2HK8A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
266
Chain Sequence
MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Shikimate dehydrogenase
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 88
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk8A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk8A01
2JAPA 5H81A 5KNLA 4CPDA 1E3WA 3ASVA 2NTNA 3D3EA 4BNYA 4EITA 3ZWBA 2BI8A 1ZK3A 3PIDA 3OBBA 4I9HA 5JC1A 5TJHA 1GZ3A 4RJTA 2VUSA 3O4RA 1YL5A 4TVBA 4BIIA 4MPDA 3KXDA 4HFMA 2Z95A 2X5KO 1DRVA 4GWKA 2G5CA 1T24A 2BGKA 2J6IA 4LMPA 4HX5A 3D64A 3DHYA 2H63A 5B37A 4BV9A 1DAOA 2Q1SA 1RM5A 3K2BA 1DXYA 5L95A 1PJCA 3NV9A 4LRSB 4P8RA 3EW7A 3LZ6A 2LDBA 1R4MA 3MOIA 4XQEA 1X1EA 2F1KA 3R1IA 3GVIA 3E9NA 4JLWA 4P4NA 5BNTA 4ESOA 5J23A 5T8KA 3LU1A 4ND3A 4IDFA 1VI2A 1O95A 2I3GA 4PLFA 3UGKA 3ICPA 3GQVA 3HG7A 4OQZA 3QE3A 4O6VA 5U9CA 2ZYDA 1OZAA 1ENOA 2GUGA 1I33A 4NBTA 5IAAA 5GY7A 1ZJYA 3D4PA 1DSSG 5KCZA 3CINA 4E2YA 1IPFA 4YJHA 3BHJA 3PEFA 4OM8A 4TWRA 1GAEO 2PZJA 4L4XA 2RIRA 4BO6A 5KJ1A 3ZWOA 3PJGA 3FSRA 3NT5A 4YRBA 5ADHA 2PTGA 3D1LA 5B12A 1N9GA 3AUSA 2DUUA 3KBOA 3NGXA 1ZUD1 1B3BA 3G17A 5G0VA 3JYPA 4BNHA 4ND4A 3DOJA 3ZHBA 1E3LA 4JXKA 2WSBA 3KYDA 1W73A 3MJCA 3ZGYA 4EEXA 1GDHA 3TZHA 4RZHA 1T4BA 4Z0TA 3GVHA 3D3WB 1CWUA 3O26A 5JXWA 2ZJ1A 3BMOA 3DMYA 3MJTA 2Y0DA 1EVJA 3PYXA 1HL3A 5ER9A 4GVLA 4QX6A 1JKJA 1TT7A 1PU2A 4GWGA 4AG3A 3ZW9A 5HS4A 5IJZA 3WQRA 1E1MA 1EQUA 2OBNA 1GEEA 4YT4A 3GK3A 1EUDA 3NX4A 4W4TA 3QRWA 3C7AA 4BKPA 1G6KA 4A5OA 5CEFA 1X1TA 1ZH8A 3KHUA 2DM6A 5JAZA 4J90A 4IS3A 2X58A 1HYEA 4DMMA 1M6WA 1PZEA 1HLPA 2B4RO 1I0ZA 1P77A 3TQHA 4E3ZA 5C5IA 3G49A 5L51A 1FDWA 5CPBA 4BNKA 1E77A 3JQBA 4PLPA 3T4XA 1GYPA 1YBAA 4O59O 1CQIA 4E21A 4CR7A 1I8TA 5BNIA 1MGOA 3JQEA 3INTA 3IC5A 3GEGA 1YL7A 4TVOA 4OMUA 4CM5A 3HB4X 4LSMA 3RCBA 3Q9NA 1ZBQA 4CLDA 3JQGB 4G2NA 3O38A 4Q3EA 5CDSA 1P1RA 2C7VA 1PJ2A 3QVWA 1TT5A 2YDYA 5B4TA 4BB5A 1KC3A 1QV6A 1ULUA 4Q39A 3VZPA 1DIHA 5A1TA 1ZFNA 3RKRA 3KRTA 3OF2A 2O3QA 2O2SA 5ER6A 3RASA 3I5MA 4F6LA 5TIIA 1LC0A 3LQFA 4RPGA 5EQDA 1QP8A 1JAYA 4CMIB 2PKQP 1DLJA 1TI7A 2PD3A 5A5EA 1IOLA 4R1UA 4JNKA 1SEPA 3RUAA 3SLGA 2HQ1A 4ZRMA 5JY6A 3ANNA 5TF4A 4MP3A 1YQXA 1EQ2A 3RKUA 1NTOA 3R6DA 3PWZA 2NVUB 3Q2IA 2BFPA 3GUYA 5F5LA 3ROQA 4IXTA 1X0XA 4C7JA 4E30A 4YR9A 1XHLA 2QQ5A 3HN2A 5DN9A 3WLEA 2EGGA 2X0NA 3W4IA 1ENZA 1ADFA 3JYQA 3SEFA 3ZHXA 3RIHA 4D46A 4MKZA 1AXGA 3STHA 1R0KA 1WXDA 4M1QA 2GN9A 1XKQA 4Y8VA 3RU9A 1VL0A 1ZXLA 4QXMA 4TRMA 1GTMA 5BNFA 4BS9A 2QRJA 1FMCA 3JQ8A 3ST7A 4PG7A 3I1JA 3OICA 1Q7BA 1SB9A 2VCYA 4J4BA 4AJNA 5GZ6A 1P3DA 4WLUA 3LT4A 5HRUA 4X54A 2OL4A 5EMHA 4CLHA 1IUKA 1CYDA 2P5YA 1SOVA 3UXYA 1GQYA 2DTEA 2EHDA 3AUAA 4WOJA 2OFPA 3GY0A 1LDYA 4S1VA 3OJOA 1N7HA 3C1OA 1Z6ZA 4PG8A 3HB5X 5IN5A 3JTMA 4CM6A 1BSVA 3RD5A 4F6CA 1I10A 3EVTA 4D3DA 1HSOA 1L7EA 4L75A 1KC1A 5ICMA 4FJ1A 1E0DA 3INRA 3OA2A 4CLOA 3KO8A 4NZ9A 1IZ9A 3BA1A 3R3SA 1YQDA 1Y6JA 3C1AA 4JIGA 5GMOA 4CM4A 1T2EA 4BO4A 1NX6A 4XWYA 5KJEA 2C0CA 2AQKA 1BGVA 1KIFA 2PZLA 1NM5A 5ILGA 4PVCA 2VOEA 2QIOA 2X5JO 3FTPA 1Z74A 2VHYA 2X9NA 1RKXA 4AVYA 3D7LA 3FNEA 1NNUA 1XGKA 1TXGA 3VTFA 3Q9UA 4FGSA 1ZO8A 2P5UA 4NPCA 1E3JA 4HWKA 4ZD6A 1QLJA 4UVEA 1D1SA 3H4VA 2PZMA 3LSYA 4FFRA 1ZSVA 4MIOA 3H2SA 4FC7A 4HFJA 2HSDA 3GAZA 1Y8RB 3SJ7A 4A10A 3PZRA 1YWGO 2YHIA 3AM3A 4PG5A 1DO8A 2BI7A 3WGGA 3ZHYA 4CV2A 4BQRA 3H9QA 4E6PA 1GUZA 5DDIP 3GEDA 5EJ2A 1HZJA 2YUTA 2Q1TA 2GERA 1KYQA 5DBGA 2A94A 1EVIA 2EKPA 1Y8QB 3S2IA 2BMAA 3HHPA 4YB8A 2VOJA 3UCFA 5HTOA 4RPJA 4F45A 5MDHA 3ZU3A 3DO5A 3SX2A 5KVCA 3G1TA 3U5TA 1ORRA 1NVMB 1GCUA 3UN1A 3BMNA 4GMGA 4BNLA 4CMBA 2X1HA 4DUPA 1P1IA 2Y1GA 4N54A 4PLCA 2QZ9A 4AICA 4YAEA 3T7EA 4D3SA 1TB4A 1PL7A 4M89A 1CQJA 5EQFA 1Q1NA 3PP8A 3TFOA 4YPOA 4ALNA 4A27A 5DCYA 3VPFA 3LT0A 4I5EA 3UKOA 2JL1A 1JKIA 2Y0CA 3E5RA 1GFSA 1GUYA 4WLFA 3LC2O 1R12A 3A9WA 3Q2KA 4J1TA 4DRYA 4A2CA 3TNLA 3JD2A 2NTVA 3LLVA 1CDOA 2O2YA 1VRWA 5JW6A 4I9NA 3WSVA 1KEWA 3WIDA 4XGKA 4W7HA 3F46A 3A1NA 4E2WA 4YA6A 4B8ZA 4HFRA 5THQA 3FR7A 1T1SA 1PJ4A 1WVGA 1X13A 3QV1A 4MVJG 3E5MA 2JHFA 3PI7A 2XXJA 1XEAA 5HWSA 1G0NA 3FR8A 1NWCA 5I7FA 1PQPA 1T2FA 4FFMA 1CERA 1P74A 5KVQA 2DLDA 3GMDA 3U3XA 4A03A 1PJLA 1M67A 1T2CA 1W8DA 4UUOA 4DPKA 1HZZA 3HJAA 4CUJA 4MP6A 4H7PA 1P0CA 1PGJA 1PSDA 2C82A 3KEOA 2W4QA 5T5QA 1CJCA 4ZQHA 1F06A 2NQTA 4ZGWA 2H9IA 4XX0A 2AEJA 3ETEA 4INAA 3KOUA 4CUZA 1VSVA 2CVOA 2AEMA 1PGPA 3PFFA 4BB6A 2J5KA 5DP1A 2JCYA 4WASA 1P45A 4XCVA 3W8FA 1E92A 3B70A 2WYUA 2CZCA 5AQ1A 1UP6A 1R37A 2AMFA 2BHLA 3R3JA 4WNCA 4CLXA 4RVDA 3W1VA 3GPIA 1LJ8A 2AQIA 3NUGA 4BNTA 3RQSA 1UR5A 4JP2A 1PL6A 1T4DA 4J7CA 1ZK1A 2GN6A 1HDOA 3OP4A 1U3WA 1LRKA 4XGIA 5G4KB 2GO1A 3A14A 2FHSA 3ZWXA 4TRJA 2PA3A 3F1KA 3WLFA 3PJEA 4RPKA 2HK8A 1XELA 3KYCA 2EKQA 5JLAA 2O4UX 5JDCA 5IG2A 2VUUA 3W6ZA 2X9VA 5DT9A 3WJ7A 4MO2A 1NXQA 4RVSA 4BMVA 3ZNNA 3GRKA 5TC4A 2WE7A 1YDEA 3ANLA 2CVQA 4A7PA 2JJYA 3P19A 3DTTA 1DC4A 1KVRA 5A04A 2C07A 3W6UA 5B4VA 2HCTA 3PHGA 3BMCA 1GYRA 5A9TA 1BDMA 1U3VA 1Y5MA 4IDCA 4E5PA 5JDCC 2TMDA 2DKNA 5LCXA 4CM8A 4MKRA 1X0VA 4XQCA 5LC1A 4ALIA 3DZFA 1LBEA 4NNJA 3MOGA 4NJOA 3G3EA 2B5WA 2D5AA 4NK5A 1I36A 3RROA 4OL9A 2QRKA 4B7CA 2G82A 3RSHA 3WGTA 4EDFA 1Z7BA 1BXGB 4XYMA 1OAAA 1E3EA 1HYHA 2Q49A 3UOGA 5KIAA 2JFFA 1PTJA 3VZQA 4M49A 3OIGA 4GKVA 1Y9EA 4LSWA 5EESA 2IODA 4J1QA 2RHRA 4BGEA 4L9RA 3VPGA 2EEZA 3S8MA 3AUUA 3WS7A 1PX0A 4MIEA 2NWQA 1HWYA 2WDZA 2FN7A 4D42A 2FPPA 3K8ZA 4PN3A 4AJHA 2G0TA 3NYWA 4CM7A 3FD8A 2CUKA 4ZJUA 3H5RA 4KUEA 2B4TO 2YFQA 3E82A 4S3MA 1B14A 1LNQA 5KVSA 2GYYA 1E6EA 1N92A 1NWHA 1ONPA 2DFDA 2VWGA 1X7GA 4RPHA 3ULKA 3EZYA 2W2KA 4KUHA 2JKVA 3FPCA 2PKQO 3IQDB 5DF1A 1XQ6A 1PGNA 4U6SA 5CG2A 4IJKA 2GNAA 4YYZA 3H9JA 5CFZA 2HAEA 3RJ5A 1O6ZA 2BLLA 1DIRA 4GX2A 5COBA 1IY8A 2RH8A 3AJRA 3GVCA 3PTZA 1O9BA 2FRDA 1C1XA 4NJMA 2UUPA 4PLYA 5DBIA 3L4BA 5C7LO 4NR0A 3N7UA 3A28A 3F3SA 4QQRA 1E7RA 3HDQA 1LLCA 1IULA 3QVSA 3AWDA 4BL5A 3U4IA 3LLSA 1ULSA 1AUPA 1PZHA 3GZNA 2BELA 1YQGA 5DOVA 2D4AA 4BGVA 5KJFA 4M86A 5JYDA 2OGUA 5U1PA 1MC4A 1P0FA 3ADPA 4TKLA 1MP0A 1WPQA 5IDQA 1HRDA 1C0PA 2CNBA 1YKFA 3I3OA 3K96A 3L4BC 4RF4A 3S2GA 4RL6A 2J5QA 1FDVA 1UZLA 1KBZA 8LDHA 3C8MA 3K73O 3RI3A 2I66A 4EI2A 3RFXA 1UP7A 3AOGA 1PEDA 3I9NA 1FF9A 3COSA 1E5LA 3E9MA 1EK5A 3T4EA 4G81A 3ZWMA 3OM9A 4KDEA 2Y99A 4CLRA 1DIGA 4DBZA 3P2YA 1IYZA 2FOIA 5IDWA 2PD4A 5F21A 3CMCO 3Q0EA 5A9RA 2NU9A 1C0LA 2PFGA 4F46A 4ND2A 3E6AA 1E1LA 3QLJA 3BTUA 2HRZA 1GL3A 3SC6A 1H93A 4BNWA 4L0QA 3NT2A 1QYVA 3GGOA 1MA0A 2JD0A 3NT4A 3H3JA 4CQMB 1ZJZA 1VL8A 4BKUA 3WGZA 2JHGA 2AQ8A 3TN7A 2OP1A 1U5CA 4GI2A 4CM9D 4QECA 2RH4A 2E82A 4IDGA 4Y9DA 2O23A 4JROA 4R3WA 4CM9A 4CQLA 2PZKA 4TRNA 3MWEB 4BO7A 1E7YA 4CLEA 4A73A 4R68A 4BQPA 1QRRA 4WCFA 2HO5A 1CETA 1X14A 1QG6A 2HDHA 3MZ0A 2VYND 4JX8A 3X2EA 1NVTA 4CV3A 3Q3CA 3GHHA 3OMLA 4KTVE 3GOHA 3QWFA 1EUCA 3BTVA 3DOOA 1ADGA 3VC7A 4D45A 2B5VA 2VYNA 2X0IA 1H94A 3WG9A 1DLIA 2GASA 2JD1A 3GFBA 3QP9A 4E5NA 1RYEA 4XEHA 1WMBA 2YFHA 2Q50A 1JU9A 2Q99A 3VPXA 2UDPA 4XRGA 4WCFC 2FMUA 3W4JA 1RM4A 4JCOA 1XQ1A 2P9EA 5BSHA 3GMSA 3OJEA 4AJKA 1IHYA 3IOYA 4R9SA 4DC0A 2GPTA 2RAFA 5L45A 1GQQA 3ZU2A 1YRLA 4FQ8A 2Y1CA 4HNHA 3QA9A 4CL3A 3K2EA 2V6GA 4RF3A 2YV2A 3NAQA 1FDTA 4J2HA 4NFSA 1OC4A 5JFOA 2EP7A 1O94A 3N58A 3Q1LA 1MFPA 4C7KA 2C2XA 2OZPA 3OQBA 1E3SA 2BH9A 3GEMA 1IL0A 3A4VA 4UAGA 4JP3A 3TRIA 1NQOA 1A5ZA 3QIVA 1I3KA 5EL0A 2XOXA 2ZYGA 3U09A 2GDZA 4YCAA 3VDQA 2GSDA 2NV6A 2EGHA 3DFZA 1B16A 3TSCA 1LX6A 4R3NA 3RUIA 3E8XA 1PQUA 2FPIA 1AXEA 3LC1O 3D0OA 1Z73A 2Q2VA 1RM0A 4M54A 1YJ8A 2CF5A 5KJCA 2O3JA 1VJTA 3FHLA 3U62A 1K5HA 5A9SB 1XA0A 1N2SA 3KV3O 1LEHA 2Y68A 1J4AA 1QR6A 4EJMA 1DHRA 2J8ZA 2JFGA 1JWBB 3H7AA 1D3AA 4FW8A 1EK6A 4B4UA 1BXKA 2J3IA 4LRTB 3U49A 5DBFA 1V8BA 5A02A 2AG5A 1DIBA 1UH5A 3D5TA 3DAPA 1GADO 3JQFA 2NACA 2P4HX 2UAGA 4TRRA 3H65A 3WBFA 3OQ6A 1BG6A 5DCWA 3VKUA 3ZU5A 3NDRA 1OMOA 4XQGA 3O8QB 4N18A 3ON5A 1ISGA 3F6YA 2IEBA 1FDSA 2WE8A 4GLLA 4EBFA 3DR3A 3BMQA 5JMPA 2I6TA 4BOYA 4RO0A 1WDKA 1W0CA 2PK3A 3PQDA 1SCUA 2Y1FA 1LU9A 1E3WB 2C5EA 2ZB8A 3JQFC 4MP8A 5DCUA 1NHWA 1JAXA 3E9QA 1T25A 5T8KC 1V6AA 4B8WA 4H16A 1X15A 4XGNA 4EGFA 1RM3A 4YVFA 1LSUA 2FR0A 3ABIA 4J91A 4D79A 3DONA 3LYLA 1JDJA 2A4KA 4XR9A 4ZQBA 3PFWO 3RC7A 4ZU3A 3K30A 4D43A 2OP0A 4J9UE 4OJNA 3UVEA 4M55A 5C7OO 3GZ4A 4BNJA 3TZ6A 1A72A 2I9PA 3H6KA 4WGGA 3IUSA 4KUGA 1R4MB 2HMWA 5JMWA 3DAFA 3GA0A 5B4UA 4Z9XA 3VZRA 1MFZA 2UVDA 3PYLA 3CPSA 4E33A 4BO8A 3WGHA 1ZSNA 2P9CA 2B37A 4UVHA 2O3UA 4B4WA 3JQ7A 3IMFA 3JD3A 1C14A 4B3HA 2B35A 4EUHA 4OO3A 3VZSA 3WGYA 4D3FA 2BD0A 2AE1A 3QHAA 3D4OA 4KWHA 1NFQA 1ZK4A 4YJHB 2QX7A 3VTZA 4OKIA 4ND1A 1WNTA 3VDRA 4B3IA 2YV3A 2CDBA 4CMIA 2IEDA 1UXIA 4EUEA 5EPOA 3PRJA 1N9GB 5COQA 1N1GA 3GDOA 4JK3A 4CMKA 1NPDA 3OECA 3QVOA 1KS9A 3NDJA 4OXKA 4YT2A 1SZJG 4I8XA 1Q0QA 1FJHA 1QMGA 1TA4A 1HDCA 1MC5A 3KYDB 3MJSA 5HA5A 2J5RA 4QFDA 1S7CA 3AFNA 2VWQA 4N5LA 4CR6A 4NBUA 4BO5A 3LT1A 4XYGA 2ZB3A 3JQBC 3BMOB 1J0XO 2VHWA 1H5QA 3H2ZA 3WMWA 1CF2O 4UULA 4YAIA 4MOWA 4O0LA 4BO9A 3KYBA 5A3JA 4K26A 1BMDA 3Q11A 5GZ1A 2WM3A 1WDMA 2AEFA 5JDIA 2WTBA 4OIMA 3LC7O 2IRWA 3DHNA 4PLHA 5DULA 4YRAA 2VWHA 3K9QO 4WJZA 5K9ZA 2J3JA 3IKTA 1ISHA 3M2PA 4J9VA 1LTHR 4XJSA 1Q0HA 3I23A 1A7KA 4K6FA 1ML3A 2XF8A 3RJ9A 3E03A 4IGEA 5G2OA 3VPSA 3ZWNA 1YE3A 2FZWA 3PLRA 4FJ0A 2C54A 1DB3A 1HE5A 4IQ0A 4B4OA 4DGSA 1F14A 3L6EA 1WDLA 1GPJA 3PLNA 3RC2A 5JDIC 1QYXA 2E49A 2QG4A 3AW9A 4NBRA 4GX1A 2GZ1A 4P4LA 1YOVA 1KY4A 2W90A 3PK0A 2OO5A 3UFXA 4LGVA 4KQWA 4RF2A 3WGOA 3WWYA 2ILTA 1OFGA 3O9ZA 2X22A 4NIMA 5U4QA 1HDRA 2OUIA 4N5MA 2OMEA 4BNNA 2O7QA 3JCZA 1TT5B 4RGBA 3PQEA 3EC7A 3DZIA 4WOKA 1P1JA 4FBGA 5T57A 3GH3A 3SXPA 2GRAA 3LVFO 3AOEA 3M1LA 3HDYA 4O5OA 5JCXA 2EJWA 4KZPA 4XYLA 1ISFA 4PLVA 2NU8A 4FOSA 4M87A 4BNMA 5JAQA 4DLLA 4WECA 3WTCA 1IB6A 3RUHA 1SBYA 5I7EA 1K6JA 4UVIA 1HDZA 4R16A 4BNZA 5FFFA 1PWXA 4P22A 4PLTA 3H5AA 3I9KA 4UEKA 1C0IA 1KOLA 3I6IA 1UAGA 1XIVA 3ROPA 3UHAA 4FR5A 4LCEA 5TSDA 4WK6A 4NMHA 1MG0A 5AXAA 4URFA 1JVBA 1KVTA 4WNIA 4XDZA 4R4JA 2HUNA 2ZQZA 4XJTA 3TDKA 3MJVA 1XYGA 1S6YA 2HJRA 2PWZA 3JD4A 2BRUA 1ONNA 3NRCA 3HE3A 3NJ4A 5B1YA 4IZIA 3GC6A 3EDMA 3HZZA 3UF0A 1R0LA 5F3RA 1E7SA 4GMFA 4RZIA 2CMDA 3JQ8B 3V2UA 3VH1A 5TX7A 1LLDA 4MVJI 4PZCA 5F1OA 5IDYA 5KJ6A 1XU9A 5JCJD 1PS9A 3HWRA 2X8LA 2NVBA 2G76A 1HE3A 5KOIA 2FR1A 2X6TA 5I9NA 2BFOA 1MXFA 1IZ0A 5AXCA 3FN4A 4WLEA 1T26A 1MUUA 4D0SA 5K0ZA 3F4LA 2WMDA 2OOSA 1PJSA 2W2LD 3ONDA 4IINA 2VTEA 2Y66A 4OOFA 3DBLB 1YO6A 1KETA 3N74A 1HLDA 1LRJA 2Q1WA 2W2LA 4L8VA 4EEZA 1NPTO 1PS8A 2OHXA 3VHRA 4CLOB 3JQAD 1X7DA 4R41A 1DFHA 1I5RA 1P31A 2Z1MA 4IUYA 3SVTA 4BNVA 3W4KA 1BRMA 3DBHB 3GGPA 4N7RA 4ZVVA 4AJ1A 2VHZA 4CM4B 2C5AA 3JQAA 2NQ8A 2Z1NA 1U2GA 4G5HA 1LC3A 2X4GA 1HDYA 3DXFA 3I9JA 3DZJA 1DRUA 1GUFA 3ZU4A 3HUDA 1PL8A 3IKVA 2PLAA 4I9UA 3DOCA 1Q2XA 3ZWYA 3VH3A 1DOHA 3H3FA 4OXNA 4BO0A 5IXSA 2PGLA 3PDUA 5ITWA 3G79A 4PLWA 4CMJA 5CDUA 5L7YA 4RQUA 5KTKA 1B7GO 5L3ZA 3WYCA 4L74A 1E7MA 3CKYA 1JKFA 1ZEJA 2B83A 2IXAA 4AJLA 3ZN2A 4CODB 1QV7A 1HKUA 4H3VA 3WDSA 2FPGA 4D7AA 4FPXA 3TZCA 4ZQFA 3U9LA 4I5FA 1T1RA 4FGWA 3EZLA 3DZBA 2IXBA 4Y67A 5EIOA 1D7OA 3SLKA 4FFOA 3W8DA 2D3TA 1XSEA 3AI3A 4CMGA 3WFJA 3SJUA 1LI4A 3LK7A 4AJ2A 5L53A 2DTXA 4QEDA 1B26A 5G0SA 1LDMA 5IFLA 3EAGA 4DTIA 5CG1A 3DBVO 3CZRA 1NASA 4HKTA 3DBRA 1BW9A 1LLQA 3RWBA 4U5QA 2EIHA 3PIIA 2EKLA 2CSUA 3ZNQA 1EEHA 3DTYA 3F5SA 4CV1A 1LSSA 3DEYX 4IIUA 5H82A 3DMTA 1EE2A 2OXIA 3RU7A 5JYEA 5ILOA 4PRLA 1XWFA 2NLOA 1SB8A 1JA9A 5F1PA 1B3RA 4HP8A 1MLDA 7MDHA 1KVQA 4UEJA 2YYYA 5FYDA 2W98A 2NNLD 2JCXA 5AXDA 3TZQA 1XLTA 1EBFA 1F17A 1LLUA 1EFKA 1PR9A 1LRLA 1UDAA 4DIBA 4R1NA 3F9IA 3WBBA 3ZWWA 4E5YA 1AHHA 3TL3A 5JAMA 2X23A 3DMTC 4L4SA 2IYOA 4WCDA 4DBVO 2IYPA 2EJVA 1U7HA 2XAAA 1KEPA 4RVGA 4I1IA 4BUCA 4ZICA 4RLHA 1EBUA 1I3LA 4RF5A 4ALLA 4DYVA 4O63O 3QVXA 1VC2A 1GYQA 2CDAA 4RLSA 5G0TA 2DBZA 4O1MA 1EMDA 4GH5A 1NFFA 4ROSA 1A9YA 4CV0A 1C1DB 1R6DA 4ALKA 4P38A 4AL4A 4NI5A 3C7CB 3S2FA 3CTMA 3OFSA 5L4SA 3JD1A 1QORA 4YRDA 1I2CA 4MVJD 5JY1A 2CF6A 2NUAA 3L6OO 4HNGA 3JYOA 2HU2A 3QWHA 1HYGA 4MVJA 4TROA 1RJWA 3RAJA 4W99A 3NEPX 4Z0PA 3CEAA 1IHXA 3ROKA 1HTBA 4LW8A 3GNTA 3TJRA 3O03A 4GAEA 4GQAA 1UZNA 1V3VA 4MVJM 1FK8A 2VN8A 2QZZA 1BTOA 3CE6A 3EMKA 5EN4A 5THKA 4PLGA 4II3A 4DIFA 4RPLA 1JLLA 1VL6A 4K1LA 3JYLA 4OXYA 2DUWA 1IPEA 4QSMA 3HADA 3DHEA 2X0RA 3VPHA 1H9AA 2FSVA 2ZB4A 3M1AA 5TJ9A 4CM1A 1SC6A 4BO1A 1Q7GA 2QHXA 3PPIA 3VOSA 1ONOA 3KETA 1AGNA 4NU5A 4GSLA 3E48A 3KYCB 2Z5LA 4EUFA 4RVUA 2PD6A 1H6AA 3KLPX 1DEHA 3OJLA 5I9MA 4J43A 4CMEA 3ZWVA 1OBFO 1TVEA 1MV8A 4C4OA 1YBMA 4IBOA 1GQ2A 1P44A 3ETDA 4ITUA 5CDTA 1OI7A 4DPMA 5TQVA 1KEVA 4BNFA 2BF7A 3ZNPA 3C24A 3IP1A 3GLQA 5GZ3A 2EV9A 4CM8B 4DC1A 1SNYA 3BTSA 3BHMA 5IN4A 2P9GA 3WX0A 4L4RA 3MTJA 4CMEC 1NHGA 5DOZA 1H6CA 2Y93A 1DAPA 2FWMX 5A3VA 1DBVO 3EGOA 2EG9A 3ICCA 5AXBA 3E18A 2Q4EA 1HSZA 5KVVA 3FCOA 5I7VA 2XXBA 4MVJE 4R5MA 3VKVA 3MJ4A 3UCXA 1O5IA 2I67A 2O48X 1P1KA 3H9EO 4TZTA 3CZMA 2ZCVA 3P7MA 1QYWA 3ZNOA 2PGJA 3OJFA 4MJLA 3H5NA 4MVJP 4B3JA 2D5CA 2C59A 1ENYA 5I9LA 2V65A 3ZH2A 1R15A 3LT2A 4CQMD 3BHIA 4ZQEA 5CDYA 4IS2A 4WLNA 4FFNA 1IE3A 4CQMA 4AJOA 1LUAA 4UREA 1PGQA 1RYDA 3QWIA 4DYDA 1ZMTA 3ZWCA 2WD7B 5A4DA 1R4NA 3V2GA 1PIWA 2DVMA 4RVFA 4BV8A 2I3AA 3ZZNA 4E32A 1NR1A 1C1XB 4XD2A 4NJMB 4IM7A 1C0KA 5L7TA 2UUOA 4XB2A 1UP4A 3PJDA 4IMPA 1P1HA 5HM8A 2TMGA 4YJFA 3ORFA 1YDWA 2IZZA 4OH1A 3LF1A 4RDIA 4UUMA 4YDRA 1P33A 1Y7TA 3GZNB 3PVZA 2ZQYA 4BKQA 3TPCA 4YACA 1DPGA 1NR7A 3GVPA 3GHYA 1N7GA 1PZGA 2EP5A 2ZK7A 3KSUA 3M6IA 4H15A 4NQZA 4R69A 1GCOA 1I01A 2V6BA 2VHVA 3ZWAA 2I5PO 4FOOA 2VT2A 1E5QA 1V9LA 1ZSYA 3KSZO 1VKNA 2C20A 4MDHA 5T67A 1SPXA 4LCJA 1J6UA 4R1SA 4AFNA 2GCGA 3T7CA 2EWMA 2SCUA 4BKOA 2IZ1A 1LSOA 3OEYA 2OORA 4AJJA 1B0AA 4Z3DA 4LN1A 1M6HA 3H9UA 2I65A 3ENKA 4EZBA 3V1YA 2RBEA 3I4CA 2AHRA 3EYWA 4FCCA 4RDHA 2HRBA 4BMSA 3CIFA 2DPHA 5HBRA 2VRBA 4JBIA 1YVEI 2ZTVA 4CLRB 5TS3A 5I8WA 2ZKLA 3DB2A 1ZVMA 1ADBA 2CY0A 4BO3A 2HMUA 3HSKA 2AQHA 1H2HA 3WSWA 1YB1A 3WR5A 1M76A 4OHUA 1DC5A 4Q3BA 4DQVA 1WZEA 3NGLA 4JGBA 2O50A 1QKIA 3WXBA 4OSPA 3GDGA 4K9DA 3ZWPA 3GT0A 3KZVA 2G17A 1QSGA 4NHEA 5CEJA 2VZ0A 1C3VA 1PJBA 3I4FA 4IY1A 4I5GA 3P5SA 2DFVA 5DP2A 1YGYA 4TMFA 2YJZA 1U8XX 2VYVD 3B1FA 4J0EA 4CQLB 1UDCA 1LXCA 3PZBA 1K2WA 2O3SA 3DAGA 4WCFB 1U5AA 2D2IA 1Y9AA 1VKOA 3EVNA 1OC2A 1PJQA 1VE9A 1D4FA 3B1KA 2DPGA 3D5QA 4JBHA 1KERA 1Z7EA 5TRTA 1WAMA 3AK4A 4KP7A 4L76A 1TLTA 1RWBA 4QO7A 4WE3A 3WJAA 2VWPA 1M2WA 1DHTA 2DT5A 1NAHA 1NQTA 2FZEA 3MEQA 4Y6SA 1HETA 5AYVA 3C3XA 2VHXA 3ZI0A 2DBQA 1VJ1A 2GLXA 4FDAA 3WQSB 3IJRA 4AJ4A 4DPLA 2V6FA 1N8KA 1Z45A 4J1SA 1YXMA 5KKCA 2W8ZA 3PHJA 1NYTA 4JJFA 4YJGB 3GRPA 1EZ4A 1N5DA 3NDIA 4D41A 4UUNA 5A05A 4B7XA 3QY9A 4MVJF 1R66A 4RQTA 4E5KA 5AVOA 3IAHA 1U8FO 1CEQA 1PS0A 3P2OA 2J3KA 5EERA 4QTZA 3L6DA 1HDGO 4AJIA 4KMSA 4KWIA 3ETGA 2ZATA 3D3WA 2NU7A 5L4NA 1Q0LA 3F5QA 2OBYA 7ADHA 1ZKMA 3GAFA 3OIDA 4PFJA 4UVGA 4RORA 4BGUA 2B0JA 4GSKA 4EYEA 2C29D 2P68A 4E5MA 1UUFA 5BT9A 4BVAA 1B8PA 5JSFA 3RFTA 1TEHA 1B8VA 3K31A 4DXHA 1FXSA 1LSJA 3H9GA 3M2TA 2HMTA 1ISJA 2WYWA 2Y1DA 2YQ4A 3K6JA 1EVZA 2ET6A 4R51A 3I6QA 1UXGA 5FWNA 3IIEA 1QYDA 2BGLA 2VUTA 4HFNA 2HJSA 5MGBA 2LDXA 1U2DA 1EFLA 4PG6A 3UAGA 3RBVA 5JNLA 1EDOA 2HK7A 1QYCA 2JCVA 3FPLA 5KKAA 5CDGA 4B7UA 1WP4A 3C7DB 5JC8A 2NSDA 1BHSA 3GN1A 4XIJA 3G1UA 3JQGA 1K0UA 1A4IA 1GZ4A 2Q1UA 3H8VA 1HF3A 3INGA 2GN8A 3ADOA 2E4AA 3TWOA 1E3IA 3ZV3A 4WEOA 2Y1EA 3PHLA 4IJUA 2ZB7A 3AU8A 3BMQB 4FIZA 4OSOA 1O89A 2VT3A 4GPD1 4BNGA 2AXQA 1JQBA 1NFRA 3PHHA 2E48A 3OQ1A 4CJXA 3ZV4A 3DL2A 4OYRA 4PIVA 4JN6B 1Y1PA 4CMAA 5JS6A 3K92A 3DZHA 2HLPA 6LDHA 4Y98A 3CMMA 3FWNA 2QW8A 3S55A 1M75A 4Z3KA 1NBOA 3RC9A 1BXZA 2UV8A 3I9OA 4RVHA 4DWVA 4JJIA 5CEEA 2NVUA 1K6IA 3FBTA 3OJ0A 4KDFA 5CPFA 4ND5A 3I9LA 1PJTA 3F47A 5I7SA 1BVRA 4OKNA 2D0IA 3JV7A 3HFSA 5H83A 4BGIA 5TT1A 1AHIA 1E7QA 3ONEA 4LVUA 3ZV5A 4OAQA 1CIVA 1B15A 2PH5A 2A92A 3DFUA 5A5FA 2EW2A 1XCBA 1VJ0A 3VVCA 2ZCUA 3RVDA 3UH1A 1DDOA 3AI2A 1GEGA 5AOVA 3V1TC 2VNSA 3GUCA 1N1EA 1U1IA 3JQ7B 4XIYA 5JO9A 4WKGA 2J3HA 4YXFA 5CAEA 1O8CA 5L9AA 2WJPA 3QSGA 1DC3A 1VM6A 2HMVA 2B36A 4TZKA 3I9MA 5TT0A 3QWAA 4NBWA 1LDNA 2IE0A 4PCVA 1I2BA 1QXSA 3GFGA 4HUJA 3DC2A 1VLLA 1SAYA 3QQPA 1V35A 4NK4A 4II2A 4TKMA 1I24A 4J2OA 3L77A 4W6ZA 2DBVO 4HY3A 3MCVA 1Q7CA 1ARZA 2CFCA 4ALJA 5G0UA 1I32A 4PZDA 2A35A 4AJEA 4DQUA 3JYNA 3G0OA 3HDJA 5ICSA 1WLYA 4DLAA 5CHEA 4W9NA 1CRWG 3TFQA 2NADA 1ZW1A 5TNXA 1A27A 2R2GA 4GX5A 3S1LA 3C85A 3HFGA 1JWAB 4IQGA 4QO8A 3AOEC 2P91A 5TGDA 4DQXA 4E2ZA 1HDXA 1F8GA 1RPNA 2D59A 1JN0A 1U28A 1Y8RA 2EF1A 3NTQA 3U4DA 1YH3A 4IDDA 1M66A 4J4TA 3ZV6A 2ZTLA 4XRRA 3OH8A 4W9NC 4YAKA 1I2ZA 4J0FA 4WEQA 4BMNA 4NDNE 2Q2QA 3EUWA 3CH6A 4CM3A 1KVUA 1T2AA 1YB5A 5DZSA 3DBLA 4YT5A 1YL6A 1WZIA 1YOVB 2R00A 4Q3NA 3FF4A 5BQFA 3JD0A 4CR8A 1KVSA 4E4YA 2Q4BA 4YQZA 3KB6A 1EUZA 1ZIDA 2HKIA 1Y8QA 1L7DA 4R01A 4E2XA 5FI3A 3DBHA 4G65A 1W4ZA 3HQ4O 4E12A 2H6EA 4GX0A 4Z6KA 2FY8A 2DC1A 4J7XA 2CDCA 3VVBA 2FSSA 3AY7A 3L9WA 4YJDA 4R9RA 2AW5A 5JCJA 3TZKA 3U4CA 1DFGA 1YBVA 2R00C 4U7WA 1LDGA 2ZIZA 2Y67A 4LK3A 3RBXA 1V3UA 4FB5A 5ENDA 3UW3A 1HEUA 1E6UA 2DBRA 4PG4A 4Q3AA 4YAJA 4ILKA 1E6WA 2Q2WA 3DZGA 2VQ3A 3L07A 2PNFA 1GD1O 2VZ8A 4J4HA 1PWZA 4OGWA 2PH3A 5CP8A 1ZNQO 4IJWA 4JBGA 2AE2A 5JBIA 2CVZA 3FRJA 4PRKA 3WNVA 2V6MA 1Y81A 4KTTE 2VNAA 1Z82A 4R1TA 4FSHA 2POQX 4ID9A 4RV9A 4IMRA 3F4BA 5COAA 1BWSA 4IDAA 3GNSA 2YQ5A 3TOZA 3GG9A 8ADHA 2WEKA 3AFMA 3LF2A 5FI5A 4E0BA 1G0OA 2O4CA 1MXHA 1YONA 2Y0EA 4FC6A 4CMHA 3RUEA 4W7IA 2DAPA 1T2DA 4DMLA 3UUWA 3EY4A 4ZRNA 5FEUA 1GR0A 2YHIB 2BFAA 1H6BA 2C7GA 4IGFA 5ENVA 1ZXBA 5T64A 2GZ2A 3SBOA 1ENPA 3L9XA 1VPDA 1A71A 4A26A 1ISIA 1GV0A 1UXKA 4KOAA 4WLOA 4Z9FA 2VRCD 3LDHA 3KTDA 3ZDFA 1XU7A 3WFIA 2ZYAA 5BSEA 3KSDO 2EXXA 1U3UA 2VRCA 2ZJ0A 3BAZA 3I83A 2PR2A 2YW9A 4MKXA 5ITVA 5BSFA 2XPCA 3JQAB 3U4HA 5BR7A 3IL2A 1ZEMA 4GGPA 4DVJA 4MIYA 3FNFA 3BMNB 4CMCA 3PWKA 4XDYA 4IQ8A 2BKAA 4IPTA 1VSUA 4LVCA 4YWJA 2DQ4A 4ZHSA 2Y05A 4XB1A 1MB4A 3WGQA 1PR3A 4EW6A 1ID1A 1Z75A 3OIFA 1EDZA 1ZCJA 2E37A 5IDXA 2NTJA 1LDBA 2JD2A 2NM0A 5G4KA 1GY8A 4PVDA 2YZ7A 2BGMA 4WPGA 1DJQA 1B8UA 3AI1A 2P4QA 3AM5A 3NTOA 4E13A 1C1DA 1I3MA 4OQYA 4XQ9A 3D4NA 3OA0A 2FP4A 2FR8A 4AJPA 1U4OA 3FBGA 2QYTA 2DU8A 2PGDA 2VTDA 5KWEA 2AG8A 4PLZA 1PGOA 6ADHA 4BNIA 3GPDG 4M8SA 3MWDB 5A03A 3ANMA 4WUVA 1A7AA 1G1AA 4K28A 3RC1A 3IDSA 1GZ6A 2C2YA 1DIAA 3GVXA 1XR3A 5C7IO 1Y5RA 3SC4A 1A9ZA 4IIVA 2EERA 4IZHA 4TSKA 2HK9A 1NAIA 4DL9A 3JQDA 2Q46A 3JSAA 1PZFA 1GV1A 4XYEA 3RFVA 2ZTUA 1O0SA 3ITKA 4NFYA 3KM0A 3DBRB 1BW9B 1W6UA 2X9GA 3PHIA 3GDFA 1UAYA 4FFPA 4UVDA 1GPDG 2GD1O 4Q3DA 1BXGA 1ZK0A 2H1SA 5C3MA 3E1KA 4NH4A 2QRLA 3CUKA 4HV4A 3WMXA 3PWSA 5G4LA 1EE9A 2X7HA 4BNXA 4DREA 1P9LA 2CD9A 3OETA 3B1JA 4EJ0A 1NPYA 3WIEA 3GR6A 3BXXA 1F8FA 5F5NA 3PQFA 4J1NA 5IZCA 1YS4A 4PZEA 3DZKA 1SOWA 3F1LA 3C1TA 1ISMA 1J5PA 3ZW8A 1J49A 4GL4A 2YV1A 1OOEA 4GGOA 1DRWA 1E1NA 2V7PA 3PXXA 5HS6A 3KVOA 1WMAA 2Q3EA 4U8GA 3RUDA 4BNUA 1XG5A 2NVWA 4HXYA 3AU9A 5IZ4A 4CUKA 5L40A 1H9BA 3GF4A 1K89A 3FNGA 2GN4A 3OHSX 5IZCC 2I76A 4BO2A 3KLMX 3KEQA 4JQCA 4XR4A 1ZZEA 2GGSA 1H0KA 5BSGA 1ADCA 3FWZA 2H5LA 2R6JA 3QWBA 4U0KA 1UXJA 1LQUA 3ONFA 1NQAO 3X2FA 4L73A 3HN7A 1DC6A 1HXHA 1HE2A 1WWKA 3ASUA 3TOXA 4B79A 2WYVA 1JVSA 5I8ZA 1D8AA 5JE8A 3TF5A 3GN2A 2F00A 5LDGA 3NKLA 4YQYA 4NBVA 3BMCB 4B4VA 2PV7A 4U6QA 3WYBA 1K3TA 3V1UA 4J7UA 2NU6A 4FS3A 5G0WA 2RHCA 3WNQA 3ENNA 3WTBA 3HNPA 4LISA 4YTEA 2YHUA 2DTDA 3ROMA 2B4QA 1KY5A 4K6CA 2BFMA 1L1FA 5EINA 3JQ6A 3WOHA 1FDUA 1P1FA 2WWRA 3MJEA 3BTOA 2GF2A 5JAIA 1HE4A 4HADA 1YB4A 4XKJA 3AM4A 3IP3A 1MG5A 4XA8A 2O7SA 1R16A 1UJMA 2D1YA 4MINA 2WD7A 4I5DA 4Z9YA 3S2EA 4ZA2A 3IS3A 5L7WA 4E31A 4KQXA 3WB9A 4QT0A 3RUFA 2D8AA 5K6AA 3EHEA 1YJQA 3VH2A 1I3NA 1X7HA 3B6ZA 1A4UA 1WW8A 4PGFA 3WQQA 4WLVA 3U0BA 3IUPA 1NP3A 3PGJA 3WWZA 4R5HA 4U0JA 2Y1OA 2P2SA 3AUTA 3GG2A 3K5PA 4YAGA 4FN4A 3GNQA 3MTGA 2W2KB 4GLOA 4Q3CA 4W82A 2RCYA 3W8EA 5C37A 3QW2A 4F3YA 4MVJH 2HMSA 1JTVA 2O3TA 3DQPA 5K6AC 5LDHA 2EW8A 4IXWA 5T6BA 3PGXA 1UZMA 1AN9A 4N5NA 4I08A 4R54A 3OEWA 1V3TA 1ZMOA 1U3TA 4YEDA 4DIOA 4FJ2A 5ES3A 3BZUA 4EJ6A 1E7WA 3I52A 4ONEA 1LDEA 3PYMA 1ZK2A 4XYBA 9LDBA 4QFCA 3KUXA 3DDNA 1LA2A 4HBGA 3AY3A 3GGGA 4J3FA 4RCVA 3JQCA 1F12A 4UEOA 3V5NA 4IDEA 2JAHA 3UICA 4GVXA 1HT0A 3FTNA 4FFLA 1U4SA 4UUPA 9LDTA 5IF3A 4QUKA 3BYZA 5DNAA 3TL2A 1NQ5A 4ZQGA 3ZHZA 4XZ3A 1UXHA 4Y6RA 1SMKA 1SO8A 4LMRA 3RUCA 1BVUA 2WD8A 2UYYA 1DJNA 4CL8A 2O3RA 1JW9B 2E6UX 4ALMA 1EVYA 3PJFA 3VH4A 1XDWA 1DFIA 4D44A 4Y6PA 1NVGA 3ITDA 3R0IA 3QVTA 1LQTA 3CSDA 4Z0HO 2YY7A 4J16A 3Q6IA 4DLBA 2IDZA 1AE1A 3BIOA 1R4NB 2G1UA 4NU6A 4FD3A 5TLSA 1SEVA 3NJ8A 3V2HA 2IZ0A 4GKBA 3HDHA 2B69A 3V8BA 3JQ9A 3B20A 2ZTMA 5A06A 2A9FA 4P4GA 1GU7A 4YJFB 3PDJA 4J6FA 5F1KA 1H6DA 2AA3A 3QJ5A 5JO0A 1U9JA 1UDBA 5IXYA 2X0JA 5L4LA 3WYEA 1PJ3A 1K6XA 3EK2A 2Q45A 3OSUA 4NG5A 4Q9NA 5A9SA 3RBZA 3VAZA 3DWFA 1KEUA 2X86A 2GZ3A 4NFHA 1I30A 4IJVA 1V0JA 4YBZA 3WICA 2I99A 3IJPA 4BKRA 2X5OA 3FNHA 4J49A 2PY6A 4YT8A 4BHTA 3JQ9C 5JPIA 4TQGA 4YJGA 2VYVA 1F0YA 1B2LA 4JJGA 1BDBA 1R0SA 3ZCXA 1MX3A 4OOEA 1E1KA 4GBJA 3WGIA 4DA9A 1PQWA 1U7TA 2QYSA 4D0RA 3UCEA 1D1TA 4ZN6A 3O8QA 3A06A 2JFHA 3L4SO 1QLHA 3NTRA 1H2BA 2YDXA 4IDBA 5FF9A 3CXRA 4A0SA 2VZ9A 2GR9A 3L0DA 3AY6A 2PKRA 3FI9A
chains in the Genus database with same CATH superfamily
2IJGX 1NW8A 4UCQA 5KNLA 1E3WA 1VE5A 4B3RB 5K8LA 2XDAA 1L5YA 4UU0A 1X7YA 2XADA 1ZK3A 1PBTA 3I12A 3IHTA 3KKPA 3OBBA 2UVQA 4RJTA 3WGVA 4TVBA 1YL5A 3CPJB 3RIEA 5ECGC 5FA5A 4DC9A 2BBTA 2W4MA 4XEUA 2RJNA 2Z95A 3A3OA 4C4RA 3CVXA 2B30A 2G5CA 1JBEA 1C2TA 1F0NA 1KR5A 5EHQA 2B7BA 1Z4OA 1D2CA 2QD3A 3A11A 3K2BA 1PT9A 4DRZA 4L9WA 2YWGA 4FM9A 4P8RA 1YCFA 3LPCA 1SCNE 2V54A 2OZEA 1JV2B 1P2BA 3LIPA 4EX6A 4IILA 3DS8A 3HVRA 3L8CA 2CN1A 3HB0A 1EWKA 3R1IA 5BNTA 3BC1A 3E9NA 3IURA 4ZZIA 5IH7A 5JRZA 4ND3A 4IDFA 2VH5R 1O95A 4JGGA 3ICPA 2WU0A 4KN5A 3GGJA 3KCQA 4GRDA 2GUGA 5DFAA 4H4EA 1I33A 4NBTA 1X7WA 3TLZA 1D6SA 4OP1A 4D8VA 1ZJYA 1WMFA 3G2JA 3IEXA 1DSSG 3H1TA 3NORA 1VBFA 5GVRA 1GL7A 4MTLA 4E2YA 5L7TA 2FKNA 2HDNB 3EH2A 5HF6A 2H4ZA 5CFMA 4OJMX 2WB2A 1GAEO 4L4XA 4UU1A 3ZWOA 1E8DA 3KEFA 3OURA 4OYLA 5ADHA 1Z5UA 1CQZA 1ZUIA 2C31A 3QG1A 4W9MC 3QYFA 5I7AA 5TVKA 1FFXA 1AA6A 1N9GA 2DHRA 3AUSA 3RLIA 4QL3A 1OXXK 3KBOA 3QEKA 4UBLA 4MR7A 4DQKA 4B34A 2ZWIA 2HPVA 4Y30A 4DCMA 1A98A 4WFIA 5G0VA 4NZPA 1OPXA 1R88A 4LKRA 1C7QA 3EAQA 4DRXB 1FTSA 1W73A 3ZGYA 1J06A 2CYCA 4RZHA 4GXQA 2O8FB 1MC8A 1L0BA 4FMCF 2N42A 2H2FA 5JXWA 3O26A 5ECWA 4GZMA 4FX2A 2P2DA 2Y3IA 2B98A 4RELA 3DW3X 1PEKE 2GJ4A 1EVQA 4F96A 1HL3A 1KJQA 3T15A 4EPTA 2QA5A 2HDWA 3MS7A 1PU2A 1SA0B 4GWGA 4LZOA 4Z9AA 1C9MA 3T0IA 3ZW9A 5IJZA 3WQRA 3PGVA 4R7GA 4C7BA 4NE7A 5AUOB 2FW7A 3UJ6A 4BZXA 2BZ1A 1KDPA 2FGKA 3GK3A 4W4TA 1G6KA 4OFZA 4A5OA 2HMYB 5CEFA 1X1TA 3E9RA 1XEXA 2DM6A 2IYSA 3I42A 1ZICA 2H31A 5JAZA 2X58A 4G8BA 4DMMA 4E1BA 2I55A 1HLPA 2NV0A 3OCZA 3VOTA 4M0DA 3ZK9A 4XIIA 3UQZA 1P77A 1YR6A 1S3IA 4I99A 5C5IA 4KGXA 4UHBA 1NLZA 1RBMA 3QNUA 3R09A 4EVQA 1OJLA 3Q7IA 4I1YA 4XCQA 3HRKA 3J80A 4K0RA 2H48A 2FQQA 1BX1A 1M2VB 4IIXA 3ZD8A 4DDKA 3JQEA 4KO3S 1IRXA 3IC5A 1MGPA 3GEGA 3WLHA 5HK8A 4OMUA 4AJ4A 4Q7LA 4OJYA 3RCBA 1CCWA 1C7EA 1QGUA 1RZ3A 1RRGA 3Q9NA 4LFCB 3RVQA 3L7DA 1T2VA 3FNQA 1IWOA 4NENA 3UB4A 1E69A 1E9SA 4GM4A 4E5UA 3RJZA 1C8VB 1T4CA 1WQ1R 2WI8A 1AGYA 2I1VB 2VYQA 2YDYA 3FE2A 1KC3A 2P77A 3B3GA 4FDUA 3KT6A 1F2TB 3CKLA 1RR6A 1G9TA 1QV6A 4KXYA 3VZPA 3BDVA 4U2DA 1AHPA 1YJ5A 4D6YA 3ZN2A 1J1ZA 2X1MA 5A4IS 1SVMA 2O3QA 2VNKA 3ZCVA 4F6LA 1JQKA 3TM4A 1VIVA 5TIIA 1A2KC 3NKFA 1Z63A 3CNOA 3GYGA 3NLLA 4NPHA 4OQEA 4ZXPA 5JRDS 1QP8A 3FOEC 1JAYA 3RRBA 4OQ4A 4BEJA 5A5EA 2X1VA 4YWHA 3LXMA 2MU1A 4R2MA 4R1UA 1G8GA 3K8YA 4R7TA 2ZI4A 5JY6A 4OHBA 4MS4B 3OQJA 4MHTA 4Z7OB 1IN4A 3D31A 3P9CA 4YV0A 1ULTA 1RJEA 3ODPA 4L3WA 4ES6A 3FFAA 1YRYE 3T5TA 1RHRA 2ORWA 3BFXA 3EMDA 3P0FA 4HNVA 1BA3A 4GF5A 3LLCA 3C3PA 2Q7DA 1J2TA 1Z8FA 2OCIA 4F60A 4QTYA 5K0JA 3NXSA 1LBSA 4JC0A 1YI8A 3D6JA 2DWUA 2QP9X 2A86A 2XA1A 5AW8A 1OIVA 3COZA 2PGXA 3RIHA 2JFBA 4BN0A 1J00A 4KJXA 4YV7A 1P4AA 3MRSA 2JZNA 5EE5B 4M1QA 2RH5A 4BQSA 1BFKA 4N7JA 1VMDA 4HEQA 3EZ7A 1ZXLA 2Z2XA 4QXMA 4BNDB 3TLJA 1EI9A 3KB1A 4QYMA 1PVDA 1FMCA 5ALEA 3T99A 2OBXA 3AFOA 3DFFA 2VK8A 1EFUA 4IIJF 4BDSA 1Q7BA 3DT9A 4J4BA 4K3VA 5DLYA 3W3AD 1K3UB 3V7NA 3SVZA 1XJCA 3LT4A 5FTLA 5F2NA 1XV5A 2CJFA 5M5BA 2EIXA 4X54A 2OL4A 2Q7XA 3DEJA 4QBHA 2FV8A 3W77A 3PR3A 2NW6A 4OV6B 5C31A 1UPFA 4QUEA 1KQ3A 3AUKA 3SXUA 1Z88A 1K08A 2A0KA 3C1OA 3LRXA 4M8IA 3T3HA 2EBWA 2ZTHA 5B2EA 5CVTA 4PG8A 3HB5X 3ZCUA 5K0GA 3LUDA 1I7DA 5JQGF 1OBVA 5BN4B 4H7JA 1UMKA 4U39A 4F6CA 4D3DA 4K87A 2IY9A 3HR4A 1FYFA 4F56A 1L7EA 1E0DA 5K2OA 2X15A 2AC7A 2QYHA 4C5AA 1TUBA 4QAQA 3SF0A 1RZRA 3PDIB 5JSUA 4DR2B 4JIGA 2OBFA 1T2EA 1YAJA 3K0AB 4BO4A 1MO5A 3PFGA 1T8SA 1ZNZA 2P0EA 4KO1S 3OOSA 3L0PA 4NS1A 4O4IA 3ZI4A 5KJEA 3C7KA 3N2GB 5E2BA 3SYTA 4P9NA 4DIEA 3HCFA 2AQKA 1KIFA 1W5EA 3CVOA 5ADUS 1Y4ZA 2VJMA 2XB9A 1FQOA 3GARA 5ILGA 5JI3E 4NCAA 1UWVA 5E6UB 3NNDA 3ZJTA 4UC0A 4BAZA 1Z74A 2VHYA 2X9NA 3JSXA 4V2UA 4PC1A 2ZT8A 1XGKA 1WCIB 5DI3A 1FLDA 4MLZA 4NLLA 4F2HA 2RG1A 2P5UA 2O6LA 1L4BA 2FPOA 3ZZ0A 4NPCA 1RC8A 3WRXC 4UVEA 2GCPA 5BW6B 4B74A 2Z3ZA 1P18A 2CCJA 4HAOA 2R85A 4K1XA 3LSYA 2FWJA 3UMYA 3H2SA 4HFJA 4M4SA 1B41A 4S2EA 1HX7A 2JIZA 3A4TA 3FSJX 1LPSA 2GVZC 2NZXA 2X6QA 3DMHA 3GAZA 2LNDA 3GEBA 3H5TA 3JWPA 1L5NA 2HH9A 3AM3A 4AN0A 4CEJA 2OD2A 5IBCA 3IUEA 2Z8ZA 1IDOA 1UZAA 1XUOA 3KDPA 3BRCA 3LVBA 4WY5A 4D2IA 4F84A 3M49A 2HC9A 4LA4A 3H9QA 5AWFC 4BFYA 4OX9B 1GUZA 1N3LA 2ZLBA 4Z8YA 5DDIP 3GL9A 1E4VA 1NF2A 5EJ2A 2PWAA 2Q1TA 2L69A 1CUBA 5J2UA 3E7FA 1EVIA 1L6RA 2JGDA 1Y8QB 3SS8A 1DAEA 3IBCA 2L19A 4X7MA 3ORSA 3W5HA 3UJNA 2VOJA 3U5ZB 4Y2YA 1BU8A 3DE6X 5HE9A 1ZLYA 1KSGA 1GNTA 2V7BA 1Z07A 3L7IA 1LF0A 1OLUA 2BGUA 3TW4A 1MO2A 1OGJA 2IUYA 2WJ6A 2V59A 1XTPA 3IV7A 4J94A 1NVMB 3ZJ4A 3ZQJA 4F85A 5J47A 4QFBA 4BNLA 2O8CB 3CKMA 4CMBA 1P1IA 2Y1GA 4N54A 5HFNA 3I8OA 1FS6A 4MRMB 3LUJA 2JASA 4AICA 5LXTB 3Q7SA 2Y2VA 4PYRA 1RVDA 1F6DA 2IITA 5E9AA 1PL7A 2QZ4A 2YCLA 2UZ4A 1NN3A 4KMMA 4E4RA 3JWJA 4GQBA 2H54A 1QCDA 4MRSA 4LHXA 2N9UA 3TFOA 2BUBA 2R4TA 3K32A 2Q4RA 4A27A 4E22A 5DCYA 3TRHA 4RXTA 2JNWA 3NC4A 4UXJA 3UMRA 1VA4A 2G4LA 4QIHA 1RNLA 1FVHA 2JL1A 1WSAA 1JKIA 2Y0CA 3D8UA 2BE7A 4IHJB 1GFSA 1GUYA 2Z57A 4WLFA 3Q2KA 2G25A 5IVPA 3L43A 2NTVA 1PR1A 1PJRA 1J0DA 1JXOA 2XDQA 3WSVA 5LR6A 1KEWA 2VJBA 1OZ0A 4ZCRA 3U39A 4P3NA 4PQEA 2F9MA 5BURA 3F46A 1YBFA 3FY4A 3TQQA 1OH8A 4B8ZA 4UE6A 4BLWA 2QVYX 3QV1A 3QNMA 4GXRA 1Y1LA 1J39A 2WVJA 1JTFA 3E5MA 4F3NA 2OCPA 2V8BA 3B13B 2GM4A 2XSZD 2IUSA 4BY9E 4MITA 4QXOA 2JZCA 5HWSA 2FG5A 1CJUC 2J3EA 4H1UA 1XI2A 1PQPA 3QSYA 2BEJA 4X1IA 5KVQA 2V4MA 2DLDA 5J40A 3RSOA 2DFPA 1S96A 4JA0A 3CR3C 4WFJA 4YMSA 5KMGB 3AF5A 4DJ5X 4UNPA 2I62A 4AF8A 3CO0S 1PGJA 2Y1LA 1PSDA 3KWFA 3CU5A 4HB2A 4L27A 1FX1A 4ZU6X 5T5QA 2UZ0A 4YC7A 1S3GA 4ZQHA 2WKSA 1E62A 3UAOA 2NQTA 1WW3A 1UINA 4EI7A 5JCPA 1MAHA 1PI3A 2AD5A 3ETEA 3KOUA 3GFOA 1Z6YA 4INAA 2MIIA 2Z3VA 3IQHX 3PFFA 4AC9A 5BWBA 2I2CA 4ZREA 4LNUA 2JCYA 5FFMA 2A9QA 2VPQA 3PFHA 1TO6A 4JVSB 1W9HA 2IDMA 3TZLA 5CFNA 3A70A 3LW7A 3ED5A 3B70A 5FXMA 1ZA2A 2CZCA 3U3OA 5AQ1A 2QTMA 1UP6A 2P7HA 3WLRA 2AMFA 2RHGB 1CJMA 1UBJS 5IKOA 2C5HA 5HIMA 1FDOA 2ZRIA 3KIPA 4C20A 6AT1A 3KVYA 5DH9A 4B48A 5CT4A 1A1SA 3S5UA 2FPRA 4YJKA 4XPIA 5E4TA 5FNVA 4B35A 1UR5A 2V7GA 2BPOA 2O07A 1J23A 2QE6A 3UANA 2K2WA 1D6JA 4MH0R 4CIDA 1PV4A 4Z4HA 1HDOA 3OP4A 3N07A 1U3WA 2QVZX 2WWTA 2XYPA 3OZ7A 5EMKA 3AF4A 1NZDA 4U2CA 4TTVA 3PD7A 2C4KA 3QLVA 1AKTA 4RPKA 3KYCA 2IS4A 2O4UX 3MQ4A 4KXWA 5IG2A 1X2EA 2VUUA 1GPBA 4X45A 4J2TA 4YNBA 2YWXA 4O2AA 1VLHA 3GU3A 2JLUA 1Z8DA 2IZOA 2ZR8A 4BMVA 4I55B 3ZNNA 2WE7A 1YDEA 3ANLA 1SXPA 3SQXA 1RLJA 3LI2A 4RIIA 4FWIB 1G3UA 4O8ZA 4US0R 2DFLA 2JJYA 1LD3A 5KHOC 4HEA1 1DNPA 1THTA 5BYJA 1OFIA 1E2DA 3VC1A 4BFVA 1HNWB 2HCTA 4C5CA 4U1RA 2ZIAA 1U8EA 2J0SA 3GNLA 3DM9B 1TUGA 4EZEA 3GUZA 4CETA 4MQEB 5LCXA 2DKNA 2R4UA 2YW2A 4L4UA 2G9QA 3O83A 4CM8A 2O1SA 1P5JA 3QBTA 1X0VA 4QUHA 1NVBA 2JB9A 4XQCA 2NZVG 4ALIA 3GJXC 1L2TA 3DZFA 2D5AA 2YOGA 2N1MA 5GJWC 3L0CA 3QNWA 4S35A 3DTNA 3RROA 3L84A 5TEVA 1NJ5A 3FCYA 4TXNA 4AMBA 3DMNA 4YR7A 4XYMA 5KYUA 2XE8A 4CKWA 1I4LD 3UOGA 5K0LA 2FPXA 2MYPA 3ZDYB 4EY7A 3MUFA 4O2RA 3M0EA 4M49A 4CFSA 1LPMA 4BGEA 3ILYA 3IO3A 3RODA 4KNVA 2V55B 1CHNA 3MBOA 3R24A 4FR0A 4D42A 2W43A 1N2BA 5P21A 4DMCA 5AVRA 2NP6A 2G0TA 1N5IA 1GA4A 4CM7A 4R2JA 1U2EA 4XWAA 3LHFA 2ALJA 1GN8A 2F3RA 4FKMA 2KQUA 4H0FA 4YAUA 4Y3UA 4S3MA 4FMDB 2GYYA 1PTJC 1E6EA 1X7GA 1APBA 4OBBA 5DRTA 2Q3MA 1OTHA 3FPCA 3G02A 4JP5A 3IQDB 4D8WA 4F2GA 2AX4A 4MKFA 1DG1G 3CCBA 4U6SA 4W1PA 4KE6A 5CG2A 2GNAA 4L95C 4Q12A 5IYZB 1W5FA 1XEWY 4RTPA 1DIRA 2QDKA 3NG1A 5COBA 1KQFA 4YJ2A 5K09A 2PRYA 2W6NA 4HDAA 2JJ2A 3KT8A 3PTZA 3GVCA 2ZJ6A 4JKYA 2BGJA 5CA1F 2JH3A 2W6IA 3OSZA 3PC7A 1UJNA 5INTA 4MDEA 3HV0A 1H4VB 2Z2JA 1WMSA 5C7LO 1KZYC 1TEZA 4YAFA 4BFLA 3LA6A 4ZFNA 4YRKA 2DCMA 2Q2OA 3B9PA 3A28A 3K5HA 3QVSA 1Y1RA 2J45A 4TUYF 3AIOA 2Q6TA 4EI8A 3AP2A 1IY0A 1AUPA 3M5DA 1YI1A 4H77A 3AJDA 5DW3A 1XXHA 2H5EA 1K7CA 1YQGA 1NYQA 1GNLA 1W30A 4M86A 3B1XA 4TKLA 5JRJA 1B0UA 3M3HA 2OMKA 3PNOA 4HGNA 3KZMA 2NZ2A 4LZPA 1HRDA 1C0PA 3N0XA 1YKFA 3L4BC 5E0KB 2OV6A 2FEPA 1WDTA 4RL6A 2B6NA 3NALA 1KBZA 1NI5A 1P60A 3AKCA 3CB2A 3C8MA 2I66A 5ABPA 3NAGA 1AZLA 4EKYA 1C9YA 3T94A 3LX8A 1AK9A 1C7JA 3I9NA 1FF9A 4G0OA 4HHEA 3CJQA 4BCBA 4H7HA 5L8VA 2BSXA 3NW9A 2VF5X 4FNMA 3ADBA 1OTXA 1AKUA 3T4EA 5D1NA 2PSFA 3ZWMA 5F7ZA 3RG8A 2LRHA 3N87A 4KDEA 3CE9A 4QEKA 2JLRA 2PL9A 4IHKA 1DIGA 4OQNA 4DBZA 3P2YA 4ZZ1A 4R71A 2FOIA 5IDWA 2VC2B 2PD4A 5F21A 2R6R1 4FUTA 2AZDA 4XI9A 1REQB 3E35A 5BN3B 5HKBA 4WXHA 4ZO7A 3U3JA 4D99A 1UBHS 2QM8A 4ND2A 3E6AA 3QLJA 3QBDA 3R7BA 4G63A 3RV4A 4LSZA 1KAEA 4OU4A 2FEAA 3WL6A 3IUBA 4CCSA 1LQ2A 3CRNA 3VC3A 5CA0B 5JS1A 4L0QA 4C78A 2HGZA 1QYVA 2XTMA 1OROA 2XKJE 4BKUA 4HS4A 1UANA 1XFDA 4A6DA 1JI3A 2OP1A 1A9RA 4M46A 4GI2A 4HQNA 4XVQA 2XT9A 4C88A 5BW5A 2ZSBA 3ZHCA 5KKNB 2E82A 4Y9DA 2YVLA 4LV6A 3SBEA 5JSZB 1E3MA 3HYSA 3RRFA 3S2SA 4CKBA 4XWTA 1C4WA 2KMLA 1SXJD 3BEDA 4CQLA 3N7TA 2PZKA 3UT5A 4BO7A 4ANFA 5EIHA 1ABFA 1E7YA 2PZ8A 1E61A 4CLEA 4DIUA 5BN5A 1A8UA 3AHFA 1J0BA 1HV8A 3DLCA 3G7SA 5LNK6 2HO5A 2P65A 1Q1BA 2HDHA 4WN9B 3M70A 4Q82A 3THSA 1Z2DA 3Q3CA 3GHHA 4M9UA 4PR3A 2B94A 4KTVE 4S12A 1O0BA 3HTXA 3NMUF 1IZYA 5HNKA 3JPWA 3TTWA 2FLWA 2YXLA 1ADGA 2D1FA 4D45A 2VYNA 2FJPA 4EHJA 1B0PA 2BMFA 4KQEA 5ALWA 3DA8A 2WLSA 3SF8B 1MZVA 4QDOA 5A7HA 4ZVQA 3EVDA 1GJRA 2RGXA 4XEHA 2DJIA 5E6RB 3ROFA 1B74A 5EJFA 4TYQA 5K01A 2Q99A 1DUVG 1W9MA 1XD8A 2UDPA 5ETJA 2DR2A 5BMOA 5ALSA 3TIFA 2FMUA 2P3LA 1U2TA 3EN0A 3W4JA 2PYDA 4JCOA 1XQ1A 5J58A 4Q4CA 4KCGA 5BSHA 3BJMA 4HAIA 2Z04A 3PNPA 3AR6A 1T0JB 4R9SA 1XZJA 2HNAA 1EXDA 1YRLA 3RAFC 2Y1CA 5JTUA 3MT0A 4Z4EA 2V6GA 3DAHA 4YFVA 4ND7A 3SHQA 1JIQA 1JQ3A 4FIDA 4NFSA 5JFOA 1U7XA 3ZI7A 1RAFA 4C7KA 1OB5A 4TS1A 1KI4A 2C2XA 3HRIA 3OQBA 2XW6A 3EQ9A 2A0FA 2WSMA 3IELA 2VJNA 3BL5A 4WGFA 3AYXB 5EXXA 5ERXA 1R8XA 2MR6A 5J1SB 1UQUA 1GPKA 1YJXA 1NGSA 2WF9A 3TTXA 4MHOA 1F4LA 1SC3A 1NQOA 1EAYA 2O7VA 1A1VA 2FN9A 1VIMA 4EELA 3U09A 1SC9A 3PXCX 4QDUA 5EHGA 4XD7D 4CE6A 5LN1A 5MN5A 1TZ2A 2PPLA 2CE2X 2EGHA 3DFZA 5ALLA 4G0VA 3OI7A 1W85B 4UEWA 5GGYA 4YMWA 1RLTA 3E8XA 1T34A 2FPIA 2OHHA 3LC1O 3SNHA 2Q2VA 4GI3A 4M54A 4P93A 2CF5A 3UJCA 2O3JA 1K6MA 1VJTA 3FHLA 3IQWA 4LTNA 4AZ0A 1N2SA 4YMHA 3ISTA 2FEMA 3GWGA 3RB8A 4LPSA 2OYSA 1YQ9A 3K8QA 4TWJA 1KH3A 2IBTA 4C43A 1FEZA 1JWBB 3H7AA 1D3AA 4NQRA 1EK6A 3TKLA 2F3PA 1G18A 1BXKA 1HPLA 1K66A 1M1NB 3ND5A 3VSEA 4A03A 1I7LA 5A02A 4QRIA 2VHJA 4ZOBA 5ALFA 3F8WA 2H1IA 4D0NA 2J0UA 1DWOA 1GADO 3OUUA 2P4HX 3RRZA 5CM8B 4YASA 3WBFA 3KXLA 1U0RA 1BG6A 2V74B 3ZU5A 3E23A 3ZX4A 1TU3A 1PUIA 2H17A 3ITNA 2QTRA 1C4XA 4WZAA 5AW2A 4IKPA 4V0RA 4PCUA 3F6YA 4FX5A 5JD3A 2GJKA 1G2QA 1XALA 2IEBA 4G5FA 3JAKB 1FDSA 1WTCA 4MKGA 3TAUA 5A2QA 4FEGA 2VZEA 1RS0A 1DMSA 4NKRA 3HSYA 2FUG1 3DR3A 3P45A 4E11A 3GLGB 1EXMA 3PC8C 3VFDA 3K9CA 4RO0A 1WDKA 2PK3A 3PNKA 5DCUA 1E3WB 1FSGA 1NHWA 2MSNA 1JAXA 3SICE 1T25A 3IAS6 4C0JA 3D4BA 2IC5A 1V6AA 4UVHA 5T8KC 3K1JA 3KQPA 3SS7X 4H16A 4G9BA 4HQKA 3NEYA 3TE7A 1RMQA 3DT6A 4AKHA 4YVFA 1L1RA 3VC2A 4A0FA 1Z35A 1T10A 3EQ8A 3JVIA 1MAWA 2Y0BA 3PEVA 4G41A 4LI0A 4DLRA 4YCMA 3DONA 2IVFA 1BD3A 1XRSB 5FA8A 1GSIA 1E2GA 5ENZA 1B2RA 4XR9A 4EPVA 2DR0A 4ENQA 5PNTA 1ZHFA 3F2VA 3KAQA 3RHTA 4WKNA 4LDNA 1SBCA 1X1AA 1EK2A 2G9VA 2WT9A 5C7OO 4M7WA 1TIPA 2IPLA 3BS4A 2P7IA 3UENA 5JALA 5JISA 4ETNA 3W3ZB 3WP0A 3VHLB 4FCTA 4MI3A 2HMWA 3REOA 3OCVA 5C1DA 3QUQA 1EINA 2DY1A 3DAFA 3IQIX 4RCZA 2QN9A 2JBWA 2IU6A 5JBQA 2VJOA 3U9SA 4AO7A 2MSEB 3A9SA 1PR2A 1MFZA 3VZRA 5LQUA 3UPUA 4E33A 1DO2A 1X7WB 2A59A 1ZSNA 1W29A 2V9PA 4IIYA 4MQMA 5CH5A 4NMLA 4B4WA 3IMFA 3MQFA 5EP3A 4CIXA 3VZSA 2PXAA 4JWKA 4LOKA 5BOSA 1ZI6A 5H9WA 2AE1A 4LJSA 5DXFA 1YDMA 3BGWA 3EFHA 1AZSC 4WFQA 2XOEA 4ND1A 3VDRA 3PTLA 1RYNA 3C48A 1UC9A 3ZHRA 4Z9BA 3UWSA 4CMIA 1FS5A 2YASA 5KEIA 2QI9C 5HTKA 3PRJA 3JVUA 3MCUA 2G08A 1FFXB 1NZJA 1N9GB 1QH0A 1GUBA 2Q0HA 2ZOSA 3DEFA 3EVGA 3IPLA 4C6TA 4MR7B 4JK3A 1C8BA 3O2SB 3QVOA 2XAUA 3NDJA 4IXDA 1G42A 1KJZA 1SZJG 4OXKA 4W7SA 2PMEA 2XB2A 3H42B 3L18A 3MJSA 5ALRA 5CD9A 1U98A 1S7CA 1TJ5A 3TQTA 3U6BA 2DWPA 3A1SA 2NUPA 4GI1A 1DX4A 4N5LA 4NBUA 5DYWA 3U4MA 4FQ5A 5D7NA 1FVFA 3ZC3A 3IQZA 4K6HA 3H2ZA 2H85A 1E5XA 4KKXB 2K87A 2HWXA 3KXPA 3V3KA 4UULA 4YAIA 4O0LA 4JL5A 2FW0A 5AVXA 3I2IA 1CJKC 4V24A 1QNFA 4PZYA 1N8SA 5E7MA 2JFZA 3PNMA 2AEFA 4BJ6A 3V1NA 1UMCA 2JLSA 2WTBA 4RLFA 4WOPA 5LYJA 3O94A 3DHNA 3MTAA 4N3NA 1UBMS 3SQNA 2VWHA 3K9QO 4BRWA 4CCWA 3ENQA 5HK9A 1ECGA 5K9ZA 2CB9A 1XEXB 1ISHA 3EC1A 1L5QA 1XJQA 3LZDA 3M2PA 1OBHA 3N8GA 4TMXA 5IDVA 2R25B 4PZUA 3K70D 3KZ1E 2WVHA 2D5IA 3VPSA 4MV8A 5HYVA 1TYDE 2ID8A 2C54A 2WT8A 3E05A 4ZCLA 1HE5A 4B4OA 1U6IA 1HQYE 1B6RA 3WYGA 3PLNA 1GNQA 2NGRA 1JR3E 1GPNA 1J2YA 1YR7A 4FVTA 2NSHA 4RQBA 5FOSA 3KV1A 4NBRA 2GZ1A 2Q5LA 2EX0A 1QZUA 3MCAA 3PK0A 2OO5A 1QGUB 2DLNA 3E81A 3KEMA 4NIMA 4NENB 5U4QA 1CUSA 1VHWA 1T4CB 2FFRA 2JI4A 1N5OX 1G291 1XTKA 1JI0A 3AB8A 3PQEA 4RGBA 1P1JA 3KPUA 3VV3A 1E8NA 3FDJA 3GH3A 5HFJA 3AOEA 3HH8A 3S1SA 2RGNC 4QBTA 4O5OA 2ZJ7A 4FYJA 1A5SB 1UBLS 1USWA 4ZYWA 5AW7A 1ZS9A 2NU8A 4TLCA 4RDCA 5JAQA 3EGEA 2I87A 4F86A 2J07A 2MTBA 2QN6A 4TSRA 3RUHA 3GD5A 3C4JA 2A1TS 2JIPA 1WKVA 1EWYA 3EIOA 1HDZA 2RI0A 4BNZA 1NF8A 1SCQA 4P22A 4OLAA 1Q95A 1YZ3A 1ORTA 2WIJA 1MQAA 4M6WA 3I6IA 4OH7A 4B6RA 5AD1A 5IK2D 1UAGA 4IYRA 1XIVA 3FETA 1P1CA 2QMUA 5LQKA 1Q17A 4LRYA 4HT3B 1Y5NA 1B0ZA 5LIRA 3HJHA 2HTFA 4LAFA 3DVRX 2NZYA 4LCEA 3NHMA 4MUGA 5JI2E 5KQGA 5D5QA 3DDWA 1QU2A 1BWRA 2DPXA 1XROA 1UT5A 3PL1A 4URFA 2YIMA 1KVTA 1GKIA 1OI3A 3HA7A 4KBFA 3K16A 3EVFA 3TDKA 4CTOA 4JI0B 1L5KA 1DDIA 1H42A 2YZKA 5DJ5A 3BXGA 3EUEA 3KUDA 1V71A 5T4BA 3HE3A 4O02B 5LWQA 4MGKR 3VSBA 1MPXA 3C3WA 3F3KA 4PRYA 4G0WA 2R66A 2I3DA 4ZAGA 2A7XA 1FYEA 2QY9A 4BEWA 5C8DA 1R0LA 3EQ6A 1G6HA 2CMDA 3V8MA 4DYHA 5BV8A 1QLWA 3V8PA 4C0BA 4RTJA 3COJA 2DF8A 2X4DA 3WDMA 3NBXX 1KR2A 1W36B 1K8ZB 5IDYA 2Q6LA 1KDRA 1XU9A 1LBIA 3HXPA 5FH9A 3BCSA 4ABYA 3GJQA 5BWLA 4IO0A 1XQVA 4OHYA 2VTBA 2R8OA 4N7BA 2FR1A 3S6JA 3VR4D 2ZRNA 5FBWB 1T9HA 3HLKA 1U9IC 1V5EA 2BFOA 2JLWA 3FN4A 3V1KA 1K9VF 3SXUB 5K6TA 3W9YA 2WMDA 2OOSA 3TQFA 4Y1GA 2G5PA 1C4KA 4QSHA 2EL9A 1WVIA 2Y66A 5IFKA 5EKDA 1YO6A 4DTCA 5FNZA 1HLDA 4NBKA 5EKUA 4DWOA 2PUEA 2W70A 3RK0A 2ZRGA 1QBKC 1MRSA 2VDPB 2GUWA 1NW3A 2I2FA 2Q29A 2OHXA 5AHRA 3VHRA 3JQAD 4EYKA 1TUBB 1DFHA 4J3JA 1QVZA 4QUIA 3SVTA 2Z8YM 2CV1A 3L92A 3DBHB 4ZVVA 2JEYA 2P69A 2FZVA 4XVUA 4S2UA 3OUTA 3DTVD 3I1IA 4O4IB 3KWLA 4HB4A 5D1HA 5I9IA 5IVKA 3EXG1 1JHMA 1U2GA 4BB5A 2X4GA 4C4ZA 1O8BA 4ZI5A 3MB5A 2B9VA 4MA4A 4NY1A 4YO8A 3M83A 1N0WA 1ZOSA 1QTRA 1XCLA 1XOIA 2A5JA 2YWHA 3BRQA 3MPOA 5DXAA 5H3CA 4I4CA 1TC1A 1FP6A 1Q2XA 4ZCMA 1LS6A 3VH3A 3H6GA 1DOHA 2DHCA 5DI3B 3D9QX 4BO0A 4QLBA 1KHHA 3OIVA 5A9SB 1IZZA 5ARDA 2WQ7A 4KGZA 3SFVA 5BWNA 2FPMA 1SVNA 1Y1SA 5HKOA 1KDZA 1MEOA 3HDTA 1B1AA 4TT3A 5L3ZA 4JUAA 5A71A 3UJ9A 3UXEA 5C2JB 1LFDB 4U5XA 1W4CA 2FHPA 4UOZA 1JKFA 3BB3A 1PNRA 2XLCA 1ZEJA 2B83A 5FWAA 4EB3A 2GK7A 5HGXA 3ZDDA 2Q3CA 1XZPA 3PA6A 5HR5A 2RARA 4OHCA 1FP1D 2I03A 1UK7A 4UDNA 3L46A 4ZQFA 4K3UA 2ZRBA 2ZSAA 4ERNA 3L3BA 4I5FA 4TV9A 4LJRA 1T1RA 2ZAMA 1M1YE 2GDJA 2NO7A 4FEAA 4FGWA 4I8IA 3UAWA 4AYWA 4O08A 1ULAA 3I34X 4FFSA 4OLHA 1GKLA 3N8NA 1NUSA 1NVXQ 2AI1A 3P4YA 2Q7OE 5TY0A 4KI7A 1NQWA 5LA6F 3T0FA 1RCTE 2ZIWB 4YGXB 3AKYA 4EF5A 3E3OA 3CSUA 3DFMA 5J2UB 2ZXEA 3IV6A 2JGDB 4V0OA 3WFJA 4JVMA 2HF8A 3OIWA 4HGQA 3L1UA 4U7GA 2DTXA 1SUIA 1B26A 2VNIA 3GROA 3VHQA 4G09A 3IR5A 3GLIE 1R8JA 1OLUB 4IEEA 1RC0A 3KX2A 3WLAA 5CG1A 4QU8A 1ZUWA 2ZUSA 4F7DA 3URKA 1YQQA 1NASA 2C9YA 3DBRA 1BFUA 2QLTA 3GJSA 5FWYA 2EIHA 4FS8A 1EXVA 1BKDR 4EY5A 1HG0A 1PQ4A 3ZDQA 2AYYA 3UTDA 3F7MA 4EFMA 5JS7A 5DNYB 1EEHA 4H7KA 1Z2NX 1XJWA 3DTYA 1YRWA 4G1CA 4CV1A 3DEYX 2AIRA 2C5FA 3KAJA 2J9RA 3QX8A 4HQ6A 3RU7A 1SIBE 3U60B 2A1IA 2B82A 1GKKA 4UTOA 4H3HB 2BR3A 2WZBA 1BGXT 2QSYA 2QEQA 1JDUA 1CG6A 2HDOA 5IUKC 7MDHA 4OHXA 4FW9A 4UEJA 4CIAA 3CVWA 5B58T 2WJVA 4LYAA 4XAQA 5BRAA 1QGYA 3LL7A 4EGJA 2NIPA 3TZQA 4QNRA 2R3SA 3ZQ4A 3CF4G 1QANA 4DLNA 5DMXA 1LLUA 1EFKA 1U0SY 4KZKA 4MYSA 4M1SA 4Q21A 1K7FB 1PO7A 2VSFA 4R1NA 4LDQA 1KMHA 3WLOA 4F9EA 2EGUA 2I1QA 2BYTA 1BN6A 1EHYA 5EAIA 4HQRA 4DXDA 1E32A 1YR9A 1SQ6A 3F7NA 4PYNA 4DBVO 2IYPA 2XDQB 1VSQA 1TJPB 2EJVA 1U7HA 1GT91 1Z4NA 1RXYA 2PS3A 2XMCA 3QMVA 4RVGA 1J2JA 4IGAA 4RF5A 4TTAA 4DYVA 4M1WA 4UPDA 5CFRA 3UPTA 3DKIA 4P80A 2BCGY 2D5LA 3OZAA 3BM5A 3NH6A 4X91A 3TW0A 2FCAA 4K9NA 1EMDA 3L8MA 1EXWA 1A9YA 1LPAB 2R5NA 1U8TA 3BIFA 4S1OA 2HBQA 4GM1A 1FU8A 2HJGA 3C7CB 3ZH9B 4ENTA 3CTMA 1WV0A 2Z5GA 4IVRA 1CNEA 4X1IB 4F7WA 1BWQA 5IPFA 3NM5A 1I2CA 1WPXA 1C3EA 2IEAA 2Q5JA 2JZOA 5SYNA 3SR0A 3CRW1 4DLZA 3LDGA 5JY1A 4LK2A 4I50F 3ZY4A 4P82A 3M6FA 2ANCA 3FVWA 3L6OO 2ZI3A 3U3ZA 3ZTWA 1MEJA 1HYGA 1JU4A 3OJWA 3ZE8A 1KK1A 5KNDA 1YHZA 4PZLA 4PONA 1FA9A 4TROA 1RJWA 2A3NA 3RAJA 2EZ4A 3LXXA 4YRZA 4F4FA 1C3JA 5C8ZA 3KPYA 4UNSA 3CEAA 2C5LA 1IEVA 2PRSA 2CGEA 3GNTA 4Z99A 4PN7A 1FJGB 4LNUB 3N0WA 4RADA 1NNSA 3HPQA 1UZNA 1V3VA 3ESZA 4U2KA 2CVPA 4MVJM 3BD9A 2VFAA 3A4IA 3N3BC 3EPKA 1HFJA 3NFYA 3WOVA 4DANA 2WJHA 1NTRA 4PAGA 4PLGA 5F3DA 4D8YA 1JLLA 1VL6A 4RAOA 1NLYA 1IPEA 3TVTA 3W5SA 3X1JA 4PYKA 3BCUA 4UOEA 1H2AS 4XPIB 2CHVA 1KYTA 2VDRB 3DL7A 5FNVB 3VPHA 2ZB4A 4TYYA 1RI4A 3EMVA 3A9CA 3LHKA 3DOFA 4P4UA 2OHJA 1R5BA 4DIKA 3UJAA 2QJRA 1FFYA 1OTYA 1Q7GA 2QHXA 2QL9A 2R48A 3PPIA 3ZE0B 3KETA 3I3SR 3QYAA 2ZUVA 3IAFA 1PG0A 1TTHA 5DX0A 1FRVA 2HQBA 3I8SA 4O4LA 3A6ZA 3KYCB 4EUFA 4RVUA 2PD6A 1H6AA 5B5SA 3LFHA 4P58A 3A1WA 1VGQA 2H29A 3HLYA 4O2AB 4R2HA 2G88A 3KC2A 2A2ZA 3OJLA 1Z0IA 5IM4A 1IK4A 4MWTA 2QTCA 4QICA 4I6EA 4PEVA 3U2QA 1H4SA 1VHTA 4F4HA 1Z06A 4J03A 2FPLA 4C4OA 5I7OA 2RONA 2NXCA 1JAHA 2O7NA 2UZAA 1P44A 4EY3A 5I7UA 4KXMA 5TQVA 4G56A 1KEVA 3T7SA 4O2BA 1BMTA 4QEZA 3ZNPA 1ZRHA 3KZCA 3HKBA 1A5AB 3KOZA 1QIGA 3TQRA 2DFTA 3BFJA 4ICIA 2IXDA 2P62A 4LQLA 2NVOA 4CVNA 4CM8B 3LXUX 4DC1A 1SNYA 2RGDA 1SC1A 3EXHA 3BHMA 5DGHA 5CM9C 4MUFA 3E1GA 4HLDA 4L15A 2WKRA 4JJAA 4KR3A 2XA9A 3LX6A 4LECA 3GEHA 1H6CA 3CF6R 2OT3B 2G36A 2O2DA 4ML3A 3EGOA 1D9XA 5F5XA 4BBPA 2DB3A 2Q4OA 2ZYRA 3IUQA 3QU4A 3SJAA 2RJ3A 2LCFA 2VT6A 2DMRA 3FCOA 3IPAA 4CKWB 5KYUB 4BZZA 5I7VA 3SIWA 3VKVA 1M3SA 4ZALA 3DLIA 2YYSA 2GPNA 5HQ3A 1UFKA 2W37A 1KP9A 4Z5XA 4YRRA 1RJDA 3ELBA 5DEOA 1R4AA 3PUHA 2BTOA 4B5LA 3H5NA 2ONJA 1O4WA 1TQHA 2J9ZB 5EVJA 2GILA 1JHXA 2REOA 2C59A 5CTAA 4YCNA 2LIPA 2C4VA 2V65A 1SBNE 2PLWA 1OFUX 4FKBA 2Z83A 3LKDA 4JQSA 4L85A 3ZH2A 2VAXA 3OOWA 3C6QA 3KUCA 5H9VA 3B53X 4GOLD 4IIBA 3ZY5A 2QUBA 1I2MA 3MFQA 4CQMA 2B61A 5AJZA 2AYZA 3U0VA 4AJOA 1QU3A 2JEZA 1RYDA 4Q6BA 4DARA 1TTTA 3G0BA 4RMNA 4BBJA 2J9XB 1KSHA 9ABPA 3ITEA 4H08A 4DDUA 1AUVA 2WD7B 4ILEA 2C78A 1Q1QA 2O8EA 3CEJA 4Y7DA 1PIWA 1W0KA 2DVMA 2IHJA 4KDRA 4RJJA 5JZBA 2E5LB 2KE5A 3ZCTA 1XVVA 4NX2A 3Q9LA 4YJ2B 1PE0A 3IIKA 5I9SA 3MRVA 4GLBA 1MU0A 1NR1A 3TSZA 4ZCTA 3O3MB 3G68A 1TQ6A 5CD1A 3A3PA 3HLTA 4XB2A 1O7JA 2CFTA 4A6EA 2OCAA 1TM7E 3X1XA 3K72B 1P1HA 5ALGA 1OXUA 2CZQA 1N2XA 3ORFA 5B7QA 1YDWA 2OCGA 2ZVJA 3Q8XB 5HX7A 3LF1A 1Z08A 1X77A 2EYQA 1IC6A 4GBGA 1NP6A 5H0IA 5T3YA 2Q5FA 3PVZA 1XXHB 2ONCA 2ZQYA 1AM4D 2BMJA 5FPPA 3ZX5A 2RHHA 1JMYA 1G8JA 3B89A 2F43A 4YMIA 3RTBA 2ZUCA 3JZAA 4ZAFA 1EFPA 2ZK7A 4H15A 4HC4A 1ETHA 4O8CA 1JT2A 1I01A 5KQPA 4L5CA 1G8PA 4NCKA 4A8HA 2BZGA 2QSUA 4HTAA 1ZJ5A 3ESRA 5FQNA 2QAGA 4IKEA 2YWCA 4L02A 5UKDA 2PSJA 4BRZA 2W2QA 3KSZO 4PO9A 4LZJA 5EHNA 5A4KA 3F96A 3W06A 4JY7A 3VNSA 2J9GA 1SPXA 1T5BA