2HK8A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
266
Chain Sequence
MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords Shikimate dehydrogenase
total genus 88
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk8A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk8A01
1M6HA 1YQGA 3L4SO 2GR9A 4WLFA 4IZHA 3H5AA 1HL3A 2AE1A 3DOOA 1NR1A 1XDWA 4NU6A 1EFKA 3ZV5A 4ALNA 4BO6A 3PRJA 1SCUA 1PJQA 1M75A 1E6WA 1PQWA 1XQ6A 2TMDA 1TI7A 2DU8A 4CM9D 1JU9A 3K30A 4CM5A 3JQAA 2B4TO 1Y9EA 4JQCA 2J8ZA 4IDGA 2GNAA 4A5OA 5GZ1A 1Z7BA 1SB8A 3PHHA 5CDSA 3KO8A 1X14A 4TRJA 4R1SA 3DZFA 1XIVA 5L4LA 4GBJA 4D44A 4HFJA 1W0CA 5F5LA 4IM7A 2HJRA 2A92A 1U3UA 2P2SA 4MVJI 1PJSA 2VHWA 4RVHA 1L1FA 1KBZA 3ZU3A 1EUDA 4HWKA 3RAJA 5BSHA 3SC4A 1R12A 1YVEI 4PLCA 4HUJA 1TB4A 2WD8A 3SC6A 1SEVA 1Y81A 3F1LA 3GGPA 4M49A 2Q2QA 2B5WA 1GZ6A 1G6KA 3OFSA 4GWKA 2Q1SA 3GPDG 1EDOA 3RQSA 1S6YA 4QECA 1EFLA 1A7AA 1JKIA 3KB6A 4WE3A 5G0TA 3AOEC 3F47A 1OC2A 3D64A 3NYWA 4IMRA 3OJFA 1P0CA 1NFFA 4XGNA 1FDVA 5JY6A 5EL0A 1EQ2A 5DCYA 4OKNA 1F8FA 1DOHA 2NQ8A 4ESOA 1X0XA 3MJ4A 5LDHA 1UH5A 3GH3A 4YDRA 5DBFA 1HT0A 4AVYA 4N5MA 2X58A 3JQ6A 2B4QA 2Q50A 1PL7A 4GMGA 4KDEA 4D43A 2B69A 3TDKA 3I6IA 1U4OA 3NV9A 4A27A 1Q0HA 1VLLA 3DEYX 3PK0A 4IBOA 4Z3DA 1KETA 4R9RA 2Y67A 3DQPA 3EGOA 3H3JA 4CLHA 1H6AA 1WZEA 3DZKA 3TN7A 4L9RA 3O8QA 3GUYA 3IJPA 2ZB3A 1Z75A 3FSRA 3U4HA 3ONDA 4E2YA 5CFZA 4YJHA 2C5EA 5GZ6A 4CLDA 5T8KA 4NI5A 4PLWA 1P9LA 1YBVA 1PJTA 4RF5A 5JDCA 3KXDA 1VKNA 5ICSA 5K6AC 1U2DA 3OIFA 3ROQA 1MGOA 1P45A 4YCAA 3S8MA 3L6OO 2GDZA 1P33A 4E21A 3K9QO 1LU9A 3U5TA 4GX1A 4YAJA 5AXCA 1ZZEA 2G1UA 3ZHYA 1AE1A 3F5QA 2Z95A 1DIRA 5AXBA 1YOVA 1QYDA 1YWGO 3WMWA 1AUPA 2QZZA 1DAOA 2IZ1A 1Z73A 3AM5A 1AXGA 1K6IA 2G0TA 2D3TA 3A28A 5K0ZA 3AK4A 3BMNA 3RUHA 2EEZA 5C7LO 1ZK1A 5I7EA 4RCVA 4W7IA 4BUCA 4CLRB 2VWGA 4YJFA 1U28A 3GFGA 2BFPA 4CLOB 2Y1CA 2E6UX 5TJHA 2G82A 3A14A 4BKQA 1F14A 4ZGWA 2E49A 2DFDA 4CLOA 3Q3CA 4BMVA 3JCZA 4IJUA 3IL2A 1D3AA 2B5VA 3OQ6A 1YDEA 2HK9A 4WK6A 5A4DA 4FFPA 2ZCVA 3DTYA 3G3EA 3W8EA 1JLLA 2P5UA 3DONA 3GZNA 4K1LA 1I5RA 1BXKA 4CV1A 4LVUA 3OJOA 4MKZA 4RVSA 4ND5A 3O38A 4B7CA 1DC6A 2HLPA 3Q6IA 4JBHA 1M66A 3FNGA 3GRKA 1YL5A 5T67A 1SOWA 1PQUA 3GMSA 1GUYA 3LDHA 4FJ0A 2EP7A 3WGZA 4CM4B 1U3WA 3BMOA 1B8VA 2C07A 4GKVA 2NU8A 3A4VA 4B3HA 1C1DB 1SOVA 1LC3A 5T8KC 3I9MA 1YL6A 1E3JA 3GEGA 3UCEA 2O4UX 3OBBA 1CQJA 4A73A 1PJLA 4CLXA 5L9AA 3PQDA 1LXCA 2G17A 5DCUA 3NJ8A 1B2LA 4M54A 4BB6A 1BG6A 4CR7A 1QLJA 4LMPA 1OAAA 1KC1A 1YB4A 1PJBA 1QV7A 3B20A 1NX6A 1E6UA 3RD5A 1Y5MA 3RSHA 1ZO8A 4OQYA 4TRNA 4CQMD 4FFRA 4OAQA 1WDMA 1CJCA 4GL4A 4BO9A 2PLAA 1YB5A 2A35A 1VL8A 3NDIA 1T1SA 3KM0A 1EUCA 4M55A 1PQPA 4YJFB 5A1TA 4H16A 3S55A 4BNZA 2G76A 3D7LA 3RC1A 2Y99A 4E0BA 2QRLA 2UV8A 1EBUA 1PIWA 5DF1A 5EPOA 4AJ1A 3OICA 3QY9A 5G4KA 4U5QA 4DREA 1VI2A 2YFHA 4TKMA 4YEDA 2H9IA 1V6AA 2HCTA 1YOVB 2NU7A 4J1TA 3ZHZA 4CM3A 4FFMA 1P74A 3RJ9A 1GQYA 2C7VA 2HRZA 4R9SA 5AYVA 1OI7A 1U8FO 3C3XA 5GY7A 3ABIA 2JFGA 4B4WA 4WECA 4QFDA 2J5KA 4ITUA 4PG8A 1I3NA 3IP1A 3EY4A 1ZMOA 4FC6A 4YA6A 1RYDA 4J0EA 3ZWPA 4BHTA 8LDHA 4DPMA 2E4AA 4E3ZA 2YV3A 1XLTA 2VRCD 1T2CA 2PD6A 4GX2A 3WGQA 4GH5A 3WYBA 4DMMA 2IZ0A 4J90A 1PGNA 4OXNA 4KQXA 1X15A 1DXYA 1GQ2A 1V9LA 2FRDA 3C1AA 3I9NA 5U4QA 5TT1A 3PJFA 3KHUA 4NJMB 2H63A 4O6VA 5F5NA 4BGEA 3GVCA 1E3WB 5C7IO 5CG1A 2PH5A 4NFHA 1UXJA 1ZCJA 4EBFA 4NFSA 2FZEA 3KLPX 3VH3A 3WBFA 4GSLA 1PGJA 1MC5A 3ANNA 1TLTA 1E92A 3NT5A 1X7HA 5TF4A 1DHRA 4XQEA 4YT8A 4FGSA 3L9WA 1BXGA 1ZVMA 4R68A 3LZ6A 1KY5A 4AJ4A 2O3RA 2HK8A 3CE6A 3KTDA 4JX8A 2QYSA 3RVDA 1VPDA 1NQAO 1YJQA 2RIRA 3BMCB 4PFJA 3ZWAA 3GPIA 4B8ZA 3UICA 4N18A 4CM8B 1IL0A 3RBVA 1PTJA 1IUKA 1JDJA 2CZCA 1MXHA 2QIOA 3V1YA 5A04A 3OETA 4QXMA 4Z9YA 3I9LA 2ZQZA 2Y0DA 1CETA 1GV0A 2PZJA 1QV6A 3WGHA 1NP3A 3ZWWA 5AQ1A 2H6EA 3Q1LA 1UZNA 3AFNA 4Q3DA 3DHEA 3UXYA 4IGFA 2C0CA 3IIEA 2AQ8A 3GY0A 4W7HA 2GZ3A 2X22A 2DBZA 3UFXA 2JD0A 3AW9A 1UP4A 3CUKA 4IXWA 3VPHA 2DT5A 2E48A 3W4KA 2VYNA 4MP3A 1OC4A 4UULA 2GZ1A 4DIFA 3MJTA 4NBVA 3TOXA 4CMKA 1DLJA 1HE2A 2HQ1A 1LLQA 3QWAA 2BGKA 3C7DB 4YAKA 2PKRA 4J4HA 4O63O 3SBOA 3IUPA 2OGUA 1ZSNA 3OA2A 3JD2A 3L77A 4E6PA 1TA4A 1ZFNA 1UXGA 3RC7A 3TL3A 5IXYA 4Y98A 2SCUA 3VZSA 4L75A 3JQ7B 4JIGA 4PCVA 2RH4A 3Q11A 3COSA 3TFQA 1QMGA 3H5NA 1DAPA 3PLNA 1HSZA 3JQAD 4DYVA 3GN1A 3JQEA 1Z82A 3OJ0A 4BO5A 3ZN2A 5JC1A 2CF6A 2PGDA 1KERA 3JSAA 2AQHA 1DEHA 4BNHA 2Q4BA 2FZWA 4OSPA 3DHNA 4I1IA 5L95A 1R15A 4HX5A 5JCJD 2FR1A 1CDOA 1LLUA 1KC3A 3AUTA 5K9ZA 3QWFA 1Q0QA 1WMAA 2PZMA 4YJDA 3WR5A 4AJ2A 4CQLB 3ETDA 4BNIA 2WEKA 1I24A 3BAZA 3GAFA 4CQMA 4OOEA 2HRBA 3PHGA 3PI7A 1DC5A 2FSSA 2JKVA 2RHCA 1NHWA 5CP8A 4LMRA 4UUNA 1HEUA 4QO8A 2XOXA 4NJMA 3H65A 3GDGA 4UEJA 4LVCA 4BNXA 1V35A 4QO7A 3LT1A 3F1KA 4Q9NA 2GRAA 1HDOA 3H8VA 5C5IA 3RC9A 5A9RA 1AXEA 3GVPA 1K0UA 4WNIA 2ZJ1A 1DRUA 3CSDA 4EUEA 1KOLA 3AUUA 3JD1A 4D0SA 3F4LA 1ZSVA 2GYYA 3INRA 3K96A 4OSOA 3VVCA 3DAPA 2EWMA 2FOIA 3K2BA 1C0KA 1A4IA 5DT9A 2YUTA 1EUZA 3C1OA 4NIMA 4ID9A 4NU5A 1F8GA 3HFSA 1NASA 3VDRA 3AY3A 3TZQA 2PV7A 4QSMA 4PZDA 1HE5A 3VZRA 1UZLA 1Y8QB 2FPPA 1FJHA 1VC2A 3ICPA 4XB2A 5I9NA 1DSSG 3HHPA 3DO5A 4M89A 2WYWA 1HDZA 3CTMA 1X13A 4MINA 4DLBA 3QRWA 2GASA 3N74A 2NU9A 1B7GO 3EVNA 4MJLA 1IZ0A 2OHXA 3R3SA 3O4RA 3PZBA 3DDNA 2WE7A 4BGVA 2QQ5A 3LC2O 2OMEA 2GLXA 3RKRA 1Z45A 1U5CA 4UEKA 3TJRA 1TT5B 4RPJA 4RDIA 4E5NA 1P44A 2BMAA 4IXTA 3RJ5A 2OUIA 4DC0A 1I33A 2V6MA 3AWDA 4YVFA 4DTIA 4BNUA 1BTOA 1ZJZA 2QRJA 3DMTA 4O59O 4CM6A 4HNHA 2NQTA 4FDAA 5A03A 2IXBA 2WM3A 5AXAA 3WMXA 1B16A 4FW8A 3QWHA 3ONFA 2IEBA 2VYVD 4F45A 5A9TA 4R5HA 3UOGA 3AUSA 1KVQA 4XR9A 5G2OA 4K28A 3GNQA 3CIFA 1ML3A 3Q2KA 2Z5LA 3L4BA 5JLAA 4XYLA 1T2DA 4CM4A 4KUGA 1L7EA 3HFGA 4IINA 4NMHA 3NTRA 4TZTA 4CJXA 3WGOA 4H3VA 3WBBA 3RU9A 1O9BA 4WJZA 3OEYA 5T5QA 3SJUA 4OH1A 3KV3O 3HG7A 1PSDA 5JW6A 4XA8A 1K89A 3RWBA 1HZZA 2D59A 2IE0A 2QW8A 2JL1A 3K6JA 4AJIA 1Q1NA 2YHIB 4D3SA 4RPKA 2XXJA 2OBNA 3WDSA 1I8TA 1E7QA 4CQLA 3ANMA 2I5PO 4DQVA 4KTTE 2O48X 5L7YA 3ITDA 4LCEA 4C7JA 4RV9A 2WJPA 5L40A 3CXRA 3U4IA 1DLIA 1P1HA 1EK5A 4BV8A 3PQFA 5IFLA 4YRDA 3RFVA 4L76A 4FFNA 2R2GA 1HE4A 2Y1GA 4E2XA 3H2SA 1RYEA 2VNAA 1LDNA 5KJCA 3ENKA 3TFOA 4ZRNA 5KKAA 2DAPA 3FHLA 3IQDB 4EZBA 5BR7A 3WICA 1GCOA 3WG9A 1R0KA 1N7HA 5CDTA 3PVZA 4CL3A 4BO2A 5AXDA 1ADBA 1XSEA 3FPLA 3PJDA 1J6UA 4KWIA 3FBGA 2B83A 2P9CA 4EDFA 4OKIA 3DZBA 3JYNA 1DJNA 3GVHA 1D1SA 1WXDA 1NAHA 5JO9A 3JQ9A 5AVOA 4IQGA 5HWSA 1ONOA 4UVIA 1EVZA 1NWHA 3L0DA 3KEQA 2WYVA 4KDFA 1CRWG 2D4AA 5C3MA 2O50A 1EBFA 2VUUA 4IIVA 3WGIA 3KSDO 3PLRA 3PYMA 2O23A 4RLHA 1MG5A 2X0RA 1MP0A 3L6DA 2EKPA 4GMFA 4IZIA 3V1UA 3VPGA 2J3JA 4BB5A 4NQZA 3T7CA 3A9WA 1U9JA 2IODA 4QX6A 4NDNE 4IPTA 1YONA 4U0KA 4PLYA 3WJ7A 2FPIA 2VHYA 2AQIA 3E9MA 2WTBA 3HSKA 5L4SA 3G17A 4OMUA 3TPCA 4XJTA 2O3SA 5CAEA 2FSVA 4BO3A 4EGFA 4K6CA 1E3SA 2BFOA 4JCOA 1ZK0A 3W6ZA 2PZLA 3C8MA 2X9VA 2D2IA 2DPGA 3H9GA 3F5SA 3CZMA 4DC1A 1A9ZA 2HMTA 3DBHA 3STHA 5I7VA 4PG4A 3QWBA 1BXGB 1I10A 5THKA 3EC7A 1NXQA 1ONPA 2WD7B 2NVWA 1WVGA 3JYOA 1KY4A 4RGBA 3NX4A 3RUEA 4BL5A 3ZWYA 4AJPA 3VAZA 1ZEJA 4IDBA 2JHGA 2GGSA 4WASA 5CDYA 4GVXA 3UHAA 2X5KO 3ETEA 2Y66A 5G0UA 1IZ9A 1EZ4A 1NPDA 5L51A 2VN8A 4Q3BA 4FBGA 5JAIA 3ZU5A 1T2AA 4EUHA 3K92A 5COQA 1FDUA 4BNKA 1LLDA 2J5QA 3NGLA 4J1NA 3TQHA 4Y6SA 1N1EA 1BW9A 1SC6A 2GPTA 5HM8A 5LDGA 3L6EA 3G49A 4CUZA 1NVTA 5ILGA 2YV2A 5TJ9A 1PWZA 1LX6A 3GGOA 3ON5A 3CINA 4ROSA 3EDMA 3KSZO 4BO7A 3LVFO 2V6FA 1HYHA 1RKXA 5G0WA 1BDBA 4TWRA 1IPEA 2VZ9A 1HDGO 2O3TA 1H6BA 1Q0LA 4MKRA 4BNTA 2VRBA 4E32A 1I36A 4YT5A 1IULA 3BHMA 3LLSA 7ADHA 5G4KB 3H9EO 1QORA 4CUJA 4RPGA 2JCXA 3ZH2A 3KVOA 3QVXA 3QVSA 1LDGA 4IJKA 3QV1A 3IP3A 1A72A 4XEHA 2RHRA 1JTVA 3DOJA 4YACA 2ZYDA 4P8RA 4AJHA 5JSFA 3Q9NA 2YHUA 3N58A 1MFPA 4Q3EA 3PJEA 1XYGA 3TWOA 4RQTA 3JD0A 2UVDA 4ALJA 4YR9A 5I8WA 4N7RA 5AOVA 1NVGA 2NTNA 1YGYA 1K5HA 4Q3AA 1NVMB 3GNSA 1DIAA 1IYZA 1I3KA 2VHVA 3G0OA 5EMHA 2QYTA 3V5NA 6LDHA 4D45A 4JN6B 3O9ZA 1JWAB 4IJVA 2W2LD 4J9VA 1ENZA 1BDMA 4XYBA 5A5FA 2P5YA 3GF4A 3FNHA 3E1KA 4N5NA 4P38A 2JFFA 3K73O 1Q7CA 5FI3A 3WIDA 1GPDG 2ZTMA 4YQYA 2Q1TA 5ADHA 1PWXA 1GZ4A 3LC7O 1OOEA 2YHIA 3LT4A 2HMSA 2Y1DA 3BMOB 3ZWNA 1XKQA 3U4CA 2QX7A 4GGPA 1XU9A 4J91A 1PGOA 1D4FA 3MTGA 4YWJA 2EIHA 5CHEA 2B4RO 4WKGA 4I5GA 4XYMA 3RBXA 2I99A 1AN9A 3M6IA 4E13A 3C24A 1O8CA 5DOVA 3QVOA 3VPXA 1Q7GA 1VSUA 2W98A 2NTVA 4BKPA 3UUWA 1UP6A 3ZI0A 2EGGA 4XDYA 5ILOA 3HN2A 5TLSA 1GR0A 4DIBA 2P9EA 5I7FA 1D1TA 1UJMA 5IAAA 3DTTA 1PL8A 3QVTA 2V6BA 1K3TA 4MDHA 4RVDA 2HDHA 5L7WA 2I66A 3RROA 2C2XA 3AY7A 1ISHA 4FPXA 1LLCA 4HFRA 1KEWA 3DL2A 1GTMA 4EEZA 4QFCA 4J43A 2CF5A 2C2YA 5CEJA 2HMWA 4BKUA 3I9JA 4CM1A 3DZGA 4A2CA 4CMJA 2DUWA 4J2OA 1NM5A 4NBWA 3Q0EA 3PXXA 5KIAA 2Q1UA 4QEDA 4J49A 3D4OA 4GLLA 2GN4A 4O5OA 1NPTO 3DBHB 1AHIA 2Q45A 3OM9A 4BS9A 3U4DA 1GYRA 4NNJA 2D5CA 4M8SA 4TMFA 3VKVA 4B3IA 4PG6A 1TVEA 2BGMA 3BMQA 4DLLA 1PU2A 2HMVA 3WQSB 1ISJA 4D0RA 3C85A 3KUXA 4LGVA 3S1LA 4JBIA 4DXHA 3QQPA 1PJ3A 4CV3A 3JTMA 1YB1A 3H4VA 1K6JA 1LA2A 3GC6A 4JJIA 1I3LA 4ZQFA 4EW6A 2X9NA 3AUAA 1H0KA 2FN7A 1EVIA 1VKOA 4Z3KA 4CMIB 3DC2A 4B4OA 3OH8A 2NADA 4ND4A 4DLAA 4UVEA 3OIDA 5A3JA 1BWSA 1RM5A 1E6EA 3UCFA 4L74A 4BGIA 2BRUA 2AG5A 1LEHA 3Q2IA 4WCFB 3ROPA 1QYCA 1BW9B 3OSUA 4D7AA 2Y1FA 1N9GA 1GQQA 1O95A 1LI4A 2JD2A 2NSDA 1SPXA 3JQGA 1Y8QA 4HBGA 4HV4A 4B4UA 2PA3A 1W73A 4N5LA 3ZHXA 1Y1PA 1SNYA 5I9LA 2CUKA 2HJSA 2OFPA 3UN1A 2FR8A 4YT4A 3HDHA 1FMCA 3AI2A 4M86A 1KVUA 2J3KA 3I9OA 4J16A 2B36A 2QRKA 3A06A 4FQ8A 2YDYA 4A0SA 1T4DA 4YRAA 5KKCA 4D46A 4PLTA 4ZJUA 1LRLA 2A4KA 2ZB7A 4RF3A 4K6FA 3RKUA 1KVSA 1YXMA 2GZ2A 1ZEMA 2OZPA 1KYQA 5EIOA 1O6ZA 3SVTA 2ZYAA 3D4NA 5U9CA 2YY7A 5B4TA 1M6WA 4BNGA 1H9BA 1QR6A 2QHXA 4RVGA 4WUVA 5JDIA 2VWQA 4WGGA 5DP2A 3MJCA 3DBRB 4BMNA 2O2YA 3VVBA 3VH1A 4INAA 4IDCA 3UGKA 1RM0A 1OZAA 1OBFO 3WOHA 1PGPA 4MVJF 2DQ4A 1GD1O 1U8XX 3TZKA 5ES3A 2VOJA 1DFHA 1LBEA 1LSJA 1NFQA 2Y0EA 4GX0A 5KCZA 1I32A 2FHSA 5KTKA 3GOHA 4R01A 3DBLA 3ZHBA 2B37A 1FXSA 1XCBA 2BI7A 3IS3A 1LRKA 1GAEO 2Q49A 3ASUA 4WNCA 4R41A 5H81A 1NHGA 4XJSA 1BSVA 3ZWVA 2XPCA 1B3BA 3RU7A 3DOCA 3EHEA 4MVJP 1B14A 2VZ0A 1G1AA 1UDAA 3FPCA 4FC7A 5FI5A 1V3UA 5JCJA 6ADHA 5C7OO 4KOAA 4UREA 5EQDA 1R6DA 3FN4A 1Q7BA 3K5PA 3VZPA 3U62A 1N9GB 2WDZA 4K9DA 4WEQA 4TSKA 2IRWA 1P3DA 1PS0A 4XYGA 3GG9A 4AL4A 1CF2O 1ID1A 4PG5A 4U6QA 1U7HA 2JHFA 3P2YA 1LDMA 5EN4A 1O94A 3OEWA 4PRLA 2WYUA 5IZCA 5H83A 4AG3A 2AEJA 4D79A 3VH4A 4LSWA 3OF2A 5KJ1A 3H5RA 3D5TA 3H9UA 1NWCA 2VWPA 4IUYA 1FF9A 3DWFA 2Y68A 3WSWA 1UXHA 3FI9A 3RUCA 3UH1A 3INGA 1MG0A 4U6SA 4OQZA 1KEUA 2NACA 1ZXBA 1MXFA 2P68A 3EZLA 5IXSA 1BGVA 3L4BC 1CIVA 1T26A 3G1TA 1QLHA 1DBVO 1IHYA 2HSDA 2JAPA 3PQEA 1DRVA 2Y05A 1LC0A 4NJOA 3SXPA 3WNQA 5A5EA 4TKLA 1J0XO 3O26A 3VKUA 2PK3A 1I2ZA 4FGWA 1E3EA 1GZ3A 1T4BA 5KVCA 5G4LA 1K2WA 4XD2A 3U0BA 3JQDA 1C14A 3JYPA 3HE3A 5HA5A 4DWVA 3SX2A 4AJOA 1H2HA 1NBOA 3QJ5A 1GEGA 4J3FA 2AA3A 4R1NA 3ZWMA 3FNFA 3DZJA 4ALKA 1UAGA 4II3A 2AG8A 2TMGA 3U49A 3ASVA 4OJNA 1X0VA 4IDAA 4CODB 4OM8A 3WSVA 3PFFA 4GKBA 2JJYA 5DZSA 1H9AA 1V0JA 1Y5RA 2D0IA 1EVYA 3JQGB 4PVCA 3I6QA 2UAGA 1A71A 1F06A 3I3OA 1U1IA 1E77A 1GPJA 2C54A 3EK2A 4NG5A 4J4BA 1YKFA 4GLOA 4BMSA 5J23A 5H82A 4HFNA 3INTA 3OQ1A 1E7WA 1YQDA 3WQQA 3PTZA 1P1JA 3M1AA 4IDEA 3PDJA 3RFTA 4HXYA 2BELA 4JGBA 2VRCA 4UUMA 5IZ4A 3PFWO 2ZJ0A 1NAIA 1B26A 1DJQA 1ZBQA 2EJWA 1PGQA 5L7TA 1ZNQO 3LK7A 1T2EA 5IDXA 1ZK3A 2GCGA 1R4MA 1M76A 1I0ZA 2VUSA 2C5AA 3D4PA 4D42A 1XGKA 4E5MA 5MGBA 5FFFA 4YAGA 1TXGA 2DBRA 1NQ5A 1WZIA 1P1RA 2X23A 1KVTA 2C20A 8ADHA 1LSUA 4EI2A 1UXIA 3JQ9C 4MVJD 4AICA 3LC1O 4DPLA 3QHAA 4WCDA 1HDXA 4OXYA 5HBRA 4CM8A 2DTDA 4FOSA 1E3IA 5CG2A 4N54A 3E9NA 1BVRA 3AOEA 1H6DA 5KVSA 1C0LA 3FWZA 3C7AA 4XGKA 5FF9A 4IY1A 1HF3A 1N1GA 2PKQP 1XR3A 4E33A 4KUEA 3ITKA 3WYCA 3MOIA 4XRRA 1ZIDA 4UVGA 2DTXA 2BFMA 1I01A 3FR7A 5COAA 1H6CA 1ZUD1 5L3ZA 3LT0A 3P7MA 2FWMX 2JCVA 4DBVO 1D7OA 2PR2A 4XIYA 1PJ2A 3LF1A 5EQFA 4PN3A 3RUAA 4GX5A 3BMCA 1MX3A 1WLYA 2X0NA 2G5CA 3MCVA 4JP3A 3E18A 3BIOA 4LN1A 2B35A 5ENVA 3UCXA 4YAIA 2DBVO 3FTNA 4XCVA 3PJGA 3RBZA 2C59A 5JDCC 2W4QA 5JYEA 1SAYA 1MV8A 2CY0A 1R66A 2UYYA 4HP8A 5K6AA 4PLZA 2NWQA 3T4XA 3BHJA 4XQCA 4EUFA 4XB1A 4ZA2A 1UR5A 3ENNA 5GMOA 1FDTA 2J5RA 3GA0A 3GVXA 2WWRA 4EITA 2DKNA 5MDHA 1QYVA 2A94A 1JKFA 1F0YA 2X86A 4FFLA 3AY6A 9LDTA 3EYWA 5DNAA 3HZZA 1E3WA 3KSUA 4E12A 4P22A 5DDIP 1Y9AA 4FOOA 1ONNA 3RI3A 2FP4A 3KYDB 1E7SA 1VM6A 3JQBC 3NJ4A 4CLEA 4Z6KA 3CMMA 3GG2A 3V2HA 1PS9A 3NAQA 2VYND 4CL8A 3RCBA 2ZTUA 3BTUA 2IXAA 1G0NA 4FFOA 1GFSA 2DPHA 4XRGA 4YJHB 2AHRA 4I08A 4W6ZA 2DFVA 3R3JA 3W4JA 5JBIA 1JAXA 1A5ZA 2AW5A 3WB9A 3CPSA 4I5DA 4ZQHA 1ISIA 3W6UA 4HFMA 1R37A 3MWEB 5BNIA 3D1LA 4B8WA 4OXKA 2W2KA 4NH4A 1X7GA 4C4OA 3NDRA 4K26A 4BV9A 1Y8RB 4YXFA 1UDBA 5ER6A 4L0QA 3DAGA 3D0OA 3TF5A 3WS7A 4DYDA 4RPHA 4WEOA 3TZ6A 3G79A 4IIUA 1JVSA 4BNLA 4L4RA 1P0FA 5FYDA 1GADO 1T25A 1V3TA 1HDRA 4PZCA 3I1JA 1BHSA 2FR0A 4AJKA 3ZU4A 3I83A 4WPGA 1DDOA 2X0JA 3WWYA 4BOYA 4F3YA 3OQBA 4OO3A 5I7SA 1SBYA 1QKIA 4A7PA 1O89A 3NRCA 3JQ8A 2I65A 5THQA 4ZQEA 4DL9A 1YH3A 4MVJE 4YYZA 4BQPA 1JA9A 4UUOA 1A27A 1C1XB 2RCYA 2D5AA 1VL0A 1C1DA 4RPLA 4ZQBA 3L9XA 4I9UA 5EERA 2CVQA 3QIVA 4Q3NA 4XQ9A 2YZ7A 1BVUA 1ZK4A 4AJJA 3EMKA 1VJ0A 1R4NB 3GAZA 3EUWA 4I8XA 4RJTA 2NLOA 5JE8A 3AU9A 3ONEA 3QW2A 1E5QA 3DMYA 4TVBA 4O0LA 4IQ8A 4B79A 5A3VA 3GZNB 1ADCA 2VOEA 5L53A 5TRTA 4ALLA 5DBGA 4LW8A 1UDCA 4R69A 2DTEA 3PIIA 4RF4A 4IQ0A 1B3RA 4YTEA 4KMSA 1WDLA 2Q2VA 3CKYA 3JD3A 2FMUA 3EW7A 3FRJA 4R51A 4RF2A 4W82A 3WTBA 2EP5A 2OO5A 3BMNB 1LQUA 4Y8VA 4ZVVA 2HAEA 1OMOA 2V7PA 2VT2A 1SZJG 3VPSA 3V1TC 1NYTA 5HRUA 4ZRMA 1A7KA 2J6IA 2Y1OA 1HSOA 4BKRA 1E1KA 1H94A 5IN5A 4FB5A 2YQ5A 5ER9A 1WWKA 2WMDA 3ROMA 3W4IA 4BO0A 1PS8A 2JFHA 1QYXA 2R6JA 1XWFA 3HUDA 5F1KA 4DRYA 2VYVA 1Q2XA 1QSGA 1BRMA 5CDGA 3R1IA 4CUKA 1MUUA 3E5RA 4R54A 3AJRA 3WNVA 3PGJA 1N7GA 1UAYA 1C0IA 4OL9A 3M1LA 1JVBA 2YFQA 4ND2A 3RIHA 2VT3A 5ENDA 1JW9B 1E1LA 4KTVE 3CH6A 4PLGA 5IG2A 2O3UA 3DBVO 4UUPA 3U3XA 2JCYA 4URFA 3GUCA 2AEMA 4E2WA 2AMFA 1NQOA 1LSOA 3BTVA 3PDUA 4X54A 1X7DA 4ZHSA 3B1FA 1PR9A 4CM7A 2GSDA 3IMFA 3V2GA 1GYPA 3QVWA 1U4SA 1HYEA 4Z0PA 2Z1NA 5B4UA 1YDWA 1ISMA 2D1YA 3R0IA 1WNTA 1ZK2A 1NNUA 3DR3A 1ENOA 5B12A 1K6XA 3LT2A 2HMUA 1P1FA 2AXQA 1DIHA 3AFMA 3DZIA 5JMWA 1VJ1A 4J9UE 4G81A 1E5LA 3LYLA 2EJVA 3ORFA 3PWSA 4RZIA 1IHXA 5F1OA 3F3SA 4GGOA 4B3JA 4YJGA 1M2WA 3AM4A 3DHYA 4BKOA 2A9FA 3PWZA 2EXXA 3GMDA 1I2BA 3C1TA 4GVLA 5A05A 2NTJA 1PZHA 4PRKA 1QXSA 1XU7A 4DMLA 5EINA 2VHXA 4IS3A 4CQMB 3ZDFA 5JO0A 3NT2A 5KNLA 1SO8A 2ZYGA 5JPIA 1RM4A 3ZWXA 1JAYA 5KJEA 3X2FA 1JKJA 4E5KA 5LCXA 1YL7A 5A02A 5ITVA 4OIMA 3CEAA 4J0FA 3FR8A 5F1PA 5B37A 3RUFA 3W1VA 4RL6A 3JQCA 2WSBA 4WOJA 5L4NA 3BA1A 4BNNA 1JWBB 2OP0A 1LDYA 3MWDB 4YT2A 4MIOA 1IY8A 3FCOA 4RDHA 4B7XA 2EG9A 5JAMA 1LDEA 1LJ8A 2Y1EA 4LRSB 3U9LA 2X7HA 1WAMA 4J4TA 3M2TA 4LK3A 5IF3A 3KOUA 3R6DA 1P1IA 1E7YA 5HTOA 3E03A 2ZK7A 1DRWA 3OECA 3VDQA 4NHEA 3ZWBA 1XG5A 3GDOA 4QQRA 4CMCA 1F12A 1P77A 4BQRA 3I4FA 2OORA 1WW8A 3PHLA 4BO4A 1R16A 4HADA 2EERA 3LQFA 1CQIA 3VH2A 3IUSA 3WGYA 5TS3A 3GQVA 1Y7TA 5LC1A 4MVJM 3W8DA 4B4VA 3I5MA 1PJCA 3GK3A 2CMDA 4FSHA 4U8GA 5A06A 2GERA 4GAEA 2I3AA 3GN2A 3D3WB 3HJAA 4J7UA 1RWBA 4H7PA 4J1QA 2IZZA 1UP7A 1LNQA 1R0SA 1H5QA 1YO6A 4WOKA 4GSKA 4ND3A 4MOWA 5DBIA 1PZGA 2JAHA 3UF0A 4NBRA 3CZRA 1ARZA 1T1RA 2NM0A 5JC8A 3DMTC 1J49A 1VSVA 4ND1A 2Q1WA 1LUAA 3HDYA 3D3WA 4LRTB 4MO2A 4QUKA 1VRWA 4MVJH 2EGHA 5T6BA 3JQAB 5JS6A 1OFGA 5KJFA 2VQ3A 2O3JA 1LSSA 4J7XA 4QT0A 2EF1A 1ADFA 2XXBA 1CWUA 2E37A 4HKTA 3TZHA 3HN7A 4J6FA 4EYEA 5BNFA 4IGEA 5T57A 1HWYA 2YJZA 1BMDA 4LCJA 1CERA 2D8AA 5IN4A 4XX0A 1DO8A 1DIGA 3ZNNA 5U1PA 3B6ZA 1Y8RA 3GEDA 1XQ1A 3PEFA 1IB6A 2PNFA 2X5OA 4I5EA 2C82A 1NQTA 2VCYA 3H6KA 3WFIA 2YQ4A 5KWEA 3ROKA 3B1KA 3KYBA 2Q99A 4MVJA 4NFYA 1QYWA 3JYLA 4QTZA 3HQ4O 4HNGA 3RC2A 1GL3A 2PKQO 1MFZA 3PYXA 4MIYA 3ZCXA 4CR8A 2VWHA 1L7DA 5DN9A 4B7UA 4XKJA 5KOIA 1EDZA 1NTOA 3RUDA 4BVAA 2H5LA 2Z1MA 3BTOA 5JAZA 4DIOA 1WMBA 3AM3A 1PL6A 3H7AA 1N8KA 1XEAA 2UDPA 1GYQA 3QWIA 4S3MA 1YRLA 5BSGA 3E9QA 3GGGA 3ICCA 1E7RA 2POQX 1EEHA 5HS6A 3B1JA 4Z0TA 3TL2A 4RVUA 3LU1A 3VOSA 3KRTA 1W4ZA 1ZMTA 5IDYA 5T64A 4CPDA 5CEFA 2WE8A 3IAHA 3VTFA 1HLPA 4WCFC 1GV1A 4PVDA 1KEVA 1WDKA 4CR6A 1N2SA 1NFRA 3E8XA 5DCWA 3MJSA 3ZW9A 1HTBA 3QE3A 4R4JA 5DULA 4L4XA 4R1TA 3QSGA 1E1NA 4NK4A 1T2FA 4EEXA 4PLVA 2CD9A 4YQZA 3JQBA 3WFJA 4YRBA 4NZ9A 2I6TA 2Q2WA 4J2HA 1ULUA 4JLWA 1QG6A 1HE3A 1R4NA 1YBAA 2P4HX 3S2EA 4DQUA 1DC3A 2W8ZA 3KYCA 1ZJYA 1VJTA 4FS3A 3RASA 1U3TA 1ZXLA 1Y6JA 4NK5A 2PH3A 4W9NC 2VTEA 2C29D 4TZKA 4E31A 2GUGA 2NVBA 1C1XA 2Q4EA 3ZV6A 2QZ9A 2GD1O 3ETGA 4OYRA 3PHJA 3QP9A 5C37A 4Y6PA 2OP1A 3HB5X 4AJLA 5KVVA 4G5HA 3PYLA 2I67A 1ZH8A 1ISGA 3TSCA 3ZV4A 1W8DA 3EAGA 1X1EA 4TRRA 5G0SA 4TVOA 4KWHA 4NR0A 4MKXA 1MB4A 3GFBA 1HKUA 4EJ0A 5KJ6A 4P4NA 4FD3A 4BNMA 4TQGA 4HY3A 5EJ2A 5TT0A 1B15A 4U0JA 4PLFA 1U2GA 4D3FA 2O4CA 5EESA 5TC4A 4CV2A 4D3DA 3OIGA 5JAQA 1PX0A 4CLRA 3VTZA 4LSMA 4YPOA 1HLDA 3WTCA 4E2ZA 5TX7A 1YQXA 4NPCA 2J3IA 3WGTA 3S2GA 1GU7A 3BXXA 1XA0A 2CVOA 2DVMA 1YBMA 1FDSA 4U7WA 4ZICA 1XELA 4CMEC 1A4UA 3W8FA 4ONEA 4BGUA 3JQ7A 2O7QA 4JNKA 3NTOA 3QLJA 1UXKA 1AGNA 1EMDA 4GQAA 2GF2A 3GT0A 1UUFA 4FIZA 1TT7A 2BD0A 4CMBA 2P4QA 3TRIA 3WGGA 3SEFA 3ANLA 3MZ0A 4PLPA 2OOSA 2GN8A 1RM3A 1ORRA 4KP7A 3IJRA 5FWNA 3I9KA 1E3LA 3EZYA 3DFZA 4EJMA 2PZKA 1FDWA 1Z74A 3OHSX 3ZNPA 3VZQA 2CDBA 2GN9A 2PD3A 3T4EA 1ZKMA 1MA0A 3GLQA 3KYDA 1SB9A 1R0LA 1HDCA 4GPD1 3WYEA 3JQ8B 3KEOA 4KQWA 1DIBA 4Z9FA 2AEFA 2CNBA 5JFOA 3T7EA 1EK6A 5BSFA 1ADGA 1E7MA 1KEPA 4Q39A 3RFXA 1DC4A 1GCUA 1Z7EA 2RH8A 3C7CB 3MJVA 4ILKA 4MP8A 5JMPA 3NDJA 5TSDA 4DUPA 4R3NA 4G2NA 4W4TA 4RO0A 4NBUA 3TZCA 2WD7A 4ZN6A 4Y6RA 3FF4A 3FD8A 3KYCB 2C7GA 3ZV3A 1S7CA 2BFAA 3WJAA 4I5FA 3PIDA 4E5YA 4EJ6A 2NVUB 4S1VA 4CMHA 4XDZA 5L45A 4CMGA 1O0SA 3E6AA 2Q46A 3GNTA 3ZU2A 5CPBA 3GR6A 1ENPA 4FJ2A 3F46A 3HDQA 4Z0HO 4A03A 3MEQA 2X8LA 3ULKA 5CEEA 1U5AA 2O3QA 2IYOA 2IYPA 2ZTVA 3NKLA 3IOYA 4RLSA 4UEOA 5IJZA 3WQRA 4BO8A 4I9HA 3WIEA 4CMEA 4FR5A 4JJGA 4Z9XA 5BQFA 4Q3CA 4E5PA 2NU6A 3TOZA 3GVIA 4ZD6A 2V6GA 2ZATA 1BXZA 2DM6A 2CDAA 3U09A 4PZEA 4FCCA 4JK3A 3RUIA 3E82A 2YV1A 1EE2A 1CYDA 2ZQYA 4R16A 1HZJA 2J3HA 1GEEA 4R1UA 1LRJA 2F1KA 2V65A 1UZMA 3FBTA 2I9PA 4KZPA 2VUTA 3HWRA 1DFIA 3I23A 3GEMA 2B0JA 3OP4A 1QP8A 2NUAA 4MPDA 2W2KB 5TQVA 3NTQA 3GZ4A 1G0OA 1I3MA 2DBQA 2ET6A 1PR3A 1EQUA 2I3GA 4OGWA 2QG4A 2PFGA 3DAFA 3GHYA 4Y67A 2Q3EA 1PJ4A 4C7KA 4ZU3A 1IE3A 5F3RA 2JD1A 4WLOA 2HUNA 1R4MB 2UUPA 4F6LA 2VTDA 3H3FA 3IKVA 3V8BA 1A9YA 4F6CA 5DP1A 4XIJA 1I2CA 2ZKLA 4JJFA 1H93A 3I52A 4F46A 2RAFA 3VC7A 4YB8A 3NEPX 1PZEA 4BNWA 2CFCA 3O03A 3NT4A 1YE3A 2FPGA 4IMPA 3ADPA 4JROA 1F17A 3D3EA 5TNXA 4BNVA 2PGLA 2PY6A 3UKOA 3H9JA 3DB2A 5B1YA 5KVQA 2OBYA 3V2UA 5IDQA 2X6TA 4AFNA 1ULSA 1GY8A 3G1UA 1W6UA 5JYDA 1IOLA 4PG7A 3F9IA 4IDFA 4ZQGA 3SLKA 3DBRA 2GN6A 3M2PA 2EHDA 4RORA 1N5DA 3VHRA 3PWKA 4WLNA 4UAGA 2VHZA 2Y93A 2ZB4A 3B70A 3F4BA 5TGDA 3TNLA 9LDBA 4L4SA 3OMLA 2ZCUA 1WPQA 3WLEA 4I9NA 4A26A 4H15A 2NVUA 3ZZNA 1NPYA 1C0PA 1TEHA 5ITWA 4XZ3A 2NV6A 4XQGA 5TIIA 3GRPA 2AE2A 1KIFA 2EW8A 2X4GA 4J1SA 1XHLA 1LQTA 2I76A 2EKQA 3Q9UA 2E82A 1ENYA 3GHHA 4TRMA 3ZNOA 3IC5A 1AHHA 3OJEA 4D41A 2X1HA 3P19A 5JXWA 4YBZA 4CM9A 3E5MA 3HADA 1M67A 4XYEA 3S2FA 4BIIA 3AOGA 3K31A 4TROA 3S2IA 4XGIA 1LDBA 3KBOA 1HRDA 2BKAA 3BYZA 4OOFA 4P4LA 5I8ZA 3PZRA 2NNLD 4MIEA 4GI2A 3IDSA 4MVJG 1VE9A 1U3VA 4NBTA 4P4GA 2CVZA 1RPNA 1TT5A 1B8UA 3DZHA 1T24A 2IDZA 4FJ1A 3AI3A 1GDHA 3VPFA 2XF8A 3H9QA 3IKTA 4KUHA 2LDBA 3PPIA 4IS2A 1HDYA 3LSYA 1DB3A 3GDFA 2EW2A 2YYYA 3WXBA 5G0VA 1J4AA 1P31A 3PGXA 2VZ8A 2PTGA 2YW9A 4UVDA 4AJEA 4ALIA 2ZTLA 4JXKA 3SLGA 5JNLA 3AU8A 4YAEA 1ZW1A 3X2EA 2ILTA 3OA0A 5I9MA 2EKLA 3I4CA 1HXHA 2GO1A 3F6YA 1YS4A 1WP4A 2O7SA 2BI8A 1U7TA 4O1MA 2HU2A 3FTPA 1V3VA 4BNFA 4WLVA 5COBA 1YJ8A 2YDXA 3ZW8A 4PIVA 5JY1A 4M87A 4WLUA 2HK7A 2Y0CA 2BGLA 2DUUA 4AJNA 2R00A 1C3VA 1JQBA 4II2A 5BNTA 1B0AA 2OL4A 3JQFC 3DBLB 5BT9A 2BH9A 3ZWOA 3JYQA 4RZHA 4CV0A 2W2LA 1CEQA 4ALMA 1PZFA 4GWGA 5F21A 3WX0A 2HO5A 3HDJA 5JDIC 3O8QB 3DXFA 1LTHR 1P1KA 3FNEA 5FEUA 3HB4X 3MTJA 2O2SA 2UUOA 3OJLA 1V8BA 4YJGB 4MP6A 3WWZA 2X0IA 3KZVA 2CSUA 4L73A 3UVEA 5IDWA 5GZ3A 3FWNA 4R3WA 3AI1A 4RQUA 2BLLA 1X1TA 1JN0A 2LDXA 1NR7A 2X5JO 3KETA 1E0DA 4UVHA 4FN4A 2CDCA 2EV9A 4L8VA 1MLDA 4DVJA 2RBEA 5B4VA 3K2EA 3EVTA 4XR4A 4E30A 3HNPA 2ZIZA 2AQKA 3QA9A 5JCXA 5ICMA 5A9SA 3JV7A 2X9GA 2IEDA 4G65A 1EE9A 2BHLA 4A10A 1J5PA 1IPFA 1VL6A 4JP2A 1HYGA 3ADOA 2PGJA 2ZB8A 4E4YA 5A9SB 1GUFA 4WLEA 2F00A 2W90A 3D5QA 3P2OA 1SMKA 5BSEA 2P91A 3KLMX 4IJWA 1DPGA 1KS9A 4LISA 3N7UA 1E1MA 1HETA 2XAAA 2OXIA 4CMAA 5IZCC 2BF7A 2VNSA 4XWYA 4RVFA 4BO1A 2FY8A 3P5SA 1DHTA 4DBZA 4M1QA 3MJEA 2DLDA 5CDUA 1ZSYA 3BTSA 4WCFA 2DC1A 3PHIA 1MC4A 4DA9A 4DPKA 4OHUA 5DOZA 1H2BA 1D8AA 1ISFA 3H2ZA 4PLHA 1O5IA 2HKIA 3K8ZA 1EVJA 2R00C 3ZNQA 3NUGA 2H1SA 4CMIA 1DFGA 3JQFA 5CPFA 3WLFA 4J7CA 3UAGA 4R5MA 4BNJA 3BHIA 2P9GA 4BNYA 3BZUA 3SJ7A 1Z6ZA 3CMCO 3DFUA 2PWZA 3NGXA 3A1NA 3UW3A 4IDDA 3JD4A 4Y9DA 3E48A 3ZGYA 3ST7A 1B8PA 3ZWCA 4W9NA 1PEDA 1N92A 1I30A 3BMQB 3LLVA 1RJWA 4DGSA 1QRRA 4DQXA 1KVRA 1SEPA 4W99A 1GUZA 3L07A 1FK8A 4JBGA 3PP8A 4PGFA 3LF2A 3MOGA 2PD4A 5HS4A 7MDHA
chains in the Genus database with same CATH superfamily
1K68A 2ZWOA 3O4VA 4F2HA 3A8TA 2X6QA 2V9ZA 3JATA 1HL3A 1N6HA 1N5RA 1NR1A 3AF3A 3DV0A 4IMJB 2JAOA 2VJQA 2CLKB 1JFFB 3FKSA 3PRJA 5CIWA 4LY9A 2DR3A 3CA8A 4YRQA 1Q1BA 2ODNA 2OGSA 2TMDA 4OHBA 4LWZA 5HCNA 1J21A 1ZXXA 3D8TA 3GA7A 3PUYA 4OGGA 3VYWA 3LDAA 3NHFA 3AR5A 3HXLA 5IS2A 3JQAA 3RTAA 3SP1A 2XDAA 2LTAA 1XI2A 2B4TO 1Y9EA 4DHWA 4JQCA 2J8ZA 2Q9BA 1J8FA 4GP9A 4D8XA 4PONA 4IDGA 1HY3A 4KX3A 1TYAE 2GNAA 2GHTA 3D6NB 3M33A 4A5OA 5GZ1A 2XVZA 2AJ8A 1SB8A 5PNTA 4ER3A 5K4AA 3THWB 5ELLA 1X7WB 3ICQB 4G1MB 4DSAA 5KYKA 4MQFA 5L4LA 2X3UA 3KPUA 1QQTA 2QV0A 4G25A 4HFJA 3UWOA 4X6UA 2CHFA 2VHWA 2WIBA 4MEAA 3TSAA 4X64B 3B7PA 4IICA 5AVQA 3CVJA 3E8MA 2QD5A 4JEMA 2YVLA 4HWKA 4ND8A 2RH5A 3RAJA 2QD4A 5T3UA 1C9MA 4PLCA 3UJDA 2I62A 3SC6A 3A4LA 4MR7B 1SEVA 1Y81A 2H17A 4GOND 4M49A 1I14A 1GZ6A 5AKZA 2NZXA 4GXNA 2GSWA 1X70A 3BOSA 1MRSA 4J03A 4GWKA 4LFCB 1AMOA 1K7XB 1MAUA 2QUZA 1LB1B 1TEVA 4NCJA 3W2IA 1NMQA 1Y80A 4QECA 5IH7A 1EFLA 1A7AA 2XA1A 1I3CA 3C4JA 2NSHA 4LJSA 4E51A 4Z4GA 5KOHB 4W6QA 1Y1KE 4HDMB 2B20A 1W47A 1LVUA 4DAEA 3ROTA 1UQRA 3OZBA 5EPUA 2XOKD 3ASZA 1NJGA 3MAGA 3VKWA 5DX0A 1MB9A 3VPDA 5FUBA 1HT0A 1Z13A 5EZQA 3EQ8A 2WYHA 1FX1A 2ICAA 1Q22A 2X58A 4G5SA 2B4QA 4KBFA 4N5MA 3G9TA 4D43A 2B69A 2FRVA 2ORED 4WZBE 3LBHA 3TDKA 2QMZA 3VR6D 4PYQA 3SI7A 1P0MA 1U4OA 3NV9A 4JC5A 4R0NA 2IUUA 2NAPA 5EKTA 3B6MA 3O1LA 3C3JA 1XJWA 3EGOA 4CLHA 1WZEA 4CKEB 4F4JA 3SEZA 5CT8A 2BM0A 3OLWA 1I7DA 4GM4A 1J23A 4L9RA 3LL4A 5GTDA 1U81A 3KTAB 3N2IA 1RRPA 1ST3A 5BR1A 4ZK2A 4E2YA 3ETHA 4JB0A 1C80A 2V55B 1KO4A 3CFYA 3K7EA 4PLWA 1YBVA 2PAAA 1L1RA 5ICSA 5JSHA 3ROQA 1MGOA 2VKTA 4YCAA 4NG4A 3KD2A 4F6RB 1L5VA 2FWAA 3H3XA 5CLQA 3U3JA 3K9QO 4GX1A 4BZQA 3K32A 2JB9A 3KUKA 4YAJA 1M7GA 3NEYA 1JEQA 1TRKA 4R9UC 1Q0SA 1FP7A 3GELA 3F5QA 4AP5A 3L93A 3KPJA 3RRYA 5D5HA 4MTLA 1S2GA 3WE7A 3YASA 3OVMA 3SIRA 1Z0ZA 3T9BA 1YWGO 4B6EA 4KH1A 1JT9A 1Z8FA 2QZZA 2ZIAA 1JDBB 2DKOA 4JUAA 2C03A 2DF8A 4ITVA 1ECCA 4ACAA 1FIUA 1E32A 5T3YA 4EWLA 3C8ZA 1HX7A 5K0ZA 2CL6X 1V16A 2P2CA 2EEZA 5C7LO 2E18A 1ZK1A 5I7EA 5K0JA 1V39A 3O7MA 4W7IA 5AVZA 4LQLA 3WL5A 4AY3A 3EG9A 3LS2A 4IZOA 2X8JA 5PGMA 3VNQA 2FQYA 5IUKC 1XZCA 2B8WA 2Y1CA 2WJ6A 2VHCA 4BKQA 3O1IC 4ZGWA 4URHA 2E49A 4CLOA 1AZSC 1P0IA 2YWHA 4EMSA 3KOYA 5FBQB 1LD3A 3IL2A 3KFXA 1YIAA 5G3YA 5D86A 3RRMA 3V55A 3EXEA 3CVVA 1EKXA 5E95A 3DTYA 2JLAA 3W8EA 1ZUWA 3DONA 4K1LA 4F96A 3I61A 1I5RA 1SUAA 1BXKA 3MOSA 3OPYI 4LVUA 4MKZA 4RVSA 3ROEA 2JEZA 4Z9AA 5GM1A 4IDPA 4YO8A 4OY3A 5CCXA 3NB0A 3F7NA 4DJEC 4WSOA 4DSOA 2QVCA 1Q1AA 1AQIA 3SQXA 4PQRA 2VAMA 3ZVRA 4DV5B 3GMSA 3LDHA 1CVRA 1E2HA 4FJ0A 4PC1A 1ESMA 2ZVQX 1U3WA 1JPJA 1B8VA 3BMOA 2A88A 4PC2A 4XPZA 1DCFA 2AYYA 2OE2A 1T36A 2PEZA 4B3HA 5A0VA 4J6EA 3ND6A 2DLNA 2YZNA 3UCEA 1G9SA 3QBJA 1OXMA 1CQJA 4NYIQ 3R75A 4YFVA 4PAGA 4KSCA 5CJPA 1C30B 1ORWA 2IDMA 4PO1A 2G17A 2DZDA 1DXHA 4L8FA 2R0QC 3U48A 3RABA 1XFAA 3VYTB 4KMMA 5FWYA 1EGAA 4BB6A 4CR7A 4G85A 3L7CA 2IHNA 2ZAIA 2HREA 3HKDA 4LMPA 4KIJA 1W76A 2BN4A 3PENA 2AUNA 1V8ZA 1YB4A 2VHQA 4JC8A 1YR7A 3IAM6 3HDTA 2JFZA 2HMAA 3M34A 1OH7A 3K9GA 1O87A 2K7ZA 1GNSA 4D9MA 1D9XA 1CQWA 4JVLA 3V9PA 2GNOA 4TRNA 3ZVMA 1ZD1A 2JH9A 3FDXA 1U0LA 4L28A 3UOAB 2F9MA 5BN1A 2OSVA 3O3CA 4IOMA 2A35A 5F9MA 3K9LA 3ZDZB 3KR2A 5CH3A 1T9ZA 4TS9A 5DYWA 4CIXA 4M1KA 1CUXA 5DBHX 4LY0A 3PB3A 5A1TA 2CB0A 3AHCA 3SOZA 4BNZA 2GZAA 2WTAA 1JPUA 2G6BA 4ARSA 1Z39A 2Y99A 1AMNA 4E7OA 2QRLA 2UV8A 3V4PB 1PIWA 5E1BA 3WK7A 3ZQKA 1T9GS 1YRHA 3QPDA 3D6HA 3OICA 3O3NB 3IQWA 5JXIA 4K0KB 3TD9A 1AO0A 1YZTA 2XWPA 1NJ6A 1VI2A 1II9A 1XL1A 3B53X 1DZ3A 3CURA 1Q0PA 3FLAA 4JLUA 4L9WA 3ZHZA 1KJ8A 3PCRB 4W1QA 5JADA 4R9SA 5AYVA 1TCVA 2EDCA 3B1WA 3RTDA 2NPOA 3SS9X 4EHIA 3FTFA 1GGJA 1OI7A 3C3XA 2WI8A 3QPAA 4HNQA 1KH2A 4Y1EA 1NXPA 5GY7A 4B4WA 4ZC8A 4ZI5A 1MX9A 3SYMA 4ITUA 2R6GA 3L41A 1RRKA 2XVMA 1VP9A 1WUJS 1ZMOA 2C95A 4L8LA 8LDHA 5IJ0B 1P60A 3AG5A 2OYRA 3SJBA 3ZXXA 3NMUF 4HDRB 2XVAA 2YV3A 2BF4A 3QE9Y 1K8YB 2PD6A 4GH5A 4YP6A 3RTGA 1A9TA 1Y9JA 3ABQB 1EG7A 4Z1MD 1GQ2A 1V9LA 2FRDA 3SX0A 1XHFA 3OD1A 3PJFA 3AUFA 3DYIA 3KHUA 1H4SA 3K0HA 5MN6A 2VRWA 4HB3A 4WZ6A 1VJGA 1DQSA 3R0ZA 1R3UA 4M76B 4BFUA 1KH1A 4BV3A 2XUKA 4BGEA 3BD6A 3CR3C 1JSXA 5D3KA 3AFGA 5ALKA 4RH0A 4ZTZB 4JZKA 4EBFA 2OVFA 4ND7A 4NFSA 5DNEA 3PUXA 3T7KA 1EFUA 2I8AA 5KSZA 2J0VA 3NUZA 3ANNA 1TLTA 2VQFB 3NT5A 2ODPA 3P0JA 4LQCA 3SR3A 3G2KA 4OFBA 1XJCA 2Q5QA 5MFZA 1KKMA 3FWHA 4FGSA 3I3SR 3R4VA 3LDFA 1BXGA 1ZVMA 4LZNA 4KC0A 2FUNB 2Z2IA 3QYFA 4OXRA 5KSYA 1KE2A 4CKBA 4XCQA 3LHIA 2Z3WA 2V1UA 4CDMA 1KDYA 3FGPA 3L18A 3NOOA 3WGMA 4D4KA 4GR9A 4B3BA 4PSDA 2CLLB 2OA0A 4PFJA 1B8NA 1P73A 1U0TA 4L5JA 5JFTA 4CM8B 1IL0A 5F4ZA 2Y2VA 2W22A 1C2TA 4H60A 3GBSA 3R3ZA 2D3WA 3F6PA 2V8OA 2ID4A 2QIOA 4X20A 1E63A 1KDPA 3OETA 3PRYA 4QXMA 3I9LA 1F6WA 3VI4B 5DLYA 5CXQA 2LP4Y 3ZWWA 5AQ1A 4M60A 1FMTA 4QU5A 3K35A 3FOBA 3ORSA 4WESB 5ALLA 4LF6B 3Q88A 3DGFC 3S4YA 1KFKB 3CLUD 3DHEA 3UXYA 3BL6A 3D02A 3IIEA 1TC2A 3LBNA 4MWZA 4Q02A 5DWQA 2FP3A 5GQSA 4QBTA 2IJGX 5AKIA 3STTA 3AW9A 3VPHA 1UP4A 4I4LA 3LMKA 3WNDA 5JD6A 2DT5A 4Z7QB 3W4KA 2VYNA 4MP3A 3LX4A 1QMPA 2AG1A 3CT4A 3LFTA 4IYRA 4CMKA 1V5FA 1JE1A 2XQVA 4D0LB 3W7BA 1X2EA 4KQIA 1PG5A 1ULHA 1MX1A 2B4AA 4HCJA 5E9WA 3ZS9A 4J4HA 4O63O 5A6VA 4GEKA 2ZU6A 4XSGA 3WA7A 5LFAA 5FBHA 2MYUA 3A31A 4AQDA 1U0JA 2ZG6A 4OQXA 5IBCA 2EZ8A 1M1YA 2HBYA 3RC7A 4L75A 1MO2A 3NBAA 1WX1A 3LQYA 2BGUA 4MMZB 4DYVA 4O8CA 3ISVA 3ORYA 1NJ5A 1Q84A 3GN1A 3GW8A 3QU7A 3HJRA 5L6LB 1Z0JA 1Z82A 3QMVA 5AJYA 1TPZA 4BZZA 4C08A 2CF6A 4WXEA 2HA4A 1KERA 2PGDA 3L0YA 1P2FA 1P7VA 2Q4BA 1K7SN 1BDJA 4JD5A 4WFKA 1AC5A 1UJ6A 1ZGCA 4H1HA 4DRXA 5JFGA 2ACWA 4NYJR 5CU7A 1G8YA 3W06A 3EE6A 3LPNA 5CDHA 1EU1A 2JRLA 3I0ZA 4FHGA 3B9RA 3HV2A 1BDIA 1FW6A 2PZMA 4YJDA 1XVLA 1ITZA 1HYBA 2CL7X 2R84A 1CDZA 3ZZUA 3BAZA 1I24A 1SIWA 4PIMA 1JQ5A 3AI7A 5CRIA 4CQMA 3EGIA 3PI7A 1DC5A 3HBFA 4QNRA 1WTAA 4ZV7A 4EY6A 2RHCA 3PG5A 1NHWA 5HF5A 1SQ0A 5JWHA 3ABZA 1BGWA 2GJKA 3BSSA 1HEUA 4LMRA 4M1EA 4MGEA 1T8PA 1XVUA 2XOXA 2VJAA 2GN0A 3KDPA 3H65A 4NJMA 3GDGA 2P2NA 5C1OA 3UAZA 4LVCA 4Y6QA 3RVSA 4AUEA 1NN5A 1V35A 4QO7A 4FHEA 5TMEA 3KJIA 3LT1A 2HLDD 1TO1E 4IVNA 3OWOA 4MA5A 4ZZ3A 2XCSB 2W42A 1Z47A 4BGDA 5K8VA 1IEXA 1PBNA 3RC9A 1AXEA 1K0UA 4IHQA 3IVGA 3N1UA 2ZJ1A 5P8WA 5CB4A 3EXFB 3CEMA 4RZUA 1L4FA 2AR7A 4NZYA 1EP1B 1YIDA 3AUUA 5IUNC 1FE8A 2VJYA 4H1VA 1BH2A 1ULTA 3INRA 3REFA 5CFOA 3KNZA 4FZ5A 2PR7A 4WD3A 1YMQA 4OSOA 3HFJA 4KO3S 3DAPA 2FOIA 5F64A 2UZ1A 1V6SA 2VJCA 3AIOA 4ZP1A 4L4ZA 1PDVA 2UU9B 3SJAA 4CTJA 4IGIA 4WADA 4HQ6A 2PV7A 4P3PA 1L4BA 3SZGA 1GA4A 1Y8QB 1WUIS 3IPAA 4Y3UA 5AW0A 3EC1A 1FJHA 1R6VA 3ICPA 5FIUA 4BLOA 4B3RB 1YI8A 3WGNA 1HDZA 2PN1A 1X13A 3HI6A 4DLBA 1Q1ZA 2ESRA 2QMEA 2PKYX 3M8KA 5CTAA 3TGPA 1KJNA 3I53A 4WJLA 2P4EA 2BISA 4BGVA 2QQ5A 3WRXA 1K8QA 3LC2O 2PMEA 4EP1A 1M2OB 3FUUA 3LUDA 4BQNA 4WFIA 1ZH4A 2GLXA 1Y98A 4RJKA 2GPSA 3TJRA 4RS4A 1ATZA 1SQ6A 2YC4C 3X1DA 5LNK6 1K9VF 3RTCA 3Q7SA 3M6XA 5I7RA 4DTIA 5CB6A 2QRJA 5F77A 1RQLA 4HG2A 3RK0A 4YJ3F 3FSGA 2F43A 1E60A 2IXBA 3M5WA 4O2AA 5AXAA 1B16A 1TJYA 3M9WA 1Z37A 1JYFA 2ETVA 4B09A 1H3NA 3M6VA 3KQUA 4GOOD 4MMXB 2IEZA 2Q8NA 4F5YA 4AZSA 5FBZA 1OXBB 1NF3A 1OFUA 1TCCA 4R5HA 4BMOB 1VHWA 1B74A 2BWJA 2WJAA 1QV9A 5G2OA 1FRVA 4M8IA 1IDOA 3V8RA 2Q6LA 1MHTA 2J5XA 2EQAA 3CLUC 3Q2KA 2GHQA 3L4JA 4XYLA 3TTVA 1HFKA 3C6XA 1HE1C 5JYBA 4DCGA 1L7EA 1TUBA 3EXG2 4TZTA 2IBSA 4H3VA 3L46A 2IYZA 4FU0A 1U3DA 1TAGA 4WJZA 4ZO8A 5AVWA 4OH1A 3KV3O 4HI0E 3HG7A 4C01A 2F3RA 4UBIA 1U8TA 2AV6A 4XA8A 1HZZA 4C7MA 3I1FA 1JTEA 5CFMA 3SC3A 1K97A 2VYQA 2YHIB 3QLVC 4D3SA 1TZKA 4RPKA 3QPVA 2OESA 5FUQA 4J94A 3JZFA 2HX1A 3EULA 2IW1A 5EYPA 1POXA 1U2PA 2ZAOA 5BSWA 2FZGA 2W2OA 4O4JF 2IT1A 3ZD9A 2ZUEA 3DDWA 4LCEA 4C7JA 3LJKA 4LNAA 1BD3A 2YINC 4WFQA 5SYMA 4B33A 4JYPA 5AVVA 2O8VA 4M8KA 2ZUFA 4V24A 3USES 1NKVA 1P1HA 2I8LA 1O97C 3C6BA 4ZJZA 3PQFA 5EWJA 3SBXA 5IFLA 3J81A 1Q7EA 5KHLB 4FFNA 2XUZA 4BZXA 4BJ5A 1CBUA 1RYEA 4Q47A 3BQ9A 1EP9A 2CVPA 3OU2A 3I39X 3PX2A 1UJCA 3VR3A 5KJCA 4KFTA 2TYSB 4EZBA 4CEJB 2H2WA 3FHLA 1NVWQ 5LBIA 1P81A 3KPYA 2H29A 5AK3A 4KQJA 4YMHA 3FSEA 1GCOA 3WG9A 4Q21A 1BWRA 4ZTUB 2H07A 1ADBA 1XSEA 2ZUTA 1Q1EA 4J0IA 2FUG6 4ZJPA 5B3JC 2X5XA 2YX1A 5FKJA 3RYCB 4WZAA 1CR2A 1ILEA 2P9CA 4NV3A 2EU8A 3DZBA 3JYNA 5JO9A 3IOMA 4GOMD 1GTJ1 1JSLA 1XKXA 3ANSA 3HBLA 1Z4PX 1SG9A 4IQGA 4NATA 2AEEA 5D2CA 3A4YA 4UVIA 2HXYA 3BE4A 1V8OA 4Y6OA 1IMOA 3IBTA 1D2AA 4NP6A 2PX5A 2WINI 3TRJA 2O9JA 3FHCB 4R8KA 7REQB 3PLRA 3PYMA 4Y0NA 4XXHA 1MG5A 5D01A 1UKCA 2EKPA 2JIRA 3LYHA 4LHVA 5G53C 4F4UA 3LLCA 3OG9A 3WBJA 5KNDH 5A2QA 1XNGA 1YR3A 4QX6A 1V45E 4H7DA 4NDNE 2XB6A 4U00A 5FUWA 1Q12A 5E6RB 4ZU1X 2AG0A 3ZQJA 5TQJA 5IVKA 1XZIA 2I2BA 3TK1A 2VHYA 3NNDA 3OU6A 4TT3D 4YONB 2PQ0A 5IABA 3QHQA 5UKDA 4AIRA 4F4CA 3K4QA 4XJTA 2BKLA 2YHBA 3OCWA 5G3ZA 3IIMA 2Q0XA 2QL6A 4A9AA 5LB4A 3PDHA 4OP3A 2BFOA 2HFJA 1S1MA 3QEMB 1E99A 1XEXB 3PDCA 2XGGA 4WVFA 1PEYA 4QYIA 4C07A 8ATCA 4N48A 3ZK8A 4RD6A 2ZB2A 3DBHA 1Z16A 2Z56A 1WUTA 4MQMA 4BE4A 2QSUA 4LOLA 3BILA 4ES6A 2QAIA 2PA0A 5JNRA 1ZM2A 3WKBA 2JRCA 2R48A 3D6JA 2X2EA 2YIMA 2WSMA 5ICFA 3RUEA 5FTJA 1BFDA 3CLRD 5F12A 3UIEA 1KDRA 3EOZA 5EJ8A 1AK1A 1FSGA 3VAZA 5LOVA 3S2UA 1ZEJA 2JLBA 3ND5A 1RLOA 2ADMA 1L3BA 4H3KB 4IDBA 3C45A 5FNVB 3HMKA 1YULA 2F1JA 4M22A 3QG1A 2HUPA 2W8BA 1QNLA 1XTSA 3FGNA 4KO2S 1IZ9A 1YDHA 2IYRA 3AWIA 4H7IA 5E7JA 1NF9A 1F4PA 4LJ7A 4FBGA 1JTFA 2O05A 2XUJA 2C57A 4PC6A 3VHQA 3I6MA 1M2EA 1T2AA 4GI3A 4O1HA 4POOA 3FJOA 4WCVA 4IXNA 2Z2XA 1FDUA 1U63A 4OQNA 1Y8AA 4Q19A 5DTQA 1PG0A 5AUPB 4Q1VA 1VA4A 3NGLA 4P34A 2Y27A 3LGXA 5LYJF 3D6UA 2HN9A 1SC6A 3PE6A 5HM8A 1XEXA 5LDGA 2FX2A 3CKKA 4HJXA 2VR1A 5ILGA 3UWKA 4CN8A 4ENQA 4Z49A 4PZUA 4TTRA 4H6WA 5AM0A 1LX6A 3E7DA 5K8CA 4TOIA 4LYGA 2GWHA 4N65A 3TOCA 2Z3VA 2XDYA 1URPA 4BO7A 1H85A 5EEGA 1YT5A 1GL9B 1OXUA 1BDBA 1PR2A 1IMJA 2E4VA 2IYUA 1IPEA 4PAQA 4TWRA 1SXJD 1HDGO 4GM1A 2A58A 3A2LA 3TQRA 4Y2JA 5KNBA 3SM9A 2XCIA 4ZEMA 2ONJA 1OILA 4H2DA 4RA6A 3DMHA 1IEWA 5TB5A 1V41E 2B1IA 3A70A 3SNHA 1H1DA 3ETNA 4GF5A 3BHMA 3DUFB 5FOXA 3QOFA 4MJ3A 1PUJA 3H9EO 5G4KB 2A0YA 1Z35A 2BZ1A 2TMKA 1U2QA 4RPGA 4OLBA 3R5SA 2WA1A 2WWVD 3BFPA 1O58A 1THZA 3M6MD 1GQOA 3ZBUA 2CLEB 2MYPA 4QDZA 1NMYA 1L8LA 2GYWA 4F6RA 4ZYXA 4ZVTA 3IHLA 5A7FA 3ZKAA 1J33A 3W0LB 2ZYDA 5JSFA 3K9BA 3RS9A 1I9GA 2YHUA 4Q3EA 1Z7WA 4B84A 5ELXA 1R7RA 1XYGA 1KEEB 1S3GA 1XXHA 2A5GA 1QK5A 2TECE 4GXRA 1AGXA 4C89A 2CL5A 1U8YA 2XVYA 3QMPA 2OILA 2ERYA 4EA8A 5LZ9A 3JAKA 1NVMB 1FUYB 2C2WA 4HSGA 4FVTA 2IQIA 1FYEA 3KTAA 4OEHA 4IX1A 3PE3A 3ZZ1A 1V2HE 1FFHA 6LDHA 4DR2B 2MSKA 2NNWB 4JN6B 1C7EA 4NE2A 2Y9MB 4IUDS 1BDMA 2BMFA 3WYFA 1GNVA 3GF4A 1N0IA 1TZCA 4CVNA 4LOIA 1OFTA 1QLWA 1GPDG 5IW8A 2FTKE 4YQYA 4N76A 4NS1A 1XRPA 1XRNA 1Y89A 1YRQA 3S81A 4M37A 4H18A 1QS0A 3LWBA 1OOEA 4HWGA 3R7FA 2B7CA 2YHIA 1M3SA 1HA3A 3E8SA 3O0DA 4HZUA 3ABOB 4B3XA 1XU9A 4J91A 5ICEA 1E20A 3ZZTA 2OQ2A 2EIHA 3IURA 4BZWA 4PAWA 2B4RO 4EL5A 3FVWA 1QRUA 4U7TB 1EGHA 4PBRA 3E3AA 4YUZA 1P61B 2I99A 4RZ3A 2GEKA 2VC2B 4ILEA 3ISTA 4JL8A 3C24A 3EXEB 5IBRA 4NABA 1VFPA 2ONKA 5EEHA 4X1YA 3HCOA 2JFBA 4K6KA 3F3YA 4BKPA 1VJCA 3ZI0A 3L7AA 1SY7A 2EGGA 1GPBA 1GU1A 2FKAA 2D7DA 4DLTA 4XM1A 1SG6A 1VMDA 3RSSA 2CNLA 5I7FA 2VA8A 5IAAA 2HHHB 4GECA 5AJWA 2BE9A 1UBUS 3QVTA 3OE7A 4RFVA 2Z6UA 2Z58A 1JEJA 2JF0A 4I4TF 5AR1A 1KJIA 1K3TA 3BFKA 4XX1A 3AINA 5DB4A 4RTQA 1KEKA 2EX0A 3KE9A 5KOYA 3RROA 2QS9A 2OV1A 4ICIA 2Q5OA 1KEZA 2PYIA 2NV2B 5JG7A 9GPBA 3I32A 4JWTA 3U19A 4QFCA 1KR5A 1PFWA 2C2YA 1EHYA 4EPWA 3I9JA 4EJSB 1SCUB 2PWAA 2J09A 2HPZA 1CUHA 3T3PB 2JI4A 3GEIA 3O74A 3X0DA 2LNDA 3Q0EA 4NBWA 4EA7A 2RGUA 3AVUA 1A9OA 2MDTA 2I2CA 1B4DA 2QJRA 2ZDGA 3NM6B 4FGZA 1C7IA 4HXGA 1MAWA 1GCIA 4ANFA 3QU2A 2P2ZA 5AW2A 2PE5A 1BEEA 1K4YA 1GLGA 2R4UA 2GQ0A 4YCNA 3U4AA 5JECA 4WZZA 2OCBA 4CYMA 4M8SA 1JKXA 5AHRA 4QOGA 2BGMA 3U61B 2GT1A 4R9NA 4MDFA 3K1YA 1DBSA 4GZLA 1WJGA 3OTGA 2BFDA 2CNWA 3QQPA 2VJOA 3BCHA 3K1AB 1KU0A 2WJWA 4MCIA 4UNQA 1U3GA 3KWFA 2GHIA 3G2IA 1H0KA 4Z3KA 1YCDA 1VKOA 1Y6FA 1G8JA 1Z4NA 2O5VA 4NMXB 2JA1A 4UHHA 1E96A 5JZSA 5BN3B 4UVEA 4JSTA 4RHFA 3DEIA 3UT0A 1E6EA 2ON6A 4LZPA 4EKNB 3NATA 4YCDA 1GA6A 2BRUA 3O4GA 1L4MA 4O4HF 2AG5A 4F4FA 3Q2IA 1X8KA 2EHJA 3WKCA 4JR1A 2NZYA 2QLMA 4K8RB 2Y1FA 2JD2A 2AIRA 3KJZA 1OXTA 1SPXA 3OY2A 5JATA 1J2RA 5EJGA 2H54A 3MD0A 2V7QD 1MHPA 3ZHXA 1JEYB 2O2HA 5LMUB 1SBIA 1PJAA 1EX9A 4QPDA 3TB6A 5EE0A 1C9EA 2G6TA 5J4KA 3Q85A 2X5NA 1FMCA 3AI2A 1KVUA 2J3KA 2XXAA 2R6FA 4C0BA 1V2GA 4GP6A 3DZ8A 3M4YA 4MGIR 5BWBA 4PC3A 1BHO1 3A11A 2KLHA 3WRXC 1Q1GA 4PLTA 4D5EA 1EDDA 3NHSA 4QXPA 4RANA 4RF3A 3EVDA 4K6FA 3HCNA 1FFEA 1ODSA 1N2CE 1US8B 3A1EA 4UEWA 1DAHA 1YXMA 1QHHB 1GZHB 2BFNA 1JR2A 2GZ2A 4EA9A 4C30A 5E1MA 5IC5A 1Q19A 3EZFA 4C5CA 2C4WA 3D4NA 4OG2A 1WBBA 3KLBA 1G2PA 3VR6H 1XZHA 1I7LA 2B99A 1H9BA 1TMGE 1Z2OX 1W88B 2PL9A 3OM0A 3TGWA 2QHXA 3BK1A 4JLOA 3T3GA 2VWQA 5JDIA 4GUAA 3MJCA 8OHMA 3LKZA 4FE3A 2P6OA 5AKKA 3H1EA 3U3RA 4B1FA 1W1UA 2O2YA 5LQJA 3KDSE 4MYUA 3SIWA 3F6SA 2FAXA 3UWPA 2FPIB 4MVJF 4JUIA 4CTKA 4PZAA 4MS4A 4MS1B 4QYMA 4XD7A 4DN6A 2GEJA 1DQRA 3TRKA 3W9UA 4WY5A 3WISA 5HIMA 3WLMA 1LBEA 1NFQA 4CDNA 5HOEA 4C2BA 3BQNB 4G5GA 1C3LA 3R4CA 4L4UA 2QTTA 4GX0A 3FTDA 2FHSA 2ZGVA 1QHSA 1J2UA 3K8YA 4J0QA 3IQZA 4AK9A 2JH3A 2F8MA 3NW9A 1Z0SA 4DZZA 2FK7A 3IS3A 4CKCB 1GAEO 2XWJI 2ZYUX 2XIJA 3DFKA 2VTBB 1J5EB 2P62A 3TQOA 3Q7RA 5H81A 1NHGA 3QQ5A 5CJ2A 1FFXB 3R9KA 4L8YA 1OJLA 2XPCA 4WESA 3KVYA 2NV0A 2F3PA 4N3GA 821PA 1I2AA 2A6PA 3DOCA 1GG5A 4LE0A 4OHXA 2CFRA 3WAKA 5JNUA 4MVJP 1B14A 1QPBA 1ZKDA 4PYNA 2J0QA 3Q12A 3FPCA 2BZGA 2O2JA 2V5UA 3TZBA 4MVWA 1JR6A 5A0TA 3NBUA 4BTEA 6ADHA 4FWBA 1NOJA 4HR7A 1WSDA 3V1KA 2RGNA 3ZI4A 1HO3A 4O4IA 1EXWA 1R6DA 5CK4A 1ZRMA 1S8FA 4HB2A 3U62A 2IC5A 2XCLA 3VTKA 3HLYA 1KYWA 4XUGB 1MH9A 4TSKA 3OMWA 4BFSA 2PX6A 3G2JA 2VTBA 1FL9A 2CLSA 3UMSA 1CF2O 1A5BB 4BP8A 4U6QA 3EQ9A 1U7HA 2GJ4A 3UTCA 2JHFA 4PSAA 5EWMB 2WVJA 3IVCA 1P5ZB 1RAHA 1LDMA 3P2YA 1TFUA 3O3OB 1EYZA 1O94A 2FZ4A 3BJEA 1KMHB 1E5DA 3SZLA 4RAQA 2WYUA 4C4ZA 3CRVA 3ZCTA 1MKYA 5LA6A 2A7QA 2AEJA 4MYSA 4V0RA 1QGUB 1T3HA 1VECA 3M70A 4D79A 1XTVA 3I0NA 1LY1A 3H9UA 1T6NA 2LKCA 3RJZA 1PNTA 4MS4B 4N47A 2P6NA 3EZ6A 1ZD9A 3DWFA 4IUYA 4XGRA 3VYVA 5FXMA 1X1DA 2IYYA 3S99A 3SVLA 2I29A 2VI5A 4WNAB 1UXHA 4JQYA 1AH2A 2ZPAA 3DHWC 4ISCA 1AS0A 4BY9E 4BVFA 4W5RA 3GEPA 2CZGA 2XYHA 4U6SA 4B40A 4ER5A 3EQ2A 1KEUA 1M7BA 2HA7A 3BJZA 3KKPA 5EIFA 3ZY4A 1JGTA 2NACA 3EZLA 1MXFA 4YDSA 1LNSA 1BGVA 2BGNA 2X8BA 5KYUA 1V7QA 2LXNA 3G1TA 3RM3A 5GVSA 1QIGA 3PQEA 1IHYA 2JAPA 2V9PA 2O8BA 3GFTA 2OO7A 1NDQA 4NJOA 2AJBA 1JEEA 2IL1A 2QRHA 4P83A 4S1PA 1BXRB 4TKLA 5A5EA 2Q0QA 4PRYA 1LJUA 5IDVA 5C8XA 2VDKB 1ZRHA 4FGWA 2CL0X 4H3SA 2VHEA 4EB0A 1BXRA 1YF3A 1WSAA 4E5UA 3KT3A 3O2NA 2IVZA 2P1ZA 3L5OA 3HE3A 4FTWA 5HA5A 1UXOA 3COVA 4PX2A 5EHQA 4AJOA 1GEGA 2AA3A 3FWPA 4Y2GA 4ZCPA 4WACA 2PCJA 1F1JA 3CLSC 1Q95A 1UAGA 3WV5A 5C8VA 3TTSA 2AG8A 3TTXA 3ZU6A 4MVYA 3JXEA 4K0RA 3SJCA 1TPYA 4E14A 3TLBA 4OM8A 3WSVA 2GTIA 3PFFA 4B6GA 5FAKA 1E2EA 3A3KA 2J6BA 2JJYA 4IKPA 1Y5RA 2JJ8A 3O4IA 4ESVA 4KPUA 2WHYA 4K9KA 1Z2NX 4AP9A 2GBLC 2JBAA 4H27A 1Q17A 4LQ4A 2BBWA 3I3OA 3CJTA 4H4CA 4HH3C 3M4XA 3E58A 1Y3IA 4TXMA 4PN7A 1CJKC 4AKHA 1DJMA 4DLSA 4YPVA 2QJTA 3ZVKA 1S02A 2GBCA 2HA5A 4GLOA 4YP0A 5J23A 5H82A 4HFNA 1MGPA 4M98A 4D9JA 1E7WA 5C35A 2X2OA 3OZRA 1R3DA 1KRWA 3RYHA 5EP2A 3Q7PA 1P1JA 3PDJA 1BJTA 1RJ9B 4JGBA 1DI0A 4BCCA 2IH2A 1MO6A 3ZZ0A 1V1MA 2X41A 3KR0A 1ZVQA 1J8YF 2IW3A 3VO2A 2YRXA 4TMKA 1V5WA 1UM9B 4H0CA 4PC7A 3LZCA 2O8NA 1I6LA 4Y1RB 4F0JA 1H2ZA 1K8RA 4OAPA 1OI2A 3MSCA 1Q0ZA 2DBRA 3HKDB 3KBBA 4I1RA 3AP2A 3BD9A 1Z18A 2QX6A 2XKBA 2PSEA 4EI2A 2QQFA 4AICA 5K3FA 3LC1O 2IU0A 3QHAA 3BN3A 4XFKA 5TPWA 1HDXA 5HBRA 1AUVA 1D2CA 1T5HX 2HCBA 3WMRA 2VK4A 4QBIA 4C4RA 4V1CI 3E9NA 1BVRA 1P4HA 2OLJA 2X42A 3AOEA 3BXHA 4X9XA 5KVSA 4ZAGA 4L3WA 1B73A 2QQEA 5FF9A 1LH0A 2GEBA 4MJXA 4YPFA 2XDWA 1O95D 1HF3A 4LNHA 4LFAB 2GK7A 3NBZC 1IVYA 1XR3A 4RH1A 3TR0A 3NHJA 5AM4A 2IU6A 3U60B 2EIXA 1PT8A 5HFNA 3T12A 1SUEA 3BORA 3IIIA 1O03A 1SBZA 2XMRA 4BU1A 2BFMA 1TZBA 2ZS8A 4LHXA 2I54A 2A5LA 3VR5D 5SYAA 5JQGB 1NVEA 1P2TA 1QPZA 1GA1A 1G20A 1DKOA 3W7VA 1DC8A 3IVXA 5IRCD 1ISRA 2JCVA 3ES9A 4D9FA 3BZBA 5JSYA 1N2JA 2PR2A 3WP1B 3W8RA 4Y9RA 3C3PA 2D5IA 2F2TA 2HWWA 3LF1A 2J87A 3JASA 1H2YA 2WB4A 1GQRA 3IXMA 4KEAA 4LG1A 5DJ5A 5HQ3A 1G21E 3BMCA 4FOTA 2GEFA 1NLUA 4P7GA 3MCVA 2G5CA 2X0NA 2BP7B 4JP3A 1FP2A 3E18A 4MWEA 5FA5A 2B35A 1VZ3A 1QH9A 1FEZA 4ZV9A 2XNHA 3BT7A 1IXYA 2RHLA 2C59A 3P27A 2W4QA 2VJNA 3FW1A 4N39A 5KB3A 1LFAA 1R66A 1RJDA 2QD2A 2UYYA 1A4RA 3GLHE 4KG7A 5BV2P 2G0NA 5EJIA 3OPXA 4N3BA 3IT3A 1T3TA 4DQDA 4EG3A 2JGEA 1CS0A 3SE7A 4YRKA 5DHTA 2YJ6A 3AVYA 3ZWDA 3OTWA 2OC4A 1TF5A 4AYWA 3L1UA 3V6MA 1NQWA 4G9EA 3BSYA 4Y2TA 2H1FA 3T7IA 1OXXK 1QYVA 3OAAA 3H83A 3NHMA 3NWOA 3K5HA 1UBCA 3MWEA 3UK6A 5K6RA 3P4YA 5LOVB 4OQLA 2JLRA 1SC9A 4I6JA 2KLBA 2DHRA 2PWYA 2QD1A 3AY6A 9LDTA 3I92A 4DV2B 1SCDA 4I4CA 5J3JA 2AMVA 4OBXA 4RWZA 4PYJA 4FOOA 4UE2A 1ONNA 3P1JA 2PFKA 4ODIA 2ZVJA 2FP4A 2QDKA 1E7SA 1SBCA 5BMVA 4LXYA 3K0CA 3CMMA 3GG2A 4HLCA 4OU4A 3V2HA 3NDBB 4LE1A 3UUGA 5HE9A 4AW9A 3AIKA 4CL8A 4RSHA 4ZT5A 2BM9A 3LQ2A 2HQRA 1IWPB 1NUAA 4RNDB 1GFSA 2IEIA 1T5LA 2VSYA 2DPHA 3MUOA 4P3OA 3TQIA 3QOWA 4XRGA 1QPGA 2Q8PA 1AB6A 1WB6A 4GPTA 2C5SA 4J29A 4W6ZA 1EFDN 1MV5A 2W0MA 1L5HA 3KJHA 4MVCA 3TX6A 1G9TA 4R0VA 5JBIA 2P67A 3A05A 4UTXA 4BMCA 1IBKB 4BLWA 3DE7X 2GJ8A 1TCBA 1NW7A 1JU3A 2B21A 3ICWA 4TWJA 5AM3A 1ISIA 2MSLA 3QFFA 3ZXSA 3KKZA 3H1TA 4HFMA 2WYOA 4HYEA 1XE3A 1UEJA 3MWEB 1QB8A 1ZN8A 3D1LA 5DPMA 1TX4B 4OXKA 3V00A 5EE9A 4YR7A 2QP9X 4Z4HA 2W2KA 2UXDB 4GDMA 4U6NA 2DHDA 3ET4A 4I36A 2D1SA 2HZ7A 3NDRA 1A97A 2YN2A 4GVPA 3IJEB 4FMPA 4AO7A 1E2BA 1UDBA 1S2LA 2BDEA 3W5HA 1W85A 3EF3A 1JXOA 2MR5A 4Q7LA 4GZ6A 4H9GA 3IMCA 1FQJA 1TJ3A 4RPHA 3WS7A 4DYDA 4E1VA 4XSVA 4GT1A 4MRMB 5DI3B 4UNPA 2BVNA 5D3ZA 1PYGA 2GPBA 4N8SA 4YP1A 4HLUC 4X3OA 4HTFA 2WPDA 4L4RA 4QBKA 2PZBA 3WDLA 1L4EA 2QNRA 4ZYUA 2IV7A 5EJEA 2FR0A 4A8JA 3KB2A 1P5RA 2NYAA 4MWOA 1FU8A 2VH1A 3ZU4A 4F85A 1T3SA 1Z68A 4WPGA 1DDOA 2WM9B 3DLAA 3WWYA 4BRWA 3AF6A 1NP7A 2BMJA 2YCLA 3OQBA 2HA2A 1CW2B 2MSCB 3AR2A 5CHYA 2K4MA 3WK9A 2LRHA 3HGMA 5E0OA 4A7PA 1O89A 1A5TA 3NRCA 2XIQA 5H3CA 4RADA 1CEXA 1KSHA 3RR2A 4KPEC 4LXUA 1RI4A 1JA9A 4UUOA 2XSZA 4I2NA 1A27A 4L4YA 2FYTA 2RCYA 4RH3A 3PUKA 1FP4A 5ALFA 2AI2A 5AUQA 4DEYA 5IKXA 1VL0A 1C1DA 3L7IA 1WXGA 1X1CA 2ZUUA 4I9UA 4AT1A 2H7VA 3DPIA 4M9SA 3IX7A 1PEKE 4XQ9A 4QC2A 1ZG3A 1ZK4A 3BK7A 3T3EA 2A1IA 3HMQA 2Z08A 1R6UA 2O57A 3BUSA 2PXXA 3QLEA 1A8QA 1K7CA 1R10A 2WBLC 3T95A 5ALYA 2QN2A 1VDMA 3TQFA 3ONEA 5FP0A 1NN1A 3NM5A 3SZMA 3DMYA 2ACEA 2Q9CA 2R8OA 1SXPA 4B31A 4GO1A 1DEOA 1ODKA 1L5NA 3T1QA 4ZANA 4IQ8A 1L9KA 1X77A 5A3VA 4U2DA 3ROGA 1ADCA 1JG4A 3ITNA 3AO0B 4X85A 1M8FA 1PK8A 4KYIB 1J9GA 2GTPA 1XAIA 4BMYA 2W93A 3MVEA 1XLTC 1T29A 3D7RA 1YCGA 4FLEA 4NZZA 1SKYB 1Z6YA 4JUFA 5EMNA 1E1QD 3GLIA 1EUQA 4X3CA 2BLNA 1SXQA 5IT4A 3R9XB 1YI0A 1STOA 2PYDA 1TU0A 4R69A 1UJ4A 4UU7A 3V8NA 5TARA 1EWYA 4B85A 4C0XA 2C31A 4A8TA 4FGKA 1E66A 1RABA 2PRYA 5IAGA 3EG9B 3X43A 3DFIA 4YIHA 1WDLA 2HBZA 5ETJA 4JY7A 3HEBA 3WLQA 2FMUA 4IUBS 1X7ZB 4ED9A 1FSZA 2ATXA 1SCKA 2WICA 1K7YA 1ZS9A 4ZEXA 4DRZA 5BUSA 2QL7A 2RB5A 1DO2A 1SBQA 1T4MA 3BD8A 2SKDA 3I4LA 5L7WA 4RMJA 2JFOA