2HK9A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and nadp+ at 2.2 angstrom resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords Shikimate dehydrogenase
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk9A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk9A01
1GFSA 3DBLA 4CM3A 1RM0A 1M2WA 1VJ1A 5I8ZA 4B7UA 3CSDA 1ID1A 4A73A 3KLMX 3HADA 5CDTA 5T6BA 4ZJUA 2JD0A 3IAHA 1OBFO 3QWHA 4PZCA 1O95A 3H6KA 4HWKA 2ZQZA 3D3EA 4MVJH 4XQEA 5EQDA 4U0JA 4LK3A 5KJEA 2E4AA 3H65A 3PI7A 1XDWA 4BNUA 5EQFA 5DT9A 4UREA 4CM9D 2ZYAA 3KEQA 2DVMA 5I7SA 2ZTUA 5CEJA 2OOSA 1B0AA 5KJCA 3K2EA 1YWGO 4P22A 1AHHA 4YJGA 4FD3A 1M66A 4D43A 3LU1A 1DPGA 1NPDA 3WGGA 4II3A 4QTZA 5IZCC 3WFJA 3BA1A 3ZW9A 4R1NA 3C24A 4MVJM 3I52A 5A02A 2BFAA 5ITVA 3I5MA 4W82A 3OJLA 1DC5A 4JBHA 5GZ3A 3QSGA 1GU7A 4MINA 3VVCA 3P19A 3PWKA 1MC5A 4FOSA 2HMTA 3ZU5A 5AOVA 2I76A 1LSSA 3ETGA 3T4XA 2B69A 1IY8A 3KXDA 2PA3A 1U3UA 1QSGA 1DRUA 4UUNA 1MV8A 2PV7A 4MVJG 1YB5A 4UVDA 4INAA 5JYEA 1LBEA 1ZSNA 1CQIA 4ALNA 3D4PA 4YXFA 3VOSA 4IPTA 4OYRA 2PZMA 3DONA 2FSSA 1F17A 1E0DA 2HSDA 2IYOA 1LI4A 4X54A 4M89A 2BHLA 3NT4A 4NBTA 5JMWA 1C1XB 1PJ4A 3ITKA 3RC7A 1BTOA 2NVWA 4DPLA 4B3JA 1X1TA 1ORRA 4E2ZA 4YRBA 1ZZEA 3BTUA 1PS0A 3LLVA 4LRSB 1OC4A 2WMDA 2NTJA 3WGOA 1DIBA 2B83A 3BHIA 1P77A 3FWZA 1ULSA 1XSEA 2Y0DA 4XGKA 1GCUA 3ONFA 2DTEA 1Q0QA 4XGNA 1ISIA 3O03A 1WZIA 3QVXA 4YACA 5B4UA 1PR9A 3WYEA 4M86A 2EJWA 4I9HA 1PJTA 2P68A 4C4OA 4RL6A 5JYDA 5IDYA 5JCJD 3HDQA 2AEFA 3BHJA 4BNFA 1LDMA 3ZHZA 2ZJ1A 3BMNB 1EVIA 3Q2IA 3RSHA 3DOJA 3PVZA 3PYMA 5F3RA 2GZ2A 1ZK4A 5TX7A 2GLXA 1T26A 1YJQA 5AXBA 2VNSA 1PJCA 1UXGA 2YV1A 4KWIA 3HDJA 3QIVA 1PJLA 4J16A 4BGVA 3GVCA 1ZK3A 1X1EA 2NTNA 4RORA 3OA0A 3ZDFA 1LEHA 3AUTA 4DC0A 4YQYA 3VH1A 1O5IA 3B1FA 3COSA 1HSOA 1Y8QA 3UHAA 4IDEA 3HJAA 2QRKA 4D0RA 2BH9A 1XYGA 4ND4A 5DZSA 2EGGA 1W8DA 3TZQA 4ZRMA 4TKLA 3CH6A 3ICPA 4ZHSA 5C37A 1A7AA 1NTOA 2A35A 2Q2WA 1KVQA 4IY1A 5G0VA 1I01A 2UYYA 3JQ8B 3IIEA 1FXSA 3FCOA 4BVAA 4DC1A 3HZZA 3JCZA 4L76A 2EWMA 4QX6A 4BO8A 1DEHA 1TLTA 3K96A 4CQLA 5TSDA 1H93A 3QWFA 1UJMA 2GO1A 3AY6A 1K5HA 2PH3A 4CMAA 4CUZA 2A4KA 4BGIA 7ADHA 4N5MA 1ZK2A 5CHEA 1XG5A 3BZUA 4CMHA 3GF4A 3HE3A 4G65A 4ITUA 5H83A 3JQ9C 4EUEA 2BMAA 1ADCA 2F1KA 4IDAA 4BOYA 3C7AA 4OQZA 5FI5A 4EJ0A 4OQYA 1C0IA 3IUPA 4Q39A 1Y8RB 4R3NA 3DEYX 1N1GA 4RCVA 3WG9A 4IQ0A 4BKUA 3WR5A 4I5EA 4MKXA 4PG7A 2JFFA 3RBZA 4EGFA 4F45A 3H3FA 3F1KA 1M67A 1NVMB 1GTMA 1IB6A 4YT4A 4W7IA 4U6QA 1EUDA 1G0OA 2VOJA 3EZYA 4J90A 3S8MA 2O3JA 1YGYA 1T4BA 3AWDA 2B36A 3C1TA 3ANMA 3SBOA 3KHUA 1DC3A 2BFPA 3EMKA 3I9NA 4WNCA 4D3DA 1KVRA 3ANLA 1P1KA 1LLDA 2I9PA 3H3JA 1YKFA 4FIZA 4WCDA 3WMWA 4LRTB 4Z3DA 2PTGA 1A4UA 1HETA 4MP6A 2Q99A 3U4CA 4R3WA 4BNGA 1RM4A 4UUMA 3KLPX 4Y8VA 1JKIA 4CM9A 4MO2A 4TQGA 2AA3A 4E31A 1GAEO 2ZIZA 2PD4A 4BO2A 5KVVA 1C3VA 4LGVA 4JJGA 3W1VA 4GAEA 2GUGA 1OMOA 1BDBA 3L6OO 2ET6A 3OFSA 3MOGA 5ADHA 3H9GA 2QRJA 1HDCA 3AI1A 3RROA 5B4TA 4PZEA 5BSGA 5T64A 4CMEA 3AUAA 4BMSA 1T2CA 4ZQBA 3ITDA 3WGHA 3JQ7B 2W2LD 1SPXA 3QW2A 2FMUA 2F00A 3DBRA 3GN1A 4IDFA 3AI2A 4O5OA 4XYLA 1KY5A 1CJCA 1V3VA 5CFZA 3EY4A 3PZBA 3DZBA 3LF2A 2G76A 3B6ZA 3D64A 4EJ6A 3RFVA 3HDYA 3WNVA 2PR2A 2OUIA 1KBZA 1GZ6A 3RD5A 3JQCA 1ISMA 1KC1A 1FJHA 3ADPA 4E0BA 3TWOA 1P9LA 1NHWA 4AL4A 3VPXA 2HJSA 1B8PA 5TC4A 2OBNA 1DSSG 1Z75A 3QP9A 3QVOA 4L4XA 3AY7A 2RHCA 4BV9A 2FPGA 2PFGA 4J4HA 1RPNA 1M76A 4NIMA 1EQ2A 2G5CA 1WDKA 1DOHA 4ND1A 1RKXA 1PQPA 1WMBA 4WECA 3P7MA 1YVEI 3FNGA 3PHGA 1T25A 2CDCA 1C0LA 2FSVA 2XOXA 4PG8A 2P9EA 4RZIA 3RCBA 4E4YA 3WS7A 1MUUA 2B35A 4OXNA 5LCXA 3GFBA 3WICA 1E1LA 4XRRA 5FEUA 2PZJA 4R1TA 1UUFA 2EEZA 1J0XO 3DBHB 4PLWA 5AYVA 2O3UA 2C7GA 4WCFB 4XRGA 2PH5A 3DMTA 3SLGA 5T8KC 4BO6A 1IOLA 1QV6A 2NV6A 2HCTA 1VM6A 4PLZA 3RUCA 1ZIDA 3VZPA 3GGPA 2X1HA 3UAGA 1YXMA 1ZCJA 4JCOA 5G4KA 5J23A 5ER6A 5LDHA 2WWRA 3OIDA 1WXDA 1XR3A 2CF5A 2E49A 3AFMA 1SEPA 4YAEA 2FP4A 4O59O 1Z7BA 1UR5A 4NI5A 2DFDA 3JV7A 1IHXA 4PVCA 2DPHA 2HUNA 1KY4A 1VI2A 4OIMA 2X0RA 4DIBA 2VTDA 1RYDA 3I1JA 1TI7A 4WCFA 2IE0A 2B4QA 4DPMA 1U7HA 4LMRA 4W4TA 3L07A 4ZQEA 2X6TA 4EITA 3TOZA 2ZB8A 1PJQA 4RO0A 4DUPA 1LDBA 4BNKA 2R00C 2GNAA 1JDJA 4GMFA 2VUSA 4PIVA 3RUAA 3L6EA 4L74A 4GKVA 3UKOA 1I0ZA 2ZATA 3ENNA 2VUTA 1ZFNA 4D0SA 2PLAA 4GGPA 3FSRA 4RLSA 1LNQA 5HRUA 2I3GA 4EUFA 4FGWA 1DC4A 3PWSA 4RV9A 1ZBQA 3V1UA 3KZVA 3SJUA 2I3AA 4QSMA 2X9NA 1YQXA 2FOIA 2VNAA 3ZHYA 3FNHA 1HL3A 4CLXA 2D4AA 5ILGA 3S1LA 3ZWXA 1V6AA 4BGEA 4IXWA 1JLLA 1T2AA 1FMCA 3I9OA 3HB4X 1I36A 2WEKA 4J4TA 4RDIA 5F21A 3JQAD 5A9SB 3RVDA 2O2YA 3WWZA 1M75A 4GL4A 1WAMA 1QLJA 2BFOA 3WXBA 2JCYA 1I33A 3KSZO 5JDCC 1BXZA 3KVOA 2I65A 3ANNA 1QXSA 3OIGA 4AICA 5ENDA 2AMFA 4BKQA 5JAQA 1NASA 3WGYA 4NQZA 2EP7A 3AJRA 1CF2O 5F1KA 1A5ZA 2JAPA 2DQ4A 4IMRA 1E3EA 1H5QA 1A72A 2BFMA 1PQWA 3G49A 1LSUA 3GUCA 4BNLA 1VL8A 4DIOA 4YR9A 1SNYA 1VL6A 4YB8A 2B0JA 2YJZA 3V1TC 3OSUA 1YJ8A 2EKLA 3JYLA 3ETEA 1IZ9A 2YW9A 2EGHA 1P1HA 2W8ZA 1UAYA 3HSKA 3H2ZA 2J3KA 3KOUA 1NQAO 3RJ9A 4B8ZA 4B7XA 3LT0A 2E37A 3BTVA 1HXHA 4BO3A 1W4ZA 4NNJA 2O23A 4NZ9A 4YAKA 1B8UA 4IZIA 3W8EA 5A04A 4K6CA 5JO0A 3UW3A 1R16A 2JHFA 3WQSB 3K30A 4BO7A 1A27A 4J1QA 4R1UA 4J91A 1V9LA 4W7HA 2Z95A 4IBOA 5EJ2A 4HNGA 3HG7A 4E5NA 2JJYA 3L77A 5COBA 3WB9A 5L4NA 3I83A 4UUOA 4XZ3A 1HTBA 3FPCA 4YQZA 2IYPA 4ZN6A 1NP3A 1R4MB 1D1SA 3S2GA 1MFZA 3RU7A 3RASA 4W9NA 1YB4A 3MJTA 5G4LA 3JD2A 3ZHXA 2JKVA 4YT2A 2DTDA 3GK3A 4XJSA 2DM6A 3EW7A 1WLYA 1O6ZA 4CR6A 4AJJA 1BW9A 1Y6JA 2NU6A 1OC2A 1PGPA 2NU9A 2Q1WA 5IXSA 3UVEA 3RQSA 4WOKA 1BRMA 1GR0A 2P5UA 1F8GA 2NU8A 4DWVA 3UGKA 4K26A 4TVBA 4IQGA 4DPKA 3RC9A 2V6MA 4XYMA 3RUEA 3IKTA 3PJFA 2YDYA 2PKRA 3UF0A 3DAGA 2BGKA 5JDIA 4CODB 3VPFA 5JLAA 1WNTA 2E82A 1IYZA 1V8BA 2O7QA 1E92A 4K9DA 3ZH2A 4E2WA 5L9AA 1R0LA 2PK3A 2CSUA 1H0KA 2YDXA 3I23A 2EHDA 1Q1NA 2JD2A 3OQ6A 2AQIA 2O4UX 5C7OO 4ZA2A 1E7MA 5GMOA 4JLWA 1DLJA 4NJMB 1E6EA 2DC1A 3ULKA 1G1AA 2P91A 4K6FA 2YUTA 5JPIA 3T7EA 3JYOA 1XHLA 3GDGA 3UXYA 3M6IA 3H9JA 4HFMA 1RYEA 5DBFA 3I9MA 1ZKMA 1BSVA 3ZNPA 3NT5A 4A7PA 5BR7A 3KB6A 1R66A 4WE3A 4YRDA 5GZ6A 3VPSA 4OKIA 3OM9A 2VWGA 3WSWA 4MVJD 3LC2O 1OI7A 5L95A 1Z82A 4Z0PA 1ADBA 4BL5A 3JQEA 5GZ1A 1I8TA 5DCUA 3ASVA 1DB3A 1H9BA 1I3LA 4YJHB 1YL7A 4NBVA 4Q3EA 1AXGA 2PKQO 4U0KA 3ZCXA 4CR8A 4JP3A 4N5LA 1VKOA 1BVUA 3P2OA 3KO8A 2O7SA 1V3UA 3GNQA 4WOJA 4CM1A 3AOEC 4XB1A 3AU9A 4IIUA 1TXGA 2PY6A 1O89A 2G82A 1S6YA 4O63O 4CR7A 2Q1SA 2RCYA 4YT5A 5CEFA 4E13A 3INTA 2VHWA 3RJ5A 1F06A 3KV3O 4R68A 5KVQA 3JQAA 1NFFA 1E1KA 2OFPA 3K73O 4NFHA 5JMPA 4WKGA 4D3FA 3DZJA 4XGIA 5HA5A 3IOYA 1M6WA 1V3TA 3HUDA 4IMPA 4AJEA 4FFMA 4EUHA 1VPDA 3PZRA 4XDYA 4L75A 4LISA 4CMEC 4GWGA 1U28A 4E12A 2CD9A 2J5QA 1GD1O 1J5PA 4PG4A 3CXRA 4Q3DA 1QYXA 5A9TA 4B3HA 1X7DA 4TZKA 3VDRA 5C7LO 1NWHA 3TNLA 3X2FA 4P4LA 1UZMA 3PLRA 2Y1GA 3HFSA 1XIVA 3PHJA 1PU2A 4LVCA 5FWNA 3VVBA 1LA2A 2CVOA 4LSWA 4BGUA 4RDHA 1UXHA 2H5LA 4U6SA 5JDIC 2PZKA 3FD8A 1MXFA 1NX6A 1Q7GA 3D0OA 3QRWA 4GLOA 1PGJA 2IDZA 5T57A 4CQMD 3FTPA 1O94A 2G17A 2V6GA 4NHEA 1F12A 1NM5A 1ONPA 3BTOA 1XEAA 5LC1A 2Z5LA 4F6LA 1PZEA 4OKNA 1WMAA 1E77A 2QYSA 1I2BA 1N9GA 1U2DA 1U1IA 3QJ5A 2X9GA 1GQQA 1FK8A 3NYWA 3V2UA 4BKRA 1HEUA 4F3YA 3CMMA 4HFNA 4B79A 4E5PA 1I3KA 4ZQHA 4FFNA 3E9MA 7MDHA 4XX0A 4M54A 1UDCA 2PGLA 1ZMTA 1EBFA 3JQ9A 2IZ0A 3JTMA 1ZEMA 2H6EA 4HFJA 4E32A 1NBOA 4FPXA 8LDHA 4FQ8A 1A7KA 1OFGA 5IDWA 2BELA 5JY1A 2Y68A 3EHEA 4IQ8A 2ZKLA 3MJSA 1B16A 1LQUA 2NTVA 2YHUA 2Q50A 4E5MA 2WYWA 1JKJA 2GYYA 2QIOA 4GX0A 3PIIA 2AW5A 1JW9B 4W9NC 3GZNB 3QY9A 5K6AC 3RKRA 4ILKA 3Q11A 1YDEA 3D3WB 4XIYA 1HSZA 1PQUA 2DPGA 3DAPA 1PL8A 2I6TA 3AM5A 4DBZA 4OHUA 2VHXA 3DOOA 4L4SA 1BDMA 3BMQB 3OEWA 5TNXA 4EJMA 3A4VA 5AXCA 4HP8A 3WOHA 4G5HA 3TDKA 4IS3A 5I8WA 4XQ9A 4J9UE 3VH4A 2CF6A 4CUJA 1HYGA 1Y7TA 1FDSA 2Q3EA 1KEPA 1SBYA 3X2EA 4LW8A 5A9RA 1LRLA 3A14A 3FF4A 5F1PA 1IULA 1ZW1A 1EDZA 3IL2A 4JBIA 3I6IA 2YQ5A 3HWRA 4YAIA 1T2DA 3KTDA 4Y9DA 4CLRA 4P38A 1PGOA 3JYNA 3KEOA 2PGDA 1NAHA 2BGLA 5L4SA 5IJZA 1E7WA 2GZ1A 4FJ1A 3WMXA 3C1OA 2Y1FA 2EV9A 5CDUA 3DBVO 4XYEA 1ZK0A 1H94A 2I99A 4NMHA 1QLHA 2X0NA 5H82A 2DT5A 5KCZA 5DULA 3VAZA 1Q0HA 3V5NA 3JD0A 4KMSA 1B8VA 2CNBA 4FN4A 1TEHA 1EBUA 1Q0LA 2P2SA 3UFXA 3WIDA 3D5TA 4TWRA 3OHSX 4RF5A 3TZKA 5AQ1A 2Y0CA 3JQFC 5TQVA 1PJSA 4CV2A 2VYVA 4FJ0A 4MP3A 4TRJA 2DBVO 2XPCA 4J7UA 3NDRA 2D3TA 2YYYA 3S55A 4UUPA 3FWNA 4JGBA 4YAGA 4P4GA 4HADA 4N18A 3NX4A 4PN3A 2DUUA 4Z0HO 3H9EO 3ROMA 1GYQA 3F1LA 3KYCB 4Z9XA 3NRCA 3QWIA 1Y5RA 3TQHA 4KQWA 4CMJA 3GLQA 3T4EA 2Q4EA 3N7UA 3QV1A 1H9AA 3A06A 3TOXA 2EJVA 1PTJA 4IJVA 5G0SA 4I08A 3PDJA 2C7VA 3ADOA 5KKAA 4CLOA 3H5AA 5JFOA 3FRJA 4L8VA 3AW9A 4RVUA 3PWZA 1GPDG 3AM4A 4ZU3A 4HY3A 4II2A 1EEHA 4B4UA 5U9CA 3DQPA 2CVZA 3I9JA 2LDXA 4BS9A 1EUZA 3F5QA 5JE8A 3G17A 3PYXA 3LYLA 4YVFA 4HV4A 2HU2A 1NYTA 3VTFA 5ICMA 4D3SA 1NHGA 3B1JA 3WLFA 4CQMA 5T67A 5I9MA 1SB8A 3D1LA 4WLEA 3M1LA 1GQ2A 1CYDA 3F4BA 3OICA 1VLLA 3GGGA 3EUWA 4M87A 2AQKA 3V8BA 4HUJA 4MVJE 4IDBA 1Z74A 3GHYA 1WW8A 3NT2A 4J49A 3L0DA 4RPHA 4CMKA 2VWHA 2UV8A 1VJ0A 1ISFA 1EFKA 1MP0A 1U8FO 3FN4A 3GNTA 4M1QA 1UP7A 1U4SA 3UCEA 1O9BA 3RFTA 2W90A 3QA9A 4IM7A 1U5CA 4H15A 4KOAA 4JJIA 5G0TA 5T8KA 2DTXA 4U7WA 5CDGA 3KSDO 3MWEB 1QV7A 4OOFA 3I9KA 3VHRA 4EZBA 5JXWA 3CTMA 1GUFA 4NBWA 4AJLA 3VZQA 4CQMB 2HO5A 4A0SA 5JDCA 4YEDA 1IHYA 1GEGA 2DFVA 3ONEA 4B7CA 3WGQA 1A9ZA 2CUKA 4JIGA 3VZSA 4BNNA 5TIIA 2EP5A 2ILTA 4R9SA 4L73A 3S2FA 2ZCUA 5JAMA 4FBGA 3SEFA 1XKQA 2WD7A 2AG5A 3RUHA 3W6ZA 5KKCA 3OJOA 1YBAA 1QYDA 3G3EA 4ND2A 4PGFA 3KBOA 4DLAA 1M6HA 3BMOA 4JJFA 2BGMA 4JBGA 2D8AA 3H8VA 1LU9A 1HDOA 1LLUA 4GSKA 3OF2A 1GYRA 5U1PA 5CAEA 5IXYA 2VHVA 5JO9A 4MIEA 3GT0A 2O48X 2P5YA 2DAPA 1NPYA 2GZ3A 4WLVA 4FOOA 1XU9A 3DWFA 5IDQA 2V7PA 2W2KB 1J49A 1N92A 1PWXA 2W2KA 4DRYA 3O4RA 2RIRA 4CLHA 3KYDB 1MLDA 5DP2A 1JU9A 5HM8A 2PD6A 5DNAA 2BD0A 2BRUA 4OSOA 3GVHA 5H81A 5JAZA 4IJUA 4BMVA 1B2LA 1MG0A 4L0QA 3GVIA 1LC3A 4R41A 4GX2A 4C7JA 3JQ8A 1GZ3A 4TRNA 1HDYA 3ZWAA 3TZCA 2QQ5A 3GGOA 1R4MA 3ENKA 1HE2A 5ES3A 3MJEA 3MEQA 5TF4A 3WGTA 2GR9A 5A5EA 4FCCA 4MKRA 3DMTC 1VL0A 1YB1A 5HTOA 1JVSA 3VZRA 1I2ZA 1BW9B 1HLPA 2PD3A 4AG3A 1ADFA 4PZDA 2IZ1A 1ONOA 1ISJA 5L4LA 3CMCO 5B37A 3GMSA 2H9IA 4J43A 3U9LA 1VRWA 3E48A 4FC6A 3RKUA 3ZHBA 4BNHA 3DDNA 4ZVVA 3TPCA 1HDXA 4J0FA 4RQUA 3W4JA 1SEVA 4M49A 4JXKA 5A3JA 3IJPA 4XEHA 4RVDA 3EZLA 1TA4A 4D46A 2VCYA 5DP1A 5TT0A 4XYGA 1PJBA 3P2YA 4YT8A 2B37A 1NWCA 2HMUA 5HWSA 3ZWVA 1CEQA 1P74A 1HYEA 3IP1A 2VZ9A 3A1NA 2Y67A 2LDBA 3TL3A 1DRVA 1EUCA 1N8KA 3E1KA 4XR9A 1QYVA 3GZNA 5CG2A 3ORFA 2IXBA 5HBRA 2I67A 2HMSA 1JWAB 4QECA 1H2HA 4AJKA 3G1TA 3O8QA 3LZ6A 3GMDA 2QHXA 1QRRA 1YO6A 4FDAA 3GEMA 3PFWO 1BWSA 3LDHA 5L7TA 3MTGA 3GVXA 1CIVA 3DBRB 3U0BA 3JD1A 3ZV4A 1XQ6A 3EGOA 1I30A 3KRTA 1GDHA 4FFPA 3JYPA 2OZPA 3NJ8A 5T5QA 5KOIA 3I9LA 2OHXA 4PG6A 4NR0A 4OL9A 1DIGA 4YJHA 1BXGA 3OEYA 4R16A 3SC6A 4EYEA 4DQUA 3JQBC 4XYBA 2R00A 3HN7A 2J5KA 4GI2A 2NADA 2EW2A 1U4OA 3NJ4A 4DYVA 3VC7A 4GLLA 1DJNA 1X14A 5FF9A 4PFJA 4CPDA 4E3ZA 4MVJP 1B15A 5L3ZA 3QLJA 4A27A 3AUUA 5EPOA 4GGOA 4OO3A 1ENPA 2CVQA 5MDHA 1P45A 1P0CA 2FY8A 4NG5A 1T2EA 1LDGA 3GAFA 3FI9A 3LT1A 4QFDA 1LSOA 1E1MA 5EINA 3ZV6A 1E3WA 4JP2A 3WJ7A 4D45A 2ZQYA 4PLFA 2CDAA 3TSCA 2IXAA 4QT0A 4QO8A 3OQ1A 3PFFA 5LDGA 1N7HA 4AJ1A 1B14A 1MB4A 3C85A 4Q3AA 4MIOA 3ON5A 5JAIA 2B5WA 3K2BA 1OOEA 2BI8A 4KUEA 2J6IA 4B4OA 2UUOA 1PL6A 1QORA 3WYCA 1U3VA 3DZKA 2POQX 1X13A 1YS4A 1SO8A 2NQ8A 3NGLA 3V1YA 4AJ2A 2Q2VA 4CLEA 3ST7A 1GUYA 2D1YA 4BO1A 4UVIA 5JCJA 5TS3A 5AXAA 4RQTA 3P5SA 2OMEA 4ALIA 2NM0A 3WFIA 1N7GA 1F0YA 1NFQA 1HZJA 4EW6A 3K92A 4PRLA 4AJNA 1YQDA 1R0SA 4OSPA 3ZWBA 2CMDA 4LCEA 3ZU3A 4BB5A 3WSVA 4DA9A 4OOEA 4GQAA 2OL4A 4BKOA 1X7HA 3K6JA 3DC2A 5A3VA 1E3IA 2NQTA 1P33A 5I7VA 5KJ6A 1I10A 1QG6A 1UZNA 2WDZA 2BLLA 3R3JA 3GAZA 4NFYA 2JCVA 3DXFA 4CV1A 3F3SA 2WJPA 3CZMA 4R5MA 5BSFA 1FF9A 3LF1A 2VHZA 1NR7A 1X0VA 1HRDA 3DTYA 1Z45A 1E7SA 1YBMA 1EE9A 3ZWPA 3HN2A 1R15A 2A94A 3PYLA 4A03A 1C0KA 4BO0A 3VTZA 3IP3A 1T24A 4IIVA 5L45A 1UXKA 3DZHA 4QQRA 1YRLA 4J1TA 5TLSA 1EK5A 2WE8A 2C07A 3CINA 2HQ1A 2OO5A 1I32A 3GHHA 1YL5A 2C54A 5ENVA 3EAGA 2UVDA 3O8QB 3E9NA 3CKYA 3R1IA 4IGFA 1SOVA 4N54A 4QXMA 3WBBA 3C7DB 2AHRA 3MWDB 3DFZA 2QYTA 1T4DA 4WNIA 3PK0A 3WQRA 2P9GA 1HLDA 3GFGA 3FBTA 2HJRA 4J1NA 3ZNNA 1EDOA 1CETA 3F9IA 4CM8B 1HDGO 3TRIA 4E33A 3ZGYA 4HKTA 1DHTA 1GZ4A 4R5HA 2RH8A 2DLDA 2ZTVA 3RBXA 1SAYA 4MPDA 4BO9A 3CZRA 4ZQGA 2HRBA 4Q3NA 3INRA 1KOLA 2YV2A 4Y67A 3U49A 1WVGA 2HRZA 2P9CA 3BMNA 5KWEA 3Q6IA 3BYZA 5BQFA 2EERA 2WYUA 2VUUA 3QWAA 1F14A 1Y9EA 1N5DA 3AUSA 3G79A 1I3MA 2FR8A 2I66A 2OORA 3O38A 5AXDA 2Y99A 5JBIA 1R6DA 5IDXA 5DCWA 3UCFA 2J3JA 1BXKA 3CPSA 4GKBA 1EQUA 1RM3A 3RAJA 3U09A 2W2LA 1QYCA 3GVPA 4CM8A 1ZSYA 3FHLA 3PJGA 3O26A 2HMWA 3WWYA 4ZGWA 2X4GA 3FNFA 4C7KA 4IDGA 1G6KA 4W6ZA 1FDVA 4CV3A 1PGQA 5L7WA 2CZCA 2X5JO 3V2HA 4EEZA 4CLOB 2FZWA 3JQGA 4UVHA 3EC7A 3D5QA 2Y1DA 3JQGB 5K6AA 1K6JA 4XD2A 3STHA 2FPPA 4E2XA 4A5OA 1KVTA 2Q49A 1Z73A 3NTOA 4DYDA 2GRAA 5A03A 1Y1PA 3UOGA 1DIHA 4H7PA 4XKJA 1ZEJA 2EIHA 3R6DA 1D8AA 4HXYA 3ZWMA 5KNLA 4GX5A 3H9UA 3BIOA 1Q7BA 1E3LA 2QW8A 5KVCA 5TT1A 1TT7A 3QVSA 2VRCD 1ZXLA 3TZHA 2Y66A 4YPOA 3WLEA 4EI2A 3NUGA 2WSBA 3D3WA 3UN1A 2OGUA 2O3SA 3MZ0A 3FBGA 4PLVA 4AJPA 1YONA 4YDRA 2XXBA 2AEMA 2CDBA 1NQTA 3OJEA 4E5YA 2VTEA 1SMKA 1ML3A 2NLOA 2JL1A 3GR6A 5A9SA 3I3OA 4CM4A 3WX0A 1C1DB 2ZB7A 3GH3A 2JAHA 1AHIA 2GF2A 1U3TA 1AXEA 2O3TA 2C20A 3LLSA 4WJZA 3VDQA 1ZXBA 4UULA 2YFQA 5CPBA 3S2IA 4DLLA 4AJ4A 2PGJA 4ZICA 3F47A 3SC4A 3BMCB 2YV3A 2YQ4A 3B20A 4CV0A 3GDFA 1CERA 2IRWA 3B70A 4LSMA 1AUPA 4DGSA 6ADHA 1MX3A 2VYND 2WD7B 4RVSA 5FYDA 1MG5A 3EK2A 1C14A 2FHSA 4DBVO 3U62A 3IDSA 1KETA 4B4VA 1O8CA 4A10A 4CMGA 4KDFA 3ZWCA 3LVFO 1R37A 2X5OA 1ZUD1 1IPEA 3AI3A 5IAAA 1DBVO 2E48A 5IG2A 5EERA 1PZGA 1IL0A 5TJ9A 3OETA 5TGDA 4I9UA 4BO4A 4NU6A 5DOVA 1UXIA 3D4OA 3U3XA 3PHIA 3RI3A 2DBRA 5COQA 2W4QA 3PQEA 4AFNA 1ZJYA 2NNLD 1ZH8A 2AE2A 3QWBA 4TVOA 1YDWA 4RGBA 5ER9A 4Z3KA 4J9VA 1YQGA 4P8RA 1SC6A 4HX5A 4ROSA 1KS9A 4WLOA 1XLTA 3ZWNA 3E9QA 4FS3A 1XELA 4QFCA 5A05A 3NDIA 4GMGA 2NSDA 4ALJA 3QE3A 1SOWA 5EIOA 5IN4A 3R3SA 1V0JA 3INGA 4AVYA 2J3IA 3H7AA 1X15A 4D41A 1P1RA 3U4DA 5KTKA 4RPKA 3GEDA 1P3DA 2GASA 1FDUA 1KIFA 2VT2A 1U8XX 3H5NA 2NVBA 4XR4A 1LUAA 5HS6A 2YFHA 1U7TA 3HDHA 1D1TA 1J6UA 4MKZA 3AU8A 4PLHA 4IXTA 3UICA 1PZFA 4G2NA 5JC1A 2EF1A 3AY3A 3SLKA 1GPJA 4DXHA 3WIEA 4BNYA 5KJ1A 4JK3A 5DBIA 1NFRA 1Y8QB 3FR7A 3NDJA 2I5PO 4P4NA 1LDNA 1DFGA 1LDEA 2Q2QA 3N74A 1DHRA 4CM6A 1X0XA 2FR1A 5A5FA 3IQDB 4XWYA 3WTBA 2GDZA 1GCOA 5B1YA 3IS3A 1UDAA 3ETDA 4IS2A 4CM7A 4EEXA 4K1LA 2C5EA 5BNFA 1GL3A 2BF7A 2D2IA 4RPGA 3NKLA 2QRLA 1R4NB 4B4WA 2A92A 2ZK7A 3HQ4O 1P1FA 1K89A 1R4NA 2CFCA 2JFGA 1Y5MA 3LK7A 4CMIA 1CWUA 1A9YA 2HAEA 1L7EA 5TRTA 3ZW8A 2FN7A 4HBGA 3W8DA 2DKNA 3VKUA 1TVEA 1N9GB 1D7OA 3PGJA 4WCFC 5L53A 2C2YA 3DHNA 4I9NA 1LRKA 1CQJA 2OXIA 2W98A 3GY0A 1LQTA 3E6AA 2X22A 1HDZA 3OJFA 2GN8A 1KEWA 1XA0A 4EBFA 3VH3A 1Q2XA 3NGXA 3ROPA 1GADO 1PEDA 5B4VA 4HNHA 4JQCA 4KDEA 1I24A 5EN4A 1ULUA 3NEPX 4PLGA 1K6XA 5C3MA 3E5RA 1R0KA 2YY7A 1Z7EA 4NFSA 2RAFA 3FTNA 4DQVA 3RUIA 4GVLA 1HE4A 1ONNA 4UAGA 2R6JA 4R51A 2GN4A 4NBUA 4ND3A 4ONEA 3KYBA 2UAGA 1EMDA 3OH8A 1WZEA 3R0IA 3ZNOA 1LRJA 4ALKA 2QX7A 3PPIA 2PNFA 4CMCA 2VRCA 1ZSVA 4YRAA 2Y1OA 4I8XA 4UVEA 4CLDA 4NDNE 4B8WA 3L4SO 4E5KA 2OBYA 3PRJA 1B3RA 4AJIA 1CRWG 1VKNA 1C0PA 2AE1A 2JCXA 3GPDG 2RH4A 2VZ8A 4ID9A 3WQQA 4BQPA 4URFA 2GD1O 4MVJF 3L4BA 3Q2KA 1YE3A 1U3WA 4TROA 3JQAB 5I7FA 3TFQA 5KIAA 5GY7A 1PL7A 4L4RA 4BNXA 5THKA 3SVTA 2J5RA 3RC2A 3RU9A 2PZLA 2HK9A 5COAA 3JQ6A 3EDMA 5ICSA 4O6VA 3DZGA 4GBJA 2NUAA 3ZNQA 1KVSA 1DFIA 3FR8A 5A4DA 2Y93A 3VH2A 3BAZA 3ICCA 4MOWA 2JHGA 3H9QA 3LT4A 2VYNA 4E2YA 2Y0EA 3PDUA 1T1RA 3Q9UA 1VJTA 3W6UA 3SJ7A 4E21A 5C5IA 4U8GA 1E7RA 4GSLA 1DLIA 1S7CA 1YOVB 5DN9A 3RFXA 1E3WB 3RC1A 3D7LA 1J4AA 1YBVA 4TKMA 1E6UA 2C29D 3TJRA 5C7IO 2H63A 3VPGA 3D4NA 1P1IA 3QQPA 4KZPA 4PLYA 4NBRA 4RVGA 4A2CA 3C8MA 3AFNA 3CIFA 2GN6A 5TJHA 4H3VA 3DBLB 3OIFA 3A9WA 4IJKA 3HFGA 4QUKA 3BHMA 4WEOA 5CPFA 5U4QA 3WBFA 1XU7A 1W73A 5L51A 4CMIB 1H2BA 1MGOA 3KYDA 1QYWA 2X58A 4S3MA 3ROQA 2Q46A 1ENOA 4D44A 4ZQFA 3FNEA 1W6UA 1DJQA 1RWBA 4WGGA 3B1KA 4WASA 3DMYA 4UEJA 2G0TA 5CDSA 1FDTA 3QHAA 2O3QA 1PJ3A 3RWBA 4MVJI 1JTVA 1BGVA 4OGWA 1B26A 4PVDA 4BUCA 4FC7A 2BKAA 4DQXA 2ZCVA 1IZ0A 3PQDA 2J8ZA 4IUYA 2ZYGA 2VQ3A 1TT5A 1KVUA 2H1SA 4RF4A 3ROKA 4UVGA 5BSHA 3ONDA 2IEDA 1Z6ZA 1GYPA 2PKQP 4CM5A 2C82A 1ZVMA 1XQ1A 1OAAA 4O1MA 4Z0TA 3L6DA 5K9ZA 1UXJA 2FRDA 3OMLA 2VRBA 9LDTA 1L7DA 3DHEA 3RUFA 1BVRA 2P4HX 1KEUA 3L9WA 1EVZA 3O9ZA 1P31A 3LC7O 5DF1A 4DREA 1I2CA 1B3BA 3DO5A 5F1OA 4YYZA 4ZRNA 2EXXA 2Y05A 2YHIB 3H4VA 4ND5A 2OP0A 2HDHA 2AXQA 3DOCA 5BSEA 3JSAA 3I4FA 4FJ2A 4GX1A 3KM0A 1XCBA 2O4CA 1E7YA 3QVWA 4RF3A 1JQBA 4W99A 1I5RA 1QP8A 1C1DA 4MVJA 5IFLA 2NVUA 2IZZA 3AK4A 1TT5B 1C1XA 2D0IA 3HHPA 5THQA 4LVUA 4XCVA 1Y9AA 2B5VA 3WGIA 1Q7CA 1R12A 1NNUA 2SCUA 2OP1A 4WEQA 1A4IA 3BMCA 4J6FA 4MJLA 3F46A 5IN5A 4WPGA 4NK5A 4XDZA 4BNMA 5F5NA 1RJWA 3E18A 4IDCA 1HT0A 1GV0A 3NV9A 1Y8RA 1E6WA 4JNKA 4PLTA 3PEFA 2HMVA 5BNTA 3JYQA 3PHLA 1EFLA 5JY6A 1P44A 3ZZNA 5MGBA 2XXJA 1IUKA 1JWBB 1U2GA 1WDMA 3E03A 3IUSA 3DZIA 1EZ4A 4K28A 4J3FA 4PCVA 4BO5A 1TB4A 2VWQA 1GEEA 3DFUA 4I5FA 5DBGA 3AOGA 4O0LA 2DBQA 4M8SA 3BMQA 1QKIA 3G1UA 4IDDA 2AQHA 4BHTA 1WP4A 4MDHA 4RVFA 1V35A 4J0EA 4YWJA 1PJ2A 5HS4A 1U5AA 3GNSA 4R01A 3OBBA 5EL0A 1PZHA 1KERA 2NWQA 4UEOA 4WK6A 4BNTA 3K31A 1W0CA 3E5MA 4NJMA 2ZB3A 3ZWYA 4RVHA 2X9VA 1H6AA 4KQXA 1HZZA 3OP4A 4YJFB 1H6BA 4YJFA 2WM3A 3ZV5A 2IODA 3ZWWA 3EVNA 2UUPA 1E3SA 5ITWA 2X5KO 4DLBA 1KC3A 4NH4A 2AQ8A 4RZHA 4FFLA 3WDSA 4AJOA 1ZMOA 4UEKA 4JX8A 3AOEA 2V6BA 3QVTA 3IKVA 1ENYA 5FFFA 1SZJG 2R2GA 3F5SA 2GGSA 4IJWA 4ALLA 4U5QA 4I5DA 3SX2A 4ZD6A 2DU8A 3DR3A 2X0JA 4TRRA 1BG6A 2UDPA 4GVXA 1DC6A 4J7XA 4R9RA 3WGZA 4LMPA 1HWYA 1K3TA 1D3AA 1SB9A 4R54A 4XB2A 1PX0A 2VWPA 3Q1LA 5DDIP 3LT2A 3HB5X 1IPFA 1JA9A 1WDLA 4IZHA 1E5QA 1NVGA 3BTSA 4PRKA 1PGNA 3DZFA 2B4RO 4I1IA 4XQGA 3GPIA 4IGEA 4FSHA 1LDYA 1A71A 4DMMA 2XF8A 3DHYA 2WD8A 5JS6A 1NXQA 1PIWA 3F4LA 4FW8A 4YTEA 3PP8A 3GRPA 4CL8A 2NU7A 3MTJA 3ZU2A 3H5RA 1CDOA 3MOIA 4GWKA 1U9JA 2NACA 3KSUA 2NVUB 1T2FA 3KYCA 1GV1A 4FR5A 2O2SA 1DDOA 3WJAA 3GZ4A 5CEEA 4Y6RA 1OZAA 4J7CA 3AM3A 3MJVA 3OECA 3CE6A 4A26A 1Y81A 5K0ZA 2Z1NA 2YHIA 2D5AA 3PJEA 3VPHA 1HE3A 1WWKA 3S2EA 2A9FA 3PQFA 1AE1A 4Z9FA 2TMDA 1QMGA 1LSJA 2WYVA 1KYQA 3GG9A 2GN9A 3PJDA 2X86A 9LDBA 4Y98A 5I9NA 4FFRA 3U5TA 1LC0A 3IJRA 4B3IA 5IZ4A 4NJOA 4ALMA 1K0UA 4R1SA 2C0CA 5DCYA 5DOZA 1AN9A 1PS9A 5A06A 3JQDA 4DTIA 5AVOA 3FPLA 4TRMA 4J4BA 4QEDA 3DTTA 4WUVA 3W4KA 3ZI0A 3BMOB 2JD1A 1O0SA 4YJGB 3LC1O 1LLCA 2RHRA 5G2OA 3TN7A 3U4HA 4OAQA 4OM8A 3NTRA 3TF5A 1GQYA 2HK8A 1MA0A 2P4QA 4OH1A 2QZ9A 2E6UX 4TSKA 4Y6SA 4RPJA 1DAOA 4BKPA 4XA8A 1BXGB 4BNWA 1HKUA 4M55A 3K8ZA 4TZTA 2VZ0A 4GH5A 6LDHA 4CL3A 3GG2A 4HFRA 3RBVA 2HK7A 4BNVA 5JW6A 4G81A 4BNJA 4CLRB 3MCVA 1L1FA 3UCXA 1LXCA 4XQCA 4CJXA 2VYVD 2X0IA 3GA0A 4BMNA 1WPQA 2ZYDA 5BNIA 5B12A 3L4BC 3ZWOA 3TFOA 2GERA 2V6FA 4Z6KA 4BV8A 1YOVA 2X7HA 1HYHA 2ZJ0A 3Q3CA 4RF2A 4FFOA 1DO8A 4BIIA 1YL6A 3HNPA 4KUGA 4F46A 2V65A 3EYWA 5CG1A 1X7GA 4DVJA 3JQFA 1ADGA 3Q9NA 1UZLA 1ENZA 5L7YA 1JAXA 2D5CA 1BMDA 3LQFA 5G4KB 2Z1MA 2Q1TA 4TMFA 4MP8A 2QZZA 1EVYA 4YAJA 1UDBA 1VC2A 1NQ5A 3M1AA 1LX6A 1PWZA 3K5PA 4LN1A 3I6QA 4FGSA 2HLPA 1AGNA 4J2HA 5CDYA 5JC8A 1DIRA 2AEJA 4KTTE 3ZV3A 4BQRA 3KUXA 1ZO8A 4YA6A 4Q3BA 1RM5A 4OMUA 1HE5A 3CEAA 1H6CA 3WTCA 3PLNA 4YCAA 2VHYA 3W8FA 4NU5A 3N58A 3LSYA 2EKQA 3M2TA 4CQLB 2PWZA 4KUHA 4KTVE 1E7QA 1H6DA 4N5NA 1DIAA 4RLHA 3OQBA 2VOEA 4GPD1 1ZNQO 5F5LA 8ADHA 5EESA 1GUZA 1LTHR 1YH3A 3GDOA 1VSVA 2Y1CA 1XGKA 1K2WA 3DAFA 1P1JA 2Q4BA 1LJ8A 4AJHA 5JCXA 2QG4A 1DRWA 1EVJA 3DBHA 3GRKA 3UH1A 3TL2A 3GQVA 3OA2A 4QO7A 4H16A 3WYBA 4F6CA 4R4JA 2FWMX 2ZB4A 2D59A 3IC5A 5I7EA 2YZ7A 4WLUA 2C59A 4D7AA 5EMHA 3NTQA 2JFHA 1VE9A 4KWHA 4E6PA 4ESOA 1GY8A 3RIHA 3GC6A 1EE2A 1NQOA 5JNLA 3H2SA 4CMBA 3L9XA 2Y1EA 4KP7A 2EW8A 2GCGA 5CP8A 1VSUA 1MXHA 3GUYA 1E1NA 5G0WA 4CM4B 3CUKA 3UUWA 3K9QO 4BNIA 4IINA 4S1VA 4XIJA 2GSDA 3PGXA 1JKFA 3TZ6A 3ZN2A 1BHSA 4I5GA 2Q45A 2G1UA 4JN6B 2EG9A 2IEBA 4WLFA 4D42A 4Z9YA 3PTZA 4FB5A 1FDWA 3OJ0A 3V2GA 4BNZA 2FPIA 4NPCA 3F6YA 1LLQA 3E82A 3SXPA 5KVSA 2Q1UA 2RBEA 3JD4A 1IE3A 1MC4A 1K6IA 2C2XA 2TMGA 2ZTLA 3C1AA 3GEGA 4PG5A 4OXYA 3JQBA 3JQ7A 2O50A 4R69A 2FR0A 3ASUA 4CUKA 2DUWA 3GOHA 4BB6A 3I4CA 4YJDA 2EKPA 2VN8A 3KETA 2DBZA 3PHHA 5IF3A 2J3HA 1ARZA 3PIDA 1MFPA 4L9RA 3C7CB 4Q3CA 1P0FA 2XAAA 1NPTO 3VKVA 2O3RA 3ABIA 4PLCA 1ZJZA 1T1SA 1E5LA 4N7RA 1EK6A 4J1SA 1E3JA 4Y6PA 3Q0EA 1NVTA 3PXXA 5L40A 2HKIA 1NAIA 1NR1A 4MIYA 3E8XA 1UP6A 4OXKA 1D4FA 2ZTMA 3JD3A 1DXYA 4RJTA 2CY0A 3RUDA 1KEVA 3MJCA 1JN0A 3C3XA 1QR6A 1HF3A 2X23A 1B7GO 1I3NA 4Q9NA 4DL9A 3IMFA 2X8LA 1G0NA 2VT3A 4NK4A 4DIFA 4YBZA 1JAYA 1JVBA 3DB2A 1PSDA 2FZEA 1DAPA 1SCUA 4LCJA 5JSFA 2C5AA 3DL2A 3U4IA 1HDRA 3WNQA 4D79A 4RPLA 1N2SA 2BI7A 2GPTA 4WLNA 4DMLA 1F8FA 4E30A 5I9LA 4JROA 4PLPA 3EVTA 3G0OA 1PS8A 1UAGA 3W4IA 1ISGA 1N1EA 5BT9A 1XWFA 2WTBA 4EDFA 3GN2A 3T7CA 1UH5A 5KJFA 2AG8A 4XJTA 3M2PA 4OJNA 5A1TA 5G0UA 5ILOA 2B4TO 1DFHA 4J2OA 1PR3A 3A28A 3BXXA 2WE7A 1ISHA 3ZU4A 5IZCA 3NAQA 5FI3A 1UP4A 3MJ4A 1ZK1A
chains in the Genus database with same CATH superfamily
4O4IB 1NT4A 2YIMA 5CLGA 1A95A 2OPHA 4CM3A 3C0KA 1XZNA 2FFHA 1HEIA 4OJYA 5I8ZA 1YDFA 2B94A 4A73A 3QFCA 3GCGA 2QTVB 5T6BA 4ZJUA 3IAHA 1OBFO 5CBPA 4PZCA 3H6KA 1LPNA 1COWA 1KDRA 2GEVA 3H1AA 4MVJH 2C2ZA 4LK3A 1K8YB 3KD2A 4UDYX 4QGAA 5KJEA 1C3OB 4HDOB 4ZRDA 2P5SA 3FRIA 3B1WA 1M34E 2W83A 4LJ5A 4RH3A 5DTEA 4DHEA 1GVNB 1GARA 3KEQA 1SXJB 2E4XA 5CEJA 4H17A 2XZPA 1Z36A 1HLFA 4IGKA 4ER0A 5I3CA 1DPGA 4ZPXA 1VL2A 3LZDA 5T41A 2DWQA 1NU6A 1N1MA 4Q02A 4PZ9A 3UKJA 2BKLA 4R1NA 3VU0A 4LHWA 4XSGA 3BQ9A 1C1HA 2GLUA 5DM2A 2WRZA 1IXSB 3VR4H 3OJLA 3T12A 1U7WA 1RYFA 1DC5A 4JBHA 4RD1A 5K8IA 3UJNA 3GPLA 3FX2A 3T52A 4G0QA 4HX9A 3QSGA 4FNMA 4Y2VA 4X66B 1P2VA 3TR0A 4A2WA 2XY4A 3P19A 1KI1A 1OQAA 4HHEA 1JPUA 1MC5A 2H3HA 3DOHA 4LV5B 5DWVA 3SKVA 1VKHA 1OI3A 4BVBA 3G8AA 3P94A 3T4XA 3SM3A 2WTUA 2VLBA 1U3UA 1QSGA 2JFWA 4QUJA 5JCOC 4PX2A 1EBBA 2ON6A 1C80A 1AZWA 1YB5A 2WABA 1QIJA 3AONB 3NVMB 4UVDA 1OUMA 3AM1A 2RC6A 3NDBB 3IB6A 3KQPA 1CQIA 4M9UA 5CW2A 2OORC 1OYYA 4JR2A 4A92A 5ARBA 1E1YA 3DONA 4O33A 5KDOA 1F17A 3FBWA 3HCDA 1YULA 1LI4A 2R62A 4ES6A 3V4PB 1TMGE 1E0JA 3J81A 2OQIA 1H1TA 4DR3B 3P9RA 2OZEA 3T35A 1C1XB 2V7QA 2QAGA 3RC7A 5JMWA 1JR6A 2N47A 4DMUB 1Z88A 4LKOA 4PSUA 3WHKA 1MW8X 4QHTA 4G0NA 3W05A 2FKAA 3W2TA 1ZZEA 4GBGA 1PS0A 1C5KA 3ZXSA 2OGWA 3VHXB 4FMPA 4XGKA 4B4DA 5AJXA 2DFLA 3ONFA 3PC8A 3BS4A 1Q0QA 4XGNA 1ISIA 1Y3FE 5CMLA 2VRNA 4EBBA 5FNVB 5IBRA 3ZW7A 1PR9A 5J47A 5JNWA 4I9HA 4K46A 4CF7A 4C4OA 1UBOS 1SA0B 5JYDA 1IXRC 5IDYA 3C3BA 2H1LA 2V4UA 4BWYA 4CG1A 5DEIA 4GKKB 1H2RS 5J2UB 1LDMA 1ZA1A 4G0XA 3OFKA 1F1JA 4QUHA 3BMNB 3EXHC 1H8EA 2NZXA 3WE7A 2Y6UA 3C2QA 3THXB 4P54A 1TEZA 3IV6A 3PYMA 1P17A 2ZPAA 5F3RA 1AM4D 3U7GA 4KL8S 1GCGA 2JGKA 1HNWB 3NXKA 4DCOA 4GYWA 3IAS1 4Y0NA 2FPGB 2VNSA 2IYLD 2YV1A 2ZDGA 3HDJA 1VYVA 3W3AD 3QXXA 4BGVA 1KI6B 4N6NA 1RP1A 3EXG1 3H75A 5IJ0B 5EJ9A 2NTNA 2WG0A 4KX5A 3K1AB 3OA0A 5JH7F 5K4HA 4G0VA 4CU5A 3BFJA 4YQYA 1G5PA 3O4HA 1XVVA 5IH3A 3SVZA 2B4KA 5FOSA 4RTJA 4OJMX 4PO9A 2FWRA 3RYCB 3U0BA 3WGUA 5PNTA 1V1MB 1WF3A 2QLLA 2ZJAA 4UCFA 3WWOA 3P9NA 1GVHA 4ZC8A 1OX6A 4DJ5X 5JZ9A 2PWYA 2NMVA 5DZSA 2EGGA 2QRVB 1QPBA 3CLTD 3RLIA 4ZRMA 3HCPA 5C2JB 1JQLB 3CH6A 1NQUA 4ZHSA 2A84A 1L4BA 3WP1B 2Q2WA 3OZUA 5J40A 4IY1A 2IBSA 4FM9A 2UYYA 3JQ8B 3M6MD 4BJ5A 2WWXA 4HAYA 1UWCA 3CEJA 4DC1A 4EY5A 3TLJA 2C3PA 7AT1A 1H9CA 4TLMB 4CQLA 4MIKA 1AH2A 2OC9A 3H11A 2HYIC 2GO1A 3SQLA 1L6IA 2PH3A 1FA9A 2WKSA 4BGIA 1OI4A 4CMAA 3LYHA 4DLYA 1ZK2A 4P7JA 1XG5A 1ZHHA 1U99A 1VBKA 2DQSA 2SCUB 3LP6A 3BZUA 4C4PA 3WYDA 4G65A 2H17A 2MSKA 4ITUA 3JQ9C 2HCFA 4IHJA 2FMXA 3SMQA 2W0MA 3C7TA 5DASA 1AURA 3CUTA 2WM9B 2NOAA 3ROZA 3S5JA 4RJLA 5FI5A 3D3QA 4RAQA 4OQYA 5DYGA 2PGOA 3ZD9A 1N1GA 2DP4E 3BIXA 4IQ0A 4RCVA 4D9CA 4FIDA 1Z0UA 2HI0A 4EA7A 5KU7A 3O47A 4FWIB 1W47A 4I5EA 3L7JA 3ZQ6A 4F45A 5J3JA 4IKEA 2CSXA 3QXJA 4R0MA 3F1KA 5KQLA 1N0IA 3D6VA 3R4VA 4LY9A 4PYIA 2D00A 1A88A 3T1TA 4U6QA 3RSLA 1G0OA 2ZRFA 3A2KA 3EZYA 1IBLB 2IU0A 1TU0A 1YGYA 4GO1A 3SBOA 2AKAB 4JC0A 5JLJA 4WNCA 4R1QA 3MGGA 1I1HA 3ANLA 3H3JA 3FSGD 3WMWA 1NN1A 3F8SA 2Z3VA 3DDHA 4LRTB 4YMLA 1JR3D 2VJCA 1HETA 2Q99A 1E8MA 1WTCA 2B30A 1JEQA 1RM4A 3AESA 3IAXA 3WZ2A 4CM9A 1A8IA 5JZSA 3WRWA 1K66A 3JU3A 1GAEO 5FTMA 5NULA 4LX8A 4WXHA 4NXMB 4JJGA 4OMCA 4GAEA 4OHXA 1K9SA 1N6KA 2ET6A 3CH5A 4NCJA 5BV8A 2CXTA 3KPYA 2GVZC 2E18A 2YWBA 4KO1S 2QRJA 1OFUX 1SUFA 4WXMA 2AWNA 3ICQB 2B3TA 1M2VB 1O95C 1TFRA 2J32A 4BEBA 1QTNA 1P6XA 4FFWA 4LRYA 3AVPA 1ZH4A 1II0A 4LJSA 1XVUA 2VL7A 4CF6A 5F64A 3UXEA 3DMNA 4OXIA 1OHHD 2HLDA 4TL8A 5JHGB 3L84A 5H80A 1UBUS 3TZLA 5L8VA 4LAFA 1ODSA 3MA0A 5DM1A 1OAOA 2R85A 2VSYA 4BZWA 1QOQB 2G76A 3CZAA 4X8LA 4ZCIA 3B6ZA 5AHWA 4H6PA 2AC4A 3PPYA 4OK6A 3RSZA 3WNVA 1T36B 4BUJA 2OVFA 2VJAA 1KZ9A 2WWWA 1J2JA 1GZ6A 2BCEA 2J41A 3FTDA 3FTQA 4WJKB 4Y1EA 1FJHA 1PT5A 2YVAA 1BX1A 3ADPA 3BSYA 3MOSA 3ZOKA 4WAUA 4EG5A 3I61A 1P9LA 1YFZA 2BUCA 2MOKA 5DYWA 2V9ZA 3UWKA 2I29A 1XEXA 2VNHA 4R98A 4YIKA 3IMCA 3R6WA 4L4XA 4WBSA 1JTFA 2IKSA 2Q0XA 2Z8YM 3LG2A 3AY7A 4YLYA 2V5AA 3BWXA 1GZUA 3H1GA 4GI7A 3T15A 5EMKA 4P53A 1YC5A 2G72A 4MUIA 5F2OA 3UMFA 1JSRA 4YCBA 4OEHA 4TQ9A 4EHNA 3R9XA 1PQPA 1RCUA 1WMBA 4GPBA 2XBUA 2XI4A 3C6XA 3TKAA 3T7AA 3QKRA 1YVEI 3FNGA 4Z8YA 4IF6A 1P0IA 1QIDA 2ZRKA 3O3CA 2OKGA 1C0LA 1Z33A 4GMKA 1DUIA 2XOXA 1UBFA 4R1PA 4ARUA 5C8YB 1Z0FA 3AR2A 2VVTA 1PV1A 1D6NA 2YVUA 3R75A 5IH7A 4HRYA 3TW8A 3DFIA 3CF2A 1TQ4A 3RS4A 4DF3A 1B0UA 3R41A 5ELXA 3KQTA 4KYIB 3I6MA 2FZ4A 1DCFA 2UZIR 1HI9A 1OTXA 3A31A 1J0XO 3NZEA 2HYDA 2Q07A 3K5WA 5K3FA 4ZK2A 1J20A 1WM1A 1D2MA 2PAAA 3MCAA 3L02A 1MGPA 4OA5A 5AYVA 4DUGD 5JOQA 5FJJA 1YFJA 2O3UA 2XE8A 3HSYA 3DMTA 2WOJA 3E53A 4XSHA 4DG5A 1IOLA 1GRRA 2NX2A 3G8DA 1QV6A 4OGGA 4KGZA 2B7CA 5ALDA 4EAAA 3EPHA 2WFZA 4LNHA 4PLZA 2P8JA 1ZIDA 2AV6A 4BWFB 4Q93A 3LH5A 5CH5A 1H4VB 1YXMA 3LFTA 3IPXA 1FNCA 1JPNA 3BA6A 4JQSA 4JYBA 4LVNA 4UHCA 1DV2A 4QDOA 3UMBA 1N5IA 4ERXA 4URVR 3EYAA 1XCPA 3AGQA 3EZFA 2HN9A 1DOAA 3LW7A 4C88A 1VJ5A 2FP4A 1HYBA 4LI3X 3WGMA 5B2ZA 3FKJA 4BDTA 4NI5A 3RT7A 1SVIA 5ETJA 2YUIA 1DEKA 2CHUA 4XFDA 4DIBA 4RIFA 1RMYA 3EDQA 1RYDA 5IM4A 2PEYA 2VK2A 3LWDA 1BROA 1JHYA 1TI7A 3FLMA 4K6MA 4WCFA 1NF3A 4OYHA 2A9OA 4C3VA 4C6HA 1XK7A 5FWXB 3O0TA 2X5XA 1YTLA 2J4CA 3L07A 5IAEA 3LS2A 3K9FC 4O4LB 4BNKA 2IX9A 1TD9A 2GO7A 3UKOA 1CVLA 3OI7A 4NVRA 3IRUA 5G3YA 2QD1A 4P3YA 2VUTA 1ZFNA 3DE0X 5LBIA 1S3GA 1BKSB 2AG1A 4DCPA 3LBAA 2J6HA 2ZS9A 1UBHS 4XTRA 4EUFA 1P0QA 3IBGA 4ZYLA 1HPLA 1Q44A 3EFOA 3E81A 4IIEA 3FVRA 4UZSA 3JRNA 2ZAYA 3KLNA 4H7DA 5A3SA 5TV2A 3DEJA 2G77B 2Q5EA 3QVKA 2VHJA 1YQXA 2JBAB 3DE6X 4FHCA 4J0HA 2B1JA 4AROA 4DY6A 1CUEA 2VNAA 1UK6A 2JATA 4IG4A 1HL3A 4C2UA 2PFSA 5EE0A 4H7KA 2PBFA 4EQZA 1NBMA 1WQ4A 2QDKA 3DXYA 3KKQA 1V6AA 4X65B 3HDGA 4N40A 4IXWA 1Z18A 3WKEA 4QTTB 3RPEA 1JLLA 4DUYB 3FPEA 2H3EA 3I9OA 5CCBA 3HB4X 1XXHB 2BC9A 3DH0A 4J4TA 2VBCA 3CXUA 2WU0A 3RJMA 2BJVA 1SBTA 4ZTUB 2PUDA 4MQ4A 3IFSA 1EIWA 5TIIA 1WAMA 2QD4A 4MLZA 3MCTA 4G5XA 1ZIOA 3FXAA 4RH1A 3BXZA 4XW2A 3EVCA 3OIGA 4M9SA 4OQDA 5FADA 1YQWA 2OR3A 1EHIA 4BKQA 5JAQA 1O77A 3EIQA 4BU1A 2VHQA 1CF2O 5F1KA 2Y6VA 2JAPA 2F17A 4IXMA 1CLEA 1H5QA 2BFMA 3T5CA 4M1EA 5F51A 3GUCA 1GTSA 2FN9A 4F2PA 1VL8A 3IJEB 1GRCA 2E1PA 1IBRA 3X1DA 2AF4C 3SHWA 3WK4A 3U13A 4QTXA 3OSUA 5C1IA 3MUOA 3VA7A 2HSJA 3ETEA 1IZ9A 1KJ9A 3L49A 2J3KA 2J4DA 3G0BA 3B1VA 4P3KA 4B8ZA 4NU8X 4RJIA 4EH1A 1WXXA 3BQMB 4WBNB 3LWBA 1YR8A 3AV3A 4Q3KA 1M6YA 1M2JA 3HJUA 4JLDA 5H3CA 2FDCA 1WDTA 4CW7A 4HDKB 4WZBA 1VLVA 4IFIA 4YAKA 2FZ5A 3LHDA 3RRMA 1VLQA 3MK31 2PRZA 3QH4A 5A04A 5DN6D 4LHXA 5HFNA 1Z63A 4ENUA 2DPLA 2Y9PB 3PX3A 4RD4A 2QF7A 1RIFA 1L4FA 3G68A 4IIYA 3UMGA 1A27A 1U80A 1WV0A 4BO7A 5BN5B 3UJ7A 4W7HA 2HBRA 2I55A 2Z95A 3BE5A 3IOCA 3RIYA 5EJ8A 3U3JA 1B6SA 3RIXA 4HNGA 3HG7A 4IJMA 4IUCS 3R5SA 4YUXA 4E5NA 1I5OA 4WADA 5J63A 2JC3A 3DAYA 2ISCA 5COBA 1SKQA 5I9IA 3BCUA 4TTQA 2P6PA 1N6IA 2PKYX 2GX6A 2WJZB 1JFFB 16PKA 3FW1A 4KRYA 4PQEA 2QZJA 3C48A 1FQOA 2YOGA 3EEIA 3FPCA 4YQZA 4FYMA 5ALFA 2E3JA 4PSVA 2I0FA 2VF4X 1NP3A 4RKRA 4L3WA 3IDFA 4RTLA 4UNIA 4H08A 4BQSA 2ENUA 2NO6A 3F73A 3ZIAA 3I64A 5IVKA 1YB4A 2VJNA 5G4LA 1QOPB 3JD2A 4YT2A 2ZSFA 2DTDA 2VAPA 3FUTA 3ND7A 3ENZA 3O1JC 2DM6A 5F98A 1HFEL 1WLYA 4CR6A 1GG5A 5EJAA 4CTNA 2JZNA 1ECGA 1Y63A 3W5IA 2I7CA 2VF5X 2NU6A 2Z3WA 1OC2A 4G5GA 2Q7OE 1YQTA 1RRVA 3GXOA 3O74A 4FMBB 5H9VA 3F5MA 1IATA 2CLOB 3IQWA 4MV7A 3GFRA 4MW4A 1L1QA 4JSRA 3V4VB 1YKGA 4P4SA 1FXWF 1TE2A 3IVMA 3L8YA 4DWVA 3KT6A 4EW3A 1TCUA 1P8JA 3FJYA 4S05A 4J0IA 2J07A 4Z1MA 2JGIA 1MB9A 2V6MA 3PJFA 2YDYA 3CLTC 1TYZA 5REQA 4QZVA 5C34B 1DL5A 1X7YB 2E82A 2A1TR 2J5BA 2NZ8A 4BQFA 1V8BA 2GJ9A 4MUAA 1R0LA 3FFXA 2PK3A 2WYOA 1H0KA 4L3VA 3I23A 3CCBA 3DM5A 2QLBA 1JE0A 5EQJB 3EIHA 4L50A 3C3EA 4QPZA 1ZRSA 3TGPA 1PZMA 1O58A 1AMUA 2XNHA 3VHXA 1O9HA 3LRTA 3X1KA 2PPVA 4JLWA 4LWZA 2DC1A 1IIBA 4RVOA 1YNOA 5I9NA 2R7LA 1YBFA 3K1ZA 3MQFA 3CN7A 5KOJA 3EBPA 4OHZA 3T7EA 3JYOA 4V39A 3E3OA 5GONF 3WOVA 1YZFA 5H7XA 4BJHB 3KXKA 3GDGA 1C0EA 3YASA 4B82A 4RK7A 1UPUA 3M6IA 4HQ0A 3H9JA 3LPDA 1RYEA 4JI3B 4JL6A 5B7GA 2PLFA 5AVUA 1ZKMA 4QOSA 4ZTZB 1PNOA 2D2XA 4C07A 3LC0A 5TR9A 4ZFNA 3JXEA 3ZTWA 2P9HA 1FFAA 3IIMA 1IMJA 4WE3A 1FSFA 5I9TA 5T4EA 1QKKA 2F90A 4FGKA 1TK9A 2NIPA 1H0SA 3L1VA 4MVJD 4C4RA 3LC2O 3QX8A 3TBHA 5BYJA 3TIFA 4BL5A 5BPHA 1DGQA 2I9KA 5GZ1A 2IZ7A 5KCMA 3L8DA 3N75A 4MI9A 4TM7A 5DCUA 2H2IA 1L4MA 4KSCA 2W22A 1X80B 2BHNA 1HURA 4JASB 5FA8A 1S7GA 3ETJA 1LB1B 5D2CA 3VDQA 5C8ZA 4BKMA 3FB1A 4JP3A 1VZ3A 4G84A 1GGVA 5FBQB 2BJWA 1VKRA 3CLUD 4IIGA 4L95C 2YJ3A 4LDZA 4FYVA 3U4GA 4NXNB 4K3VA 3IIIA 2R8YA 1H85A 4PGHA 1G41A 4WOJA 1QMPA 3PC6A 1TXGA 1Q3TA 3V46A 5JNUA 1X2EA 2GFQA 4YO8A 1X92A 4C22A 3V8PA 4F4CA 4NE2A 2VQSA 2TECE 2C8LA 1EGHA 1L5ZA 2VYFA 4URHA 3DE1X 2O2GA 4O63O 3UANA 3NG1A 3ZY6A 4ZT5A 3INTA 3RABA 4K6OA 3B1ZA 4G6ZA 1Y48E 1PTJC 4R68A 5KVQA 1NFFA 1E1KA 3F0TA 3N59A 1RAIA 4G9EA 4NFHA 4ED9A 5A2QA 3AFHA 2I4TA 3A6LA 1M2KA 3DZJA 4D3FA 4DCTA 3ESDA 3KZMA 4URUR 4MKFA 2ADMA 2JAUA 3DL4A 2AX3A 2G8LA 4ZCLA 1U04A 3C8HA 4BX9A 2QY6A 2JH8A 2ZUFA 2I2BA 3H1FA 2Q6VA 1GTRA 4KC0A 2UZ0A 3K9WA 4YAFA 5KYUA 1LK5A 5J43A 1U28A 1UJBA 2WHQA 1OYVA 2BFFA 3A6HA 3NEJA 4KQJA 1L7OA 3K0CA 1EKXA 4DUZB 3EZXA 1GD1O 2WJGA 1S2NA 1UJ6A 3CXRA 3OWXA 2DHEA 4B3HA 3FYHA 4YCSA 2VXBA 1GRQA 2C2KA 2Q21A 2W8BB 5AI6A 3A27A 3UY4A 3VZCA 5LNK1 1UZMA 4BDSA 1SUCA 3RVBA 4KLAA 3BL6A 3PE4A 2C9MA 3CBGA 4YK7A 2A57A 4LVCA 2FRXA 3K3PA 5FWNA 4I2NA 2WUVA 1YIAA 3BWBA 4HB3A 1YZLA 2CVOA 3ODGA 1XRLA 4HXFB 1RWVA 1UXHA 4LSWA 4BGUA 2PZKA 3IRVA 5JDIC 4CEHA 2C9OA 3D0OA 3QRWA 1MRNA 1YZHA 4TTJA 4MRAA 2WZBA 5T57A 3TLMA 4CQMD 2N46A 2C98A 4RTNA 1O94A 2KPOA 3BXEA 1CFZA 2G17A 1UKEA 1NM5A 2YWDA 1Q3HA 3GLHB 5LC1A 4QYIB 4M1OA 3IDAA 3UUFA 1A8UA 2VDVE 3QEMA 1IFXA 1TZJA 3LNCA 1CEEA 3SZ3A 3PGKA 3FZYA 2I6FA 3ORYA 2GESA 1MN6A 2QLMA 5IS2A 2D4HA 3M8KA 3H9BA 1RC1A 2IUTA 2DECA 1A0OA 1I3KA 4FX2A 4V0LA 2IWRA 3M6LA 4QPJC 3E9MA 3KSAC 4ETWA 4XX0A 2A5GA 2FSVC 4LVOA 2IK8A 1G60A 1CJMA 1RJEA 4M54A 3UK7A 3D7MA 4MLPA 3MB8A 1RSZA 2GK6A 1ZMTA 2REQB 4F2HA 3CISA 3VMMA 3JTMA 5EMMA 3UMCA 2ZT7A 4BQEA 2YXEA 4TTPA 4QU0A 1GQFA 5IDWA 1UBGA 3NHUA 2BGNA 4IQ8A 4L08A 3ZWKA 4DTCA 3W90A 4TLAA 2NTVA 1MQ8B 1ZAKA 1BHQ1 4QC2A 1JKJA 1E9VA 3PFCA 4PC6A 3TTSA 1ESMA 5BN4A 3G7UA 4M0LA 1T2VA 3GZTB 1ZD4A 4KXVA 1I3OA 4UEWA 2FAXA 4NYMQ 1P6UA 3FCCA 3B52X 4F8YA 3OOHA 4IIDA 1WDWB 1NI4B 3A25A 4ILKA 4X61A 3IBTA 3Q11A 1YDEA 2TRSB 3E9CA 1QCDA 5LN1A 5I8PA 5HF9A 3O73A 4R8LA 5LWHA 1BQ3A 1VOTA 3D6TB 3DAPA 4FYYA 1COZA 1NSYA 2I6TA 4LPSA 4MVYA 4X95A 1W35A 5T3UA 4JLPA 2ZXUA 3H42B 3AJ8A 3GQBB 3BMQB 4KN8A 3V9PA 1I1NA 2BYTA 2FZLA 1NQVA 1AHNA 5D86A 1QGUA 2PIAA 3IYLW 2X8JA 4IEIA 4X7PA 3O3OB 4L72A 3ZXIA 2WTEA 3D4IA 4NNPA 4PX3A 2YVQA 5DE3A 1RYYA 4A5SA 1QIGA 5GJCA 1V11B 1KMIY 4C1NA 5EMNA 3SF0A 4CGYA 4BMZA 1IK6A 2W42A 4RVCA 3TLZA 4B84A 3H2BA 3TUJC 5F1PA 1L4HA 1ZW1A 3R6TA 3RGWS 2XUFA 2PL3A 4MJ7A 3ZE7A 1RTKA 3AR9A 4YLEA 3E27A 3HWRA 4FKBA 2CCJA 4R2IA 3DW3X 1SRQA 4YAIA 1CY2A 3HCBA 4O8CA 3QBTA 4Y9DA 2WYHA 3JS5A 3GJ6A 3JYNA 3QU5A 4PFSA 4AP6A 2BGLA 5L4SA 5LZ4A 4DMKA 4ZOAA 4AULA 1C7JA 3DJYA 3KEFA 2GZ1A 3PUIA 1V6SA 1DJOA 4FJ1A 4ZALA 1ZCZA 3C1OA 2V8OA 3PPXA 4EUNA 3PX7A 2EV9A 5CDUA 4G26A 4XYEA 1G9XA 1ZK0A 3RS9A 1H94A 1QG4A 2CDNA 2F8LA 2I99A 3EZGA 4GOOD 3JY6A 4J1TC 2CEKA 5E95A 3IUYA 2AXPA 2WF8A 2X0NA 5ESRA 1GAQA 1D1QA 3GJ3A 2QP3A 4KMSA 1NUQA 4INZA 4OM7A 4PBRA 4BFXA 4GE0A 1IXYA 4TYWA 5AQ1A 3GYGA 4J0JA 1I2MA 3IXLA 1NXPA 5FOUA 2Y0CA 1BS1A 3DT9A 5LD2C 2BEVA 1IJFA 4CEJA 5KHOC 3L8MA 1XTTA 3T9CA 4CKBB 1N2HA 2VYVA 4EKYA 2O8FB 2ADFA 1PJRA 2EBWA 4R0NA 1QIHA 5CVVA 3GFFA 3B36A 1VHTA 2BGUA 3DYVA 2WA1A 4HLDA 4J7UA 4NMWA 1BS9A 1RXUA 4JHLA 3VSCA 3RREA 2D3TA 2YYYA 3R0VA 3S55A 1CQPA 5MN5A 3FTFA 1SY7A 3FWNA 3QVUA 2JGLA 4JGBA 4P4GA 4LYYA 3DOIA 4A6EA 1WD7A 5DV9A 3ZXXA 3QXCA 4KE7A 4PN3A 4PC7A 3ROMA 3VO2A 3BK7A 3H9EO 1GYQA 1P7CA 1V26A 2LIVA 1D0SA 3F1LA 1E2FA 2G63A 4QJBA 4XVHA 1MEOA 2CLDX 1E9BA 1OZGA 4ZOLA 3VV2A 2PUCA 3QU2A 4D6PA 2TMYA 2XKKA 1LV7A 1UM8A 3IV7A 2ZSBA 1L4NA 4C30A 3HYTA 4G1MB 4IJVA 4DAEA 5G0SA 4CLOA 1FX0B 3H5AA 3FRJA 4L8VA 1EFVA 1NC3A 4RVUA 1EYZA 2ODQA 3AM4A 1NVKA 3GO4A 4HY3A 1IM2A 4UOZA 1NQXA 2FU5C 2GTHA 4BZXA 2NSJA 4MVWA 4FSDA 4CIDA 4BS9A 3CZ5A 3KC2A 1E1CB 1L8LA 4P7GA 2W5UA 4E51A 1WMSA 1P2FA 1PT7A 3G0DA 1OFIA 5JE8A 4EGAA 1EGMB 2NW6A 3NEYA 1CHDA 4B32A 4A0GA 3FM9A 3JASB 2WJ4A 3VTFA 4YUYA 5F76A 3VR6A 5ESXA 1RC0A 2IYSA 4M37A 4CKXA 4CQMA 1FRFS 5J5CA 4EB3A 4X6YA 1N5LA 1SB8A 3HP1A 4WLEA 4NCIA 4BVEA 1Z0JA 3P9QA 3SYNA 3PXUA 1VHQA 4OXQA 3V8BA 2H11A 1RCTE 3C5WP 4IDBA 5ALJA 3K9BA 3NAMA 4JUAA 4OLJA 5GJVC 2D1RA 3HXMA 2OYRA 3H2YA 2GAAA 4GMHA 4MWDA 1CUDA 2D62A 5EWLA 4H4EA 4A6DA 4RPHA 2ZRDA 1PNTA 1G17A 4CMKA 2UV8A 5EP3A 1VJ0A 3NHJA 2AZ4A 1D9XA 1TU3A 1UP7A 2W2XA 5DK4A 1G8KA 3AT1A 3M9XA 5K0SA 3QBJA 4Z9BA 2B34A 4BRSA 1XXHA 3OX1A 4JJIA 1XKXA 4U7WA 1WZ2A 2WPDA 2JFUA 5AM2A 4EWLA 2M9MA 1U6KA 3L1JA 4OOFA 3SFVA 3V3TA 3VHRA 1RRCA 1S4MA 4O4HF 4AJLA 2R6CA 1K8ZB 3HMKA 3WLNA 4KREA 2FW6A 1KZ4A 1JBKA 4RHFA 2JFYA 2DFVA 3HJCA 1H23A 1E1RA 3ONEA 4B7CA 3WGQA 1A9ZA 4B74A 5MHTA 2CUKA 1ZW6A 4PFKA 3AR8A 4JT8A 5K51A 2EP5A 2ILTA 5SY6A 4M1WA 1AHPA 4S24A 3VKHA 2ZCUA 4XFKA 1TPYA 5BPFA 3I8SA 4ZVLA 3F5DA 2GM5A 4TN5A 3DKPA 4RIHA 4OHVA 1QYDA 1DQPA 5B3KA 4Z4HA 1MDFA 4TV8A 1DBPA 4JJFA 4BU0A 4J6EA 1QNLA 1R6AA 4JBGA 2P67A 2YNMA 3IO5A 2L69A 4KXMA 4DV2B 2R6FA 5K99A 1IM5A 1HDOA 4QXQA 5EZYF 1E3MA 3DB1A 1MR3F 5KHLB 1T91A 1Z0AA 5KB3A 3IT3A 3WRXC 2O1SA 2Q9UA 3ZTTA 4PN7A 1NGSA 3PI6A 3FOFC 3MMZA 2O48X 3DNFA 2GFIA 1RBMA 2ODAA 4LWQA 3FYTA 1FSZA 1XU9A 3DWFA 1X8LA 2V7PA 2VJMB 2W2KB 3KVNA 3PICA 5IDQA 1U0EA 5G1OA 1AQNA 1OXUA 1XU4A 1N1DA 3RTDA 4U2DA 5DP2A 5SZJA 1IIRA 2BD0A 3CWCA 1TYEB 1NN5A 3GVHA 1W1IA 5H81A 1CYEA 1OFUA 2MWMA 4BMVA 1B2LA 4AO6A 4L0QA 4F9FA 4ZYXA 2ZAOA 2GNPA 3KOXA 4CT5A 4KHZA 2V55B 2WHEA 5KZMB 2WICA 4C7JA 3JQ8A 4ZIRB 3H2HA 4RADA 2JFPA 3T3PB 3UYLA 3O8LA 1KH3A 1J2TA 2NU8B 5DGCA 2UYOA 4LFCB 3D0QA 1P39A 3ENKA 3PKZA 4NONA 1AKWA 1J0AA 1QV9A 5ES3A 4GLFA 1GJRA 3CB2A 3ER9A 3EH2A 1ZLYA 3FGZA 5DNEA 3C3JA 4MKRA 1JDPA 1P2DA 3JQQA 3A2LA 5A71A 3V4RA 2D2VA 1O5OA 4JELA 1V16B 5BQ3A 5FLKA 2IZ1A 2VT7A 3AP1A 4HNQA 1F60A 2ZG6A 1Q17A 3CMCO 5B37A 3S3TA 1Y3DE 5CX4A 3GMSA 4J43A 3U9LA 5B1DA 5FI1B 1HTWA 3M7IA 4FC6A 1SU4A 3RKUA 4DW8A 3PQ3A 3N76A 4BNHA 2W70A 4KDRA 2V7BA 4ZVVA 5C46F 1KAGA 4I99A 2AH5A 4MA0A 1JFFA 1SEVA 5E6UB 2JCBA 3QY0A 3IJPA 2Q41A 4YRZA 2YY6A 4PTLA 4XEHA 3NC1C 2XTNA 3QNWA 1F6DA 2IOFA 2I4RA 1TA4A 5HCIA 1CQXA 1FBTA 1DQSA 3BL8A 5DP1A 3CH4B 4X92A 1ZGGA 2HPHA 2E87A 1ZDMA 2CXQA 3UC9A 3WWCA 3Q3HA 5A5VA 2J48A 1W52X 3DMDA 2I1VB 2B37A 3Q8WA 5B30A 5AW8A 1NATA 1HYEA 1FX0A 1ZNXA 1K4YA 2VZ9A 2OO3A 4E5VA 4ABTA 4RKWA 2Y67A 4KW7A 1Z8FA 4KPUB 2FEAA 2PT7A 4Q9JA 2ZT6A 3SBXA 1N8KA 4FGLA 4PYKA 2WSSD 2YN4A 3W06A 2FDXA 1NLFA 3RRJA 2A7QA 1ECLA 2JGMA 4X6XA 2HMSA 4JKYA 2I2CA 4AP5A 1JWAB 2QNIA 3G9ZA 2C88A 2FF5A 4QECA 1AF4A 2X4LA 2C3UA 3GMDA 2QHXA 1QRRA 4D26A 5HUHA 3V7UA 3ZKWB 4LXTA 4EHDA 2PX8A 4C87A 1O5TA 2JVIA 1KRWA 2OUKA 3INYA 1OI2A 4FMDF 4PICA 5B3JC 2R5FA 2RHJA 2ZI9A 2VUIB 5HZMA 4RZXA 1GDHA 3NONA 3EVFA 4PG6A 5IM4F 2Y4NA 1DIGA 5CCEA 2JANA 3RYHB 1GG9A 4V1CB 4AN1A 4DQUA 1VMAA 5JZBA 4XYBA 4L5IA 3HN7A 1GZHB 3M3PA 3O8OB 3T5GA 1J39A 5E3HA 1JQ3A 3AF0A 3GBVA 2V0CA 1FP4B 1GPBA 1GNVA 3I42A 5BWOA 1DAHA 2W6NA 5LMCA 2PFKA 4PFJA 1E63A 1S8FA 1ODCA 1B15A 2Q7DA 1UJ4A 3K20A 3Q1KA 4EGQA 4R8RA 4JI5B 1JIIA 4OO3A 1NVVR 1U1FA 2CVQA 1HKHA 1K6MA 3A7DA 3QYPA 3CVUA 4I4CA 4NG5A 2FY8A 5EHQA 2KX7A 4AW9A 1J06A 7REQB 5CNMA 4V0KA 3SBDA 4BZZA 3GAFA 4QFDA 2ZAIA 3FI9A 1GDTA 4CKWB 2W6MA 3DT8A 2PMBA 3HWX1 3JARB 3UT5A 2A1UB 4PLFA 2NSYA 2XWBF 2ZDHA 3QK7A 4QO8A 2C4VA 1AK1A 1CIJA 1MF7A 2OHFA 2FEWB 3DV9A 3OQ1A 3PFFA 5ALYA 1N7HA 4UM7A 4ID3A 3T6KA 1S96A 5TPWA 3S8EA 3C85A 4EHBA 4BQNA 2NPOA 5LBTA 4KUEA 1Q0PA 3K2BA 5SZKB 3PGLA 4PCUA 1TGYA 3VKFA 4L02A 2DX7A 3I6YA 3OOYA 3OZFA 5M2QA 1XNRB 1GIAA 2YXNA 1U3VA 3GLHA 2POQX 4HPXB 1X13A 1GG8A 4JU8A 2NQ8A 4PU0A 3NGLA 3IVGA 2BEVB 1XRQA 5F35A 2ZIGA 3QVJA 4JYCA 4C5AA 4CLEA 3TNJA 1PYGA 4H6XA 4IHAA 1DQNA 1IWPB 2YIDA 4LX0A 1C7QA 3PITA 4UVIA 5D01A 1QH0A 3H5IA 3QLEA 5AJHA 5AXAA 2OMEA 4Q19A 2H54A 3AERB 1FFEA 3WFIA 3P27A 4BJ1A 4I9GA 1F0YA 1FS5A 4MQMA 3SIPA 1NFQA 1RZ3A 4EW6A 4BMYA 3PQCA 2J3DA 3G2LA 2NUTA 4EL0A 2CMDA 3CH7A 3EPPA 1FFSA 2EFGA 2IHKA 3M5PA 5ALHA 4OOEA 4W9MC 2AW3A 3IMKA 4Q03A 3TK1A 1JR4A 4KVFA 4BLQA 3W3AA 3LTNC 4Y2QA 3JAWA 2G5TA 3NW9A 3NBUA 1E3IA 4KFRA 3PJRA 4HNAB 1A3CA 4D81A 2XA2A 3JWHA 5I7VA 1JL3A 1KNXA 4LTNA 1X77A 1TIPA 4GR9A 2VJPA 4ZKEA 4WN3A 4HXGA 1KDOA 1UZNA 2RH9B 3QMVA 4KR0A 4P82A 1L5HA 4ARZB 2BDTA 2ZUEA 3VDXA 2UYHA 4NFYA 3S0JA 5EWMA 2JCVA 5J5AA 3DXFA 2RGYA 3F3SA 3OZ7A 4CTJA 4J94A 4DSZA 5MFPA 5BSFA 1U2TA 2GAIA 4W63A 2A5DA 2WNSA 2FEOA 1Y6RA 1I3CA 4NS4A 3TSYA 3ILXA 1WO8A 4OU4A 3H2GA 4WNAB 4JV5B 3BCHA 3DTYA 1KK1A 1E7SA 2XAUA 2C31A 3WLIA 3HN2A 4IDFA 4XPZA 4C5CA 3IXMA 4HWSA 1DEXA 2A94A 4P7KA 1M1ZA 1XLTC 1CB0A 3KZXA 3OZRA 1E9SA 5K0TA 1LJLA 1MKYA 1Y5IA 4C4SA 3HKDA 4IIVA 3KOZA 4G4JA 3Q40A 2JRCA 2M32A 2QDXA 3RUPA 1UXKA 2A1TS 2QRPA 1XXLA 3C3CA 3QTLA 4YI5A 3RVPA 3RAFC 1FRQA 3MT0A 2JZOA 4KXYA 5TLSA 1EP3B 1S9HA 4DQKA 1EK5A 1BXRB 4NCKA 2EKDA 3LNTA 4LNUA 3QFSA 2C07A 3H87A 2P4EA 4GNKA 4DADA 3BC1A 2HQ1A 3GHHA 1EP9A 3K8OE 4R83A 2RGGA 4RXUA 2C54A 2R4TA 2I7XA 4R8KA 4B45A 2YMQA 2WF5A 2H48A 4TXMA 1EHCA 1CB7A 4IGFA 2DR2A 5KHAA 2GKGA 2I54A 2GHQA 2I4NA 4GM4A 4KHPB 2W6PA 4N47A 2IS2A 4C08A 3MWDB 4HNSA 4XEUA 2V74B 2R8OA 3KAJA 4KK3A 1W5FA 2QYTA 3ZYZA 1G55A 5TF0A 2XNJA 4DDMA 1AKUA 1HLDA 3GFGA 3KXIA 3FBTA 3IBSA 4J1NA 1EDOA 1FX1A 2FFAA 3MWYW 1QPGA 4CM8B 3K2IA 4GBMA 1TECE 1QGED 3MTAA 3P26A 2JFZA 1DHTA 4HKTA 3ZGYA 2K5UA 3OPYI 3R7WB 1VSTA 2AUTA 4A1OA 2VJQA 3W6OA 2FMHA 2BHRA 1XPRA 5AW0A 5KYTA 3ZE2B 1XZAA 2ZTVA 4GU5A 3WAGA 4Z51A 1ZI6A 2WHYA 3AUKA 4MPDA 2LGJA 4PAGA 2QN9A 3WJ1A 3HYCA 4FKZA 3T7IA 2JGNA 3UIEA 4F56A 3RYFA 4E70A 2CLFB 2X3FA 5F2KA 1QDUA 2KS6A 4FE7A 4RK6A 1DQYA 3BMNA 4Y67A 1PLLA 3I0NA 3BYZA 2C3MA 1SWWA 2JEZA 4PWYA 2VUUA 3KPUA 3TI9A 3ZY5A 2R6R1 8OHMA 5HZKA 4EMTA 3C15C 3AUSA 1X19A 4MGIR 2FR8A 2I66A 1PT6A 2PJUA 2J9FA 4P1ZA 5CH3A 2WZQA 2ZJ8A 3PD0A 5AXDA 1G9TA 2C00A 5JBIA 3AMVA 3UCFA 2J3JA 3GFVA 4L16A 4TV9A 1ACJA 1BXKA 4I1YA 3HXKA 2M6KA 1W2HA 2R8PA 1RM3A 1Z12A 3HKEA 2JAQA 4GKBA 4LRXA 5BV2P 4LF5B 5JIBA 5D3KA 3L7CA 4OUDA 4C14A 3PJGA 3O26A 2HMWA 4P0QB 4HAUA 2R8EA 3FNFA 2F3TA 1E9CA 4R9VA 2LCQA 1TUBA 2I6SA 3EXG2 3AC0A 4POAA 3CUYA 1BCSA 2W43A 3LTEA 5CDFA 1ADYA 1G6KA 2BKUA 2G7ZA 3A4MA 4HQOA 3QXGA 3T0FA 1FDVA 4WXEA 4CV3A 1IXZA 1PGQA 5L7WA 5LOVB 1HQCA 3V2HA 2Q5LA 5CXSA 3BIWA 2Q8QA 1XK6A 3JQGA 3IA7A 4UVHA 1G5IA 2X3YA 4AB1A 4KIWA 1DO0A 3JQGB 3WLOA 5K6AA 1K6JA 3IBYA 5E2IA 3R20A 1RLTA 4A5OA 2IF2A 3MD9A 1M1YB 3F98A 2Q49A 2WTNA 2GARA 4DYDA 5EYPA 1Y1PA 2H06A 1W88A 2A14A 1DIHA 4H7PA 3G0IA 4LXXA 1MA3A 3UJHA 1MRSA 1R6TA 5I5GA 1E0AA 3C7KA 1R0BA 3R9IA 3ZZMA 5FHQA 4EEKA 2HF2A 1D8AA 4JP5A 2YY5A 1A82A 5LYYA 4BAGA 1XTZA 4M0PA 2GS9A 2XOKA 3H5TA 2OKCA 2JNWA 1U0FA 4QYWA 1E3LA 1KNQA 2H0AA 3LBNA 4E5DA 3TW0A 3Q85A 4BLSA 2GKOA 5KVCA 4MPPA 5TT1A 3F2VA 3QVSA 4C29A 4YFVA 5SY9A 4EIWA 3WO1A 1RKVA 3TZHA 3NDPA 2AC2A 4US1R 2WIAA 3AINA 4IO0A 2AN3A 1UMBA 2A0WA 1K5PA 2EP8A 5DXAA 5A0FA 3D3WA 2IUYA 4C6TB 1MU0A 4XASA 1ZCBA 3P1JA 2HD4A 1YVDA 2IP2A