2HK8A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus at 2.35 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
266
Chain Sequence
b'MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate dehydrogenase
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
total genus 88
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk8A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk8A01
1E5LA 2UUPA 5A9SA 5MGBA 1H93A 4WGGA 3WLEA 1YS4A 4OSPA 3RU7A 1TXGA 1N7GA 5CDYA 3RIHA 3TSCA 4G2NA 2DAPA 4ZRMA 1O94A 2VRBA 2WYWA 2VTDA 3GR6A 1R0KA 2PNFA 2P4HX 3RD5A 4IM7A 4IS2A 3WMWA 1V8BA 5FFFA 3DHEA 3PK0A 1E3EA 2B4QA 3PWZA 2NVUB 4RJTA 1ULSA 4CMEC 3GQVA 3E03A 1LA2A 3OEWA 1U4OA 2XXBA 1HDYA 3IUSA 1ZSNA 4BNXA 2ZQZA 4BNZA 1LX6A 4RL6A 3ZWWA 1U8FO 2ZB7A 4RF4A 4Z0PA 5K6AC 2RBEA 5L3ZA 3OJLA 1ONNA 2BGKA 2VOEA 3CIFA 3VH4A 5T6BA 2QYSA 3GUCA 3WFJA 1LLUA 1VKNA 1OBFO 4NMHA 2PK3A 1PJSA 2TMDA 4ND3A 1XDWA 3WX0A 3FR7A 4IPTA 4R9RA 5AYVA 1LSSA 2VWGA 3H5AA 3TL3A 4CLRA 2AMFA 1EBFA 5TLSA 2YDXA 5TQVA 4EEXA 2GSDA 2X5OA 2FPGA 1XA0A 4ITUA 4JQCA 3E6AA 2ZTVA 1DOHA 3L4BA 1YRLA 1PQUA 4A27A 4CQMA 1E1KA 3UCEA 3PDUA 4ZA2A 3OA0A 5ICSA 1M66A 4R5MA 1MX3A 3NUGA 3DOCA 5G0VA 4BO8A 1KEUA 3S2IA 4R3NA 2I5PO 2O3JA 3WOHA 3DBHA 4ZJUA 4RF5A 1P44A 4Y8VA 1NFFA 1E7YA 3HDYA 3OJEA 4P4NA 1BWSA 5JW6A 1IULA 3B70A 3DBRB 1EUDA 1HYGA 4IMPA 3ROPA 2O23A 2W2LD 3WGHA 2PZLA 4BIIA 2GASA 3P2OA 2QRJA 3R6DA 5DCUA 1QMGA 4AJ4A 4DA9A 3K9QO 4FD3A 3IKTA 2VNAA 3HN7A 4WEQA 3O9ZA 4YA6A 3VZQA 1XKQA 1TB4A 4D0SA 5G4KB 3NJ8A 5ER9A 3T7CA 4HBGA 2ZCVA 3LU1A 1LRLA 2NUAA 1DFIA 1WP4A 2E48A 3JQ7B 1BVUA 4PG8A 2NNLD 4J4HA 4RVHA 4LK3A 4CMIB 3WSWA 3GZNB 2C2XA 4HNGA 2I66A 3KB6A 3DZKA 4ALKA 1KIFA 1Y5RA 2CZCA 3GNQA 1IZ0A 2DBQA 2J3KA 4BMVA 5KVCA 2X5JO 4QX6A 4B4OA 3LLVA 2NVBA 7MDHA 1GEGA 4YT5A 2O50A 1C0KA 3SEFA 5JDCA 3ROMA 1WDKA 3CXRA 1K6IA 3R3SA 4GMFA 5FWNA 2PD6A 1ONPA 4AICA 1VL0A 4XYMA 2VTEA 1OZAA 3HDJA 2GNAA 2NTNA 4CM9D 1GU7A 4DLAA 4I08A 2NWQA 4WNIA 2HO5A 2WSBA 2Z95A 5TNXA 3JQAA 1PR3A 4WJZA 3KV3O 3ABIA 3NTOA 2GZ1A 4OHUA 3KETA 1UZLA 2O48X 1P77A 3OJFA 3RKUA 3GN1A 2AW5A 3BZUA 4CV0A 3BA1A 5L9AA 2BHLA 4RGBA 4UUPA 1ISGA 1E1NA 1N2SA 2NQTA 3TF5A 1D1SA 4CLHA 1J49A 1XGKA 2PGJA 3TWOA 1DIGA 3RBVA 3NT4A 3DR3A 3CH6A 3ADOA 5LDHA 4RPLA 2Z1NA 3WNQA 4AG3A 1DBVO 3HZZA 3SJ7A 3IJRA 2ZB8A 5CDUA 4I5DA 2FR8A 4NK5A 4AJOA 1H0KA 1GZ3A 3HE3A 3SJUA 1P31A 1PL7A 3JSAA 1CJCA 1QV7A 4Y6PA 5I7VA 3OIDA 1VSUA 4E31A 1VI2A 5GZ6A 3RU9A 2HMWA 4EUFA 4KDFA 3TZKA 1DSSG 2WEKA 1KEWA 3C8MA 3CZMA 3C7AA 5JAIA 1ADBA 4YB8A 1PJ4A 3OF2A 4FJ2A 2D5AA 1LEHA 1YKFA 1JAXA 1SBYA 3TN7A 1NQAO 2AEFA 1ZZEA 2Q46A 1HTBA 4FN4A 2DC1A 2YQ5A 3LVFO 1HDCA 1XG5A 1PWXA 2EG9A 5C3MA 3PHJA 4K9DA 1CDOA 4IJWA 4N5MA 3R3JA 2HLPA 4UULA 4CUKA 1XU7A 1MGOA 2X5KO 3EUWA 1QYCA 2HQ1A 1EFLA 4MOWA 1IHYA 3FTPA 1PU2A 4CL3A 1PGJA 3SX2A 4E2YA 1BTOA 4E2WA 5I7FA 3WB9A 1RKXA 1J4AA 3AI1A 4FGWA 1YDWA 3OJOA 4BO2A 4N7RA 3NYWA 1R66A 1VM6A 4JBIA 4R69A 5CG2A 3H5NA 3R0IA 3KHUA 3FNGA 4CM5A 1UP4A 5TJ9A 1YDEA 4BOYA 1UDBA 1NQ5A 3C1TA 1YL6A 2WYVA 3FD8A 3BMQB 4BKRA 2D0IA 1E3WA 3AM5A 4KQXA 3INGA 3HQ4O 3DHNA 4CMHA 4B8WA 2VN8A 3AW9A 2EXXA 3G17A 1MV8A 4XEHA 3WXBA 1DC6A 1BXKA 2JKVA 1BSVA 2BMAA 3B6ZA 5B12A 3BMNA 4NNJA 3GOHA 2AQHA 1BHSA 1ZK2A 1UXHA 3D4NA 3PJFA 4MVJA 4MP8A 3ZU4A 2Y1CA 5ILGA 3K30A 3WSVA 1UZNA 5F1KA 5C7LO 1XR3A 1P1FA 3H9EO 1Z75A 3JD1A 4ZD6A 4BNTA 3JTMA 1PJ2A 1G6KA 2PKQO 1Q0QA 3ZCXA 1NR1A 1X14A 3VZRA 5EPOA 4GKVA 1XQ1A 3CUKA 2A92A 3CKYA 4WECA 3TNLA 4YRBA 4OKIA 3HJAA 1H6DA 3BIOA 3HNPA 4Z3DA 2VOJA 5JO0A 3NAQA 5FI3A 2DPGA 5FYDA 3I6QA 3WGOA 4CM7A 3WGGA 4M87A 4YJGA 3KUXA 3GAFA 3JQBC 2FR1A 2ZJ1A 5DBFA 5A3VA 1FDWA 5A03A 2H1SA 4HXYA 4P8RA 4XIYA 1KEPA 1W73A 1D4FA 1YVEI 3BHMA 4OOEA 5JYDA 1EK6A 2W2KA 4IQGA 1RM4A 2IZ0A 1DIHA 1GPJA 3KBOA 5G4LA 3RFTA 1QYXA 3GHYA 2NTVA 1EUCA 3GMDA 2P91A 4WLVA 3PYLA 4WNCA 4NFYA 4CR8A 4OYRA 1QYWA 3ZWPA 1D8AA 3JQGA 6ADHA 3ETEA 3S8MA 1A27A 5JCJD 3AY3A 1O0SA 3DZGA 3Q1LA 4Z9FA 1EDOA 3F4LA 2VZ9A 3QHAA 4A26A 3EVNA 1CERA 3QA9A 2Q50A 1RJWA 3GAZA 4PLWA 3ASVA 3MWEB 4CM1A 4OXKA 2O7QA 1QLJA 3FNHA 5DNAA 5AXDA 3VH3A 4H3VA 1DPGA 3PQDA 1BXGA 3N58A 4NJMB 2VHWA 5CPBA 5DDIP 3CINA 4XRGA 1Z6ZA 2C82A 5AXCA 5IZCC 4YYZA 3BMCA 2V7PA 4BKQA 4GBJA 4YJFB 1N1GA 5DULA 3RJ5A 3ZWNA 4XYLA 1DFGA 3SXPA 5L7TA 3I3OA 2JFGA 2VHVA 5CEJA 4GLOA 3ETGA 1NHGA 4L4SA 3D4PA 1U3UA 2FHSA 5HBRA 1PZEA 3UH1A 4GX5A 4HKTA 3PIIA 3T4XA 1GYRA 1RM3A 3E9MA 4J6FA 5KCZA 3ICCA 2YJZA 2GD1O 2J5KA 5TSDA 4R9SA 2ET6A 3H3JA 1GUZA 5I8WA 1V3VA 4DIBA 2R2GA 4R3WA 5HRUA 3I4FA 2YW9A 1C0IA 4KUHA 1ADGA 1QRRA 4J2OA 2CVQA 1HYHA 3Q2IA 2X0NA 3VDRA 3L6OO 4IXTA 2AHRA 3O26A 4HX5A 3H5RA 2GN8A 4Y98A 3UFXA 4YRAA 1J6UA 3RWBA 3EMKA 4QUKA 3V2GA 5COQA 5B4UA 1B3RA 3AWDA 3HFSA 2X9VA 1SB8A 3UUWA 2FP4A 5K9ZA 3ONDA 1D1TA 3V8BA 4HADA 3V5NA 4OOFA 1ZK3A 3WFIA 4MIYA 4XGIA 3PJDA 4YBZA 3RUIA 3KYBA 1SOVA 4LGVA 1DHRA 3DHYA 4DPKA 3EC7A 4RF3A 4XWYA 4B79A 1GQ2A 2HJSA 5A04A 3IJPA 5IXSA 3KSZO 5T67A 4IIUA 1G0NA 2D4AA 5AXAA 3OICA 4BVAA 4CJXA 5A9RA 5IDWA 4CV2A 3IAHA 1WWKA 1P33A 3C1AA 3HDHA 3E1KA 1PX0A 5EL0A 5BSEA 2ZYDA 3Q11A 2GPTA 1HZJA 3ZHXA 1LDMA 4QXMA 4Y6RA 5FEUA 2DFVA 1HEUA 5KJCA 4J4TA 4II3A 4U8GA 2V6MA 5CDSA 3OIGA 5JO9A 1V0JA 1HRDA 1MUUA 1DC4A 4RZHA 4Y6SA 4XYEA 2VYNA 3PYMA 2Y93A 1X15A 3O4RA 1DAPA 1YQDA 1X0XA 4E30A 2W98A 3LT2A 3DAGA 2E82A 1KERA 2YHUA 1DIAA 2OZPA 4ND5A 4ZHSA 3DZHA 5H81A 3W8EA 4YT4A 2BELA 4HFNA 4LRTB 1NBOA 1Y8QA 2P5UA 2VWPA 4HFRA 4IJVA 3VVCA 4LSWA 2NU9A 4RPGA 4MVJI 3U4IA 5HS4A 2JD2A 3KSDO 3S2EA 2XOXA 5BSGA 1LC0A 2CD9A 4Z3KA 3MJEA 3EHEA 4YT8A 1LUAA 1YB4A 3ZHYA 4BUCA 1XCBA 1LU9A 3WQSB 4DPLA 1DDOA 1WLYA 4TMFA 2B0JA 2R00A 5L7YA 1MG5A 2G76A 1D7OA 1ZEMA 3WGYA 1SB9A 4PLHA 1A4UA 4OL9A 4C4OA 4FJ0A 2Y1EA 5ES3A 3GN2A 4PLPA 2DBZA 4LMPA 5TF4A 1YBAA 3BTUA 4I9NA 3RAJA 1E7SA 2GGSA 5BNTA 3VAZA 1NXQA 4EJ6A 2I99A 3STHA 1BXZA 1E3JA 5U4QA 3DMTC 1SPXA 4Q39A 4XIJA 1W4ZA 5DBGA 1Q0LA 3VH2A 3WGTA 1FXSA 2X86A 3WGZA 2ZYAA 1A71A 4DPMA 1GFSA 1TA4A 3K6JA 4BO7A 2JFHA 3U9LA 4L4RA 4JK3A 4IINA 4KQWA 4KTVE 3F6YA 1Y6JA 4I9HA 4YT2A 4RLHA 1QR6A 4YR9A 5AOVA 3QVXA 3KEOA 1GAEO 1CF2O 3WWZA 3AUSA 1PEDA 1ENPA 3B1FA 4QT0A 4XR9A 4NR0A 4Y9DA 1JA9A 3T7EA 4WLUA 2ZQYA 2EGGA 4ZQBA 5TGDA 2QRLA 3ITDA 1I0ZA 3HSKA 4PN3A 5ICMA 4BO5A 1QP8A 2GF2A 3RUAA 4L75A 3DBLB 4YWJA 2QG4A 2QQ5A 4OQYA 2J8ZA 4D79A 3KYCB 3MJSA 4WCDA 1CRWG 2I67A 3JQ6A 4MIEA 1ZSYA 3LT0A 1GUYA 2IZ1A 1DAOA 1H9AA 2B4TO 4KUGA 3ANNA 4IDFA 2DUUA 1HXHA 4G65A 1GUFA 2CF6A 4F3YA 3QVWA 3TRIA 1Y8RA 3ZWVA 3VOSA 4JLWA 3UKOA 3RCBA 2OUIA 1TEHA 2OFPA 4R1SA 3HHPA 4B3JA 1T2DA 5L40A 1HDRA 1T2FA 1YJ8A 3TZ6A 3GMSA 4IY1A 3O8QA 3ONFA 4DMLA 7ADHA 4QO8A 5IDQA 2BF7A 5JY1A 2G1UA 3GVXA 4UAGA 1RM5A 1SNYA 4PG4A 1V6AA 1WAMA 2LDXA 3AOEA 2YQ4A 5GMOA 1LLDA 4GL4A 4E5YA 2J3JA 3RC1A 2SCUA 4A0SA 1PS0A 5L4LA 1YJQA 4OQZA 1N92A 3H7AA 5BR7A 1B26A 4P22A 1DIRA 2I76A 4URFA 4XQGA 2Y1DA 1P1RA 1QLHA 4UEOA 3I6IA 5IN4A 3UAGA 1CEQA 3A28A 4WKGA 1ZW1A 2X0IA 2WMDA 1ZMTA 2O2SA 3DXFA 3EDMA 1ZK4A 2YHIA 1QORA 3ZH2A 3VTZA 3UXYA 4GLLA 4A5OA 5DP1A 4R16A 3VDQA 4J9VA 3ZV3A 1SOWA 3KLMX 3VC7A 4P4GA 4W99A 4MVJH 3S2GA 4BQPA 5JC1A 4R68A 2A35A 2IEDA 4HNHA 3WQRA 3MJVA 4HFJA 3VZPA 4XGNA 3U4HA 1LDNA 4UVHA 3ST7A 1UH5A 2VRCD 4OXNA 4Y67A 3D64A 3ZU2A 1GDHA 1UR5A 3NDIA 4ND2A 3W4KA 1Q0HA 2WDZA 2GR9A 2X6TA 3IIEA 3DOOA 5JYEA 4EUHA 1EE9A 3GDOA 4JXKA 1EK5A 1E7MA 3SBOA 3LF1A 4YAKA 1U3WA 2QRKA 5T8KA 1V35A 1LSUA 1UJMA 4BMSA 2GYYA 4B3IA 4BGEA 1H9BA 3NT2A 3LT4A 4FJ1A 1DLIA 1Q2XA 1FDTA 3JQAD 4NI5A 3UGKA 1LJ8A 1N5DA 2DLDA 3WBBA 1E6WA 1VKOA 4MKZA 1G0OA 1MXFA 5JY6A 2PGDA 4JBHA 4PRLA 4TKMA 3B1KA 3S55A 4EBFA 3DFZA 3S2FA 3ZN2A 4TRMA 2WE7A 1QKIA 1NVMB 1J0XO 3AUTA 1ZK1A 4R1UA 1KBZA 2IYPA 2NLOA 5C5IA 4J0EA 5GY7A 2EKLA 4WK6A 4CLXA 3VPFA 1OFGA 3M1LA 3EZLA 3RUDA 2AE2A 4E2XA 4E2ZA 1RPNA 2BI7A 2UUOA 3G3EA 4LN1A 3ZNNA 1TT5B 1GZ4A 4RVDA 2FSSA 4YAEA 4O6VA 1EQ2A 3W4IA 1PJCA 4R54A 3GEDA 4UVEA 2OO5A 4OM8A 1F0YA 1R4MB 4J1QA 3E9QA 3D5TA 4M49A 3WGQA 4J9UE 3NKLA 3JQFC 4M55A 2VUUA 1I2ZA 2JAHA 4GPD1 1Z7EA 4E5KA 3FNFA 3D5QA 5JMWA 4WASA 4YJHA 4DXHA 3KYDB 1OAAA 1BGVA 4EYEA 3H65A 2YY7A 1HYEA 1XLTA 4PCVA 4H7PA 3FNEA 1E6UA 3W4JA 2CMDA 4JNKA 1WDMA 3IC5A 4UUOA 3AJRA 4I5EA 1OI7A 2WD7A 2YV1A 4BO1A 2JFFA 1WZEA 4NIMA 3E8XA 2CFCA 4CR7A 5IDYA 1IPEA 4JJFA 5HA5A 2AEMA 1GEEA 3CMCO 3JQEA 4XRRA 2Q1WA 4RCVA 1PZHA 4IS3A 4UUNA 2EW2A 1R4NA 2ZKLA 5L45A 1NYTA 2VUTA 4NDNE 2FMUA 2DQ4A 4FSHA 2RHRA 4NU5A 1QV6A 2ZYGA 4AJEA 3GHHA 3PGXA 5L95A 4CODB 3D7LA 5G0SA 1DRVA 4PGFA 1YB1A 3GF4A 4J90A 3AK4A 4H16A 1I01A 5T57A 2RCYA 3SLKA 3CZRA 1BG6A 1Z73A 2YUTA 4OIMA 2PKRA 5L53A 4D44A 4NU6A 5KJEA 4LSMA 4B8ZA 1AXEA 4KMSA 4BB6A 3GGOA 4ZQFA 3GFBA 2B5WA 4XYGA 4FDAA 4K28A 2Y68A 5IXYA 5CHEA 5JDIC 1QSGA 3B1JA 3AY7A 1YBVA 1EMDA 3H9QA 1E3IA 2X8LA 4RV9A 2WE8A 4NBRA 2E6UX 5LCXA 3UW3A 1GQYA 2C7VA 1ZKMA 1L7EA 4CQLB 2PV7A 2IZZA 4Q3BA 1B3BA 1CETA 8LDHA 3DTTA 3GY0A 1PGPA 3T4EA 1G1AA 4D0RA 1KOLA 1RYEA 4XYBA 4CM8B 1P0FA 1N9GB 4AJ2A 3OQ6A 1MA0A 1U7HA 4D3DA 1U7TA 1JU9A 3TOXA 1JKIA 1UXIA 1VJTA 1W8DA 4CLOB 1FK8A 4RLSA 1A9YA 3BTOA 2G17A 2GDZA 3GVHA 1BW9B 3TQHA 1T24A 3GEMA 1I5RA 3QLJA 4FC6A 2BLLA 3UN1A 3AM4A 3ZWMA 8ADHA 4DQXA 4P38A 5C7OO 3VPHA 4BS9A 2ZTLA 5EERA 2HJRA 1F06A 1YOVA 3P2YA 3OBBA 2R6JA 4JX8A 1E3LA 4DBVO 3IL2A 3GGGA 1PJBA 1M75A 4MKXA 3AI2A 4HUJA 1LRKA 1ZXBA 2B37A 3AM3A 5U9CA 3AOGA 1E6EA 3I23A 1Y8QB 3RUCA 5JBIA 1PGQA 5CDTA 4W7HA 3JQDA 4FOSA 3EY4A 1S7CA 3DC2A 3QY9A 4FBGA 5JPIA 4CUJA 5KNLA 1Q1NA 1NVGA 2C07A 1MP0A 3VPXA 5JLAA 2B5VA 1GQQA 4EI2A 3FPLA 3H9JA 3H2SA 1EDZA 4J0FA 2C7GA 2GERA 1X7HA 1F8GA 3H4VA 4FS3A 4J7XA 3F47A 4NBVA 5ENVA 3D3WA 5A5EA 5GZ3A 1ZO8A 1KC3A 1U2DA 2Y0DA 2VHYA 3BYZA 2D5CA 4UEJA 4D7AA 2X58A 4CM4A 3WIDA 3JQ8A 3LC1O 2EJWA 1Q7CA 1V9LA 4FFRA 3CTMA 3O03A 4RVUA 4E5PA 2GUGA 4N5NA 5JSFA 4WCFA 2QIOA 3QWHA 2P68A 4MVJE 2FOIA 4CMJA 4A03A 1XIVA 4IQ0A 3PVZA 4JCOA 1PS8A 2W8ZA 4IDBA 1C1DA 3QE3A 4GQAA 3MOGA 3U5TA 4ZICA 1FMCA 3F9IA 1C1XB 4PIVA 1JDJA 4JP3A 5GZ1A 4N18A 1U4SA 4R4JA 2CDCA 2VYVA 4IBOA 4YTEA 5G2OA 3PQFA 4E21A 1W0CA 2FRDA 4U5QA 1O89A 3JD3A 4BMNA 1MC4A 2ZATA 3RSHA 1T2AA 2NM0A 5EJ2A 3ZGYA 5A06A 1IZ9A 3OETA 4TQGA 1DB3A 2FZWA 2Q4BA 1KVTA 5A05A 4MP6A 3TZHA 3OH8A 2IEBA 1ISJA 1PGOA 4O0LA 4FR5A 5JMPA 4QSMA 1PL8A 2OORA 1N8KA 3JQ9C 4J49A 1I3LA 3IMFA 4Z0HO 3F5QA 4IJUA 1U3VA 2HAEA 4BNIA 4EUEA 5IG2A 3DTYA 3JCZA 4BKUA 4CL8A 1U8XX 2FZEA 4PVCA 4ZRNA 1B8PA 3GT0A 1PJTA 4EW6A 2W2LA 3RC2A 2CY0A 4HP8A 3O38A 1Z74A 3QWAA 5FF9A 1SC6A 3U4DA 1E3SA 4JN6B 1O95A 3A14A 3FCOA 3DAPA 5B37A 4BNLA 1NFRA 5COAA 5DF1A 2JHGA 5K0ZA 4I9UA 5BSFA 4CLDA 3QW2A 3QWBA 3IS3A 2O2YA 4W9NA 4DUPA 5KJ6A 3GNTA 3NTQA 2VHXA 2YDYA 5CP8A 1H2BA 2PY6A 4PLGA 2Q1SA 1UDAA 1YO6A 2HKIA 4LRSB 1B2LA 2TMGA 2AXQA 5EN4A 2DBRA 5KKCA 1FJHA 4F46A 3LDHA 2D59A 1EVJA 2POQX 3TPCA 3PZBA 2YV2A 1F14A 4YDRA 4EZBA 1YBMA 3ADPA 3WR5A 4WLEA 2AG8A 4ZN6A 5A02A 1SMKA 4BNYA 1NWHA 3BMOB 3M2PA 3FWZA 5THQA 1PQPA 3DB2A 2RH8A 3L4SO 1U5CA 3MJ4A 3RC7A 1ORRA 2BH9A 1JVSA 4QO7A 3IQDB 2DFDA 3BTSA 2CUKA 2I3GA 1T1RA 3V1TC 2NVUA 1EQUA 3I83A 4RQUA 4B4VA 1NTOA 2DU8A 2Y67A 2OL4A 1EVZA 2BFOA 1PJQA 4CR6A 2C59A 5JS6A 4RO0A 3W8DA 5F5LA 1DRUA 3ROQA 4NH4A 2O4CA 1AUPA 3ENNA 1MFPA 2EP7A 2WM3A 3WYCA 2EHDA 2Y1FA 1LSOA 3TOZA 2W4QA 2C5AA 2PA3A 3WICA 2GN6A 2PD3A 4E33A 1DLJA 2QHXA 3DMYA 4YVFA 1CQJA 1PL6A 2JD0A 3LC7O 3DL2A 1RYDA 4L76A 1T26A 2O7SA 4TRRA 5JXWA 4IGFA 2BI8A 5A9SB 1EE2A 1I32A 2E37A 3JYPA 1M67A 1ISIA 3GRKA 3JQCA 2XF8A 4BNKA 5IAAA 3KXDA 1AN9A 4BO9A 1L1FA 4BNFA 3NDJA 4BO3A 2VNSA 5KOIA 2Z5LA 3AUAA 1NPTO 4DC0A 2Y1GA 4NPCA 5LC1A 1QYVA 2HCTA 3L4BC 3NJ4A 1BDBA 4NBTA 4XD2A 4ALMA 4NZ9A 3ZV5A 4CMEA 1I36A 2YYYA 5ILOA 1XHLA 4BV8A 3X2EA 2V65A 4BNMA 3DBVO 4KOAA 4PLZA 3DBRA 1IB6A 5K6AA 4RPJA 1U3TA 3CPSA 2IODA 3SC4A 3ZZNA 3MTJA 4Q3EA 4D46A 2DKNA 3PPIA 1UP7A 4R51A 1BMDA 1YE3A 1V3UA 1ZK0A 5A5FA 1GY8A 4EJ0A 2NACA 1ZFNA 2Y0CA 3G1UA 3L6DA 3OECA 1GADO 4ILKA 5BT9A 1SO8A 2Y99A 3INTA 3W8FA 3WJ7A 2UVDA 3C7DB 4LCEA 1NR7A 4Q9NA 5COBA 5G4KA 4BGUA 2EGHA 1EVIA 4CLRB 4GMGA 4B7CA 4CMGA 1XWFA 5F1PA 3JQ7A 1H5QA 1UP6A 2RIRA 3OFSA 1Q7GA 4CMIA 1R16A 3GZNA 4G5HA 3E9NA 3WQQA 4CQMB 3ZI0A 2VT3A 4L9RA 5ITVA 2O3SA 1VJ0A 2HMVA 4XB1A 1JKFA 1F17A 5DCYA 3DBHB 5EQFA 1MFZA 3TFQA 3FTNA 2D3TA 1PTJA 3I9KA 1SZJG 3UOGA 4WE3A 4IUYA 1XQ6A 1PS9A 2ZTUA 2NSDA 4U6SA 3GVIA 4J43A 3FR8A 3VZSA 1CQIA 3ON5A 5JDCC 2O3TA 5F5NA 3MJCA 4TRNA 4CM3A 2XXJA 1T1SA 2BGMA 3I9JA 3RBZA 4O63O 4HFMA 2NV6A 5JAQA 3DZBA 2ZK7A 2OBYA 3BXXA 3M1AA 3PLRA 3RJ9A 3DZFA 3ZNPA 1NWCA 1ARZA 2A94A 3ITKA 4PLFA 1XSEA 4BO6A 1I3KA 1DJQA 1WXDA 3ONEA 1ULUA 4RVSA 4RQTA 4GWKA 4W7IA 4YPOA 3HB4X 3L07A 3MZ0A 1R37A 1WPQA 4GX2A 1LDYA 1B0AA 1JWBB 4XB2A 3E5MA 2VUSA 2DM6A 3ZHBA 4PLTA 5L51A 3GZ4A 1JKJA 2P9CA 2ZCUA 3D1LA 4NQZA 1J5PA 2IXAA 3G1TA 4XX0A 3F4BA 4D43A 2C2YA 5TT0A 3FF4A 1KS9A 3GVPA 2P9GA 3GDFA 3I52A 5L4NA 1IOLA 1U5AA 2FY8A 1ENYA 4M1QA 1PJLA 4TSKA 4P4LA 1PJ3A 4BV9A 1CIVA 1HLPA 2EW8A 4UEKA 4XJSA 5JCJA 1K6JA 4LVCA 4U6QA 3ORFA 4FB5A 5IDXA 1ZIDA 4NFSA 3LZ6A 4ZQEA 4MJLA 5JCXA 3JQAB 5HWSA 3UHAA 3S1LA 1N1EA 1XELA 2PD4A 4XQEA 4DRYA 3WYEA 4GX1A 1M6WA 3U4CA 3G0OA 1ZVMA 4PZEA 5CDGA 4W82A 1HDXA 1ZXLA 1TT7A 3F1LA 4DVJA 5BNIA 1I30A 3WJAA 5KJ1A 2Q49A 1IY8A 3ENKA 4JGBA 1B15A 1F8FA 2BFAA 4LCJA 1UUFA 5I7SA 3EGOA 1BDMA 1EVYA 2OBNA 3D0OA 3WTBA 4B4WA 3VVBA 2VWHA 3JD2A 3PJEA 1UZMA 5A1TA 2OOSA 3PHLA 4JJIA 1T25A 2XPCA 3FN4A 1H94A 2HSDA 3OIFA 4IDCA 4NJOA 4R5HA 4PG5A 1K2WA 3EYWA 3MEQA 4E12A 4OO3A 4CQMD 2UAGA 1TLTA 4PRKA 1RM0A 1XU9A 5TT1A 2FPIA 2PZJA 4NBUA 4PLYA 3BMQA 5THKA 1NM5A 1HWYA 4AL4A 4XQ9A 3ZNOA 2HK8A 1ENZA 4BHTA 1PIWA 4ZVVA 1YL7A 3K2EA 1K6XA 3TFOA 4XR4A 1H6BA 3GK3A 1I3MA 4RORA 3WWYA 5LDGA 5EESA 1OC2A 4FOOA 4R01A 4B4UA 3CEAA 4I5GA 3LLSA 3NX4A 4R1TA 1NHWA 5HM8A 3F3SA 3RBXA 4PZDA 1LDGA 1P3DA 1D3AA 3AFNA 3WG9A 4UREA 4M89A 3EK2A 3JYNA 3QP9A 1O8CA 3RC9A 3FSRA 1NASA 3ZWCA 4PLVA 1WZIA 2JCVA 2B69A 1GZ6A 2GZ2A 4XDZA 1A5ZA 4TROA 2DPHA 4WLOA 4CM6A 2B4RO 2FWMX 4HY3A 4PZCA 1Z7BA 3LT1A 3TZQA 4PFJA 4D3SA 3WIEA 1NPDA 3QIVA 3NTRA 4FIZA 5JAMA 4S3MA 3GRPA 4IZHA 4XGKA 1Z45A 1E3WB 5U1PA 3EVTA 1LQUA 4EGFA 5KJFA 2GLXA 3K5PA 3AUUA 4AJLA 3C24A 4OGWA 5I8ZA 3PI7A 4RVGA 4TZTA 2CDBA 5BSHA 3WDSA 5IF3A 4E0BA 3G49A 4YJDA 2RHCA 2J3IA 3BMNB 3KO8A 3QSGA 1DC3A 2E49A 3KM0A 4QQRA 3UF0A 1P1KA 2HMTA 3WMXA 2EF1A 4DBZA 4O1MA 3Q2KA 1ENOA 1VL6A 3MJTA 1YWGO 2C0CA 4WLFA 1NAHA 3LC2O 2YFQA 1E7WA 3GC6A 2P5YA 3A1NA 4XQCA 4AJKA 5TJHA 1VLLA 2CDAA 3I9NA 3E82A 2PKQP 3MCVA 1NFQA 3U62A 3CMMA 5BQFA 5KVQA 1ZEJA 4NJMA 3P7MA 2DUWA 3V2HA 3N7UA 5B4TA 3JQBA 3U09A 3C7CB 1L7DA 4YJFA 4YJGB 3PFWO 4J4BA 1IYZA 2BD0A 4E5NA 3IP1A 4K6CA 4BNJA 2IDZA 4DLBA 1X13A 2CF5A 3JV7A 3FHLA 1U1IA 4AVYA 2W2KB 1ZJZA 3GFGA 4MO2A 3ZWOA 5HS6A 4D42A 1HDZA 4ZGWA 4MP3A 1ZNQO 3SC6A 4C7JA 2EKQA 4YQZA 3JQGB 2AEJA 1HE2A 1ADCA 2UDPA 3KOUA 1SAYA 3QVOA 4NBWA 4U0KA 4BL5A 1MC5A 2DTXA 3L77A 4J91A 4NHEA 2AQ8A 4DQUA 1IHXA 4W6ZA 1E92A 3FRJA 1ISHA 4GSLA 5CEEA 5KIAA 1VC2A 1KVRA 5IZCA 1BXGB 1WVGA 1B7GO 4TVBA 4BNNA 4II2A 2G82A 1VE9A 2VWQA 3BMCB 4UVIA 1A7AA 2VYVD 4Q3NA 5I7EA 3K31A 1W6UA 4BO4A 4A73A 4QEDA 3VPSA 4Q3DA 2PFGA 4PVDA 4FW8A 4J3FA 2VZ0A 2J5RA 3DEYX 5A9TA 3H6KA 1BRMA 1EEHA 5G0WA 1NQOA 3E18A 4OMUA 4OH1A 4FFOA 5I9NA 1P1JA 4J7UA 5EIOA 1S6YA 4A7PA 4XJTA 5G0TA 3FPCA 3U0BA 3Q9NA 4NFHA 4YRDA 3D3EA 4WEOA 5I9LA 3ZDFA 5AVOA 4YAIA 4CMAA 2VZ8A 3GPDG 3L9XA 1BVRA 1M6HA 1V3TA 3BHIA 3JYOA 3U49A 4UVDA 5ITWA 2D2IA 3AI3A 1YONA 3LF2A 3HDQA 2QW8A 1EZ4A 4XZ3A 3JYLA 4QECA 1T2CA 2NADA 2LDBA 3PEFA 2EERA 3MOIA 4DC1A 1NQTA 2W90A 3ANLA 2P4QA 1ZSVA 3GG9A 4CLEA 3GNSA 2GCGA 3W6UA 2ZJ0A 3QJ5A 4DWVA 1I2CA 1HT0A 1P74A 1E1LA 4JROA 3UCXA 4MVJD 2WJPA 3RASA 1GD1O 4A10A 2VT2A 4AJPA 4R1NA 5DOZA 2X23A 3OSUA 4W4TA 3H8VA 2C54A 3RKRA 2YFHA 1NP3A 1LNQA 1XEAA 3B20A 1QYDA 3KRTA 3Q3CA 1HLDA 4FFMA 4CUZA 4EITA 2EKPA 4RDIA 9LDTA 1K3TA 2ZTMA 4K26A 2R00C 3TDKA 4AJ1A 5IN5A 3OJ0A 4MINA 4MVJM 2IRWA 5JFOA 2FR0A 4LW8A 4BNGA 4ND1A 1R0LA 3UVEA 4FFPA 3LQFA 4GVLA 1AGNA 2GRAA 1R15A 4L4XA 5IZ4A 2ZIZA 4F45A 2VRCA 3RUEA 4DIFA 3F46A 4GI2A 3BTVA 1E77A 3I1JA 2DT5A 1ML3A 3PRJA 1T4BA 3K96A 1Y7TA 1DIBA 3P19A 4QFDA 4ALIA 1MXHA 3FBGA 5FI5A 3ZWAA 5JE8A 1VJ1A 1C3VA 2EEZA 4IDEA 1KVUA 1MG0A 4WOJA 1JVBA 3I9OA 2Y05A 4J1NA 5DP2A 5T5QA 3COSA 5JNLA 3VHRA 1YXMA 3L9WA 4FFNA 4FPXA 3Q0EA 4GSKA 4GVXA 3PHHA 1ZUD1 3HFGA 4HWKA 2OP0A 4DQVA 4DYVA 1LRJA 2QZZA 1GCUA 5KWEA 3L0DA 1T4DA 1E5QA 1YL5A 1LLCA 1X0VA 4U0JA 3IKVA 3DONA 4E13A 3VKVA 3DBLA 3CSDA 1Z82A 4IIVA 2PWZA 1ONOA 2VCYA 4JBGA 1B8UA 3KYCA 1LTHR 3A9WA 3DMTA 1DJNA 3K8ZA 2NVWA 3NV9A 4J16A 3F1KA 2HUNA 4PLCA 5TS3A 1A7KA 4INAA 5F3RA 3RVDA 1NX6A 4BGIA 5H83A 4NG5A 1B8VA 2A9FA 1EBUA 5F21A 3ZNQA 2A4KA 2QZ9A 2V6FA 4ROSA 2D1YA 1Y5MA 3NDRA 4IGEA 4Q3AA 2O3RA 2AA3A 1UDCA 1T2EA 2NTJA 2O4UX 5H82A 2CVZA 2FN7A 2EV9A 3ROKA 4Q3CA 2H63A 3FI9A 3ANMA 1HE5A 1N7HA 1UAGA 3GEGA 3OQBA 2QX7A 3RUFA 5L7WA 2PLAA 5CAEA 1KVQA 2BFPA 4KDEA 2ILTA 3W1VA 3C3XA 1I24A 3SVTA 1Y9AA 2X22A 3OEYA 3OM9A 1ISFA 3AOEC 3PHGA 4BQRA 4Z6KA 5EMHA 1AHHA 2WD8A 1IL0A 2PZMA 1HZZA 3H9UA 3MTGA 3VPGA 3EZYA 1KC1A 3AFMA 1GYQA 2JCYA 1ADFA 3P5SA 4U7WA 3I9MA 3HWRA 4TWRA 4XA8A 4MIOA 3ASUA 2JJYA 1UXKA 3IOYA 4J1TA 2OMEA 3IP3A 3NRCA 4BNHA 2QYTA 1GCOA 1PSDA 3M6IA 2BRUA 2WYUA 1Y8RB 3ETDA 1C14A 1FF9A 1LDBA 2GO1A 2X9NA 4MDHA 3NGLA 4MPDA 3WS7A 3C1OA 2Q2VA 2Q4EA 4M86A 4E4YA 3WYBA 3WTCA 3I9LA 1F12A 1NAIA 4WOKA 1HSOA 2VYND 3CE6A 2GN9A 1HSZA 3EAGA 3O8QB 4OJNA 3OA2A 4C7KA 2HRBA 4E3ZA 4RVFA 1LDEA 2DTEA 4PG7A 4RDHA 2NU8A 3GG2A 1A9ZA 3PP8A 3VTFA 2PH3A 4TZKA 5DOVA 2E4AA 1CYDA 3K2BA 3PJGA 1VSVA 3PZRA 1X7GA 2V6BA 5B1YA 1P9LA 2EJVA 3OP4A 1PGNA 2Q2WA 3Q9UA 5IFLA 1EUZA 3RI3A 2C20A 5T8KC 3SLGA 3ZW8A 1DEHA 4QFCA 4EJMA 1NPYA 2AG5A 1KEVA 1X1EA 2Q1TA 5CG1A 3HG7A 1IE3A 2B35A 2PGLA 2YHIB 1I2BA 1C0PA 5TC4A 4Z9YA 3JYQA 3PFFA 3I4CA 1M76A 3GVCA 2OP1A 3BAZA 4CM9A 2F00A 6LDHA 2RAFA 2FSVA 1SCUA 2Q45A 3HUDA 5JAZA 1PZFA 1I10A 1KY5A 1X1TA 3GGPA 3UCFA 3W6ZA 2I9PA 2BGLA 3GDGA 2PZKA 4EDFA 2J3HA 1TT5A 3DWFA 4JJGA 3KSUA 3KZVA 4IJKA 1LQTA 1YQXA 2DBVO 2EIHA 3WNVA 1WW8A 2NU7A 4D41A 1AE1A 5DBIA 3DOJA 1KY4A 2BFMA 1U2GA 3EW7A 1R4MA 2X1HA 3TZCA 5HTOA 1HL3A 1MLDA 4ZQGA 2G0TA 3L6EA 5L4SA 3RROA 3ICPA 1Q7BA 2Y1OA 1DRWA 1GR0A 3OMLA 3KYDA 4ALJA 1P45A 3E48A 2P2SA 4G81A 1U28A 4CMCA 4B3HA 1GV0A 1PQWA 5DT9A 3N74A 1AXGA 2H6EA 1U9JA 4IQ8A 4CV3A 4BKOA 4RZIA 4GWGA 4J2HA 4GKBA 4AJJA 4IXWA 2JCXA 1ZCJA 1GPDG 3PXXA 3G79A 1FDVA 1B16A 3M2TA 4RPHA 4BO0A 2UV8A 1E0DA 1O5IA 1P1HA 3QWIA 5DZSA 5ENDA 1VRWA 4AFNA 4B7UA 4TRJA 1YGYA 1LC3A 4MVJF 3PLNA 5DN9A 2HMSA 1KVSA 2V6GA 1I8TA 2IE0A 2RH4A 2HRZA 3JQFA 3PDJA 5TRTA 9LDBA 3MWDB 1H6AA 3ZHZA 3R1IA 3WLFA 1HETA 3QVSA 5I9MA 4L74A 4JP2A 3DDNA 4BNVA 3F5SA 3KEQA 3IUPA 2G5CA 3PHIA 4YJHB 4GH5A 2DVMA 1MB4A 4F6LA 2Z1MA 3Q6IA 3LSYA 1WMAA 4YXFA 4IDGA 4D45A 3ULKA 4KTTE 2OGUA 3TL2A 5KKAA 5T64A 1HKUA 1OMOA 2WD7B 4CMKA 4CQLA 3ZV4A 1GV1A 2IYOA 2HK7A 3PWKA 3PTZA 1LLQA 3QV1A 3U3XA 4ONEA 1JW9B 4E32A 1LI4A 3A06A 1IPFA 1R4NB 4Z9XA 4CM8A 4LVUA 1JN0A 1N9GA 2I3AA 3A4VA 3H2ZA 4YAGA 4A2CA 4PG6A 2DTDA 5B4VA 2B36A 4I5FA 2WTBA 4CLOA 2HK9A 4LMRA 4DLLA 5IJZA 1BW9A 4BGVA 4GGPA 1E7QA 3GPIA 2XAAA 1K0UA 1Y9EA 4XDYA 4ESOA 2CNBA 1DXYA 1VL8A 2OHXA 1HE4A 5KVVA 5KTKA 5A4DA 1QXSA 4S1VA 3GLQA 2CVOA 3WGIA 1ZBQA 5JDIA 1ZH8A 2UYYA 3RFVA 4FCCA 4AJIA 4M54A 4DYDA 3H9GA 4OAQA 1DO8A 4CV1A 4RF2A 4FFLA 3KTDA 5MDHA 2ZB4A 2Q99A 3JD0A 1UXGA 1GTMA 1P0CA 4MVJP 5DCWA 4J7CA 4DTIA 1ZMOA 2OXIA 4IDAA 3PWSA 2Q2QA 3NEPX 4KWIA 3VH1A 3LYLA 4R41A 1O6ZA 2HMUA 4AJHA 2JHFA 3FWNA 1KYQA 2H9IA 1JQBA 1M2WA 3D4OA 2O3UA 3K73O 1Y81A 4B7XA 3DAFA 3JD4A 4YCAA 3QQPA 4L0QA 3ZW9A 4J1SA 3QVTA 1JLLA 4K6FA 1NVTA 1XYGA 4XCVA 1YOVB 3AY6A 5AXBA 1LXCA 4UVGA 1YH3A 5C37A 5G0UA 3X2FA 4UUMA 1P1IA 4WCFC 1CWUA 4DL9A 3BHJA 1KETA 3DO5A 1LSJA 3UICA 5AQ1A 5KVSA 4O5OA 1C1XA 1TI7A 3V1YA 4YEDA 2HDHA 4GAEA 1QG6A 2O3QA 3PGJA 1FDUA 2J6IA 4DMMA 4Z0TA 4LISA 1DHTA 2GN4A 1I3NA 3DQPA 3RFXA 1WMBA 4TVOA 3IDSA 2WWRA 1UAYA 2Q3EA 1SEPA 3VKUA 4D3FA 4E6PA 5CEFA 2IXBA 2Y66A 3ZU3A 4N54A 1O9BA 2GZ3A 1H6CA 3D3WB 2X9GA 3OQ1A 4GX0A 4L8VA 4BNUA 4F6CA 5A3JA 4I1IA 3TJRA 2JL1A 1HDGO 2BKAA 3KVOA 1C0LA 2PR2A 3RUHA 3WBFA 4CM4B 2JD1A 3JQ8B 3K92A 4XKJA 4MKRA 1GL3A 4E5MA 2B83A 1HDOA 1K5HA 4WCFB 4BKPA 4YACA 2YZ7A 4N5LA 2I65A 4IDDA 2AE1A 4H15A 4KZPA 3ZV6A 1PZGA 3V2UA 2CSUA 1SEVA 1ISMA 1C1DB 4IZIA 4ZQHA 5JC8A 4FGSA 1R0SA 3GH3A 4ID9A 4JIGA 1JTVA 4DIOA 5C7IO 3DZIA 3QWFA 4K1LA 3RQSA 3NGXA 1A72A 2ZB3A 5ER6A 5EINA 2P9EA 1JAYA 4RPKA 3ZWXA 4CMBA 4M8SA 1UXJA 5TX7A 2X0RA 3PYXA 4WLNA 1AHIA 4OSOA 3I5MA 1WNTA 3ZWYA 4ALLA 3C85A 1OOEA 3GA0A 3NT5A 1YB5A 5EQDA 4BNWA 2JAPA 4W9NC 3E5RA 1RWBA 2Y0EA 4ND4A 4MVJG 1A4IA 2VHZA 4ALNA 1B14A 2X7HA 3H3FA 1YQGA 3V1UA 3JQ9A 4DREA 3PIDA 2EP5A 4FQ8A 4IMRA 5J23A 1R12A 1E1MA 2AQIA 4EEZA 5ADHA 1K89A 1OC4A 1GYPA 3QRWA 4HV4A 4KWHA 1I33A 3GUYA 4OXYA 4FC7A 1PWZA 1HE3A 3PQEA 1DFHA 2YV3A 3OHSX 3INRA 3AU9A 3DFUA 2NQ8A 4OKNA 4WPGA 3HADA 1X7DA 2X0JA 2Q1UA 1WDLA 4X54A 3BMOA 1Y1PA 2D8AA 1DC5A 3ZWBA 2X4GA 1E7RA 4DGSA 1ZJYA 2PH5A 3HB5X 5CPFA 2FPPA 5F1OA 3KLPX 3LK7A 4YAJA 1PR9A 2NU6A 4ZU3A 1NNUA 1R6DA 2F1KA 1HF3A 2C29D 4BB5A 1ID1A 1TVEA 1H2HA 4TKLA 3FBTA 3HN2A 2C5EA 4KUEA 4CPDA 2PTGA 2J5QA 4I8XA 4O59O 4QTZA 4NK4A 1VPDA 2I6TA 4GGOA 2H5LA 2AQKA 5BNFA 1LBEA 4L73A 5CFZA 2EWMA 2VQ3A 4AJNA 5TIIA 1FDSA 4YQYA 1EFKA 4KP7A 3ZU5A 1IUKA 3AU8A 2HU2A 3DZJA 1JWAB 4WUVA
chains in the Genus database with same CATH superfamily
3T3DA 3HB1A 2QN9A 4WGGA 3LY9A 4XDGA 1TXGA 1XV5A 2ZEJA 1M2JA 3NMUF 3RIHA 1AN0A 4AAYA 2P78A 2C2ZA 3GJ4A 4M99A 5GVSA 1O94A 1GGKA 2WYWA 3AKYA 3X44A 1YI8A 1M54A 5H82A 3OIYA 5HZGA 1E9EA 1W8IA 4IM7A 2YHAA 3WMWA 2N1BA 4EW1A 3DHEA 1G64A 2O0JA 3O1HB 3PK0A 2HR1A 1CRLA 1OAOA 3LAWA 4NE7A 4PBRA 2NVUB 1KEEB 4C7BA 2Y1WA 1TVCA 1AQLA 4CMEC 3GDHA 1IRIA 3I2GA 3FOBA 4PS0A 3R9WA 2AG1A 1ZRMA 1FYWA 1U4OA 2M32A 2XXBA 2Y8EA 3M5WA 3KELA 3NBFA 3OLQA 3PQ6A 3AVWA 1LX6A 3NHAA 1RWPA 4XUEA 3RIYA 2F7SA 2FLVA 1ONNA 1DADA 3UAVA 3ABQB 2XTMA 2QYSA 2DQSA 3W5HA 1UK6A 2IOQA 3ZVNA 4GO1A 3ZE0B 1QIFA 1M1YA 1RHQA 1TADA 3CUVA 4ZT3A 3PGLA 3NASA 4G5FA 2JJQA 2ECKA 3BH0A 1PJSA 1QFSA 3P9XA 4NMHA 4NV3A 5GM1A 3WX0A 4EI9A 4C1BA 2QR3A 3LQRA 1L3IA 3TKLA 2HOQA 3G2PA 4Q1DA 1GCIA 4QNRA 4YJ2F 5JSZA 2YDXA 4EEXA 1IWOA 5EJAA 2CLOB 4R83A 4KX3A 4K0RA 5L8VA 5G40A 1XA0A 2NN3C 4C04A 4XVQA 3ZY6A 1HDEA 1YRWA 2QTHA 1IBKB 2HIHA 1DOHA 5CB4F 4CQMA 3FOFC 3GL9A 1EFHA 1E1KA 1KSFX 4B17A 1CR2A 1SKBA 2O2DA 3NUGA 1VXOA 3T9AA 3IAM1 1FTYA 2FEMA 3S2IA 3TQSA 4R3NA 3ZWDA 1Q5PA 1FW6A 3K0CC 4LXYA 1TGVA 1UQUA 3HDYA 1F4LA 3A1VA 3CBQA 2VF5X 3OJEA 4EF4A 3IXLA 2XUAA 3GAAA 3HU2A 2DEUA 2GF9A 1PTJC 3MC1A 2C4HA 3I1FA 3EUEA 5BP7A 4GHWA 4F5ZA 2O23A 1V8DA 2HMAA 3GUUA 1IOZA 2QRJA 3BWBA 4N65A 3W2IA 4LYJA 4C0XA 1O7JA 1T9HA 4F04A 1OXUA 2B2CA 1Z33A 4FD3A 1ZVQA 2A14A 2VNAA 3HN7A 1J06A 4JJ6A 5HJ2A 2O2JA 3X1ZA 3O9ZA 4WNAB 4YA6A 3VZQA 4JITA 4NC9A 4D0SA 5G4KB 2RCNA 5D5HA 2DHCA 3OP1A 4CEHA 4G9BA 4WX2B 5C4IA 3T7CA 4Y2QA 2VDJA 1GQRA 1SVWA 2PKXA 4B2IA 1ZBDA 3K1AB 4A3SA 3LU1A 2Q5EA 1LRLA 2FZCA 5T6MA 4EQZA 1PVDA 3FPJA 4PG8A 4J4HA 4HDOB 3GZNB 5JRJA 1TAQA 1TOAA 3NUQA 2VJBA 4FKMA 3N8NA 1DNPA 4YRGA 1TX4B 3S2YA 5JCZA 3DZKA 2RGGA 3CURA 3MFYA 4ALKA 2RSLA 3OZTA 4MUIA 4HGPA 3LNTA 2CZCA 1O6BA 1GNQA 1Z3IX 5F4ZA 2G80A 3BGIA 4IL5A 2AG6A 4O4LA 5KVCA 4Z4QA 4OU5A 3T4UA 3LLVA 3QE0A 2NVBA 5TY0A 1H2WA 1GEGA 4GYWA 4YT5A 2O50A 2CLFB 1WB9A 3ROMA 1WDKA 4I6EA 1YVRA 4TZ0A 1PFQA 4GMFA 4OMDA 4V02A 1Y7PA 1S8AA 1T0BA 5SV2A 4DNOA 4FVTA 2QPLA 3L93A 1RRGA 4C21A 2QR5A 4QXOA 3RG8A 1Z5VA 1A1VA 3V32A 5CD1A 4L5JA 2B6HA 4LI0A 1ZMRA 3BE6A 2C1XA 5IKEA 1RQLA 3W9SA 4AQ7A 2WVGA 3LE8A 4LPSA 2GNAA 5CJ2A 5DCLA 5BSUA 1NZDA 1W44A 3E7PA 3C6KA 3HI6A 1NW8A 3UTCA 3QKWA 2C96A 1M72A 1KO7A 2FG5A 1D2GA 3U4MA 3MGCA 1M7GA 4BPRA 1UPFA 3CGWA 3CX3A 4KIJA 4DLNA 4Q93A 3H3XA 1YKSA 4JIMA 1C1HA 1SQSA 1LBQA 2ADMA 4D82A 3L1VA 3KWLA 4FDTA 5FHQA 2RGBA 1N2SA 5K3FB 4LC1A 1D1SA 4PX2A 4CLHA 1J49A 2H1FA 2Y9MB 5EXXA 3TWOA 4G63A 5C31A 3ILHA 4XFDA 1J21A 2AYZA 3IA2A 3MGBA 3MMNA 5CR9A 5LDHA 1GRNA 1JKJB 4BTEA 1BYUA 2K2QB 3HZZA 4GUAA 4CIVA 3DW1X 3DGEC 3K09A 3IJRA 2ZB8A 1NW7A 3W5CA 2YIJA 4GDMA 1FFHA 4F6RA 1EXDA 2FWNA 3VVLA 1G42A 4XAQA 3HE3A 3EF0A 2VJLA 3SJUA 1UBEA 3F6EX 3JSAA 4CT0A 4M37A 4IZOA 4I3GA 4MWTA 1VSUA 2V0NA 5I7VA 1RCFA 2PUGA 1DSSG 4WV3A 3U61B 2G9NA 3H5TA 1PJ4A 1CY1A 1K5DA 3EQ2A 4DG5A 3SY8A 5DNUA 3ANYB 3KZ1E 4AZSA 1ZZEA 1NLMA 2UVPA 3LUFA 2Q46A 1HTBA 2GN1A 2IWHA 4TS4A 2B4KA 1XLVA 4FN4A 3GNLA 2IHUA 2YVLA 4LJAA 2OHOA 4E11A 2DB3A 4JL8A 1D6MA 5IJ0A 3ENVA 2VPQA 1T8UA 3P0IA 1PWXA 3EN0A 3G8AA 4PHCA 4PQGA 4X7PA 5C3MA 2V8BA 3IV6A 3GBVA 3OQMA 1KOGA 1KZ7B 1RQXA 2QK4A 3ANTA 1GCAA 4IJWA 1VP9A 3X1WA 3M5CA 3UQZA 4ZI7A 4N5MA 1JBEA 3PUVA 2HLPA 5DHSA 2FUNB 5INTA 3KKQA 2GJAA 4X61A 2WB4A 4MDEA 1U63A 1E6KA 1PU2A 2M1ZA 2VC2B 4I4CA 5K4HA 4ENTA 1BTOA 1DV1A 1K97A 5I7FA 3I28A 4FGWA 5DB4A 1G18A 1MN6A 2NV0A 4KDCA 1CVLA 1TD1A 4CL2A 1XMOB 5JVDA 4MCJA 4R69A 3H5NA 3KHUA 3A3NA 4REQB 3SXUA 1Y5NA 3FDIA 3QTBA 3KUDA 4CCSA 4Y2HA 1VHTA 2WNSA 1MH1A 1YL6A 1D2HA 5CLQA 5WRFA 5KNBD 2P5SA 5JJKA 3BMQB 5C35A 4TOIA 2W42A 3FUTA 1OKKA 1ECLA 1VP3A 4HDRA 4KQXA 4RKFA 4V0LA 4DV5B 2AZ4A 4D4JA 3KL4A 5K8LA 1YVPA 1EWQA 5HF6A 4AROA 2WHPB 2OLJA 1TO1E 1Z4KA 2EXXA 2W8BA 3G17A 4Q7KA 3VR2D 3QG1A 3WXBA 4AN4A 4GKAA 1VL5A 1DC6A 4HCJA 5BQOA 4F56A 4QZVA 3G59A 1ZD5A 2VJYA 3GGDA 5EHGA 1EWTA 5B12A 1N0HA 3L8DA 2ZBFA 3ZDBA 4ARCA 3F5FA 3V7UA 2DRIA 2E4ZA 1BXRB 3OX2A 3DWEX 3IVRA 4NNJA 2AI3A 3LRXA 3VRHA 1E2QA 1IK4A 1VE1A 1QIHA 1UXHA 3VNBA 3Q98A 4D9MA 4DV0B 3PJFA 1C8LA 1C9NA 1EFDN 4G8CA 2JVJA 1F4VA 1ZD1A 3DE0X 5C7LO 4AYXA 1XR3A 4GYYA 3VMFA 3BIXA 1CQZA 3JD1A 2XT9A 5IM5A 5B3KA 3DVAB 1JTEA 1Q0QA 2GCNA 1UBNA 3IE2A 1X14A 4F9EA 4Q4DA 1V1JA 1XVAA 1ABEA 5JYBA 4OHWA 3DCIA 3TECE 1RVV1 4BKMA 3OQVA 1UOEA 3DF7A 3O4JA 5E0KB 3W3AH 4TZ6A 5BUZA 2D62A 1H6DA 1DQPA 4AT1A 3BIOA 2VSXA 3HNPA 1JMVA 2VOJA 2ZIUB 3WGOA 5JWOA 5GOTA 3QPAA 3OVMA 2GX6A 1OBCA 1Y89A 3KUXA 1B41A 2P65A 3OLXA 4X1YB 2FEKA 1U1DA 4FZVA 3SVLA 1HX7A 2CVFA 1G41A 1A8UA 1OZFA 2B1JA 3P4XA 2IBSA 2JLRA 4P8RA 4XIYA 2AR9A 3BHMA 3RVSA 1D4FA 5GADl 1UC9A 4IFIA 2IUEA 2XGMA 3ELDA 5JG7A 5A62A 1RM4A 2B1IA 3EXHC 3C3KA 3WFZA 4BCCA 1YS6A 1QYXA 4JY7A 3RFTA 3NZEA 5ITZB 1EUCA 4YCSA 3LRTA 4MA5A 2WMNB 3L0PA 1RXEA 1J8YF 3HB7A 1MO3A 3BEOA 4MEAA 3OCWA 2RC6A 4H7DA 3S1AB 3PRYA 3VU9B 2ONYA 5CYPA 4WKOA 3D8HA 4TL9A 5JCJD 1OXSC 2Z6AA 1H3EA 1YGPA 3KJIA 5KDLA 1AKYA 4B3FX 4EFNA 1K5GA 2PGOA 5K3BA 3T3PB 4IIBA 1RZ3A 2QMEA 3QU4A 2Q62A 3ASVA 2Z08A 3MWEB 4HTFA 2O7QA 3FNHA 1NN0A 3FB1A 2ODEA 2CL7X 2X40A 3T15A 2WUWE 1DPGA 2XZOA 4A16A 5ELXA 3GJTA 4D9KA 4XRGA 5DDIP 3HN6A 5L6MB 2C82A 5IZCC 5IKPA 4OD0A 4DA7A 2PS3A 3OFVA 1KWGA 1NW3A 4YJFB 3TUJC 5KYXB 1DFGA 1NVKA 3LNCA 4LDQA 3SXPA 1FTGA 5L7TA 5K8TA 1Z25A 3ISTA 3N2KA 3PXUA 3R5KA 4GLOA 1WKCA 1KQPA 4L4SA 1DBSA 2QG6A 4O5AA 4C0LA 1E1QA 2FQWA 3EXHB 2E7ZA 4X8OA 5JSHA 4G0MA 3CN7A 4HKTA 4LF7B 5LM3A 3PIIA 4IG9A 1QP0A 2PGXA 3T1TA 1XCGB 3LDFA 3DMNA 3C3DA 3ICCA 2YJZA 2XOKD 5TSDA 2PAFA 1OLOA 2BL4A 2OCGA 4LYAA 5C1PA 2ET6A 3FJYA 1GUZA 2QVCA 4RH0A 3SVZA 3WK8A 2FW7A 5HRUA 3I4FA 3WLMA 2OUKA 1ABFA 2YW9A 3KJHA 2W6CX 3PPYA 1EAMA 1QRRA 2WJYA 3SOZA 4B6GA 3VDRA 2XTAA 1K8QA 4IXTA 4HL6A 4Q12A 4HX5A 2QG9A 4ARVA 2GN8A 2J32A 5DXJA 2V03A 4UMDA 4Y98A 3WLNA 4DIEA 1N5RA 1WDTA 4MWGA 2BGTA 5AI5A 2YUIA 4YRAA 3RWBA 2ZVPX 1T5SA 3EMKA 3L0CA 4HAZA 2X19A 5MGNA 3EVCA 1B3RA 4NMMA 5TMPA 1ZH0A 2FP4A 4C0KA 2WJ6A 1R0BA 4FW9A 1D1TA 1TUBB 4UASA 2GM4A 4HLUA 1X9IA 4HADA 4OOFA 5AJYA 4XGIA 1H1DA 1NYQA 2H29A 2OBXA 3PJDA 3DHYA 4BLOA 3EC7A 4K88A 4MLDA 4KVZA 1VGVA 1ILEA 4TTTS 4BJHB 2UZ0A 4GXQA 2IP4A 3O74A 1N32B 5IAKA 1EFRD 1QIGA 5IXSA 1K06A 2HSJA 3KSZO 3TBKA 1GVNB 4IIUA 2HA0A 5CT6A 2FSPA 2PFKA 1QKJA 3BCSA 3FKSA 4GI1A 4BLUA 4CJXA 3M6MD 2AFIA 4C4RA 3A1FA 1NVXQ 3TZEA 5EL0A 4EHBA 1YT5A 2FCRA 2HJWA 2GPTA 4KDRA 2IH2A 4HDQB 3PHCA 1WZNA 5FBRB 3K0HA 2C9DA 5FEUA 2DFVA 1HEUA 2Q6IA 2X2OA 4UAVA 1XQWA 1WEKA 5ELLA 4V1CB 3OIGA 3DNFA 3GLRA 4LTNA 4ZPXA 4EO9A 1MUUA 3NVAA 1DC4A 4RZHA 3TW6A 3SC2A 3RREA 3JASB 2X77A 2Z2YA 1DQNA 1DTSA 2IXGA 3TLBA 4JJEA 1ST3A 4WZAE 1GUBA 4BVFA 3O4RA 1WMEA 1DAPA 2FX2A 1F9EA 2F3QA 1SZCA 1X0XA 1Z5WA 3AJDA 1NF9A 3KFVA 1G7TA 4R8SA 2QENA 3DAGA 3R0JA 1KERA 3OC0A 3R5HA 3RGWS 1VMKA 4TLMB 5H81A 4A6EA 4E70A 1Q3TA 5BNZA 1SCBA 1I7SB 4PR3A 1NBOA 2AOVA 1XRPA 1ZWKA 2VWPA 3AUJB 3P0EA 3HZRA 3MS7A 4HFRA 3T5CA 3NYQA 3L41A 3Q88A 1VPTA 6GPBA 3CH5A 1P80A 2I78A 2YXLA 5HCNA 1WHTA 3VVMA 2X4LA 3LUJA 1LC0A 1C4KA 4ILEA 4XI9A 4DSOA 1GPLA 2I80A 4YT8A 1T4GA 1V9CA 5JI2E 4K87A 1JEEA 1I7PA 2C2HA 2IU4A 2ODNA 2WFMA 4F4JA 1DDOA 2EJCA 2B92A 3SQWA 1FS4A 2JZNA 2PLRA 1BE6A 4ZDWA 4D74A 2G76A 3QBJA 1O4VA 2OILA 3WGYA 4PLHA 3MMZA 2EL9A 1E62A 1A4UA 4XPIA 5DLEA 3DPSA 5AKYA 1MZPA 1ZCFA 1REQB 1N6PA 2VYFA 2W2VA 3GN2A 2P67A 3EXEB 4LMPA 3B82A 1YBAA 3RAJA 5BNTA 4F71A 1E7SA 2CHQA 5D1NA 2XZPA 3ZEIA 1DQRA 8AT1A 5LQKA 1RRCA 4MGZR 4PYNA 3N28A 2DERA 3DWGA 4IAOA 1ZU4A 4Q39A 2XGJA 2PQ6A 4J16C 1NJFA 2AJCA 2ZSHA 1U2ZA 3WWPA 1DDIA 3N8HA 5JWHA 5DBGA 1FXSA 1P7ZA 3DUFA 1C8BA 5BSRA 2ZYAA 4BLQA 2HNAA 4DBLC 1A71A 4BB9A 3BXFA 2B4AA 4DC9A 4D4LA 3FVRA 3PQ4A 3X2SA 1NQVA 3VNAA 5EJGA 3SZRA 2OAQ1 4MUEA 1E79D 3SAJA 3TINA 4IINA 4QPNA 3TL6A 1VIAA 4EHKA 3ESXA 3F6YA 5KYTA 3C1UA 3L0ZA 4FZRA 1E1CB 4G5OA 3KZCA 4EYKA 4BMOB 1ZUNB 4YR9A 2B8NA 4B3SB 1T0HB 3R20A 5JRZA 5BYKA 3WWZA 1PEDA 4QT0A 3UPUA 1G8JA 4DLWA 4HZUB 4Y9DA 1JA9A 3AEKB 4WLUA 2EGGA 3EGWA 2QRLA 2WWHA 3HGQA 2FGKA 1I0ZA 4YC7A 4ON9A 3DDHA 5TGDA 4DLVA 1ZZGA 1C30B 5KSPA 4JBLA 1S01A 2GAIA 3ZJTA 4W5HA 2FKAA 1WCWA 3R40A 2XDAA 5CLJA 5E8JA 5TQ2A 2Q41A 3VJKA 3O8NA 4B44A 4L28A 3MJSA 1SVKA 1VIVA 3CF0A 4PQEA 2IPOA 5FO1A 2GJ9A 1D4ZA 3KOXA 2V7BA 3EFEA 3IA7A 3ZHQA 2FMFA 1SUEA 2HPVA 1DTWB 1RRPA 2ARKA 3OD1A 5H1YA 1A8SA 2Q3JA 3HWSA 3WK9A 2IZ1A 4ZDJA 5K0TA 3E2IA 1GUFA 4F3YA 1P0PA 4J1TC 1X1DA 3QVWA 3PSHA 1Y8RA 4XLZA 4NS4A 2WFLA 2XCIA 3DQQA 3G8BA 1FNSA 1OJ7A 2PQMA 5KS2A 4PINA 1TM7E 4MQBA 3P52A 3OWXA 1GAWA 1DAIA 4RS4A 5FPSA 4EYGA 4R1SA 5JSQA 4QLAA 3HHPA 1FTQA 2LGJA 4B8YA 4H1WA 2BFFB 3E8SA 1PFKA 1YJ8A 2NUPA 3OEHA 3REGA 2QTRA 1ZGHA 5IDQA 1YCFA 2XA9A 5CA0B 1RM5A 4HC4A 1WAMA 3AOEA 1N25A 4HB0A 2XCUA 3BILA 4AWBA 5THXA 1T36A 4DQKA 1PS0A 4B3RB 1FLVA 2OWDA 3W04A 2QSZA 4OQZA 3OF3A 1IOVA 4JQOA 4K2HA 1UEXC 4P22A 2A9RA 2I76A 2XYHA 2H4FA 2Y1DA 1P1RA 3TGWA 5CHYA 2HF2A 4EG7A 2CNLA 2B8EA 4M0CA 3PPXA 2Z3ZA 3FNQA 3ZOKA 2VT7A 1IONA 4PQFA 3RS9A 1I3OA 3WHIA 1MHPA 1CUZA 2E0IA 4D3XA 3B5EA 3D6MA 4UXIA 2O2SA 3T4PA 2GHTA 2PMDA 3P27A 1CBUA 4DDMA 4ZEVA 2C03A 1M1UA 3GEHA 2BN4A 4RM3A 3KKZA 2XKBA 3EIUA 1I4EB 2YHIA 3ROGA 5EJ4A 3OEEA 4K8RB 1X3SA 1YRAA 4CCAA 3FA2A 4ND3A 4A5OA 5DP1A 4L22A 2VBFA 4FFDA 1ESNA 4P6VF 1US8A 4TV8F 4RPCA 2IQIA 4F8EA 3VC7A 4P4GA 4MVJH 4J94A 1LPSA 4NOLA 4WZBE 3S2GA 1XO1A 1A4RA 1G7SA 2IEDA 4KXWA 1ZNYA 4HNHA 5DXFA 4HFJA 3WQRA 1YQQA 4WESA 5CB4A 3WA7A 4H59A 4XGNA 1NVVR 1IM2A 2GN0A 1GSAA 2V5AA 3EPRA 4UVHA 3CZQA 3ST7A 1KWKA 1Q84A 3QJYA 4IFTA 1BEZA 5CJJA 1WUKS 4OHRA 2A33A 2CE2X 2HK6A 1PJRA 4Q6BA 2GR9A 4F8JA 1JEAA 1F6BA 1X7ZA 2B20A 2RGEA 3CE9A 3LY8A 3PE6A 4CCYB 4D8VA 1WZ2A 3WLSA 1EE9A 3SBOA 3DOHA 1EK5A 3VR0A 3FDXA 1LSUA 1WX1A 1LV7A 3S44A 2J48A 4H77A 3NWOA 3TD6A 4DRZA 1DG1G 2GBLC 1Z5NA 1H9BA 1QB7A 2XT0A 3CRNA 4GPZA 1MQSA 3T9CA 5AVZA 3TSYA 5CH8A 3HKBB 4YCNA 2PXHA 2HFJA 2P90A 1C9YA 2MINB 1EX9A 3B60A 3G2NA 4COKA 4QYXA 2DG2A 4MKZA 4LFBB 1MXFA 4KFUA 4F1KA 4UTZA 3ND6A 4TKMA 1YMUA 3A1SA 4YYEA 2ZI9A 3DFZA 5I7AA 3DGFC 1VZ2A 4ZVUA 2D06A 2L18A 3BFKA 1C9EA 1QKIA 3JVEA 3SXJA 3BGSA 3IDZA 4R1UA 1KBZA 4EA8A 3L06A 2HDOA 1SCUB 2YWJA 5SICE 5K0EA 3H75A 1JHUA 4XASA 4RY2A 2HDWA 1GLVA 2JGAA 5KMGB 4D5GA 4PSUA 1XDDA 2R4QA 5G02A 6YASA 4KJXA 5AJUA 3CW2A 1X7YA 5K3DA 3IUJA 2Q0QA 5EVJA 4RVDA 3VKGA 3VDXA 4O6VA 3OU6A 3B48A 2JBHA 2P79A 3ZVKA 2BJHA 4O02B 3ZBQA 5BYAA 1NOIA 2O0LA 2XAUA 2XITA 1SBQA 2HEIA 3MWDA 1N57A 4M49A 3R3UA 4J9UE 4N1AA 5C0OE 3TLKA 4M55A 2W6NA 1EP2B 3WGQA 1OWNA 1OTHA 1CX9B 1RJ9A 2HU5A 4GPD1 1KYYA 4F93B 4QQFA 1Z7EA 2AFHB 2WV7A 3ANXA 2QD3A 3TXAA 3D5QA 4BBPA 3W79A 4CYMA 1Z4LA 2R84A 5LZ4A 4HEA6 4U7GA 1OAAA 4M0PA 1NT4A 4YFYA 1OROA 4MB2A 3RAGA 4EYEA 4I9FA 5IBQA 1ZGAA 3CG4A 3N0RA 3QKUA 4H7PA 4YI5A 3W4JA 4DM7A 2QUBA 1WDMA 2VK2A 4P5EA 3Q2OA 5CVJA 5E6RA 3DP9A 4NU0A 4AUKA 4C5AA 3N0VA 5MN6A 1Q3KA 3AJRA 3K4PA 1UMDB 1OI7A 3FPFA 3N7TA 3KKPA 2WD7A 1ZC3A 2QX6A 1OLXA 2JFFA 2YV1A 2GWRA 3GJ7A 2C8LA 3OC6A 2A67A 4KGVA 5IDYA 4KEAA 5TDHA 1GEEA 1UOQA 4RTRA 1RWXA 2OHVA 4NULA 2X9QA 2Q1WA 2R6GA 3FVVA 4RCVA 1XZDA 4UUQA 1RAAA 4ZAXA 4IS3A 3NDBB 1QQAA 3DP7A 3W2EA 1C7QA 2JVKA 2X1MA 4LKRA 4NDNE 3UMBA 1HFEL 4H7FA 2RHRA 3FOZA 5KYGA 3GHHA 3V42A 5BURA 1C7ZA 1RABA 2JEOA 5CCDA 3ADDA 4RV4A 3D7LA 3L84A 5HIIA 1FP2A 1DRVA 1S96A 2VNJA 2QMHA 1RI1A 2J9FA 3GF4A 3NTXA 4G2TA 3AK4A 4HDMA 2C4VA 2RCYA 1KQGA 2F8MA 1BG6A 3WMFA 2LXNA 3V7FA 4AS2A 2X15A 2G5PA 2AOUA 1TIBA 1TMKA 3NCHA 1WV0A 5HE8A 3TVTA 4BB6A 2ZJBA 3GGOA 4ZQFA 3RU2A 4YX9A 5JATA 4TKVB 5LB2A 1WUTA 2BFDA 5ENZA 5A7HA 5CFNA 5GP1A 3QXJA 5JDIC 1QSGA 3B1JA 3VZBA 3AY7A 3UM9A 4EATA 3H97A 1SIUA 4Q4AA 1ZRNA 1IEXA 2QMZA 3W90A 3MWKA 2GDJA 3R3HA 1DU4A 1LJLA 3BJMA 5LCXA 1L5WA 3GGSA 1MAUA 2Z2KA 1ZKMA 3D2CA 1JG2A 5EKSA 4CQLB 2O1WA 1FSPA 4Q3BA 3OF5A 3EX7C 2QUHA 5CTAA 1P7PA 2IOFA 5AM4A 1D1PA 3RT9A 3V1NA 2VJMA 3T4EA 3VU0A 4W5JA 3E3MA 3QMVA 3M4YA 4QEZA 1RYBA 3QF4B 3NYIA 1NIPA 4AJ2A 2J6CA 2OPBA 3I53A 3WVNA 4F5YA 1WHSA 5E4YA 5EHIA 1Y4DE 1W8DA 4QG7A 1RP7A 2OXFA 2YWEA 1W9MA 3BTOA 2JLSA 2PSDA 1BW9B 1WQ3A 2W6OA 1I5RA 2GEVA 5DH9A 3R0VA 4N7MA 4WXPA 2BLLA 1GA1A 5DISB 3UN1A 1KYWA 4MWBA 3AZQA 4P38A 5JHGB 3VKFA 4MHSA 4K9OA 2PZEA 1XRNA 4GMKA 1JSCA 3I42A 5DM2A 2ZTLA 3K0BA 5IABA 2P1ZA 3ABSB 4NAUA 4D8YA 2OESA 1MPXA 2HWUA 3PIRA 4JYBA 2QYHA 4AWAA 1TZ2A 3KTAB 1WMDA 1E3LA 1C8KA 4AS3A 2PZFA 1M75A 1E2BA 1VGQA 2GT1A 1LRKA 2IELA 1ZXBA 2YWFA 3AM3A 3QLTA 1PR4A 1E6EA 2SKDA 1NTRA 1E5XA 1J56A 3I23A 3CKLA 4Z0NA 5G1PA 4MPPA 1J22A 3H5IA 1Y80A 2OKGA 3RUCA 4Y30A 5CDTA 3JQDA 5FOSA 4LMAA 2YZNA 3NCTA 4HQ0A 4KR0A 1NXSA 4RD3A 1PD1A 1NVGA 4FGUA 1RCTE 2HBYA 1SVNA 4JJAA 3H9JA 1C3JA 3BIWA 1QF7A 2H0QA 1TRHA 2OY0A 1X7HA 1ZPDA 2IC5A 3U9TA 3F6BX 1F8GA 5P8WA 2HHAA 1Z4MA 1SH7A 2BGGA 3ZS9A 4TMYA 1QNFA 1XYVA 3A11A 3GPCA 1N9ZA 2AZDA 5DFAA 5GZ3A 1OZGA 3PTAA 1NYLA 3BYZA 3O1JC 1ACLA 1JLLB 2D5CA 3MM4A 4FYYA 1FPQA 2DH6A 4UEJA 2C7RA 3QEJA 1XOIA 3GJ0A 3JQ8A 4WXMA 4YIKA 2DR0A 5K05A 5KDOA 3SIPA 1R9GA 3CTMA 2O2IA 4A1OA 4N5NA 2YJ6A 4WCFA 2OCAA 4QLBA 2CMFA 4IHKA 4MVJE 2JATA 3A2KA 5BV1A 5HVNA 5IMSA 3IDAA 4IQ0A 3PVZA 2WFAA 3CX4A 3IQEA 3O95A 1H4VB 3ICWA 1N5KA 4GQAA 3U5TA 1OIXA 1ST2A 3F9IA 3NRJA 3T0IA 4XWWA 5FWXA 3L4JA 1DCKA 2QSUA 2PSJA 4BMZA 1IC6A 4G8BA 4N18A 7GPBA 1U4SA 2VK1A 4RMNA 3TG8A 2YOHA 4RK7A 3HK2A 4US1R 5BXYA 3HYTA 3DLHA 3Q5EA 4JA2A 1II8B 2HBQA 1WNFA 4E21A 2FW0A 2HPAA 2WNHA 2QTTA 4DLZA 3OTWA 5EWMB 4EPVA 1A5BB 1RBYA 3NI2A 3U19A 3KIPA 4V24A 5E6SA 3ZGYA 1IZ9A 3RVQA 2CLCX 1DB3A 4DW8A 3HJHA 4X0EA 5HUHA 3E7FA 1Y4ZA 5CLHA 3TZHA 3SNKA 5D7NA 4O4HF 3WYGA 1BEUB 4IHJB 4KIUA 5BWBA 2IHNA 1BCRB 2ALJA 5JMPA 4X24A 2OORA 1N8KA 3U4AA 4GT1A 1BU8A 2HPZA 2JZCA 4KN8A 2C1EA 4D0LB 4AZWA 1GNLA 3F5QA 4IJUA 3CS3A 3O8DA 1HI9A 2QUJA 1B74A 5IG2A 5KAPA 1TPYA 4YBRA 1L5OA 2A1TR 2VHTA 1X74A 1WO8A 3FCYA 4AMVA 4BKUA 4X7BA 4K6MA 4RNDB 4PVCA 3ZWKA 5TR9A 5DLQC 3GT0A 4EW6A 3ZY3A 2ZRQA 4H35A 2W2LA 2DETA 5T3YA 2I4NA 4G0UA 3FFWA 3L6BA 3O38A 4LJLA 1JWLA 3S2UA 4AI6A 4URVR 3KKNA 4I1UA 4JN6B 4WSOA 4JD5A 3GLUA 4MMZB 2BBTA 1T4CA 1NFRA 4Z7OB 2D5IA 3A04A 3KQMA 4ZYZA 4EH1A 5LYYA 2GFQA 3I8XA 5HKLA 1A96A 4OXIA 4EGJA 1PSZA 2MWMA 5B5SA 3VBEA 4DUPA 3K16A 5A4IS 3CVUA 2E4XA 2VHXA 1TCAA 3ROTA 2J46A 1ZG3A 1EYZA 1BCSB 4PPYA 1H2BA 4O4IB 2N46A 3VNSA 3U3ZA 3WKCA 5EJ7A 1IM5A 1MORA 1UDAA 3GQBB 3ISVA 3CISA 3QX9A 1B2LA 2C3UA 2WG0A 4HQFA 4ZXPA 4A91A 2TMGA 3I09A 4PSKA 2ZRLA 3LECA 2L2QA 2C9BA 1TD9A 1JE1A 4AK9A 3ZQUA 3OLWA 4H4DA 4HXEB 4WUTA 4Q4HA 1NW5A 3LDHA 1N6IA 1TVKB 4QU8A 1E9CA 2R7KA 2X14A 1QHNA 1OH6A 1W19A 1FTSA 2YV2A 1Y5IA 2XQIA 2IK8A 4Y9RA 4DLSA 5EJ5A 3WHPA 4EZBA 3VHXB 2BTQA 1S89A 2GPSA 4TMKA 4F85A 4ZN6A 5A02A 1SMKA 4S0ZA 3BMOB 1QOQB 2X6RA 2V7XA 4X93A 2H52A 3DCJA 4U7HA 1GNVA 1QQ7A 1PJ8A 3S6JA 5JLJA 4G5SA 3L4SO 3MJ4A 3VKWA 3AY0A 2BH9A 3S5UA 1RD4A 2H31A 3EA4A 5H9VA 1BVYF 1O94C 2DFDA 2NT3A 10MHA 1A8IA 1UZUA 5U4XA 4L85A 5AVWA 1L5RA 4QU9A 1EQUA 4C5CA 5C52B 1ZA1A 3A37A 4RQUA 1OAOC 4QT4A 2YN0A 5KTYA 1KZGB 2BFOA 2XEXA 5BVGA 4ZYLA 4HXFB 3AVPA 5LQMA 1PJQA 1QVAA 2Q1XA 2I3ZA 2ZJ7A 1CR4A 2ZUVA 4LDRA 4D4GA 1GU1A 2AJBA 4DDKA 4JQZA 3W8DA 4EABA 1VRVA 1KFJB 2ECOA 1MFPA 2EP7A 2OOKA 4J3JA 4U2FA 3AEYA 3NNNA 4JUDX 1CUHA 4BQOA 2W4QA 5EP1A 5GJWC 1XROA 4NYMR 4PNEA 3CLVA 4D57A 3THSA 1Y7LA 2PD3A 3H16A 1OPRA 2QHXA 4WBSA 2L42A 1PL6A 4OQDA 2JD0A 3LC7O 3ZI4A 3LPCA 4IJ6A 5JXWA 3STYA 1SOAA 1E2FA 3WNBA 4AKIA 4MA0A 4JJ4A 3L7LA 4NZNA 4NX2A 1UKAA 2PMKA 4C5BA 5IP5A 1ISIA 1L8XA 1K2VN 1R0XA 2XF8A 2EJUA 3GRKA 1P2SA 1TQDA 2EEPA 1AN9A 4EL0A 2V9ZA 3A6ZA 3NDJA 2BDEA 4MW0A 1XTRA 4AO7A 2BR4A 3S40A 2Z5LA 2HLDA 2REQA 2ZE5A 4JH0A 4NPCA 1KDOA 3PCTA 3KT0A 4Q1EA 1QYVA 2HCTA 4S0XA 5AJZA 2ABWA 4ZZ1A 2DYKA 2Q2NA 4NZ9A 3OPYI 3C3EA 5ULLA 5ILOA 1VLJA 3EFBA 2C42A 3AX6A 3X2EA 5EHNA 2J31A 3C5VA 4WESB 1MX9A 3RLIA 2R9VA 2AK3A 5K6AA 1RADA 1U3TA 2BHSA 3CPSA 1XPUA 5IM4F 2DKNA 5CM8B 3FVWA 3YASA 1P4SA 4R51A 1BMDA 1XJ5A 2WM8A 2Q8QA 3AETA 1NW4A 5IAJA 5A5FA 2BWJA 2ZE6A 1YR2A 4H6XA 1M0TA 1ZFNA 5H68A 4ZK2A 1GADO 2Y99A 2VH1A 3FNIA 1M1YB 3AILA 1GT6A 5BSWA 3A4YA 1VSTA 1VKZA 3IUBA 1N0WA 5COBA 5EIAA 1TMGE 3FJOA 1SD2A 4BGUA 5IUKC 4S1WA 3DEJA 5JSZB 2QZ4A 4A8TA 2C2WA 3WGUA 5SYAA 5JAPA 4CMGA 1LBHA 5F1PA 3JQ7A 1H5QA 4URZR 2IH4A 3OFSA 5HM6A 2PMBA 4KQ9A 2MSKA 4RGVA 4TXHA 4CMIA 1Z6QA 4P2GA 5I9BA 1QHXA 3WQQA 3ZZUA 1OB5A 4CQMB 4UDYX 1QGAA 3D8NA 2VT3A 3ZI0A 3C3WA 1AQYA 2O3SA 1UT8A 1VJ0A 6Q21A 2W5UA 1RXYA 3OT4A 3ZTWA 3G9ZA 5DCYA 5EQFA 4HYYA 3DTNA 3MAGA 3P8ZA 4TTSA 2CZQA 2G09A 1IJFA 3IPCA 1USKA 4TVSA 3I9KA 3UTDA 3U2QA 4O2LA 2GPJA 5FBKA 3KQQA 4JUFA 4YPFA 4BRWA 4IUYA 1XQ6A 2P9FA 3M81A 4MQ4A 2YZKA 2FWIA 2VDNB 2ZTUA 5AVJA 3GVIA 3TO5A 1SKYE 4MDYA 4LF5B 1CQIA 2FUEA 2JGDA 3EJWA 2PX4A 2CV2A 5EZ5A 3MJCA 3QQ5A 3G0BA 2XXJA 1UM9A 4X6YA 4CM3A 1G3IA 1I2DA 2BGMA 3I9JA 5T4BA 4DG9A 1ZJ6A 4BV3A 3FMVA 3JPYA 5DK4A 3NBKA 2XRYA 1Z0UA 3RJ9A 1SVIA 1V8PA 3DZFA 1NWCA 2XNDD 3ZNPA 1ARZA 1KAHA 4F38A 3C45A 4F86A 3FKJA 3OBIA 1I3KA 1DJQA 1WXDA 1SKQA 5DJ5A 2XYQA 3BZWA 3CVJA 3NAGA 4MWCA 1FFAA 2QF7A 2Q8NA 1WDWB 2Q9UA 3G2IA 2HWXA 4GWKA 1XNHA 1OE0A 3HB4X 3I2IA 3L07A 3MZ0A 3OFNA 4MUXA 4R1LA 4RX1A 1R37A 5HMMA 3ZIUA 2MOKA 4DEVA 1FXUA 2E89A 5CK5A 5H9WA 4QOEA 1TZBA 2V7QD 2VJDA 4LZPA 2IHZA 1DAMA 3HY3A 1ZOIA 4XB2A 8ABPA 1BN6A 3I6YA 1T2UA 2QM8A 5JXGA 2O2GA 4MCHA 3TG2A 2X0DA 2C94A 1PWHA 4O4LB 2Q29A 3K8QA 3F8TA 3VR5H 3L40A 3RYHA 1CP2A 2P9CA 2VP6A 4LF6B 3WSTA 2IXAA 1ZD9A 3G1TA 1V1MA 3OJCA 4XX0A 5AKLA 1KBOA 2GRJA 3KZKA 4WN9A 1UBFA 3U4QA 1QO0D 2AFRA 2PDAA 2YWCA 3F8WA 2SKCA 3GDFA 3K09C 1RXCA 4QGFA 3OQOA 2V4UA 1ENYA 1D0VA 1Z26A 3MUNA 4M1QA 4LJKA 4ZOLF 1USIA 1YBFA 5FA5A 4X66B 4MHTA 2H4HA 4P4LA 3D8BA 3GRYA 4WKCA 4PF1A 1CIVA 3FZGA 3CNBA 1HLPA 1O94D 3M9XA 4HQLA 1XT6A 3LHFA 4RH3A 4F7WA 3G7SA 3G88A 3ORFA 2V6IA 3OZDA 2VQEB 1KAGA 3A4TA 3G2KA 2XUJA 3LZ6A 3TEJA 4ENUA 3ADBA 1CZUA 3NAZA 4QPZA 3MMXA 3RF7A 2PA0A 3VC3A 1ZUIA 3WP1B 5HWSA 4TV8A 1COZA 1TFUA 3BSFA 3WYEA 4DRYA 1M6WA 4BX0A 4QBFA 3UY4A 1BWQA 3G0OA 1H22A 1ZVMA 4PZEA 5CJPA 4OATA 2HCBA 1S4QA 1WTCA 2J0UA 4GVPA 2EU8A 5BMVF 1UBSB 3GFSA 1KYIA 2CB0A 5CDGA 4BJ5A 1JNYA 1O6CA 3BCRA 1KJJA 2IS4A 3TLAA 5BNIA 5KSOA 1MR3F 3TYXA 2P2GA 2MYNA 1QC5A 5DIZA 3RK4A 3D8RA 4JEMA 4JNCA 1OY1A 4KL8S 1F8FA 2BFAA 4MMXB 4NMLA 4XLTA 3RYFA 5AVVA 1PNVA 2V3VA 3GLGE 3CT6A 1UUFA 2FZ5A 3KB8A 5KQSA 1JHQA 1BDMA 3B3JA 4QL3A 4JLOA 2GM9A 4F6RB 3D0OA 2NSYA 4IGIA 5EKUA 4B4WA 3UC9A 2BEJA 4YPVA 2EFJA 1E9DA 3PHLA 4JJIA 1HL7A 3OU2A 1II9A 1SQ0A 1KZ4A 3DMRA 3PTLA 1H94A 4LHZA 4YXWD 4ZCIA 4EENA 1KO5A 3H1EA 3E7DA 1AKRA 4Z2YA 1GGEA 1O2DA 1FU4A 4CQMD 1SHTX 1CW2B 1I2MA 2BM8A 4BMDA 1TLTA 3PXEA 1RM0A 1XU9A 2NO6A 1GRCA 5TT1A 3W8RA 2PZJA 2P9JA 3NBUA 4QGHA 5THKA 2UVPB 3N8KA 3L3BA 1YE5A 2OA0A 4AF7A 4XOIA 3H19A 4XQ9A 3ZNOA 3FZYA 1YOBA 3CLSC 2QS9A 1Z3CA 1UJ4A 1EAYA 3CPJB 1OFVA 4QICA 4ZJYA 5KTSA 3PUYA 2D2XA 1P8AA 5IJ0B 3OUZA 3TFOA 1FBNA 4WA7A 4EJSA 1H6BA 1EE1A 1QHYA 1TJNA 2COEA 1I3MA 3A1DA 3GK3A 3R6LA 2A1IA 5DKFA 5FOXA 3WWYA 1KNQA 3LTEA 4MGKR 4ZI7B 1DAHA 1JMKC 1XXHA 1IHDA 2WF9A 1NHWA 3MJDA 5FWDA 4AJ9A 3RWMB 1P3DA 3HU3A 3AFNA 2EX0A 3V1KA 3WIBA 1KI9A 3WG9A 5AW7A 2IHBA 2RHHA 4MWDA 4IDNA 1H8HD 3QP9A 3P9PA 1XTZA 3FSRA 1EIWA 2HF9A 1PNRA 1NASA 3ZWCA 4GEKA 4ENWA 4BX9A 1OWOA 5M34A 3BULA 5AOCA 5JVDB 1AOXA 3LXXA 3TRDA 1OV6A 1RJEA 2YYSA 1RP1A 1LY1A 2B4RO 3SXUB 1O3YA 3PXGA 1Y82A 3H8SA 1QFJA