2HK9A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and nadp+ at 2.2 angstrom resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate dehydrogenase
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk9A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk9A01
2GN8A 4DRYA 1Z73A 3U3XA 1P33A 1K3TA 1C1XB 3AM4A 1DAPA 2BI8A 4D3SA 2W90A 3WGTA 4BKRA 5CDGA 1GEGA 2GYYA 3OFSA 4NFSA 3BTVA 4BNIA 1IYZA 4BNGA 3CZRA 3R1IA 3W1VA 1PJTA 1NNUA 1QKIA 4NBTA 5HWSA 1KOLA 4GKBA 2CDBA 1QG6A 4IDBA 1QYVA 2JFGA 2Y1DA 3KZVA 5JMPA 1HLPA 1E92A 3O03A 2EKLA 1I01A 5DBFA 1Y5MA 2WD8A 4FJ2A 1YB1A 4ZHSA 5JMWA 2D1YA 4BNLA 5U4QA 4AICA 4OXKA 3RUFA 1GCUA 1SAYA 5CDUA 4GL4A 5TF4A 4OM8A 1F12A 2HCTA 5ILOA 1GY8A 1P44A 4EI2A 5JCJA 3WMXA 3AUSA 5JYEA 3AJRA 1LUAA 3M6IA 2UYYA 4A27A 1CEQA 5I8WA 3OA2A 3MJVA 4IS2A 2YQ5A 2YHUA 1CDOA 4KTTE 1WMAA 3ORFA 1KETA 1BSVA 1OFGA 2ZTMA 3GFBA 3JCZA 4CPDA 4E5NA 4IQ0A 1D1TA 2Y0CA 4NU5A 1PJCA 5A9SB 4K6CA 1D4FA 4W99A 2DT5A 1JKFA 5TX7A 4OQZA 1HYEA 3P2YA 4GI2A 1EFLA 1YE3A 1GUYA 5CPBA 3MCVA 5DBIA 3ZV5A 3GA0A 4OGWA 5FEUA 1Z7EA 2VYVA 3GH3A 3ZV4A 2FRDA 4NR0A 5JCXA 5BSGA 3DAPA 3E82A 4BO6A 1U8FO 3OQ6A 2W2LA 3KOUA 1FDVA 4DPMA 1RM5A 3NDIA 2Y99A 3Q6IA 3WFJA 3PI7A 1LLUA 1Y6JA 2C7GA 2C5AA 2OHXA 5CDYA 5JDIC 1A9YA 1I24A 1U3WA 4R51A 5G0SA 1PJ2A 1E7MA 1EQUA 5ILGA 3W4IA 2TMDA 2XXJA 3CIFA 2X5OA 1LSUA 3GQVA 2EW8A 4IXTA 1DFIA 3F5SA 1DSSG 2VWQA 5AYVA 1E7QA 4CM8A 5DOVA 3M1LA 3WGOA 2GN9A 4AJ4A 5C5IA 3QA9A 1BHSA 4XYGA 2X6TA 1YVEI 4MVJP 3D3EA 2X0RA 4AFNA 1T25A 4DL9A 1GFSA 2UV8A 5JXWA 5KJ6A 2ZTVA 2Q49A 3GVHA 4W82A 2VHYA 4TVOA 2UUPA 5TJHA 5LCXA 2BGKA 2Q1UA 4E33A 1DRWA 4TQGA 4R9SA 3KV3O 1NASA 3O4RA 1SZJG 1WDLA 3SLGA 1OBFO 2CMDA 3R3SA 4H3VA 3JQBA 1EVJA 2EXXA 1PJ3A 4FFNA 3RVDA 4O59O 4YJDA 3KLMX 3GPIA 1DHTA 4TZKA 5H82A 4BQRA 3WJAA 4FDAA 1HKUA 2VUUA 4CM6A 1B0AA 4NDNE 3GDFA 2XPCA 5IN4A 4MVJG 4RF3A 2V6FA 2OL4A 4L73A 1R37A 3CPSA 2CD9A 1RM4A 3AY3A 5ENVA 3UICA 1HDYA 3N58A 1YS4A 2VZ8A 4A7PA 4FGSA 1PL7A 3L6OO 2B83A 1VPDA 2EEZA 4K26A 4GGOA 2VNSA 1FXSA 1PJBA 1O8CA 3JQGA 4PG4A 1KY4A 4GX0A 4BO8A 2HRZA 1DRVA 3GEMA 3LZ6A 4PLWA 4OSPA 5A06A 1TA4A 5IXSA 4W9NA 3L4BA 4HFMA 2OZPA 1R15A 1W8DA 3ZU2A 4FFPA 1HEUA 5CAEA 3PFFA 4PG5A 3E5RA 4H16A 1DEHA 4MP6A 3DOCA 1VSVA 4QQRA 2D8AA 3DHEA 1HYGA 1HWYA 1NHGA 1PGJA 1U3TA 4PVDA 5AXBA 4BVAA 3KYCB 3PJFA 1W6UA 2VTDA 2X22A 4DMMA 2C20A 3KBOA 3ETGA 3C24A 3LLVA 1KS9A 1Z6ZA 3V2HA 3U4IA 4YJHA 5BQFA 1GDHA 2VWGA 1B8PA 1K89A 4J6FA 4YDRA 3KXDA 3VTZA 2OUIA 1ZCJA 3NJ4A 1UUFA 3DQPA 3ZI0A 1Y8RA 4EGFA 4YAEA 3C7DB 4EW6A 3JQ9A 3OP4A 4CQMA 4ZQBA 3H2SA 3WNQA 4AJKA 1IZ0A 5JE8A 4R5HA 4BO0A 3HUDA 1SOVA 3T7CA 1GADO 1UXIA 1YOVA 5G4KA 4K1LA 2I9PA 3D0OA 2ET6A 4UAGA 1MGOA 4WUVA 2JJYA 1KVQA 3UUWA 4BO3A 2VT3A 4KOAA 1DOHA 1DC4A 3C85A 3AFNA 1HTBA 1LDYA 2IEDA 4QO8A 1AE1A 1WMBA 3M2TA 3PTZA 2B4TO 5THKA 2CSUA 3UVEA 5KJCA 5DZSA 1GU7A 1H2HA 3V8BA 5KCZA 2WD7A 4KMSA 4CMIB 2J3HA 2O3UA 1IHXA 2RBEA 3DMTC 3E5MA 1T2EA 3FNHA 2EG9A 4CM4B 4LVCA 2PGJA 4XR9A 2GN4A 1R0LA 5HBRA 4A2CA 1GV0A 1M2WA 4GVLA 2O7QA 3E9NA 2Q3EA 1B3RA 2HK7A 1I5RA 4PLYA 3U5TA 5THQA 4MVJF 3A1NA 1VC2A 2B4RO 5IF3A 4Q3EA 4IZIA 4XB2A 4FGWA 1OOEA 3CTMA 3UHAA 4DLAA 4WEOA 1E7YA 5A03A 5HS4A 3VZPA 4N5NA 5CDSA 2IXAA 2QRKA 3QHAA 3DOJA 3I9NA 4DXHA 5L4LA 2B35A 1UXGA 3GN1A 2PNFA 3D3WB 4O6VA 5AVOA 3BMOA 3JQ7B 1FDTA 4UUOA 3F4BA 2DM6A 4BNYA 3ST7A 3LT4A 1EQ2A 1GPJA 4DWVA 1B16A 2PKQP 1Z74A 1KC1A 4Q3CA 1UAGA 2Q1WA 4BNWA 4ALJA 1TI7A 3JQAD 5IG2A 2NQTA 5JS6A 4NQZA 4QSMA 2YHIA 1DAOA 3Q1LA 4CMHA 4AJJA 5I9NA 4BV9A 2I5PO 4N18A 1DC3A 4WCFB 5IAAA 4AJ2A 5CEFA 1QORA 3KLPX 3LVFO 1IPFA 1T2DA 4IDCA 4BHTA 2VWHA 4JQCA 3WIDA 1YJ8A 4IBOA 2FZWA 2J5KA 5JC8A 4B7CA 1B3BA 1V0JA 1YBVA 1PZFA 5KKAA 3D1LA 4QECA 1MLDA 1NHWA 4TRNA 3ZWYA 2GDZA 2CDAA 2ZYGA 1U7TA 1C0KA 4UEJA 4UUMA 3FPCA 5IZCC 1YQXA 2B4QA 1CF2O 3IUSA 4R01A 1VLLA 2Q99A 1VRWA 5BSFA 3H4VA 4BNKA 3TPCA 3ZHBA 5K0ZA 5AXDA 1XU7A 2BFMA 1DIAA 1CETA 1IPEA 2YQ4A 2O50A 2OO5A 3LLSA 2G1UA 5A04A 5DOZA 2JKVA 2X7HA 3IP1A 3EK2A 1JU9A 1B2LA 5U9CA 1YB4A 1E0DA 1UZMA 2Y1OA 5FFFA 3VZSA 4BNMA 4DGSA 1YKFA 3GDGA 4OQYA 4R41A 4TKMA 4F6CA 3MWDB 1MB4A 2IZ1A 4J7UA 2GZ2A 2X1HA 3G79A 1RM0A 4DIBA 2RIRA 2O4CA 2EW2A 2FR8A 4GMFA 3UXYA 4MKZA 3V1TC 5KJ1A 1C14A 3STHA 3PZRA 1JAXA 4LSMA 1H9BA 5G2OA 1QRRA 1IHYA 5A4DA 2HO5A 4JBGA 4A03A 1PJLA 1SB8A 4FJ0A 1BTOA 1ZK4A 1OZAA 4WLVA 7MDHA 1DB3A 5KWEA 4BB5A 1FDSA 5K6AC 5JNLA 2D2IA 4CMGA 4NFYA 2VYVD 4XGIA 3FHLA 4LMPA 1PSDA 3AU8A 2WSBA 5DBGA 1EBUA 1GUZA 2W2LD 4D42A 5EQDA 3RUCA 3G49A 3FBGA 3WWZA 4DQUA 2VN8A 2QYSA 1K5HA 1NVGA 1P1KA 2AW5A 2WM3A 3D5TA 3GRKA 5ES3A 1QP8A 3BMNB 3HB5X 3AM3A 4BUCA 4TZTA 1XIVA 3U9LA 1UZLA 1O94A 2J3KA 3HDHA 1I2BA 3FTNA 4XZ3A 4CV0A 4DIOA 4JXKA 3CXRA 3DZGA 4RQUA 1U2DA 4E2YA 1KC3A 3BMQB 4XDYA 1YDEA 1JWAB 1NAIA 5AOVA 1VJ1A 3CMMA 1NVTA 2GUGA 4PZEA 4RDHA 2DBZA 2VCYA 3PHLA 4L4RA 4I9NA 2Z1NA 3O8QA 1UP7A 3I23A 4E6PA 3GVXA 2BLLA 4WECA 3DBRB 2PD3A 4D45A 3U62A 4GMGA 4ONEA 1HL3A 3LU1A 4H15A 4DC1A 2ZQZA 3IP3A 4N54A 1QMGA 2ZK7A 4ALMA 3DR3A 4NU6A 1C0LA 4IJWA 4IIVA 1ISHA 1N92A 1XSEA 5TC4A 3LT2A 5B37A 1J5PA 4G65A 1PZGA 5KTKA 2YUTA 1HDRA 3GG9A 4QFDA 3JQFA 4Y6SA 2OBNA 3N74A 3E6AA 3GAFA 3EW7A 1P77A 1EZ4A 4XJSA 1P1RA 3F47A 4YTEA 4ZQFA 4YJGB 1MV8A 1R0KA 2X5KO 4GX2A 1ZVMA 2Q45A 4NFHA 1HDXA 2NUAA 1GV1A 4E12A 1V6AA 1F8GA 3INGA 3INTA 1HDZA 2E82A 5A05A 8ADHA 3PHIA 1CJCA 4RO0A 3WICA 3UKOA 1WVGA 2JD0A 1P1HA 4IUYA 3X2EA 5EQFA 4N7RA 2Y1GA 1IY8A 1I3LA 4QT0A 4B4UA 2FPPA 4YT4A 1NFQA 4FFMA 4EEZA 3QV1A 2PD6A 1Y9EA 3HDJA 4L9RA 1X13A 1KEPA 4B4OA 2Y0DA 1DO8A 2HMUA 3EVNA 4D3FA 3AW9A 1YJQA 1U4OA 4ALIA 2WWRA 4E2XA 3WJ7A 2GZ1A 3Q3CA 1H6AA 5DDIP 1HE3A 1TEHA 5G0VA 1JQBA 4PZCA 1M66A 1NYTA 1NWCA 1KEVA 3FR7A 4PFJA 1H6BA 2O3RA 1L7EA 1ZSVA 1R0SA 3ETDA 2I3GA 8LDHA 1T2AA 4A26A 2JL1A 1LNQA 2EGGA 1A71A 3ZU3A 2CVZA 1U8XX 1O0SA 4GPD1 5IZ4A 1T2FA 3ZCXA 2PTGA 1GQYA 3U4DA 4CMBA 1EVYA 1WW8A 3QVXA 4BIIA 1F8FA 2X5JO 2HMSA 4E5YA 4RZHA 4WCFC 1AXEA 2VHVA 3ZZNA 2BHLA 2GASA 3ZH2A 2DFDA 3EHEA 4MVJI 4NIMA 4CQMD 4B3IA 4WLEA 4IDAA 3I4FA 3L4SO 5COAA 3OF2A 3GNSA 5JO9A 3F46A 3UOGA 5CG2A 1PZEA 1JTVA 4BOYA 4CLOA 4BGVA 1UDAA 2YJZA 3BHMA 1X15A 4O1MA 1PJSA 1E6EA 4IZHA 1YB5A 1DC5A 1R6DA 1YQGA 4N5LA 3IDSA 5L7WA 1PR9A 1ISFA 1Y81A 4BGUA 1B15A 5EESA 3T4EA 5F3RA 5EN4A 3RU9A 4J90A 1JKJA 1AN9A 2XF8A 2POQX 3IOYA 3DC2A 3RFVA 1CQIA 3P19A 3HSKA 3MJSA 3MJTA 1BW9A 2DKNA 3K6JA 3QVSA 1XEAA 3OHSX 3PXXA 4U0JA 5JDCC 3WBFA 5TSDA 4I9HA 2DTEA 2P9CA 1EE9A 1ADFA 5FWNA 3VVBA 2A92A 1A4IA 4JGBA 3K73O 4EDFA 3I52A 2BRUA 1EVZA 2JFFA 2NADA 4F6LA 1K6XA 2ZYDA 4KTVE 2FSVA 3FN4A 4IGFA 4XWYA 4YAJA 4XYMA 1H2BA 2QZZA 5B1YA 4A5OA 3PWSA 4GH5A 4CMEA 3VZQA 1NAHA 1U2GA 2Q1SA 2IEBA 3RJ9A 4R54A 2C82A 3UCXA 4JLWA 3ZWBA 3DAGA 2C59A 2ZTUA 1WDMA 3ZU5A 5KIAA 3KYDA 2EV9A 3D7LA 1D8AA 1P1FA 4XGKA 5T6BA 1I0ZA 3HNPA 4D41A 4YXFA 5HM8A 4RVHA 4CUKA 3JTMA 1PIWA 2G76A 2RHCA 3FWZA 3PIIA 2FP4A 4BKOA 2DBRA 4GX5A 5DCUA 4BNXA 1ENPA 4EUFA 2QZ9A 3CMCO 4RJTA 1NR1A 3TZ6A 5DULA 1TT5A 1S6YA 3JQAA 1B14A 1K6IA 4IJUA 5FI3A 3RUDA 5KVCA 2HJSA 2CZCA 5A3JA 5CDTA 1TXGA 5ICMA 1X1EA 5HA5A 2NQ8A 2Y0EA 3D5QA 4J16A 3GOHA 3VH2A 1MA0A 3W8EA 3S2FA 1M67A 3INRA 1SC6A 5GZ6A 4WK6A 2CFCA 3KETA 4ND1A 2OP0A 2H63A 5K9ZA 1A5ZA 2OFPA 1LA2A 1TLTA 3JYNA 2VWPA 1Z7BA 4I5FA 4HP8A 1PWXA 1I10A 4W7IA 5L7TA 4NBRA 4PRLA 1ZZEA 2DU8A 2G82A 3RC1A 3E9QA 1KVSA 1B26A 4J4BA 4J0FA 3KYBA 3BMOB 2Y67A 1FDWA 3G1TA 4FCCA 1QR6A 1Q7CA 3VOSA 3VKUA 3ZNOA 4AJPA 1HLDA 4E2ZA 4IXWA 3JQ8A 1H6CA 3T4XA 5I8ZA 4QXMA 3TSCA 4G2NA 3GFGA 4HBGA 5ER6A 3IAHA 3SJ7A 4L76A 1LC3A 4OXYA 2PH5A 1KYQA 4CR7A 3AY7A 2H1SA 4ROSA 1YWGO 3KSZO 2Q2QA 2GERA 4J1SA 4CJXA 3NEPX 1ZXLA 1JW9B 3BMCA 3JSAA 2E6UX 1ENOA 3F5QA 2EWMA 1PJQA 4EJ6A 3GHYA 3WSVA 1KY5A 4R1SA 4AG3A 2HU2A 1QLHA 4XRRA 4D79A 1EUZA 3L9XA 2DPHA 4CUJA 1J6UA 4FOOA 4JIGA 1JLLA 1HF3A 2ZCVA 1P0CA 4Q3DA 1CYDA 4GKVA 1A7KA 4R3NA 3AUTA 4I8XA 4LK3A 3GY0A 3LYLA 3IJPA 3RCBA 1R12A 2GRAA 4HUJA 4BNJA 1P9LA 3GT0A 3GZNA 4P4LA 3PQEA 3ZU4A 2VOEA 4G81A 2VZ0A 4QFCA 4W4TA 2FR1A 4FN4A 4OKIA 3WYEA 3GEGA 1WP4A 4DMLA 1LTHR 2CNBA 3WLEA 1XGKA 2XXBA 3RUIA 4ND2A 3OJFA 1DDOA 4E5PA 1BRMA 3ZWAA 4CLEA 4XB1A 1IE3A 3RFTA 2EKPA 3NGXA 1R4MB 2EJWA 3C3XA 1LDMA 4WPGA 3GZ4A 3BHIA 4XYLA 3ONEA 2EP5A 3FPLA 1ISIA 1OAAA 4KQXA 4O63O 2R00C 5L3ZA 3LT1A 2ZATA 3P2OA 2O7SA 1JWBB 2OORA 3ENKA 2W2KB 4ZQGA 1PS8A 3GMDA 3HWRA 3K96A 3ZV6A 1W0CA 2P9GA 2RH8A 3WTBA 2P91A 4RVUA 3ONFA 4II3A 2AQKA 4E21A 4JNKA 1GZ4A 3ITDA 4QX6A 3DMYA 1BMDA 1LC0A 2NVUA 4FBGA 3DONA 4MVJE 4A0SA 4D3DA 4YAGA 1VL6A 3JQCA 3AOEA 4QUKA 4NBWA 4Z3DA 1EE2A 3DZKA 4WCDA 3NUGA 5JLAA 3L07A 4Z0TA 3RC2A 3ULKA 3Q0EA 3DHYA 3B1JA 4O0LA 1BVRA 1B7GO 2FOIA 1LQUA 1X7HA 2WYVA 1YL7A 3WSWA 3IQDB 1ZK1A 2ZB4A 1CERA 3NX4A 1WZEA 4C7KA 4Q3BA 3TFOA 1MG5A 5KJFA 2HQ1A 4ZQEA 4EUEA 1E3IA 5A02A 2EP7A 1SEVA 4BS9A 2NWQA 4YRDA 4GSLA 5COBA 5COQA 3WB9A 4DPLA 5KJEA 4Y8VA 3BIOA 4YWJA 1EBFA 1C1DA 3DBHA 3PGJA 1ZKMA 4BMVA 1QYWA 4PN3A 4E30A 3O8QB 1JDJA 3E8XA 3RD5A 3MJ4A 3WGIA 1OMOA 4DYVA 4MIEA 3GUCA 1TVEA 1WNTA 3DFUA 3K92A 4LVUA 2A4KA 2D3TA 3FR8A 5CHEA 3CKYA 2BGLA 5ER9A 1UJMA 3VHRA 2JAHA 4ZQHA 3WG9A 3JYPA 3U4CA 3PWKA 4M55A 2BFOA 5G0TA 4AJ1A 4IMPA 5JDIA 5DCYA 4RL6A 2C2XA 4JN6B 3D4OA 3ROKA 5A5EA 2NACA 1F14A 4RGBA 1E77A 4CQLB 4DVJA 1I36A 2Y93A 4ZGWA 3H5AA 2O48X 2P5YA 3JD3A 3SVTA 2HRBA 4R1UA 3WNVA 3UGKA 2J8ZA 2J3JA 5TS3A 4UVGA 4EEXA 4XR4A 4KDEA 4Y67A 4FOSA 3VPHA 3TDKA 5CPFA 3NT4A 3OEWA 7ADHA 3S2GA 2A9FA 5KVVA 4YT8A 1M6HA 5A1TA 1UDBA 1PQUA 2TMGA 4MP3A 1PEDA 4GLLA 3ZWOA 1VKNA 4JBHA 3TQHA 4J4TA 1GZ6A 2Y68A 1E6WA 2EKQA 4XQ9A 2B5VA 3PIDA 4KQWA 3LSYA 3KSDO 3WGZA 4GAEA 4BNFA 2AG5A 4ZVVA 2BI7A 4PLHA 4S3MA 3HN2A 5C7IO 1XA0A 1YBMA 3L9WA 4NJMB 4WASA 4RF2A 4OO3A 4B7UA 3R3JA 2CVQA 2X4GA 3I1JA 4E13A 4J0EA 1CQJA 5BSHA 3B20A 4OL9A 4ZICA 5TRTA 3QWIA 3B1FA 1DLJA 4AJLA 4Y6RA 4PLGA 3GDOA 3ITKA 5IXYA 2UAGA 1ZH8A 2ILTA 5DF1A 5F5LA 2VHXA 3AM5A 3FNEA 2JD1A 1XYGA 3RU7A 1GEEA 1LQTA 4U6SA 3N7UA 3WS7A 1I33A 1ISJA 3SJUA 3ZGYA 3ZWWA 4BO9A 2JHFA 4CM1A 1NM5A 3HZZA 2DQ4A 2SCUA 3ICCA 3EC7A 1BXGA 3FTPA 1PGNA 3DL2A 4BO4A 1PJ4A 1C0PA 2EJVA 3GLQA 4R1NA 3GF4A 3Q9NA 2GNAA 1Y8QB 4YCAA 5I7EA 3RQSA 4OHUA 2AA3A 4YEDA 1XHLA 1LRKA 1YRLA 3ONDA 3QLJA 4NHEA 2DLDA 4OSOA 4RLHA 1PS0A 5JC1A 2VQ3A 2DUUA 2NNLD 5ITVA 2I67A 4RF5A 5I7FA 1UR5A 2LDXA 2O3JA 2ZJ0A 1BVUA 1LSOA 5KNLA 3OIFA 3DBLA 3TFQA 1T24A 1G0NA 3CE6A 1ZMOA 1UH5A 3PPIA 3DZJA 3DTYA 1BW9B 3EMKA 4KWHA 3DFZA 1X1TA 5F1PA 4PLPA 5JAMA 1JA9A 1BXKA 1TB4A 3QWAA 3RBVA 2FN7A 4DBZA 1XG5A 3MWEB 1N9GB 3UN1A 1QV6A 4GX1A 2WEKA 3LF2A 1QV7A 1C1XA 1X0XA 4O5OA 4I1IA 1L7DA 4BKUA 1O9BA 2CDCA 3H5RA 1DPGA 1N2SA 1T4DA 1V9LA 4GWKA 4CL8A 3MEQA 5EPOA 3ZWCA 4ALNA 1K2WA 1S7CA 4J1TA 3LDHA 4YB8A 1SCUA 1XKQA 4BO5A 4RZIA 1LSJA 4ZN6A 4FFOA 2YV2A 2NM0A 3B1KA 4TROA 4PIVA 4I9UA 2HLPA 3NTRA 4UVHA 4DLBA 4Z6KA 2AEJA 2VUSA 4KZPA 2ZTLA 1QLJA 1ZO8A 4OYRA 3K2BA 1EEHA 3RWBA 4XQCA 5G0UA 1E3LA 4FFRA 4IY1A 3DMTA 4INAA 4P38A 1KEUA 3JQAB 5TT1A 1C0IA 1D1SA 1J0XO 2EERA 2Q50A 3AWDA 3DDNA 4XRGA 5JFOA 2PGDA 2PZKA 4IINA 4M54A 3AK4A 1I8TA 1UXKA 1E5LA 1PGOA 1XQ1A 4U8GA 1MFPA 4J7XA 1OC4A 1MC4A 3IS3A 2WE7A 5T8KC 2YDXA 4CR6A 3HHPA 3M2PA 4FJ1A 1ZK3A 4D7AA 4XKJA 1LRJA 1ISMA 4CMKA 4OMUA 2A35A 1QXSA 1XWFA 4JP2A 4RPGA 4E3ZA 4TVBA 3OIGA 3HB4X 3PEFA 4QEDA 1DXYA 3C7AA 4LRTB 4MVJM 4N5MA 1NQAO 4RVDA 4CLDA 5KVQA 4EBFA 1NPTO 3TZKA 1UDCA 3QRWA 5AQ1A 1LX6A 5BSEA 3NV9A 2B5WA 5T64A 5IDQA 5C7OO 2JCVA 3ZHYA 4NMHA 1KBZA 2IXBA 1NWHA 3AY6A 3OIDA 3TNLA 2W98A 1FJHA 1N1EA 3LC7O 4HY3A 1CWUA 2XAAA 3GGOA 3O26A 1ZFNA 3G17A 4LCJA 3H3JA 2O2SA 2O4UX 3F1LA 1U3UA 3HADA 1DJQA 4W7HA 1DFHA 3H65A 5CP8A 1A9ZA 2YFQA 2BD0A 4P22A 1WLYA 4YT2A 4IDEA 4LISA 1NFRA 3NDRA 1P1IA 3A28A 3LT0A 3ZHXA 4J91A 4YRAA 2E49A 3X2FA 3WIEA 3HE3A 2PZMA 1RKXA 2CVOA 2PZLA 4RVGA 4YVFA 4KP7A 4AL4A 5JAZA 5FYDA 4NZ9A 5IZCA 3HN7A 4JBIA 4ALKA 4Q39A 4BKPA 5DNAA 3VPFA 2VHZA 3RJ5A 4Z9YA 2Y1CA 3G1UA 3RC7A 3VPSA 3OEYA 5JSFA 4Z0PA 1O89A 3IKVA 2FMUA 1X0VA 3I9KA 1U4SA 4MVJH 3WR5A 4CMJA 1PS9A 1HXHA 2Z5LA 4XQEA 1T4BA 2Z95A 4WLNA 4ND5A 1IB6A 4LN1A 4WNIA 4DYDA 5HTOA 4XQGA 2X0NA 3EDMA 3GNTA 4M49A 2J3IA 3FNGA 2QRJA 3GR6A 4TMFA 3AI2A 3ETEA 2WDZA 1KVTA 3K9QO 4ZRMA 2X0IA 5IFLA 2PZJA 1LSSA 3MJCA 1ZEMA 1GZ3A 1MUUA 3V1UA 4XDZA 3EYWA 2J5RA 5T67A 4DQXA 4MINA 2GPTA 4CM8B 1H6DA 2RCYA 4M86A 1SBYA 1HDCA 1GQ2A 2PR2A 1LDBA 2J5QA 3A06A 2NLOA 3DZBA 3NT5A 1UP6A 4CL3A 4FIZA 2C54A 6LDHA 2R6JA 1DIHA 2CY0A 3ZN2A 4UEOA 4E5MA 1VSUA 4DBVO 4RVSA 5H83A 4MIYA 5L4NA 1LDGA 1YQDA 3ZHZA 1JVBA 4U7WA 1LEHA 1ARZA 3PHJA 2HMWA 2FZEA 1I2CA 4MVJD 3SEFA 3UCFA 1KIFA 5I7VA 3DZHA 1HZJA 3VKVA 1DIRA 3H9GA 2P68A 4B4WA 4GGPA 2NVBA 3F4LA 2J6IA 2R2GA 2VUTA 3KYCA 4OKNA 4IJVA 1NXQA 1OI7A 4PLTA 4BNZA 3TZQA 5DT9A 2BFAA 5IN5A 3GRPA 4M87A 3PWZA 1LLQA 4GVXA 3EZLA 3FWNA 3U0BA 3ANMA 3TZCA 3O38A 4PLCA 2IZ0A 2QQ5A 3AUUA 4CLRA 2C7VA 4DA9A 3DBHB 3PLNA 3NAQA 1R4NA 3JQEA 5LDGA 1MFZA 2VYNA 2HUNA 4PG6A 3JQGB 5HS6A 2PH3A 4Q9NA 3ZWXA 5CG1A 1GUFA 3K8ZA 3DWFA 3PQFA 2BFPA 4YBZA 1Q7GA 1WPQA 2ZB3A 1H0KA 3VVCA 4JJFA 3K30A 3KB6A 4YJFA 5TJ9A 5TLSA 2WE8A 5BR7A 4FW8A 1XU9A 1AXGA 1EUDA 3JD2A 3DZIA 5B4TA 4ID9A 1PZHA 2I6TA 3SXPA 1YL6A 5LC1A 2QG4A 2NTVA 2V6BA 3FCOA 3OECA 1KEWA 3ZDFA 3QVOA 3I9LA 2G17A 2VOJA 2WTBA 4BGIA 4YPOA 1YBAA 2Y66A 1SPXA 3NGLA 4NPCA 2GO1A 4GWGA 4FFLA 4RDIA 4YJHB 4AJHA 2F1KA 4B4VA 2B37A 3GC6A 3JQ6A 4PG8A 3KSUA 1ZJYA 4LCEA 4J3FA 4ZA2A 2Q4EA 3B70A 1P1JA 3VPXA 1Y8RB 3SC6A 3C7CB 4Z0HO 3GNQA 3OA0A 4CMAA 4CQMB 3FRJA 1Y5RA 2GSDA 1GYPA 1PGQA 3VDQA 1B8UA 1GD1O 4D0RA 5I9LA 2P4QA 3AOGA 4X54A 1R16A 4MKXA 4KUHA 1UXJA 2OP1A 4PVCA 1NQOA 4HFNA 4ND3A 2O3TA 1PWZA 4B3HA 1YOVB 3M1AA 2AMFA 3C8MA 3K31A 5G4KB 3WGYA 2HK9A 3QWHA 2X9GA 2PD4A 3DO5A 2Q2VA 3D3WA 3VH4A 5MDHA 3AUAA 2P9EA 3JQ7A 5JYDA 4PG7A 4R16A 2V65A 1EDZA 2GD1O 2ZJ1A 2EF1A 2ZIZA 2WD7B 3VPGA 2JAPA 1BG6A 1H94A 3UFXA 1DLIA 4DTIA 1YGYA 4BO2A 3BXXA 3UF0A 2O3QA 4BMNA 3KVOA 3TWOA 2ZB7A 1ZSNA 3PK0A 4M89A 4M1QA 2VHWA 1TT7A 4XYEA 4WCFA 3D4PA 1AHHA 4LW8A 1P0FA 3LC1O 3AI3A 2VRBA 3VH3A 4Y98A 1VJ0A 3PFWO 1UP4A 1YH3A 3BA1A 2C0CA 4HNGA 4BGEA 3CZMA 4EYEA 2FPIA 3IUPA 4MKRA 4LGVA 4R68A 2I65A 2AQIA 1XQ6A 1IZ9A 4MPDA 1BDBA 1I30A 3IL2A 3DBLB 3PYXA 4JROA 4ZD6A 3RBZA 1QSGA 2Z1MA 4B7XA 3P5SA 1Q2XA 4Z9FA 4Y9DA 3RFXA 3V5NA 4AVYA 1XDWA 4J2HA 5ENDA 5L95A 3ZWNA 1HT0A 3I9OA 1H9AA 3OSUA 5JDCA 1V3UA 4IJKA 2ZCUA 1QYDA 5DCWA 1P3DA 2P5UA 1A27A 2OGUA 4XD2A 5AXCA 4XGNA 2YHIB 3OICA 5KKCA 4C7JA 4TWRA 2W4QA 4CLHA 3E9MA 4ALLA 3P7MA 4NNJA 3ZW8A 1PQWA 1SMKA 3C1OA 2VRCD 3PZBA 1LLDA 1N1GA 1WWKA 2BF7A 2CF5A 3F1KA 1ZK2A 2BKAA 5EIOA 5JBIA 1MP0A 4UVEA 4B8WA 3EY4A 1GL3A 2NSDA 2DC1A 2YW9A 3OQBA 3CSDA 3PGXA 1PL8A 4YYZA 3ZNPA 3AOEC 2EIHA 3ADPA 3LQFA 1O5IA 1H93A 3JQBC 4UVIA 5F1KA 5L7YA 1ENYA 3S2IA 1EK5A 3ANNA 5IDWA 4AJEA 2HJRA 3GVIA 4CM7A 3U49A 1E3SA 4F46A 2IZZA 3I9MA 1QYXA 1HETA 4KUEA 3UCEA 3WOHA 5BNFA 4Q3AA 2JFHA 3BMNA 3TF5A 2DPGA 1BXZA 1RPNA 4GBJA 5TIIA 4BNNA 2D5AA 3KRTA 3EZYA 2YDYA 3PJDA 4YRBA 3IC5A 3AI1A 3OH8A 3ANLA 1LDEA 1DIBA 1YXMA 2RAFA 2FHSA 2BH9A 3BMQA 4NJOA 2HMVA 3PQDA 3ASVA 2EHDA 3WXBA 3DBVO 4RPLA 5F1OA 2ZB8A 3SLKA 3LC2O 4E5KA 3WWYA 5J23A 3AU9A 1NP3A 3K5PA 1XCBA 2IYOA 5FI5A 3MOGA 4JX8A 3R0IA 3CINA 3DBRA 2NVWA 3B6ZA 4CUZA 3IJRA 4RV9A 4W9NC 3L4BC 4MP8A 2GN6A 1UAYA 1U5AA 4AJNA 1UXHA 3ENNA 1IL0A 1E5QA 4L4XA 4A10A 4HADA 2BMAA 2GF2A 3D4NA 3GEDA 4CM3A 2DBQA 2G0TA 4OAQA 4ESOA 1EMDA 1ZMTA 4R5MA 4RCVA 3Q11A 1T1SA 2I66A 3DB2A 1VJTA 1G1AA 3GN2A 3RI3A 4OJNA 2JCXA 5A3VA 3HFSA 1A7AA 3WLFA 4YJGA 3MOIA 2IYPA 4WKGA 5L4SA 3QWBA 2C07A 1N7HA 4D44A 5BNIA 3TL2A 4EJ0A 1GYQA 1WDKA 4BL5A 3C1TA 4DREA 4U0KA 1Q0QA 1GAEO 1ZEJA 4EZBA 1E3EA 1I32A 2PV7A 1J4AA 1ULSA 2IRWA 1E3WA 4OXNA 3GPDG 3JQ9C 4NH4A 4FC6A 1FK8A 2JCYA 3W6ZA 4UUPA 5FF9A 1HE2A 2AHRA 4MOWA 5EL0A 3HJAA 2YFHA 3R6DA 4MIOA 5I7SA 4PLFA 5ICSA 3OJ0A 4MVJA 4PCVA 5EJ2A 1V3VA 3QY9A 1F17A 5B4VA 1K6JA 2B0JA 3KUXA 1NQTA 3H8VA 3CEAA 2VTEA 5L9AA 3ZWMA 1GCOA 4BNHA 1Q1NA 1T26A 1F0YA 3GMSA 4CV2A 2OOSA 1I2ZA 3CH6A 3DTTA 4FD3A 4E32A 3PDUA 3D64A 2X58A 3VAZA 5MGBA 3WYCA 1C3VA 1PU2A 3FI9A 1V3TA 3H3FA 4BQPA 2R00A 1N5DA 2DUWA 1Z75A 2PKQO 3JD0A 3W4KA 2AG8A 2NU8A 3C1AA 3GG2A 3WDSA 1PQPA 4RLSA 4AJOA 1EK6A 1HDOA 3QIVA 3S55A 2VYND 1GPDG 2QYTA 5LDHA 3A14A 1DBVO 1T2CA 3FNFA 4HFRA 2AE2A 3PVZA 4DC0A 1X7DA 3QQPA 1U28A 1F06A 2H5LA 4MO2A 4WE3A 1V8BA 4XX0A 1A4UA 3IKTA 3WTCA 4A73A 3SC4A 4I5DA 2QHXA 3MTJA 1ZW1A 3EUWA 4RQTA 4TSKA 5T57A 3ZNQA 2NV6A 3W6UA 4IMRA 5L40A 2AE1A 2GZ3A 4WGGA 2DFVA 1E6UA 2E4AA 3HG7A 3H9UA 4JJIA 1WZIA 2NTNA 3TOXA 2HSDA 5IDYA 1DHRA 1LI4A 4Y6PA 3WX0A 3GAZA 3H9EO 1NPDA 2D59A 4CLRB 3Q2KA 3F6YA 4JK3A 1R4NB 1IUKA 4IDDA 3GK3A 2FR0A 2O2YA 4IS3A 4UULA 1Q0LA 2A94A 4XEHA 1CRWG 4B3JA 4RF4A 4IDGA 3GGGA 4IQ8A 4NK4A 1YDWA 2I3AA 4RPJA 9LDTA 3PP8A 4JJGA 1ID1A 1VI2A 1D7OA 1Q0HA 1X14A 4BV8A 2Q4BA 4YJFB 4I5EA 1NVMB 3F9IA 1WAMA 1W73A 2YV1A 5ITWA 3G3EA 1I3KA 4CLOB 5A5FA 1N8KA 1EVIA 1IULA 2BELA 4J2OA 2IODA 3QSGA 4C4OA 1I3MA 4EITA 2AQ8A 2I99A 2PWZA 4HFJA 2V7PA 3I3OA 5EMHA 1YL5A 2E48A 3EAGA 1VM6A 1U9JA 4H7PA 1BGVA 4M8SA 3BZUA 1E1LA 1VL0A 4L75A 1HYHA 1O6ZA 4UEKA 4URFA 2X23A 2BGMA 3NDJA 3W4JA 1U5CA 5JPIA 2D5CA 1HRDA 4TKLA 3JYQA 3A4VA 3HDYA 3DAFA 2F00A 1GYRA 2Y1EA 2V6GA 3WQSB 2ZQYA 4GQAA 1RJWA 3LF1A 2QIOA 4K6FA 3NRCA 2PY6A 2YV3A 5CEJA 1LBEA 2E37A 4RPHA 3WYBA 1NX6A 4GSKA 5C3MA 5I9MA 5BT9A 1ISGA 4K28A 3T7EA 3JD4A 4B79A 4D43A 2AEMA 3AFMA 3TN7A 1E7WA 3QVTA 9LDBA 4DIFA 1BDMA 2NU9A 4DUPA 3KYDB 3ZV3A 1H5QA 4CM9A 3I9JA 3V2GA 1JAYA 1HSZA 2WMDA 3UAGA 3Q9UA 3OM9A 5EERA 5JO0A 3F3SA 1M75A 3KO8A 1E1KA 3HDQA 1LRLA 3JYOA 1UZNA 1NBOA 2HMTA 4J7CA 3HQ4O 3MZ0A 3BHJA 3RKRA 1ZXBA 4EJMA 1N7GA 3V2UA 1E7RA 2Y05A 4TRMA 1SB9A 3KEQA 1TT5B 1NQ5A 4GLOA 4L4SA 1ENZA 4WNCA 4Z3KA 3ROMA 3H6KA 3KEOA 3QP9A 3TZHA 4ZU3A 3BAZA 4OOEA 4YT5A 4ND4A 3ROPA 1CIVA 5TGDA 1DJNA 4IDFA 1P45A 2UUOA 4FSHA 5L45A 3ZWPA 3DOOA 2GGSA 1NTOA 2VRCA 3PJGA 1KVRA 3E03A 1AHIA 4J9UE 4KDFA 4XJTA 4NBVA 4AJIA 2X8LA 2OBYA 1DIGA 1KVUA 3H9JA 4NG5A 2YYYA 1NFFA 3ASUA 5JY6A 2X9NA 5A9SA 3PJEA 2LDBA 4J1NA 3W8DA 5A9RA 5IDXA 2WYUA 4IM7A 5AXAA 3W8FA 5CFZA 2GLXA 4J1QA 1ML3A 1WXDA 3NJ8A 4I5GA 4UVDA 3WMWA 3GUYA 5JY1A 1JVSA 3JQ8B 4BMSA 5L53A 3A9WA 2JD2A 5B4UA 2UVDA 2XOXA 3FD8A 4S1VA 3S2EA 4BO1A 1RM3A 1LU9A 3FBTA 5JCJD 1X7GA 1ZK0A 3PHHA 3QVWA 3PYMA 3E18A 3NT2A 3L0DA 3KM0A 1E3JA 3BMCB 3JQFC 2FY8A 4L8VA 2OXIA 1RWBA 4XIYA 5T5QA 4NK5A 5JW6A 1R4MA 4L74A 4G5HA 1QYCA 1V35A 2VNAA 2VZ9A 1BWSA 2AEFA 2GR9A 3DHNA 4PGFA 1VL8A 5TQVA 5TT0A 1E1NA 1Z45A 2X0JA 4UREA 1PR3A 3PRJA 4RPKA 5A9TA 2W2KA 5F5NA 5DP2A 1ONNA 2QW8A 3G0OA 3TRIA 5KVSA 1IOLA 3OQ1A 5DN9A 4U5QA 3ZWVA 1EFKA 2B36A 1EUCA 2W8ZA 3HFGA 4JP3A 3DZFA 4WLUA 3V1YA 1ADBA 2PGLA 2WYWA 1T1RA 3JYLA 4L0QA 3DXFA 3S1LA 2RH4A 4HV4A 3CUKA 1P31A 3TJRA 3WGHA 2FPGA 2GCGA 3ICPA 4WJZA 2AXQA 3RIHA 1RYDA 2CUKA 2JHGA 3JD1A 2P2SA 1AGNA 3L77A 4BNVA 3GZNB 3OJOA 3GVCA 3ROQA 4WLOA 2ZKLA 4BNUA 1AUPA 1FDUA 4HNHA 1VE9A 3EGOA 5T8KA 4ITUA 4B8ZA 4BB6A 4DQVA 2FSSA 2UDPA 1EDOA 4F45A 4Z9XA 3GGPA 1Y1PA 3QW2A 3FF4A 4CLXA 4KWIA 3EVTA 5B12A 4OH1A 5GZ3A 4E31A 1MXFA 2YZ7A 5BNTA 1U3VA 1PTJA 3BTUA 1DFGA 4P4NA 2OMEA 2YY7A 3SX2A 3ZNNA 1ORRA 4CV1A 4D46A 2Q2WA 1O95A 3OBBA 1A72A 1FMCA 1ZBQA 3SBOA 4DPKA 1PX0A 2DTDA 4HX5A 4J49A 3OJLA 3WFIA 1W4ZA 3IMFA 2Q46A 1GR0A 2NVUB 1HE5A 3DEYX 3PHGA 3RASA 3JV7A 5K6AA 3PYLA 1JN0A 2DAPA 2QX7A 5CEEA 4R3WA 3RKUA 4NBUA 5G4LA 3I4CA 3WQRA 3BYZA 4CQLA 3MTGA 5KOIA 1ADGA 2B69A 1MX3A 1LDNA 1SOWA 2C29D 4JCOA 1XR3A 3H2ZA 2Q1TA 3I83A 1GQQA 4K9DA 1DC6A 4E4YA 2EGHA 3E48A 4FR5A 4IPTA 4FS3A 1FF9A 2PKRA 5F21A 4ZJUA 3GVPA 3PLRA 4R4JA 1E3WB 4WLFA 1L1FA 1MC5A 3VDRA 2HKIA 1C1DB 4P8RA 2QRLA 1E7SA 1LJ8A 3VH1A 1GTMA 4FQ8A 2C5EA 3H9QA 3O9ZA 2WJPA 5GY7A 1NR7A 4J43A 4YQZA 3U09A 1MXHA 5GZ1A 3BTSA 5TNXA 3OJEA 3K2EA 2NTJA 1DRUA 1U1IA 2VT2A 4P4GA 4QTZA 3RROA 4CMEC 3KTDA 3NTOA 4CR8A 5JAIA 4NJMA 2D4AA 4IGEA 5C37A 3LK7A 4LMRA 3RC9A 1SO8A 1NPYA 3RUEA 1J49A 2X9VA 4OOFA 4E0BA 4OIMA 3RBXA 1Z82A 4HWKA 1ONOA 1PL6A 3UH1A 1HDGO 4ILKA 1SEPA 1RYEA 3U4HA 2HK8A 2G5CA 2PLAA 2AQHA 4XIJA 4RORA 3Q2IA 3ON5A 2PFGA 3I5MA 4LRSB 4CMIA 4Q3NA 2ZYAA 3UW3A 5H81A 4CM4A 4LSWA 3QE3A 3QWFA 3L6EA 3I6QA 1KERA 4PRKA 4D0SA 5L51A 2DTXA 4CM5A 2H9IA 3I6IA 3RSHA 4NI5A 1ZNQO 3NYWA 1ZSYA 1JKIA 1Y8QA 2I76A 3QJ5A 1PGPA 4IIUA 3RUAA 2Y1FA 3VTFA 4R9RA 2V6MA 1OC2A 3RUHA 4YR9A 2PK3A 3ZW9A 3WBBA 1Q7BA 4QO7A 1VKOA 5G0WA 3H7AA 3JQDA 1ZUD1 5GMOA 5U1PA 3VC7A 3WGGA 4BKQA 5C7LO 3KHUA 4BO7A 3NKLA 4HKTA 2RHRA 2O23A 1ZIDA 4FB5A 1M76A 4PZDA 2CF6A 1I3NA 1HZZA 1ONPA 3H5NA 4ZRNA 3OMLA 1XELA 2PA3A 4I08A 3L6DA 3MJEA 1ULUA 5JAQA 2FWMX 3TL3A 4XYBA 4CODB 4WOKA 5IJZA 1Y9AA 1LLCA 4IQGA 4TRJA 3RAJA 2DBVO 1N9GA 1U7HA 4YQYA 3VZRA 3BTOA 1R66A 3NTQA 1ADCA 1BXGB 1K0UA 2NU7A 3TOZA 5HRUA 4BNTA 3FSRA 1YO6A 1YONA 4KUGA 4YAIA 4FPXA 4XCVA 4EUHA 1SNYA 1LXCA 2IDZA 4WEQA 3PDJA 1D3AA 4YA6A 4RVFA 4II2A 4DLLA 4E2WA 1M6WA 3WGQA 1B8VA 2O3SA 4CMCA 3WQQA 2H6EA 4YAKA 1G0OA 4CV3A 4MJLA 3E1KA 4HXYA 4W6ZA 2X86A 4XA8A 1XLTA 1G6KA 4TRRA 3IIEA 4U6QA 4YACA 1P74A 4PLZA 6ADHA 2IE0A 1E1MA 2D0IA 4CM9D 4J9VA 2HDHA 3GHHA 1HE4A 4FC7A 4PLVA 3ABIA 5DP1A 3COSA 1ZJZA 2C2YA 2DVMA 2HAEA 4J4HA 5EINA 4R1TA 2NU6A 4MDHA 5ADHA 4UUNA 2P4HX 3S8MA 4WOJA 1MG0A 3OETA 4F3YA 1HSOA 3ADOA 4R69A 1Y7TA
chains in the Genus database with same CATH superfamily
2GN8A 3KQVA 1N32B 4IH9A 4BLWA 1GLVA 3ILXA 3Q8LA 3HS3A 2BI8A 2UXCB 3U7RA 4D3SA 2W90A 3RK4A 4BKRA 1GEGA 4IRUB 3BTVA 3CX8A 3IUBA 4NFSA 1XLUA 2ZSFA 1QJ4A 1SUAA 1M2KA 3F0TA 4X6UA 3R1IA 4Q9IA 5FI0B 1T9HA 1NNUA 1TAGA 4EUNA 5IJ0B 4YLYA 5FAXA 2G3YA 4JJ4A 3VR5H 2IHZA 4DRXB 4MYUA 5D8DA 1OFHA 3VSEA 1SQ6A 3K6RA 4GKBA 2CDBA 3P2IA 1JIJA 3WQBA 1AGYA 3MN1A 4EUSA 5D01A 3HXOA 1I5EA 2D0DA 3DA8A 4OK3A 1R0WA 1V6SA 4HH1A 2V4ZA 3KYIB 3U7QA 5L3SB 3DMHA 1OLXB 1JJAA 1KHHA 4EFLA 2QBYA 4B6EA 5ALWA 1CK4A 1I01A 1AK9A 2UZIR 3OPMA 5DE3A 3T3MB 3GP3A 5LUAA 2N46A 2C4TA 2D1YA 3QTLA 3SXUA 4H7HA 4MDFA 3TBKA 1BIFA 1T5IA 4QTTB 4FP9A 3PT9A 1Q7TA 1SAYA 4RTQA 3ZYZA 1F12A 4NENA 1IC6A 3FJ1A 5JCJA 3BXEA 2PQMA 3PNQA 3NWOA 2UYYA 4KFSA 1XTZA 2XVAA 4A27A 5BSRA 1K7XB 2DWQA 3S81A 5I8WA 4Z5XA 4OX9Y 3MJVA 5ITZB 4LVNA 2MSKA 1CDOA 4CPDA 4H7JA 2ZTMA 1Y5IA 3GFBA 1GSAA 3UYLA 1WSDA 2QSYA 1K5PA 1HL7A 3ZD7A 5FRDA 1ESDA 4WN9B 1TC2A 1PJCA 1OT5A 2QNBA 4K6CA 5E6SA 4X00A 1D4FA 4AX4A 1V37A 4D6PA 5A4MS 1JKFA 4Z54A 5BPHA 1N9ZA 1GUYA 2NXWA 5LKAA 4P3PA 1Z08A 3WLAA 5DBIA 3GA0A 3DFMA 1S1CA 3QLTA 1D7AA 2VF8A 1SXJA 1TM7E 3JZAA 2G0NA 1ZITA 3I8XA 2ZBDA 3ZCTA 2ZWVA 1RZ3A 2QVGA 3TUIC 4BO6A 2QM7A 2C78A 3WLKX 4COKA 4N40A 1PG0A 2K2QB 3VAAA 3NDIA 2Y99A 4ARVA 3NP7A 2XWJI 4CYMA 3WFJA 1GA4A 2XECA 2Q9UA 3IOCA 4B47A 2RIPA 4K9SA 4FSXA 3RSFA 4GG1A 2QXUA 3E22B 3FUTA 4KYVA 3NIBA 2XTMA 4FS8A 1E7MA 3UIEA 4EA6A 4IXTA 2X5OA 3E84A 3ZOZA 3KJXA 3O5AA 4WNAA 3F7OA 4CM8A 3D0RA 3N7TA 4LYDA 2GN9A 1TOAA 1QCZA 1CNEA 1YDHA 4AJ4A 4A2QA 2ZRHA 5HF9A 4TWIA 5C5IA 2J9YB 4N41A 1BHSA 3URMA 4AP5A 2DY0A 5TXGA 2N1BA 4JR1A 5BURA 1G3RA 1ACJA 1OJLA 1TO1E 2HFJA 2X0RA 3GFTA 1T25A 5EGNA 3T4UA 4AFNA 4D9FA 4G0NA 5K0FA 2O8DB 2UV8A 2Q3MA 3KU4A 2XUGA 1BFDA 2IU0A 4QD3A 3GVHA 4W82A 2UUPA 1G4HA 1IQPA 5TJHA 4R2MA 2BR4A 1USIA 3LA6A 4DANA 3UUGA 3GDWA 3A2NA 4TQGA 4OLJA 1T29A 4MCAA 4UDXX 4DUZB 4DLPA 2A7QA 3FFXA 1PT5A 2Y1WA 3QA3E 3ZWKA 5FORA 3LHSA 4FFNA 3RVDA 4O59O 4FKBA 1W5EA 4EENA 4YJDA 2LGJA 4QOSA 2V5VA 4JC8A 1H4QA 1NF3A 4UBOA 1JI3A 3NTVA 4OKSA 5FOUA 4N0EA 5KTOA 2IYAA 3COZA 3OPVA 4JVNA 1B0AA 2B1RA 2PYDA 3EEQA 2XVYA 5A5VA 5JS8A 2XPCA 3Q10A 5TY0A 1E1RA 1P2TA 3GJZA 4IFIA 1OBOA 1YR7A 2FSIA 4ILEA 5FYQA 3QU2A 5B3AA 3KUCA 4GKAA 3IB3A 2CD9A 3OMWA 4J94A 4YDSA 1UJNA 3U4HA 2V6JA 1MAWA 3AEXA 3I1YA 2QMOA 3D6NB 2OV8A 2X41A 1WZ2A 2VZ8A 4MKGA 2X2PA 3M6VA 5KBYA 5DM70 2RGDA 2R6FA 2O7VA 2YXNA 2WLSA 2EEZA 4Q34A 4K26A 3V4PB 1GGNA 4Z3KA 1OU0A 4N12A 4Q7MB 4ACAA 5B36A 2BEUA 2HD4A 2FZ4A 3REFA 2FVXA 3CG0A 1O8CA 2QGNA 1E4OA 1W88A 1NM5C 4PG4A 3F5MA 4EHNA 3ADCA 1KY4A 2X3UA 2PV0A 3ZZ1A 4FYVA 1N77A 4JP5A 3L4BA 4HFMA 2OZPA 3FI0A 1R15A 3O21A 5ALXA 4WKNA 3SGLA 4BVEA 1F1BA 2IIBA 4RD2A 1X9IA 3L04A 4K9NA 3E5RA 4PG5A 4HGQA 4QC2A 1J0AA 1DEHA 3R09A 4KK4A 4MP6A 3DOCA 1OYWA 3A3YA 1HMPA 1VSVA 2N0SA 5F64A 3WLQA 4AKGA 5SYMA 3HI6A 1SVLA 4UC0A 1QUFA 3GCWA 1JDPA 1HYGA 4IF6A 4JI0B 1WDWB 4DMMA 5KAPA 2VTDA 3TTSA 3AUJB 2C20A 4YJ2A 1CTQA 1N78A 3AHJA 2F6RA 2BFFB 2JLYA 1UC4B 3U4IA 3EPKA 4DY4A 1BU8A 1L6RA 3M89A 4BP8A 3WZMA 2R6AA 1DDIA 1U0HC 1ZI9A 3HP7A 2FW9A 4MR7B 1SCNE 4D0NA 3BA6A 1IOVA 2AMVA 1XU4A 5LXTA 3NJ4A 1UUFA 3C6YA 4QREA 2LIVA 2W0MA 1Y8RA 3DLAA 3C7DB 1UPUA 3IQXA 4DSOA 2OZLB 4CQMA 1IEWA 4EL5A 1XWWA 2VK2A 1ZU5A 4Q3OA 1LV8A 3LY7A 5BQOA 5FLXA 2JJQA 3J81A 1ZM3A 1C9MA 4NV1A 1R9JA 3KPJA 1XDUA 4ER6A 2AL7A 3RANA 1QH9A 3HUUA 3UJCA 2EJUA 4JP1A 1H8ED 4QEKA 3B78A 3MRTA 3SVLA 1W4AA 4KRFA 3FPJA 1VA4A 4C5BA 3ESDA 1PG5A 2C4WA 4H0NA 5JZOA 1X7ZB 3C6ZA 3D0OA 2ET6A 4MKIA 5EMLA 3TOCA 4ZZ1A 4L2IB 4B0PA 4ZJZA 2JJYA 4Q6BA 4M0DA 2OSBA 4HSGA 1YR8A 1DOHA 3C85A 5I6DA 1X1DA 1EX7A 1LDYA 1HTBA 2RHHA 2WHEA 3AKYA 4DA4A 4LV6A 4I1PA 1AE1A 3PTZA 3BE6A 5L6MB 4RANA 2VDVE 3WK4A 3LI2A 4Y7DA 5AMXA 1KBOA 4TV9A 3C6KA 5CCXA 3GROA 4M7OA 4NBNA 5M04A 5DBHX 1RJDA 1O57A 4QXAA 4U6NA 4IUDS 4F7WA 3R20A 3R3UA 3ZK7A 1P18A 1BZYA 2OENG 2XB6A 3G5UA 3QY0A 3WLPA 4RM2A 1CUUA 5DYNA 5FXMA 5CD1A 2AI2A 2IU3A 4GVLA 4B74A 2XCIA 2O7QA 3E9NA 3UV3A 4I7EA 2J59A 4KMMA 4ZJYA 2ORWA 4FZJA 5HKOA 2SECE 1VC2A 2ORVA 3A1NA 5JZBA 5J43A 3QEMB 4IZ6A 1UKZA 3P9YA 1YKSA 3QVJA 2P2CA 1HT1E 4I0WB 3ER9A 3ABOB 2VK4A 4BBJA 4EH1A 4AG5A 3JPWA 4TLMB 4XB2A 4DNQA 1ZJ4A 3C3JA 1RYZA 2SBTA 2C2WA 2PUTA 1Z38A 2XT6A 3RK0A 1E7YA 5HS4A 4RSRA 5DBOA 3QKWA 2QRKA 1A1VA 4YJ2F 1FUIA 3I9NA 4DXHA 3SQWA 4LY6A 1N8TA 2BMDA 2WOJA 3ML1A 3VU9A 2VDNB 3K9GA 4KRYA 4LZZA 1YR3A 3JQ7B 5F5XA 5IAOA 1QS0B 4GXTA 1F38A 4LBWA 3ST7A 3LT4A 4F2PA 3C2QA 1EQ2A 1GPJA 1T6XA 1V7CA 4DWVA 4B5KA 4X45A 1PW7A 4ZQIA 4DEYA 2Q1WA 4BNWA 4WHMA 4JC0A 2WJAA 1E79A 4DJJA 3I37X 4NQZA 1ZH4A 2CMKA 5FP0A 2BFNA 1L4LA 4AJJA 1ODTC 2P75A 4ZQCB 4H9GA 4BV9A 4LI3X 3TYXA 4PE5B 2H1FA 1ATZA 1KIMA 1W5BA 4L85A 3KTAA 4WCFB 5TMDA 3V8EA 5BWNA 3KLPX 5AM5A 4G1MB 5KOJA 1EPUA 4DAOA 2I6UA 2LP4Y 2VWHA 3AUKA 4GPEA 4JJ6A 2QSZA 3BL8A 3WIDA 1KMHA 5M5BA 4IBOA 1XP8A 2YXPX 4UBIA 3WV5A 4X1KB 3DMFA 3LCRA 1V0JA 3HFJA 4K9OA 3OWXA 4S1WA 4Y0VA 3KDSE 4TRNA 2OWDA 2PGOA 3ZWYA 4LZJA 2V03A 3KTFA 3WB0A 1M10A 2VKQA 4GNRA 4HD8A 4QPDA 3AVVA 1BWPA 1HUQA 3FPCA 4BXOB 1W85B 1YB2A 5IZCC 3CS3A 1H8HD 2I3ZA 4HMOA 5TQ0A 4A8HA 2UXBB 5FIUA 2Q6IA 1VP9A 3IUSA 4WY8A 1VLLA 4HQ0A 4B6RA 1Q12A 5F2EA 4AZ3A 2D7CA 1PFVA 1EWQA 1NT2A 1RZVA 3F73A 4P5DA 2C5HA 3ZHBA 1XU7A 1M2VA 2F43B 3E7PA 1CETA 1V96A 1TZ2A 2DF8A 2DQKA 3O93A 3VR6H 4EKNB 4GL2A 2GCEA 3EMVA 2CUTA 3KEFA 3G7UA 4KVZA 2P6UA 5DOZA 1GTSA 3A2MA 3I39X 3C3WA 1NZDA 3TRDA 3IP1A 4UPDA 2ZWAA 4EDHA 3UTDA 1TM2A 1JU9A 5DU2A 2FWPA 3QNUA 2W2VA 1PNOA 2IKSA 1YB4A 1CP3A 1B42A 3GRZA 3RTBA 1NBAA 1SXGA 2QTVB 3PEEA 3QKUA 2E85A 3AFGA 4FGLA 1JZQA 2DMRA 4OQYA 1RYYA 4R41A 1VG1A 4C4YA 5C1DA 2HK6A 1TGVA 2GZ2A 2XVXA 2GFQA 3AMVA 3M1YA 4JD5A 1YRAA 3UJBA 4IIEA 1MRZA 4F85A 1LBSA 4LRQA 3G79A 1RM0A 2WG0A 3RG8A 1Y3IA 1DMSA 2ZKIA 1J97A 5FQOA 3V1TC 5LJIA 5KJ1A 1L4HA 4ZPJA 4R9VA 3EJ6A 1K66A 4JVSB 4QNMA 1JSRA 2DR3A 2XDWA 3OT1B 2HC9A 3PSHA 4D9NA 1XQXA 1GCAA 2OZKA 2RHTA 3EBPA 1YE5A 1ACMA 3A6ZA 3F3KA 4WADA 1XPOA 1PJLA 2WIBA 2HMYB 4FJ0A 4RKYA 3TOSA 7MDHA 1HR0B 1OTXA 1OZAA 2ORIA 4NOKA 4WLVA 5CA1A 1DB3A 3I01M 4BB5A 1FDSA 3SOZA 5DXFA 3Q8WA 2PS3A 4WWHA 2QN8A 3HR7A 4CMGA 1VXRA 4LMPA 1UADA 1EXVA 3EPLA 2OZEA 1QTIA 1YTUA 1XXHA 3VVMA 4D8VA 3ME5A 2ZRIA 1VCOA 4DLSA 3EXIB 2K87A 3G49A 1J8YF 4QATA 1JG7A 1CRZA 3ZUPA 3UY4A 3LDAA 2QYSA 3GRKA 2FUG6 2AW5A 4WZAA 3D5TA 4RK1A 5CGZA 3JRNA 5CFMA 5GTDA 3BMNB 4J0JA 3HB5X 1WHSA 2QZPA 1M6VB 2FDXA 3N2GA 1GGKA 1O94A 2J3KA 2OSVA 2H2HA 1NVAA 2OV3A 2ZRQA 1ODJA 3C3DA 2YBDA 4GYWA 5CVUA 1QRSA 5FWXB 1RI5A 4CGZA 2CCJA 3RTAA 2VHUA 4JXKA 2R7MA 4G0UA 4E2YA 1U2DA 4DLKA 1KC3A 4CT5A 1YDEA 1NAIA 3E7XA 1I7SB 2CL0X 4ZDKA 4PZEA 1OKKD 2V4MA 1CF4A 1SU4A 1WUKS 2XUAA 1HDIA 5JAHA 1Z0DA 4LYAA 3RVMA 2GHTA 3V8QA 2PM8A 3I6ZA 1XZAA 2CHGA 2NZWA 3O8QA 2FPMA 4I9NA 4ZEXA 3FOWA 4Z53A 5IAEA 5CVEA 1L7QA 3AO0B 5P8WA 4D45A 3O8RA 1HL3A 2F8SA 4LTMA 2QRUA 3VUFA 2ZQZA 1QMGA 2ZK7A 3H6GA 4NU6A 4OF4A 1SCBA 4D9HA 3WP1B 4KR9A 1ISHA 4MPRA 4AO8A 1XSEA 5C34B 5GIPE 1PYOA 3LT2A 3LUPA 1J5PA 2EW1A 3QENA 4G65A 2GCPA 4UXHA 4YMSA 2OXTA 1HDRA 2WZDA 2CD7A 5KCMA 1CDDA 1OV4A 3JQFA 3KYJB 3K9CA 2X0EA 4YONB 4CM9D 2QUHA 3MC1A 3NHSA 1ZOPA 3E6AA 4GDFA 3PD1A 3VSDA 1LY1A 1X86B 3GAFA 1YSCA 4YAWA 4XJSA 5IKXA 4X7MA 3I6YA 2P2YA 1P1RA 2O2XA 3F8TA 2OILA 3IE2A 4YTEA 2IOYA 4ZAYA 1OIXA 3QEJA 3FE2A 4WTOA 1MV8A 1Q7RA 2Q9CA 4N0PA 2X5KO 2Q41A 5EXEA 2J41A 3N6XA 4HPWA 1JV2B 4NFHA 1M2JA 2NUAA 2I4TA 3DF7A 4RXTA 1DVRA 3I2YX 3TLKA 3UTCA 4BLQA 5A05A 2Q3LA 1Q0SA 3WICA 3DUFB 3UKOA 4NZPA 2JD0A 4HYEA 1L3IA 2E6KA 2OGSA 1G3IA 2G08A 4IUYA 5DRTA 2CFTA 1W2HA 5EQFA 3ZDYB 3E3LA 4H77A 2G67A 1WX1A 4RSMA 1ND5A 1MQ8B 3B3AA 4QFMA 4HDNA 4YT4A 3LBNA 4EEZA 3VX4A 1KRXA 4BMVA 2ZUSA 1X13A 4B6GA 3BFXA 2JI9A 4DR3B 2ISSD 4EJ2A 2ZWMA 3AW9A 1U4OA 2GOYA 3NHUA 1PT7A 2PAFA 1HZZC 3WJ7A 3IEPA 3MQ2A 2LCQA 1H6AA 5DDIP 1TEHA 1CZHA 4NV3A 4RAQA 1ZUNA 1EP3B 2FN9A 1U9IC 4PZCA 3DLPX 1XEWX 3M9XA 3R5FA 1XDBA 3QPUA 1E32A 4FUQA 5JH7B 3PTAA 1NYTA 1H3NA 4IILA 3N75A 1H6BA 1NE2A 3UAOA 5KYYB 3NHWA 5FTMA 4PCAA 1P81A 4U7FA 3UJ3X 4D97A 3HVIA 2XD4A 2I3GA 2FF5A 4IMJB 1RAHA 1DC8A 3K09C 2IE8A 1MN6A 2CVZA 2VBGA 3KHKA 3QX8A 1KI1A 1U8XX 2YV4A 3UMCA 3VNRA 5BV2P 1YJCA 5IBQA 4TUYB 4GPD1 4BJHB 1B0ZA 1V48A 4FR0A 1YGPA 3U4DA 3A8TA 4EI7A 2X5JO 1YS2X 3P8ZA 4Y1RA 1G8FA 1TKCA 3M4NA 4RD0A 4WCFC 1KO8A 3ZH2A 3ZZNA 4EM6A 1MDFA 3EHEA 4IF4A 3VDNB 3QV2A 1P4AA 4FCWA 5CAEB 3GJRA 3I4FA 1I0IA 1V2GA 1Y3DE 3OF2A 3TLXA 3X1XA 5JRJA 2UYCA 4KCGA 3UOGA 5CG2A 3FOFC 2GEVA 2W6ZA 1H8EA 4CLOA 2BCGY 1ZMRA 4BGVA 1FIUA 1L7BA 2G9VA 4D9EA 1X15A 1GNRA 5DEIA 2HQBA 2E1RA 4LZWA 1DC5A 1R6DA 3HKEB 2IC5A 3S70A 2FJUA 1IG0A 1JAZA 2FOLA 5FADA 2FE4A 4LEIA 4M0MA 5LU9A 1R9GA 3CR7A 2BBOA 1B15A 4X1OA 1Z15A 4GR9A 4X7BA 1V4VA 1D4OA 2RB5A 3DOFA 4GPIB 2WP8J 1MHPA 4BQSA 1OZ0A 1ML4A 2XF8A 4LS3A 7ABPA 4Q9HA 3R0JA 4OYHA 3EGWA 4ZOLA 3HSKA 3MJSA 4JU8A 4PHHA 5JFGA 3NALA 3THWB 4GSYA 1XEAA 1YZTA 4PRZA 1PN3A 4FR2A 2ZIFA 2C8KA 3Q88A 1A2BA 4ZCTA 2AZDA 3VVBA 2O8FA 2A92A 2BIFA 1J42A 5KNBD 1RBYA 3GGCA 4JGBA 3K73O 5C1PA 2WB2A 2PKEA 3HYLA 2ZRMA 1EVZA 2UZ1A 1C3OB 4HQ6A 1FTGA 1Z6AA 3B5JA 1IVSA 2D1SA 4RETA 1EFUA 5AESA 2QKYA 1H2BA 4EB0A 2Z8ZA 4K6HA 1BE8A 4A5OA 2HJWA 1JEYB 3EDRA 4XLTA 5DX1A 1B6GA 4K2AA 3KOZA 4YCSA 1NL3A 3O0DA 3V8NA 2ZSDA 4X5OA 5I7HA 3D81A 4CTNA 4GBED 5BVHA 5KIAA 1QUEA 2F4VB 3D7LA 1P1FA 4MROA 5F33A 5T6BA 3VYWA 3ZE9A 2ECPA 4C88A 3VPDA 2BFWA 3LL7A 5HM8A 2YNMA 1QO9A 2VXOA 1QAQA 1M2HA 3DOHA 1NXXA 3JTMA 1PIWA 2G76A 2BYTA 4PAMA 2RHCA 1UBEA 4W6QA 4XIIA 1I0LA 1VIVA 1GL9B 4GX5A 4XWKA 1G9SA 3DE3X 5ARDA 4O4HF 2P9QA 2MDTA 1RWNA 3TZ6A 5DULA 4U2KA 5CFRA 1G8JA 3NIDB 4TLLB 1B14A 1NIJA 4WVFA 4IJUA 1N3IA 3DEHA 5JCOA 1GRNA 2HJSA 2PS9A 5DTQA 1CW2B 1Z47A 3H17A 3P9XA 1X87A 1X1EA 5AI0A 5HA5A 4AUNA 5CDTA 2GM4A 3QKSB 4ZAZA 3FRHA 1MW9X 1VMAA 1NV8A 1QG0A 3FNQA 1XJWA 4EHLA 1R9NA 4BFXA 2JGJA 2FUCA 3IHTA 5IVDA 3Q12A 3UZUA 3X1YA 3KETA 5GOZA 1XF9A 1V8DA 2CUNA 2H63A 2OP0A 2GK3A 4KLZA 721PA 1LA2A 1TLTA 2YIMA 2VWPA 3DO8A 1FSZA 2BZ0A 4YAFA 3OQVA 3D1JA 3PCRB 2YWFA 3I2KA 3B1VA 4HP8A 2H54A 2PMEA 1VL1A 2BGUA 2J4FA 4WQMA 4PRLA 2PBLA 2VXCA 4X3OA 1V25A 3AB3A 3NWBA 1T4GA 3C3KA 3COVA 2JKZA 4XCXA 5FPTA 4IX9A 2NU9B 3RC1A 4BBAA 3HVHA 2JAOA 1KVSA 1B26A 2C5LA 2Y67A 1DWOA 1T5BA 1E8DA 3G1TA 4M9QA 1G21E 1E89A 1OLUB 2O57A 1H8HA 5F77A 2NQ2C 3ZE6A 2Q62A 4ND8B 1HLDA 1O08A 1V2HE 4QUHA 4ME6A 1IN5A 1K2VN 5HFNA 4AM8A 4F93B 2QAGA 1LLFA 1EESA 1LGYA 1ZGAA 5CVDA 1O97D 1C2YA 4BYGA 2QTNA 4OXYA 4Q93A 4GXRA 1KYQA 3AR4A 2EKBA 1Y3BE 3KSZO 3HPRA 3F6BX 1XRSB 4N3CA 1GPMA 1G6OA 2PWPA 1SWWA 3FCCA 2ATVA 3FLEA 3NEPX 4AYTA 3RYCB 2E9SA 4I4CA 1TKRA 2FZVA 1YR9A 1ENOA 4MW1A 3F5QA 5K3OA 1O8BA 1PJQA 3W0LB 2G25A 1B0PA 3N8KA 1G20B 5J2UA 5JNRA 2AFHB 4YC7A 1Q95A 1QH0A 2R68A 3KZNA 3PD0A 2G36A 3R3YA 3D3KA 4R1SA 2QYHA 2I3DA 2BTOA 3FKSD 4M98A 2HCBA 4RUKA 5AKHA 4D79A 1KI8A 2DH6A 1KO7A 4FOOA 3NHYA 1V16B 2DWPA 4NCIA 2ZCVA 4Q3DA 2QQ0A 5KDOA 1T0PA 3RT1A 1LI5A 2O0KA 2H5JA 3O47A 3GY0A 4LYEA 4DQDA 1JQKA 5FKJA 5E95A 1CVRA 2FEAA 4PEVA 2GRAA 3RYFB 4ZEMA 3I73A 3GT0A 3GZNA 1U0GA 3PQEA 3ZV7A 1J8DA 3TLYA 3MPUA 4G81A 1WUYA 5DTEA 2VZ0A 4W4TA 3Q2OA 4QG3A 3BHNA 3GLIE 2AK3A 2HYDA 2NO0A 3WYEA 1YQUA 1WP4A 3AW8A 1XYVA 3P20A 1XGKA 5ALDA 1G9TA 5HDQA 1MH1A 2PKWA 3OJFA 3RUIA 4YRSA 1FP6A 5HHTA 1VMEA 4R81A 2VNHA 4C2AA 4CLEA 4R2HA 1U7WA 2AMLA 3I5AA 4HNSA 3RFTA 3W2GA 5E1MA 4GI3A 4EYQA 4ZHQB 5KNCD 1MAUA 3C3XA 4WPGA 4XSVA 4ZVOA 2AC2A 3BHIA 1G8HA 2J6HA 3QBVA 2Z08A 1FRZA 1PW5A 3P27A 2BMFA 3LGSA 2F1JA 3EPPA 3TD9A 2JGNA 4KQXA 3I4LA 2R00C 2I1VB 3EZNA 4PX3A 3ITEA 2ZATA 1ZC3A 2C9OA 4JGGA 2QRPA 3QE2A 4JLNA 3ZV6A 3D59A 4FHGA 4TWBA 1JR2A 1YAJA 1X38A 2ZAGA 5DTMA 3RJZA 2P91A 2WU4A 4RVUA 2IH4A 3L4EA 2AQKA 5DSXA 5FOQA 4L6IA 3DMYA 4EY5A 1Y80A 1XAHA 4FBGA 4HTFB 1U28C 4D3DA 4YAGA 1VL6A 1R0RE 4K3UA 1X2BA 2NXNA 3BJIC 4NBWA 4QUKA 2HRCA 5FB3A 2QSUA 1I4WA 3ZCQA 1JJ7A 1YNSA 3C6MA 3BSFA 3ULKA 4KO1S 3HBLA 3AVTA 3MB8A 1JG2A 1FOEB 1RVDA 1BVRA 1VSTA 1B7GO 2VPXA 1IAQA 4L28A 1H2EA 1UMBB 4RKWA 4ZCLA 3BQNB 1EK0A 4LOHA 2CHVA 1RRGA 1L5QA 4G0YA 3PE3A 4D4LA 5KJFA 5CYPA 3C3EA 4AWXA 1MW8X 1M0SA 5E7MA 3UWDA 5HRCA 2OFWA 2NXJA 5FEMA 3S5UA 1RXVA 2BFBB 1CS0B 4AY6A 1CF9A 4LXQA 3QITA 5CLIA 1KI3A 2AOWA 5FHRA 1BDIA 4YWJA 1QANA 2XE7A 3LHKA 4MKFA 2PRSA 2ZSBA 2HBZA 3KC2A 1QYWA 4M1SA 4NU8X 4Q24A 2IHNA 1GG2A 4X3CA 5AI8A 4XPIA 1T5LA 2WJ4A 2WJHA 4YMLA 3OO1A 3L7MA 4GW3A 2ZRDA 4NDZA 5CHEA 1EWKA 5C35A 2O05A 2D3TA 1VJDA 2BGLA 4ZU6X 2PU5A 3WQHA 4ZQHA 4X6YA 3FUCA 1TO2E 4PCUA 1KOFA 3NC0C 4WZBA 3K53A 2O1XA 5EJ9A 1OF1A 5AKEA 2ZZNA 4OLFA 4QZVA 2BBSA 2UUBB 2EX1A 3G7SA 1WOYA 3WAGA 4DC9A 3UA4A 3IVAA 5ESWA 4JN6B 1FC0A 1WSWA 4M7WA 1ZOIA 1M6NA 4XOIA 1CNFA 1OB2A 1QQTA 4IFTA 2XWPA 4NYIQ 4CQLB 4DVJA 4X7RA 1SZPA 4G8DA 1I36A 4O1HA 4S2UA 1XTVA 3JD3A 3PD7A 4QKQA 3E3OA 4ZU1X 2P6MA 1EXNA 2RG7A 3I72A 4FUTA 5AOAA 3SR0A 2J3JA 3BWVA 2VP2A 4RY9A 3AUFA 3LV8A 3MYRA 2C0QA 4FOSA 2FMXA 4H17A 4CKWA 4KPUA 4AY2A 3VJMA 3U7GA 3UB2A 1JBQA 4O4JF 7ADHA 4DV7B 2A9FA 4HH4A 3GJXC 2K4MA 4UUBA 2PAAA 1B74A 2AOVA 4QOHA 1FTQA 4ARBA 5FV7A 4Z8XA 4HDAA 2ILVA 1BFKA 4M8NE 4ZCSA 1QF9A 5LYJB 4AKHA 2EKQA 4I4IA 4YRNA 4M1OA 5IHPA 1S3FA 3KSDO 4GUAA 5K8TA 2P27A 1NJSA 3ZDBA 2AG5A 4ZVVA 2BI7A 4KV7A 1J1UA 2I7DA 1UFOA 2NYRA 4JEMA 1AQYA 3BD8A 2XMSA 4ZRDA 3TM4A 5HUQA 4OO3A 3T5MA 1IN8A 2CYBA 4JI8B 1CQJA 2QZSA 3I45A 2CNDA 3KT3A 2WY2D 4ZICA 5TRTA 1Z37A 4DWWA 1DLJA 2EG5A 4Y6RA 1ZD4A 2PWAA 4DG8A 5I45A 4Z4GA 3GT7A 4AUMA 3EXG2 1UC5B 1ZH8A 4MUJA 2LWIA 4H59A 5F5LA 3FNEA 1RXYA 2DUJA 3AM5A 1QV9A 1T5SA 1XYGA 1U6IA 3MMZA 3RU7A 1GEEA 3NH6A 3W8EA 2HSGA 3N7UA 4DQKA 2EZ9A 1I33A 2XUOA 4G1EB 3S8EA 3ZGYA 5LZ9A 1A95A 1E3TA 4JUDX 4BO9A 5KQRA 1NM5A 4LECA 3U1VA 1ZJWA 4REQB 3BJZA 2CC2A 3NASA 5ALRA 1JUDA 2QT0A 5KNBA 1C0PA 1UBFA 1CX9B 3GLQA 2F3UA 1O3YA 4U1RA 4NCHA 4A8TA 3GF4A 1V4NA 3KG2A 4X63A 5LLTA 5I7EA 3WLSA 1REQB 3CEJA 4YEDA 3N2NA 1TU3A 3QXSA 4LZAA 4NHEA 2C0PA 3FPHA 4DFDA 4IV0A 4RLHA 3OCVA 3T99A 5AVZA 1F0PA 1D2NA 1KRHA 2DUUA 3IP5A 2NNLD 2Q1YA 4KKVA 4RMGA 3W2IA 4BFVA 1UR5A 3KHTA 1PD0A 5FR2A 1PYDA 3OOYA 2QROA 3R75A 3V8VA 1C9JA 4G8JA 4EVQA 5KNLA 2XRZA 3R5KA 1IJKA 2NSHA 2BGNA 3DL0A 3DM9B 1O03A 3FHJA 2J1LA 1F2UB 4QYMA 3T7TA 1ZVKA 3DKRA 1ORWA 2X4DA 4H7EA 3TAXA 2FUKA 2WHPA 1UH5A 4EPTA 1CRQA 1AKRA 2IQ5A 3JATA 4JB0A 3AF5A 5BNTA 1EB8A 3RYHB 2H8GA 3AGQA 4KWHA 2GESA 2R751 4L8GA 3DFZA 4E09A 1JHOA 1UBMS 3QF4B 1CJBA 1T2VA 1O6FA 1G291 1CY4A 1X1TA 1QGOA 3N0VA 2E1PA 5G02A 4PLPA 1PUXA 2K7FA 2B3TA 3QWAA 4UTVA 3D3JA 3X3HA 3HCFA 1XG5A 3UN1A 3EIXA 1V11B 5E9QA 5CXUA 1KBQA 2AN9A 2JGDB 2WV9A 1VPVA 1ZL2A 4RIFA 5EXDA 3ZTYA 1ZHFA 4O5OA 4JI5B 1Q2UA 3AJDA 2GILA 1DCMA 3D2BA 4NSNA 4E1BA 1L7DA 1TMYA 1D07A 1IM2A 1F2TB 2WQZA 3DB1A 2B99A 2C5FA 5JI2E 4YCLA 1JG3A 1N2SA 3LFHA 5DH9A 4MQFB 1PQYA 4PBRA 3N05A 3MEQA 5DFAA 4ZXFA 1V26A 4Y2UA 4ALNA 2R8ZA 3DEIA 2CXHA 3BD9A 2KBEA 1KQGA 2XX3A 1L7XA 3PQ6A 5KDDA 1KY3A 1EHYA 2YV2A 4TROA 5HFJA 4NYIR 2IYXA 1SIUA 2VUSA 4KZPA 5EXTA 4EO7A 2VAVA 5L3SA 2HOQA 1OLXA 4OYRA 2H1HA 1S2GA 1QM5A 3MS2A 3P45A 4JHXA 3T3NA 3NBZC 4MWSA 4TTAA 4XQ0A 1AKUA 3QE9Y 2I3BA 4F9EA 2ZSHA 3AL2A 5KC9A 4DR2B 4INAA 4F9TA 2A9PA 2JGMA 5TT1A 1C0IA 1J0XO 2EERA 1DC7A 2WF7A 4GPTA 3RTCA 3V8RA 1Z2OX 2Q50A 2X4IA 5BW5A 1GFIA 4FT2A 4M9SA 5EP1A 3F2IA 2V54A 1E5LA 3NHAA 1PO7A 2I6FA 3NWEA 1UT5A 2WE7A 2YWRA 8ABPA 1DKLA 5ITZA 1ZVVA 3ELWA 4A0QA 4URXR 4EARA 5C5EA 1UC8A 1ZK3A 4D7AA 1SVOA 4XKJA 1V5FA 5ALUA 1LRJA 1ISMA 2ZP1A 4NXMB 2NNWB 4I50B 2JIPA 4WN9A 1XWFA 2R5WA 4E3ZA 1MB3A 3PEFA 3ANSA 1O6CA 3FKSA 3O4IA 4KN8A 2CXTA 4BV2A 2BKEA 4CLDA 1L9XA 1HGXA 5REQB 3TPZA 1FDOA 4O29A 3WHIA 5EHXA 3AXSA 3TZKA 5AQ1A 5EPUA 3ODPA 3HJCA 4MWEA 1FTNA 5DHQA 3TNDA 4P3NA 4Y6LA 3R74A 1QJCA 4WN3A 5T64A 4HH3C 5IDQA 4TXLA 1GCGA 1F2VA 2HHCA 2JCVA 4KIJA 1R8YA 1NWHA 3O91A 1OYYA 3G2NA 5CM2Z 3LWNA 5K4AA 1HNWB 4JLUA 1H42A 1FJHA 4C87A 1N1EA 3R5SA 1LBHA 5AFSA 3IQGX 3G17A 3EARA 3FW1A 3F1LA 4TKVB 1QWOA 4S05A 2N3ZA 2XCQA 5EP4A 1NG1A 3HP4A 3MWFA 4W7HA 3RS3A 2WFZA 5CP8A 5DNDA 4A15A 1A9ZA 2YFQA 5B57C 3RS0A 3V3KA 1RU3A 1RXIA 1R00A 1R0XA 4LISA 1NFRA 1FNSA 2JS7A 2CJWB 2JK0A 4GDMA 2XE4A 2J32A 3DZDA 5LQAA 5K2OA 1DG9A 3WLEA 5LD2B 3ZHXA 2GM5A 2E49A 1MDBA 3X2FA 1I7QB 3WIEA 5B55A 4JHLA 2ZSAA 3EQ9A 3W5SA 5DXAA 1DAMA 3H2GA 1JLLB 5A2GA 1ESZA 2IY9A 3F5FA 1A76A 3DE6X 1MOPA 2QD3A 5IZCA 3NG1A 4X20A 5IJAA 3TB6A 3TLCA 2F4NA 4UM7A 1U0JA 2ZAIA 2X2FA 1KO1A 1C7QA 3VPSA 4QUEA 1G59A 3ZZTA 3BL6A 5FBZA 4G84A 4YUYA 1YZUA 2FF7A 1O89A 4F1JA 1F1JA 3ZIAD 3HDTA 1X0VA 3DQZA 1PS9A 2Z5LA 3PC6A 4QJ3A 5LQCA 2V9ZA 3ILVA 3UC9A 4KLAA 3EDMA 3FNGA 4FNOA 1BYUA 3K6SA 2J46A 1FTYA 1XZIA 3ZHVA 1MOSA 3AY0A 4EHFA 2LR0A 3G1WA 3V7NA 3HBFA 4QDXA 1WKBA 3SF0A 1ZEMA 1XEWY 1GZ3A 1UQUA 4I6GA 5AW2A 1GZUA 3HJBA 3O4VA 4EKDA 1EZ1A 3H2HA 2J5RA 3O3NB 4GKKB 3ER6A 1XOIA 5GJBA 4HB4A 2G40A 4PAQA 2GHRA 3G2LA 5LNK1 2RCYA 2HTEA 1G1MA 4KXMA 1U8AA 1U2TA 2R7KA 3A3OA 1G4UR 3N3BC 3R3HA 3SYTA 5LSAA 1O96A 1J99A 1QHGA 3A06A 1FS5A 2NLOA 3DZBA 3JYHA 4Z4CA 5ERYA 4P1ZA 2OCAA 2R6JA 1DIHA 2OO7A 2CY0A 1XWIA 4L8YA 4LGMA 4PXYA 3S4YA 3ZN2A 5JAPA 1A9TA 4E5MA 4DBVO 2GLUA 5H83A 3EXHB 3PFCA 4L8FA 5L4NA 1LEHA 3R7NA 1JHDA 1BH2A 2QT1A 3PHJA 4MVJD 1CBUA 3HB7A 1TCAA 3TE7A 2CXQA 4JLKA 3E4DA 3TTUA 4YFVA 3IE1A 3D0QA 3VKVA 4I1VA 3H9GA 4FNGA 3ZJ5A 2P68A 4ADSG 4C0XA 2ZJOA 4LC1A 4GGPA 1EK1A 4F0JA 3F4LA 1Z8NA 2J6IA 2R8OA 2WVGA 5H1YA 1KI6A 1AKMA 1MJGA 1UBRS 4IJVA 2NX2A 5CX1B 5KYGA 4D99A 1NQUA 2B1IA 4G26A 3KOYA 4BNZA 2BFAA 3WHLA 1FFDA 1WEHA 5HPYB 1W96A 1SN7A 3ROTA 4GVXA 1F8XA 3BE8A 1H69A 1SVWA 421PA 1E6KA 3UGJA 3TZCA 2XGSA 4CLRA 3G89A 2IZ0A 4N9QA 4MR7A 4URWR 5JATA 1SBHA 1ESEA 2QRNA 4PBTA 2QORA 3S2UA 3SX4A 4BFCA 4DA9A 2ZM5A 4B43A 3EIFA 1PJAA 3HEAA 1XPRA 1HKHA 3VA7A 1WF3A 2HUNA 1C7JA 2OZLA 3CW8X 4ZFNA 2QD2A 4WBNA 1O4WA 3IO5A 2QTAA 3HKDB 2Z0MA 4Q9NA 4MQUA 3CZAA 4CEIB 3DWFA 4ZVQA 2M1ZA 3OOWA 3SZRA 4EP1A 4PM4A 1H0KA 3NM4A 4INZA 2VDWA 4JJFA 1UFRA 1Z7GA 3I3SR 1G8AA 1X7ZA 3KB6A 5BR7A 1AXGA 4XW2A 4L2IA 4IYRA 5TQ2A 4OFBA 4GYYA 2B8NA 4ID9A 4KNYA 1RBQA 4J29A 5DI3B 4URVR 4OLAA 3KKMA 3L6CA 3QSYA 1XTQA 3A6EA 2FKAA 1XXLA 3GBSA 4IJ6A 5IASA 4DIKA 5DM0A 3STVA 2NTVA 2HIHA 2V6BA 3L5KA 4DV4B 4LWQA 4MDYA 3SHVA 3OECA 3DPSA 3QVOA 3ROZA 3Q98A 5FO0A 1J2UA 4JI4B 2MWMA 2VOJA 1YA8A 4BGIA 3CJQA 2IBSA 1UPFA 1V1JA 2Y66A 2W4IA 3EGCA 2DX7A 2QLJA 3BORA 3MQFA 4GWGA 3WRYC 2J48A 4RDIA 4YJHB 4C0QC 4AJHA 2XRYA 1FW6A 4PG8A 4ZMSA 1JIXA 5BN1A 2JLZA 3HHEA 3OLCX 5PGMA 4ZA2A 3HO8A 2Q4EA 4RTSA 1U2SA 2IP4A 4MV3A 5D1HA 2I2WA 4CMAA 4R6WA 2WWHA 1T1IA 3BDVA 1FFGA 1GD1O 3C45A 2P4QA 3UMMA 3QEMA 3ENVA 4LHYA 4X54A 1R16A 4B7ZA 2G9QA 4JQYA 2PJDA 2CMHA 1ZR2A 4HFNA 4ND3A 1E9CA 1P7WA 3A32A 1YIOA 2QUZA 3OIUA 5F9MA 4BWFB 3VUEA 4HT3B 1ZUWA 4LXHA 4E51A 5LL6P 3DZCA 1U9IA 3BE4A 2HHHB 2WINI 1W49A 3BERA 4ZEOA 1ABBA 2ZFUA 3HV0A 4UU8A 5HK9A 4ZDIA 5DMXA 2JBHA 1U02A 2B98A 2MTBA 2P9EA 2Z2IA 2ZRBA 1UMKA 1JT2A 3AUAA 1QS0A 2KQUA 3JQ7A 5F52A 2NMVA 4O2LA 1EDZA 4YO8A 2W6ID 2ZIZA 3LLCA 1CCWA 3HEBA 3K09A 1DLIA 1HQCA 4BO2A 4V1CB 3ZBTA 4MCIA 1EJ0A 1NXPA 2O3QA 2I4OA 2Q3FA 3OESA 4FEEA 4L5JA 4PC3A 4R8RA 2OBFA 4O3MA 4UATA 1ZSNA 3MTQA 3PK0A 4G4JA 1MNAA 4KWCA 1CUYA 3RSQA 2O54A 4WCFA 2F9LA 5H3LA 2GB4A 5H70A 1YFJA 4GMXA 5ED4A 3PFWO 4CTKA 1YH3A 4QGSA 5JJLA 5EZSA 3OF5A 2C0CA 1IEQA 3EUEA 3A4LA 3TIGA 3IT1A 4BGEA 5LD2C 5ICCA 3IUPA 4PZLA 2QQFA 1TYBE 2XE6A 3UEOA