMCA 3HY6A 3ND5A 1QB7A 3QVMA 4DA7A 3H86A 3SKXA 2PQMA 3N2NA 5H4HA 1EX9A 3BIXA 4PYNA 4ZD6A 4RXUA 4HUTA 1E2QA 3MINB 4GPBA 3QVXA 1JMKC 2C8VA 4FD2A 4YEDA 1F14A 2ZTHA 4BNTA 3SGLA 3LC7O 1N6RA 3RFFA 2NSHA 1GQRA 2CBZA 4F04A 4H7HA 5JASA 1L8QA 4HNGA 1A76A 4MWEA 5ERXA 4C9BA 3WHKA 2IXFA 3ENKA 3FR7A 4QUBA 5CPBA 1J1ZA 1GGKA 2WHPA 2UVDA 3A9CA 5AW5A 3SAJA 3D8RA 5L51A 3QJ5A 1ZH8A 1U7UA 3MAGA 5JPIA 3TX2A 1SOUA 4F1JA 1T9HA 3TQOA 4GPZA 5EKUA 4F96A 4IDFA 3D0RA 3RK4A 1JEAA 3P5BA 2D0OB 1ZC3A 4NE2A 4EW6A 2O3RA 4ZT7A 2I7XA 3ZCPA 4C2UA 2O1EA 2AE1A 2BEWB 1DXHA 4R7GA 1U8ZA 4IVRA 3KJNA 4JUDX 3ANLA 3B5IA 1L7AA 3B9PA 1RJEA 5FHRA 4L50A 2AOTB 3SF8A 3ZWDA 2EKDA 3AETA 3JPYA 4GP7A 4JBLA 1POWA 1RJWA 1XWWA 1Z08A 2NWQA 2QUHA 3JU3A 3AJDA 1B0ZA 1LPBB 1OD6A 1N0HA 1BRTA 3HU2A 4PZ9A 3TAUA 5KSYA 2IITA 3TRKA 4OB7A 5BN5A 3IEUA 4KNYA 1U1FA 3FVTA 2E48A 4NMWA 1B8PA 3S2UA 2Q1YA 3H5AA 4KBFA 4RSRA 4YAWA 1WOYA 3NHYA 2BUBA 5ICEA 4JOQA 1QIGA 3O0DA 10MHA 4IZIA 1LWOA 2VZ0A 4HGRA 3ZWNA 1LPOA 3OUTA 4X44A 4RVDA 5CH8A 5IX8A 4J6EA 4FEYA 1YR1A 1RWMA 2FPPA 3OIFA 4IOLA 1JLSA 4U2BA 2BFDB 1N8SA 1GZ4A 3X2SA 2P3LA 1T9GR 2VG8A 2BUCA 3I0NA 4JR2A 5CMLA 4ZVOA 4I3HA 2NVUA 4YIHA 3ZVNA 4JEMA 3HXOA 3OX1A 3AF6A 3OJLA 2O3QA 3O0TA 2QPOA 1R9JA 4BFUA 4LRUA 1DEXA 1BW9B 1M1YE 2BFCB 2DM6A 2P67A 2AYXA 3TOCA 3V2UA 4ZO8A 1DCTA 4MDHA 5P21A 1MAUA 2VEDA 2ATXA 3D3EA 2GJ4A 5T4FA 4CM9D 2XMCA 3ZWVA 1E5TA 5A4AA 4TMXA 3MS7A 1F9AA 1AD2A 1VCOA 4EOGA 4WFKA 3UBTA 2XYVA 2YMMA 4FFNA 2PHZA 2WFZA 4DC1A 1K5DA 3TIFA 3SYTA 5BQFA 5CDHA 1PF7E 5EWMA 4M54A 3T9FA 4EGFA 3LQ1A 2CLCX 1XDWA 2FZ5A 2II6A 1S3IA 3AUSA 3DMDA 4P3NA 4NYJQ 5E8RA 3CZ9A 1QG4A 1IIRA 5DP2A 3AF2A 4C88A 4ER0A 1XWIA 5L95A 2XGOA 4GE0A 3IA2A 5AO9A 3TD2A 4QBTA 1XWFA 4DRZA 3LD9A 4XUDA 2RHRA 5KKCA 1TVMA 3HJBA 3RU3A 1RAEA 3D7SA 3JAWA 5ELMA 1AQ6A 5KYXB 2NO0A 2D1TA 2ZROA 2EYUA 4KXVA 4B2IA 4Q3AA 3OHSX 5BSEA 1LXCA 2W83A 2X8JA 1DE0A 4XVRA 2AZTA 3CZ5A 3TDNA 1PR6A 1PS9A 1ZIYA 3HYTA 1NONA 1KOJA 5ALTA 5EP2A 5HE8A 1JI0A 1X1TA 1FFCA 4EG6A 4NLLA 1N7HA 2GYUA 1A9YA 4L72A 2OLKA 3CUVA 3FPSA 4L0DA 5EERA 3PHBE 3VHXB 3WXMA 4BTEA 1I4OA 4DA9A 1S5PA 5A6VA 3U5ZB 13PKA 1NJFA 1Y4ZA 4Q4HA 3O75A 5DGXA 3A2KA 4FWBA 3VJMA 2YR0A 4BVLA 3OEYA 2PFSA 2WHXA 2HADA 3OZDA 4FUTA 4YWHA 4WE3A 1OT5A 3SE7A 3LT4A 2ZWAA 3ONFA 4G5FA 1B1CA 2Y0CA 1S2IA 1PQ4A 2BUAA 3BWEA 4FX2A 1JEDA 1JS1X 1UZNA 2HEGA 4U6QA 1ZEJA 3FMOB 3VXKA 1X9HA 4FE4A 5AVQA 4W5RA 1Q20A 2FPIA 4MPTA 3BX1A 3QOWA 3SICE 4RTPA 4QPCA 1D1TA 4HYYA 1FX0A 2EEPA 3PPXA 3NT2A 1KIMA 3NNNA 3LHKA 4QNNA 3H9GA 1FQWA 3E4DA 3L8DA 3JVEA 1MRSA 4U8GA 3V7YA 3ZDBA 4N03A 2IU4A 1SURA 2OWDA 5EA2A 1V96A 3I9LA 1ZY2A 4UM8B 3P2OA 3VKVA 4KHZA 4E6PA 1HT2E 1X7YA 2J85A 3EG9A 5B1SA 2GN6A 1JQBA 4OAOA 3PQ8A 4PLHA 4MAAA 5TPZD 4TXJA 4QXMA 3DW3X 1W76A 3LHFA 1P1CA 3OPMA 1U0SY 4QG7A 3KVRA 1OZHA 4S04A 1ZMRA 2ZI7A 3FDJA 4IIUA 3H8SA 2EXXA 4QXRA 1YB1A 4IQGA 2PUDA 3CF4A 3KLBA 1SKYE 1ZZEA 4N82A 2PUEA 4D0LB 3LZCA 1HT3A 4W5OA 3ZE8A 2IEGA 5HKOA 1FXSA 4PLWA 4HLCA 5A1JA 1QG6A 1K6MA 1MVNA 4C07A 1OFGA 3AIOA 4BMOB