2HK9A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and nadp+ at 2.2 angstrom resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
molecule keywords Shikimate dehydrogenase
molecule tags Oxidoreductase
source organism Aquifex aeolicus
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk9A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk9A01
2YQ4A 3S55A 1WAMA 4J7XA 1JVBA 4XRGA 2VHXA 2YYYA 4RVHA 1HDRA 2CVZA 2ILTA 2Q50A 4O5OA 4B7XA 4PRKA 1N9GA 3ONFA 3KYCA 2PKQP 4WASA 5CG1A 5THQA 3VH3A 1R12A 4A7PA 5EQFA 2CSUA 2WDZA 3L6OO 4BNZA 3Q9NA 5L95A 1O9BA 4YJFB 2PWZA 3K2BA 5L7WA 1GYRA 2FOIA 2G1UA 1HYGA 4FFOA 1SAYA 3RC2A 2O7SA 2YY7A 2C29D 2YFQA 2AQHA 3BA1A 1UDCA 1V0JA 5IXYA 4NQZA 4DMMA 2GZ2A 1DAOA 5DT9A 1NVMB 3D3WA 4DPMA 1B7GO 4G65A 3EHEA 4D43A 4R01A 1U5AA 1U2DA 5A3VA 5ILOA 5CDYA 1UZLA 4IBOA 2EF1A 2HK8A 2DFDA 4LRSB 3GT0A 1HDGO 4AFNA 3T7EA 4L74A 4IDBA 3FD8A 2JD1A 4YQZA 3C7AA 1GU7A 3NUGA 1UZMA 2WE8A 4IMRA 4Z9YA 3I6IA 3I5MA 1B8PA 1UXGA 4PLCA 1CDOA 3EVNA 2WJPA 5LDHA 3B1JA 1ZO8A 4NJMB 3G1TA 1XELA 5HA5A 4JBIA 1A72A 2DU8A 3CZMA 5A06A 4BO4A 1N1EA 2PD4A 3VPGA 1AN9A 4KDFA 1C0PA 4DWVA 1R0KA 4M49A 5L9AA 5I7EA 1LC3A 3L0DA 2EGGA 4U6QA 3GFGA 3BMQA 1H9BA 2VTEA 1QR6A 2DFVA 2HDHA 2Q1WA 2FY8A 1WMAA 2BKAA 3GGOA 5C5IA 1WW8A 3WS7A 1JU9A 3BAZA 3WWZA 3A14A 5CPFA 1WXDA 3VPHA 5CHEA 3ZNPA 5TGDA 5IDWA 5AXAA 1X1EA 4Q3NA 2Q2WA 5G0WA 3VKUA 2FN7A 1U7HA 2JD2A 5G0TA 4BNXA 2XPCA 3FPLA 1N5DA 3FNFA 5DDIP 2I3GA 2ET6A 4CQLB 3M1LA 4HBGA 3DZJA 3NGXA 1F8FA 1PQWA 2D1YA 3K73O 3E6AA 2NWQA 5IZ4A 1KS9A 1LU9A 3C1OA 2HQ1A 4MVJG 4JJIA 4BOYA 2J5RA 4YCAA 1PJTA 2B4QA 1X15A 3F9IA 1AHHA 1A71A 4AJNA 4DC1A 4XR4A 1ULSA 1DIAA 4R3NA 4CM5A 4DMLA 4B3JA 4D42A 3TOZA 1E3WB 1A9ZA 3HDJA 4R54A 1A4UA 3EK2A 4P8RA 1LC0A 4OKNA 3JYOA 1O0SA 2ZQZA 3HSKA 4A73A 4B8WA 4YR9A 1JKJA 1EDOA 1K6IA 2CY0A 4A03A 1X7HA 1HXHA 5F21A 4DQXA 4CM4B 4RF3A 4FR5A 4UVGA 2O4UX 2FZWA 1NVGA 3Q1LA 3GC6A 2PR2A 5EIOA 2YHIA 1R66A 1HRDA 5C7LO 1OAAA 3DAGA 2C7GA 1Z74A 5T67A 4JBGA 4RPHA 4B3IA 3JQEA 2X1HA 4UUOA 4CL3A 3PDJA 4XEHA 2NVUA 4WLFA 1DFGA 2JAPA 5A5EA 1PU2A 3PIDA 3VZQA 1SO8A 4BGUA 4FDAA 5G4KB 1YQDA 2PNFA 1ONPA 4DYVA 4OAQA 5JLAA 3KEOA 3WGIA 1ISFA 1U7TA 1GQ2A 4O59O 3SLKA 2NSDA 3JD3A 4BKQA 1RKXA 1PR3A 4DL9A 2J3IA 4LCJA 2Y05A 3GZNA 4MIYA 1VM6A 2YV2A 4IXWA 4ND3A 1PZHA 1GZ3A 1T2FA 1DIBA 1U3VA 4OKIA 1BMDA 3FTNA 3GGGA 4BO0A 3F1LA 4FFRA 5G0UA 3FBGA 3UN1A 1P74A 4I8XA 3JQAD 5HM8A 2PD6A 2P91A 1BXGB 4MVJP 1JKIA 1VL0A 1F8GA 1I24A 4TZKA 1B8VA 3VDRA 4XJSA 4L0QA 5I7VA 3KB6A 5TC4A 4BNWA 2ZTVA 5MGBA 4OSPA 1VRWA 4J0FA 1PGQA 2EG9A 4LRTB 5L51A 4UEJA 4Z0TA 3FNHA 3AUAA 1E3JA 3GQVA 3GRPA 4XGNA 3CE6A 4YTEA 1BXZA 2IEDA 1IUKA 1VKOA 3KYBA 5FYDA 2O48X 4R1NA 5JCJA 3QWHA 3PHIA 1HYEA 3JD4A 4PLWA 3ZU5A 1E1KA 4IDDA 3ZZNA 1GPDG 4IS3A 1YBAA 1XCBA 1UZNA 2FP4A 3TFQA 4YT8A 1PS9A 3MWEB 3D1LA 4YT2A 3GA0A 1PR9A 1PIWA 1E7QA 4QTZA 3UICA 2P4HX 1MFZA 3WSWA 1DC5A 1EVYA 1Q7GA 3U4HA 2UDPA 2E82A 2OHXA 5A05A 5JCXA 2IEBA 1PJSA 4HWKA 4CR8A 2YW9A 1ZSNA 2VTDA 2X5OA 4CL8A 3RC7A 5A9SA 4CM9D 3WIDA 1PS0A 2RCYA 1I8TA 2PH5A 5TX7A 4NH4A 3V2HA 1EE2A 1QKIA 2CF6A 4L4RA 4ALIA 1OZAA 3K9QO 3EVTA 3AJRA 3PHGA 4WLNA 5IJZA 1DHRA 1QV6A 1U4SA 3BXXA 1W0CA 5FWNA 1K5HA 2Y1DA 3GLQA 4TVOA 4JN6B 2V7PA 1WDMA 4DA9A 1UP7A 2VQ3A 4B4WA 4CMIA 1PJBA 1T24A 3JQFA 1LNQA 1IE3A 4ZJUA 4IZIA 4BNKA 3NJ4A 4CPDA 2HMUA 1P3DA 3EYWA 3WLEA 2V6MA 3LC1O 4FGWA 1NAHA 4ZQHA 3UCEA 1Q0LA 1SB8A 3H7AA 3V1YA 4KDEA 3X2EA 2BGLA 1EBFA 1Q7BA 1SEVA 5KJFA 5DULA 4CUZA 1EE9A 4JXKA 1E1MA 4B7CA 1ZK1A 4E4YA 4E5YA 1X0VA 3PWZA 2HJSA 2BGMA 1G0OA 1F17A 3DZKA 3FNEA 3GVCA 4TMFA 4CMCA 4BMSA 1ISMA 2VZ9A 1R16A 1SBYA 1YJ8A 4YACA 3RKRA 2A9FA 2Q4EA 1N92A 4WCFA 4PLHA 1HDXA 2YV3A 4GAEA 4OOEA 3BMOB 4BNGA 2VWQA 4RVDA 4RO0A 4TZTA 3TQHA 3L07A 1AXEA 4ZVVA 2HO5A 3FNGA 2AG5A 1PL7A 4PVCA 3WGHA 3EY4A 3DTYA 3IAHA 4NFSA 4EDFA 2X0NA 3JQ9C 1QLJA 4CLOA 1KVTA 3ANLA 5L7YA 1VE9A 1PEDA 4UULA 4PZEA 4IJVA 4I9UA 4E33A 2AQIA 1I10A 2OO5A 4BHTA 4IS2A 1GAEO 3DO5A 1DLJA 3GG9A 3T4XA 4C4OA 5CEFA 3PFWO 1BSVA 1AE1A 4C7JA 4PG4A 1HE5A 1LI4A 1TI7A 1I2CA 4J9UE 5KJ1A 2QHXA 1FF9A 1NWHA 4JBHA 4LISA 5ILGA 3HB4X 3ZW9A 4BO3A 5JE8A 4HFRA 2ZJ0A 3E9QA 4GQAA 4CMJA 3JQDA 2NADA 4M54A 2CD9A 2IDZA 2J3HA 3DHEA 4L4SA 4U6SA 1IZ0A 4FJ0A 4JIGA 1GR0A 3DL2A 5AYVA 5H81A 4CMHA 2UUOA 4OL9A 1I0ZA 2A4KA 3QW2A 3VVBA 3WFIA 5EPOA 2ZYAA 4JROA 4XDYA 1JKFA 2HAEA 1XKQA 3DHNA 4WNIA 2DUWA 2GRAA 2Q1SA 1E77A 2XOXA 3G17A 5JXWA 4J9VA 3W4IA 4EEXA 5CDTA 3UW3A 1UAGA 1KVQA 3WG9A 1D3AA 1E6WA 1FDTA 3RROA 1T25A 3PQEA 1M6WA 4GVLA 4OMUA 5TNXA 2JL1A 4DLAA 3JQAB 3NDRA 1ZSYA 4FFMA 4R9RA 5JDIA 2HK9A 4YVFA 3AM4A 3S1LA 4EJ6A 1I01A 3U4CA 3HFGA 2UUPA 3FCOA 1X13A 4HX5A 4R3WA 1ISGA 1HZJA 2X5JO 4KZPA 4UAGA 3WJ7A 4UUMA 4ESOA 3RUFA 3CPSA 4CLRB 3C8MA 2R00A 4DBZA 3A28A 2P2SA 4J1QA 2Y99A 3S2EA 3HN2A 3IKTA 3TOXA 3D5QA 4B4VA 3AU9A 2D59A 4BVAA 3VH2A 4DPLA 2Y68A 3IDSA 1XG5A 2NTJA 3L4BC 1LRJA 3PGXA 2UAGA 3QE3A 1YH3A 4EJMA 6LDHA 4CV0A 2DVMA 2H6EA 2DBRA 3U09A 3LT4A 3RUEA 3ZWPA 1Z75A 4OXYA 4NBRA 4QXMA 4RVUA 4HFMA 3PHHA 3NRCA 1VJ0A 2EIHA 1JAYA 4F6LA 4WGGA 4CM8A 1JDJA 3E8XA 2O3RA 1X1TA 1PJ2A 2R2GA 3RFXA 1Y81A 5C7OO 1BW9B 5G2OA 5IDYA 4E5PA 3UCXA 3RU9A 3RCBA 3S2GA 1UDAA 3HQ4O 4E5NA 4L8VA 3O26A 1M76A 3GMSA 2LDXA 2W2KB 4WOJA 3JQ7A 1LSUA 4D3DA 4IQ8A 3DFZA 4XQGA 3D64A 3HDYA 3ROKA 1ZCJA 2I76A 3WYEA 2AEFA 4E32A 1PL6A 4P22A 3DDNA 3RUCA 4EEZA 3S2IA 3VZRA 3RC9A 1TT7A 3WSVA 2B4RO 4J16A 4MP6A 4AJLA 4PLGA 5L4LA 3PJGA 3KLMX 3PJEA 1OOEA 1ZSVA 4CUJA 1NPTO 1QSGA 1WVGA 3IKVA 3RBZA 1HLDA 3E5RA 3AUTA 4AJKA 3HWRA 3OICA 2D5CA 4L73A 4LSMA 1WDKA 2VZ8A 4PLYA 3UCFA 1O94A 3GNSA 3ZV3A 4BB5A 4OM8A 1IL0A 3H65A 5L40A 5L7TA 1MFPA 2B69A 4CQMA 1T2DA 2B0JA 2VYVD 3LLVA 4GX2A 4NBWA 5FI3A 1YOVB 2IZ0A 2HMTA 4FSHA 4YJGA 3O8QB 3VH4A 4ALLA 2BI8A 2GD1O 3KHUA 5B12A 2HJRA 1KOLA 1MUUA 1QXSA 4PG7A 2X9GA 4BV9A 1JQBA 1TXGA 2I99A 3MJVA 2G82A 3NT4A 3DBHB 2X8LA 3RBVA 3OECA 2VHZA 1DFHA 4PN3A 3RAJA 2GN4A 5DBFA 4YAEA 1E1LA 5GZ6A 5ENVA 4WEQA 3BMNB 3SJUA 4AJJA 1TT5A 3LT0A 2GLXA 3FR8A 3OA2A 4RVFA 3PFFA 3ZH2A 1HDYA 2Y67A 4ZU3A 3KTDA 4Q3EA 1O5IA 4QEDA 1V8BA 5F1OA 3RBXA 1DOHA 3C85A 4DGSA 4R5HA 4RPGA 3DB2A 2DTEA 3DAFA 4J4HA 3KLPX 1Y5RA 1UUFA 1DC4A 3KO8A 4HFNA 1I3NA 3ITKA 5TT1A 2X5KO 4J4BA 1XQ1A 4JNKA 3ONDA 4EGFA 1QMGA 1ZVMA 3INTA 1PJQA 4YJFA 2J5QA 4YPOA 2O50A 3AY7A 4BNVA 2Y93A 2GPTA 3IP1A 1NXQA 4FOSA 1EVZA 4W82A 3VPSA 2NU8A 3SBOA 2A92A 3GOHA 4J2OA 1H5QA 1ZZEA 1GL3A 3ONEA 2P4QA 1R0LA 5A4DA 2C2YA 3P7MA 3L6EA 4ZQBA 1K0UA 4FFLA 3G1UA 4W4TA 3IOYA 4D41A 1JWBB 5CDUA 5ICSA 3HB5X 2HSDA 1IHXA 1XQ6A 2W2LA 1ULUA 4DUPA 4J6FA 2XXJA 4NU6A 1LX6A 2F1KA 2Q46A 3NX4A 4EBFA 2YQ5A 3HJAA 3KETA 2ZYDA 4BNTA 1BTOA 1JLLA 2C54A 1ISIA 1MB4A 1MV8A 4UVEA 3ROQA 3MJ4A 5JYDA 5CDSA 4GLLA 1LA2A 1J0XO 5KJCA 3K8ZA 3DBLB 3PK0A 1WZEA 4D3FA 3WBFA 4L9RA 5T8KC 4QQRA 3Q9UA 3A1NA 1Z82A 4NBTA 3EAGA 4NJMA 3I6QA 2Q99A 3VAZA 2J6IA 4ALMA 4N54A 1MLDA 2O4CA 4OOFA 1PS8A 5KWEA 2ZB8A 2X4GA 5CDGA 4TSKA 3WTBA 1U3TA 4FOOA 3WYBA 1XYGA 3O9ZA 3OBBA 3PRJA 5KIAA 4FBGA 4NK5A 3Q11A 4Z3KA 1PWXA 3GHYA 4E3ZA 2DAPA 4NJOA 3WGQA 1NQAO 2FHSA 1GUFA 3CMMA 3I9MA 4GVXA 3NT5A 3C1TA 4NK4A 4AJ2A 1T1RA 5CEJA 1Q7CA 4K1LA 5LCXA 1PGOA 1E0DA 4W9NC 5F1PA 3N74A 3HFSA 1N2SA 1EEHA 4EUEA 4CQLA 3GPIA 2DUUA 3L77A 2QX7A 3RQSA 1JAXA 5BSEA 3WNQA 1NFRA 2H1SA 3RUHA 3AOGA 2VRCA 3OMLA 5I8WA 2D5AA 4J4TA 2HKIA 4JLWA 4XWYA 2AQ8A 1D4FA 4TQGA 4MP3A 4FS3A 1PJ4A 3AI2A 3GMDA 4MVJF 3QLJA 1KEUA 1V3UA 4BV8A 4U0KA 1DSSG 3DXFA 1E5QA 2B83A 5F3RA 2EJVA 4O0LA 4R69A 3CUKA 3W4KA 3LC7O 3M2TA 3RJ9A 3RJ5A 3CTMA 1E3WA 2VNSA 2Z5LA 4W99A 3TRIA 1HTBA 2WMDA 1SZJG 4LN1A 3U4IA 4Y6PA 3NJ8A 4GL4A 1XGKA 4Z9XA 4J1SA 4CM4A 1BHSA 3P5SA 3ZWCA 2EJWA 3KEQA 2A94A 3GDFA 4CMEC 1PGNA 4PLZA 4YRBA 2OOSA 3TNLA 3ZHXA 1E3LA 1UH5A 2VZ0A 5AXDA 4AJ4A 5KCZA 3RASA 1ZXLA 4XX0A 4BKPA 3S2FA 2PY6A 3MTJA 1P1KA 2BFPA 5JC1A 5IN5A 5I7FA 4QFCA 3ULKA 3K31A 2CF5A 1U1IA 5I9LA 2DTXA 3H3FA 1E1NA 2G5CA 4HP8A 3ZWMA 2XF8A 4AJIA 5G4KA 3DR3A 4IMPA 5T64A 3MZ0A 3ZNQA 2GR9A 3ETGA 5KKCA 4DQVA 3GAFA 4RQTA 2CDBA 3JSAA 1ZFNA 2GF2A 1LSJA 3ZWWA 5IZCA 4CLXA 3MOGA 3GY0A 4RLSA 3MJEA 4R1UA 1RJWA 5ADHA 3PYMA 3Q2KA 6ADHA 3RWBA 1M66A 2XAAA 4ZICA 1YJQA 4PFJA 2FWMX 4NHEA 1BXGA 3LYLA 4PLTA 3TZCA 2CZCA 1B15A 3BTUA 1GYQA 3VKVA 3ZWXA 4BO7A 4EZBA 2JKVA 5AOVA 3VH1A 4MOWA 1H6BA 4X54A 5JYEA 5KVCA 5BSGA 4NZ9A 4BNJA 4FGSA 3PP8A 1QYDA 3GG2A 2VWPA 2ZQYA 1GUZA 4EW6A 3GDOA 2ZJ1A 1K89A 3OIDA 4RF5A 5HS4A 3F3SA 4RL6A 1HWYA 4QUKA 4ALNA 3DBRB 2C0CA 9LDTA 3DHYA 2GCGA 1H9AA 1WP4A 1GV1A 1NFFA 1LBEA 1YGYA 4M1QA 3JQGB 4XZ3A 3RU7A 5JCJD 2H63A 1IPEA 1EBUA 1H6DA 3NDIA 3OIFA 4R51A 3UF0A 5JO9A 1PZEA 2JFFA 2HUNA 2O3QA 3WWYA 2ZK7A 4I1IA 4WJZA 3FSRA 5COBA 3GAZA 1VPDA 4IDAA 1GD1O 1KEVA 4Q3AA 1NQ5A 3E9MA 1VC2A 1NQTA 3ASUA 1VKNA 1VLLA 1W6UA 1PJLA 1ZEJA 1Z45A 1C0KA 4PIVA 4Y9DA 1E92A 3ROPA 4WPGA 2Q45A 3RFTA 2YJZA 4AICA 5C3MA 4B4OA 4D7AA 4WLOA 3DZBA 4XR9A 1E3EA 5JPIA 3PWKA 2G17A 3DZHA 1RWBA 3NYWA 2ZIZA 2ZATA 1GUYA 2YHUA 3P19A 1V3TA 1E7WA 2CVQA 3ADPA 1QYWA 4CLDA 1YL7A 2PFGA 4CMKA 3KOUA 1PZGA 1ONOA 4U0JA 1A4IA 4RPKA 1WNTA 4DRYA 3PZRA 2Q2QA 4HY3A 1PSDA 1PGJA 5FF9A 5ITVA 1DPGA 3D3EA 4J1TA 4RDIA 2O2YA 1GADO 1OI7A 3L9XA 1DFIA 3I1JA 3PYLA 4CR7A 3DTTA 4WECA 1NR1A 3WBBA 5F5NA 1DLIA 1MP0A 1K2WA 4BB6A 5FEUA 4BQPA 1LDEA 3E5MA 2NQ8A 3ICCA 4DIBA 2OBNA 1UXJA 3F5SA 4GGOA 3WYCA 4EITA 3GN1A 5CG2A 3S8MA 1PJ3A 1HSOA 3W6UA 2HRZA 2OMEA 8ADHA 2BFAA 5K6AA 1KEWA 1U9JA 3BMOA 3KBOA 3AOEA 5T6BA 3T7CA 3QWBA 4IM7A 4XDZA 2HK7A 4Z9FA 3DZGA 1FDWA 1HF3A 1W8DA 4M8SA 3JD0A 1FMCA 1IYZA 5J23A 2WYVA 1DRUA 2B5WA 1JW9B 4OJNA 3I4FA 3OF2A 4R4JA 1QORA 1IOLA 3AM3A 4J91A 4WNCA 4BKUA 3B70A 3U62A 5JC8A 3BHIA 3JYPA 3KYDB 1MA0A 4GMFA 4MVJI 5T8KA 3K2EA 3UAGA 1TVEA 3F4LA 2X58A 1Y8RB 2VOEA 3PI7A 5BSFA 4NFYA 4S3MA 3RUDA 4AJOA 2NV6A 5COQA 4I5EA 2PA3A 3FPCA 1JN0A 1V3VA 1ZK0A 3LLSA 4FN4A 4I5FA 1AGNA 2DBQA 2IE0A 4BIIA 2FR8A 4OXKA 1ARZA 3JD1A 1NX6A 1H6AA 2AHRA 2BD0A 2AEJA 4JX8A 5JO0A 3W8DA 4LVCA 2AMFA 4D3SA 4ALKA 5B4UA 4IDCA 4BO6A 3UGKA 3B20A 1H94A 2JHFA 1D1TA 4CM3A 4J43A 1LUAA 2WEKA 1T4DA 4HUJA 2WYWA 5KJEA 1UXHA 5L3ZA 4RZIA 5AQ1A 4W9NA 1P1FA 2A35A 3BZUA 3UVEA 1LDMA 3VPFA 4ND5A 4GX1A 5U9CA 4CM7A 3NTQA 4FQ8A 4H7PA 2I6TA 4Q9NA 2W8ZA 4ID9A 3VHRA 4AJ1A 3JYLA 3E48A 2OUIA 1O95A 5DN9A 2HLPA 5JSFA 4KWHA 1V6AA 1LXCA 4O6VA 4O63O 2DKNA 1R4NB 3JQAA 3ABIA 2QRJA 4KUHA 1B26A 4TVBA 5F1KA 1YL6A 2NM0A 4NFHA 4Z3DA 4OO3A 1R6DA 1OMOA 4WLEA 1C0LA 1LLCA 4BO8A 1HEUA 2PD3A 2VWGA 4XJTA 3SEFA 4K26A 9LDBA 4CLRA 3DQPA 5AVOA 2C59A 4BNFA 3WTCA 1B3BA 1ISHA 3PLRA 4MVJM 2VYND 4INAA 4GI2A 3OQBA 1AUPA 1CETA 2NLOA 1GEEA 3FR7A 3KSZO 3OJ0A 5EL0A 5GZ1A 1ZJYA 4DQUA 3H9JA 3ITDA 2RH4A 3EUWA 2E6UX 3HZZA 2JCXA 4XYMA 1GZ4A 5A04A 4YA6A 4XYBA 2GN6A 5KNLA 2V6FA 3OIGA 4GX5A 4IDGA 1P1RA 3DOOA 3QVOA 4HADA 3ETEA 1ADBA 2EP5A 3IQDB 3N58A 3QWAA 4BMVA 4RZHA 1B8UA 4BO9A 1A9YA 1JVSA 3LT2A 2C20A 1BW9A 3IL2A 4J7CA 1GPJA 4N5MA 3PYXA 2VUSA 3CSDA 4TKLA 3H9EO 3WGZA 5EJ2A 1P33A 3JCZA 4CM9A 1DEHA 4RF2A 1DJNA 1FDSA 4GWKA 4YWJA 4BL5A 4A5OA 3T4EA 2OORA 1YWGO 1CF2O 2W2KA 3WNVA 4W7IA 3TZ6A 5TSDA 1EVIA 1EMDA 3TZKA 2EKPA 1NASA 2CDAA 3I83A 4Y6SA 4N7RA 3I9OA 1HLPA 3F4BA 4FIZA 1T2CA 1D1SA 2O3JA 4YB8A 4XA8A 3UKOA 1I3MA 3NTOA 4EUFA 2PZMA 1EQUA 4ZHSA 5FFFA 4GGPA 4S1VA 1I2BA 3OJFA 1YXMA 2RAFA 3ZWNA 2YUTA 2X7HA 1NP3A 4Z0PA 3ZWOA 4F3YA 5IAAA 1PTJA 1SMKA 4MPDA 3H5RA 3DMTC 3FRJA 2DLDA 1WLYA 1HZZA 4XB2A 5BQFA 1VJ1A 3I52A 2Q3EA 3F47A 4KTVE 1U3WA 1C1DB 1HDZA 1P1IA 1XR3A 5A3JA 3JV7A 3R3JA 4I5DA 1F0YA 4KP7A 2G0TA 1R37A 1I32A 2C7VA 3BYZA 3DWFA 2GSDA 3HDHA 4NIMA 3ST7A 4A2CA 2YV1A 1PQPA 5EN4A 5L45A 4GKVA 1YOVA 3I9JA 4IDEA 3O8QA 1SOVA 1Y7TA 3K96A 5LC1A 4XGIA 1N7GA 2DBVO 3PGJA 2FSVA 3IJRA 4ZQFA 5BT9A 2PKRA 3DBHA 3EW7A 3U4DA 3VDQA 2TMDA 4IJKA 2BLLA 4CV3A 4I08A 2ZKLA 3UHAA 3GDGA 3WDSA 2VWHA 4R9SA 5JY6A 3BMNA 4TRRA 3BHMA 1HE3A 1OBFO 3OSUA 2FPGA 4GBJA 4J90A 4QT0A 3KSUA 3BMCB 2VN8A 3A4VA 3ORFA 3WFJA 4YBZA 2JD0A 4WLUA 5KVVA 4N18A 2FR0A 3X2FA 5L4NA 4M87A 1Y1PA 3FHLA 1GDHA 2ZTUA 4ALJA 2HRBA 4WKGA 3QWFA 4ND2A 2QIOA 2RH8A 2WE7A 2Y0DA 4GKBA 4UREA 1P0FA 1DO8A 4II3A 2DTDA 2GNAA 4FW8A 4BO1A 3KVOA 7ADHA 3QVTA 2C5AA 3PDUA 4B4UA 1BVUA 1E7SA 1U28A 4Y98A 1J49A 3QY9A 2GZ1A 3ANNA 5HTOA 4URFA 1P45A 4ZGWA 3PVZA 1GTMA 1YBMA 5DBIA 5ES3A 5TIIA 2CNBA 5BNIA 2JHGA 1D7OA 1I3LA 2I65A 4LVUA 4W7HA 1V9LA 4E2YA 5KVQA 2O3SA 2X22A 4RJTA 4WK6A 1ORRA 2XXBA 2W2LD 4P4NA 4YQYA 5COAA 5TF4A 1N1GA 3DBLA 4MO2A 1X14A 3PPIA 2X0RA 1SEPA 1XLTA 1ENZA 2O2SA 2JJYA 4BO5A 1ZXBA 2AQKA 4WOKA 1XHLA 4MVJE 3TL3A 1X0XA 3GN2A 3IUSA 4WLVA 3O38A 3TFOA 4E13A 3D7LA 3ZN2A 2EGHA 2X9NA 3SC4A 2GN8A 3JQBC 4FFNA 3DC2A 4OSOA 3AWDA 5DNAA 4CV2A 2FPIA 5I7SA 3ZV4A 5CEEA 1BDBA 2Q1UA 1YO6A 2X86A 4UUPA 2EKQA 4Q3CA 3F46A 2GASA 2DPHA 4YEDA 1L1FA 1U8FO 3GF4A 2QQ5A 1CERA 2D2IA 4H3VA 3W6ZA 1PWZA 4HNGA 3INRA 4M55A 4KWIA 1R4MB 5DP2A 4DYDA 4E5MA 3WIEA 1ZK3A 3MOIA 4P4LA 1GFSA 1ADGA 1YQGA 3VZSA 4IIVA 1I2ZA 4MDHA 4TRJA 2WD7B 5DOZA 3WLFA 1VL8A 4R16A 1NQOA 4A0SA 4F45A 2JFHA 5A03A 5I9NA 1NAIA 3QIVA 3FWZA 3VC7A 1ENYA 3ZI0A 1G6KA 2YZ7A 5IF3A 3RSHA 2DT5A 2POQX 3W1VA 1ZEMA 4JJFA 4FCCA 3CH6A 4YAKA 1J4AA 1NHWA 1YB5A 1M75A 2FPPA 1N8KA 1Y9EA 4XRRA 3ZHBA 3BTVA 4AJPA 4BUCA 1YE3A 1OC2A 3U5TA 1UP6A 1G1AA 2W4QA 4GMGA 4AG3A 4BNUA 4LCEA 4MVJH 2IXAA 5KJ6A 3LK7A 4CODB 3KV3O 3FI9A 5TJHA 5TRTA 2I9PA 3RUIA 1G0NA 2WM3A 4B3HA 4D79A 4NI5A 2I5PO 4Q3BA 3N7UA 2VT2A 5AXCA 1MC5A 2B37A 2PZJA 2X9VA 4QO8A 5JAZA 3ZU2A 2CFCA 1FXSA 2DPGA 1MC4A 2JFGA 3JQ8B 3K6JA 4I9HA 3I9LA 5GZ3A 4MKZA 1I5RA 1O6ZA 4LK3A 5DP1A 3SXPA 1DAPA 1T1SA 3QVWA 4FD3A 3H2SA 1ADCA 1KEPA 1LDGA 1O8CA 2BFOA 1I33A 1MXFA 1ZBQA 2BF7A 1P0CA 4XD2A 3V5NA 5B4TA 4XQ9A 1GQYA 2AE2A 3NKLA 3JQ9A 3G0OA 1CQJA 1EQ2A 1HDCA 3D4PA 5C7IO 1C1XB 3ZWAA 5A5FA 3KUXA 4Q3DA 4XYGA 2VYVA 3VVCA 2EKLA 2VNAA 3DZIA 2CDCA 3HDQA 4XQEA 5L4SA 2Q2VA 3Q6IA 4K28A 2C5EA 2C07A 2NVWA 1U8XX 1QV7A 3WGOA 5DZSA 1MG5A 5EESA 5JAQA 1U5CA 4ITUA 5EERA 1PX0A 1Y8QB 1BVRA 1HT0A 3JQFC 3ZHZA 4ND1A 4PVDA 1NVTA 4YT4A 3R1IA 3STHA 2O3UA 3PJFA 4LSWA 4IXTA 4OHUA 3K92A 3GHHA 1QYCA 1AXGA 2HMVA 5A9TA 1VL6A 4ZRMA 2JCYA 1S7CA 1K3TA 3AW9A 5JS6A 3D0OA 1GEGA 3D5TA 2UVDA 2LDBA 3LZ6A 2BMAA 1IPFA 1LSSA 3H9QA 4DREA 3NGLA 2Y66A 3E82A 3V8BA 4AVYA 3RVDA 2E49A 1JWAB 1E6UA 1V35A 3BIOA 3RKUA 2PKQO 1B2LA 4MP8A 5JMPA 3OETA 2E48A 1WWKA 2E37A 1U3UA 2WSBA 3CINA 4XB1A 3INGA 4WE3A 5EINA 1RM0A 3OEYA 1F12A 1K6XA 3DBRA 3QP9A 4TRMA 3W4JA 4U8GA 4MKXA 1MGOA 3ZW8A 2WTBA 1ZK2A 3TZHA 4N5NA 1NWCA 1SNYA 2PV7A 3JQGA 2Y1GA 3DMTA 4KTTE 4OIMA 1ENOA 3ANMA 5ICMA 3HADA 4DTIA 5L53A 4DXHA 1XU7A 2P68A 3C7DB 4KMSA 1PQUA 3O03A 5IFLA 4EI2A 1NNUA 1RPNA 1NR7A 4J49A 4WCFC 3H3JA 3B1FA 4CLEA 3DZFA 1YB1A 1CRWG 3HN7A 3GVIA 1KVSA 4NDNE 3VOSA 3OQ1A 3BTSA 4JJGA 4RORA 3B1KA 2FSSA 3SVTA 1IY8A 2UV8A 1I3KA 1YBVA 3BHJA 2BELA 2EHDA 4Z0HO 1X7DA 3L4SO 3ZNOA 5IDXA 3WQSB 1ISJA 5HWSA 3PZBA 4JK3A 1EK6A 4L75A 4EUHA 4TWRA 2JAHA 2WWRA 3GK3A 4YAJA 4DC0A 4EJ0A 3L4BA 3DAPA 1NTOA 1WZIA 1DC6A 2B4TO 3PQFA 4IGEA 2ZB7A 3OA0A 4E5KA 5FI5A 2VRBA 3RFVA 2D4AA 2TMGA 1DBVO 1EK5A 2RIRA 2OXIA 1CYDA 4YJHB 3JD2A 2Y0EA 5IG2A 3CXRA 2DM6A 2AE1A 2GYYA 5DCYA 5G0SA 1TB4A 7MDHA 4Q39A 3EZLA 5JFOA 4MVJA 4GX0A 4JP2A 4OXNA 1FK8A 1SOWA 3WMXA 4K6FA 4CUKA 4I9NA 4KUEA 2R6JA 3NT2A 4UVHA 1T2AA 3LSYA 4IQGA 5JBIA 4JP3A 1E3IA 3OP4A 4IDFA 3GGPA 3OJLA 3DOJA 3MJCA 2PGJA 2ZCVA 3ZWBA 1BG6A 1UXIA 3K5PA 4HV4A 1B3RA 2HCTA 4HXYA 1H93A 1ID1A 1P31A 3D4OA 2EW8A 3HUDA 4BKOA 2Z95A 2NTNA 1T2EA 1EUZA 3TF5A 3G49A 1N9GB 1EDZA 3KYCB 3MEQA 2ZTLA 4U7WA 4ZD6A 1P77A 1KY5A 4DPKA 3DEYX 4MJLA 4LMPA 4XYLA 5G4LA 4ROSA 1KBZA 1GV0A 1NYTA 1ZNQO 4LW8A 5JDIC 4E21A 4PCVA 1W4ZA 3OHSX 4CLHA 4CV1A 1U4OA 4YRDA 1EUDA 5U4QA 2DC1A 5C37A 2GZ3A 1ML3A 3CEAA 1OC4A 1I36A 3KYDA 4ILKA 4J1NA 5TQVA 1A5ZA 1H2BA 2P9GA 3IMFA 2QRKA 2GO1A 2PGLA 1Y8RA 5ER9A 3D3WB 3JYNA 1Y5MA 2R00C 2B5VA 3QA9A 3UH1A 5JW6A 3Q3CA 4RQUA 3GVPA 2VUUA 2YDXA 5JDCC 1VSVA 1QG6A 1H2HA 1SPXA 1PJCA 2OP1A 2GGSA 4E31A 4RCVA 4ZRNA 3JQBA 1XDWA 2YFHA 5EMHA 4ONEA 3IC5A 1Q1NA 1VI2A 4BO2A 3GEDA 1NM5A 2IYOA 3LT1A 1CQIA 4II2A 1BXKA 3IS3A 3PTZA 4OH1A 2OL4A 3WOHA 4A27A 3E18A 3FTPA 4P38A 4YAGA 1HYHA 3FN4A 3I23A 5CAEA 1Q2XA 3CKYA 2QYSA 5TT0A 3WMWA 4MKRA 3MCVA 3C7CB 5DCUA 3AUSA 5IDQA 4D44A 1JTVA 1XIVA 2BGKA 1QYVA 3BMQB 3OFSA 3DBVO 3R0IA 1NBOA 1M67A 2YDYA 4E0BA 2OBYA 3I9KA 3ZNNA 3GFBA 3QQPA 1R4NA 3B6ZA 1D8AA 1LLQA 2NACA 4R41A 4BNHA 4L76A 4UEOA 4PG6A 2IZ1A 3AI1A 1Q0QA 1K6JA 2HU2A 2WD8A 1LDYA 5A02A 1ZW1A 2E4AA 1PGPA 2BI7A 2O3TA 2X0JA 3LU1A 1HSZA 1W73A 4IZHA 1LTHR 3R6DA 1RYEA 3WJAA 1RM5A 3GUCA 3ON5A 1ZH8A 3M2PA 3OJEA 3TWOA 4E12A 2OP0A 5U1PA 5K9ZA 2J8ZA 5KVSA 3AUUA 3EDMA 4QECA 1EUCA 2SCUA 2G76A 4IINA 2QRLA 4XIYA 3Q2IA 1J6UA 1ZMTA 4RDHA 4FC7A 4YXFA 3F1KA 3H2ZA 3NV9A 2QYTA 3GNTA 1N7HA 4BMNA 5IN4A 1UP4A 4O1MA 4YDRA 3CZRA 3COSA 3M6IA 3CMCO 1UJMA 3E03A 2AA3A 2EV9A 4OGWA 1CEQA 4ND4A 2YHIB 1SB9A 1WPQA 5GY7A 4EYEA 3VPXA 3WQRA 1VJTA 4PGFA 3SC6A 1DIHA 1NHGA 2H9IA 4IIUA 4F6CA 1CJCA 1KIFA 1TA4A 3TSCA 2NU9A 4CM6A 4PLPA 1P1JA 2Z1NA 4AJHA 4KUGA 5ENDA 2AG8A 1NFQA 5DCWA 2ZTMA 3NEPX 4FC6A 3L9WA 3QHAA 4M86A 1HL3A 2NVUB 4NU5A 2GERA 3NTRA 3PIIA 4J2HA 4K6CA 1IHYA 3V1UA 2OGUA 1KERA 1UDBA 2ZYGA 3AU8A 3NAQA 1YS4A 3JQCA 5EQDA 4DIOA 1DC3A 2I66A 4NBVA 2NQTA 3HHPA 3PEFA 4H15A 2VT3A 3GEGA 3CIFA 3OJOA 3LC2O 4ZQGA 1JA9A 4GPD1 3QSGA 3QJ5A 2RBEA 3GZNB 1YQXA 4RV9A 1E7MA 4TRNA 1C1DA 8LDHA 3D4NA 4LMRA 1QRRA 4P4GA 3VTFA 3P2OA 1DIGA 4J3FA 1KVUA 4JCOA 4A26A 1E3SA 2IRWA 4FB5A 2CUKA 1GY8A 1WDLA 4IGFA 3ZWVA 4WEOA 1LLUA 3GVXA 1YONA 2WYUA 4UVDA 2JCVA 3GNQA 2I67A 5IXSA 2H5LA 1BGVA 3LF2A 4RLHA 2EERA 1L7DA 4PG8A 3MWDB 4OQYA 4BKRA 3ICPA 4CMEA 1KETA 1E7YA 2FZEA 1LSOA 1R0SA 2FMUA 5B1YA 1B14A 1HETA 2FRDA 2ZB3A 3AI3A 5DBGA 3QVXA 5TLSA 2IYPA 1HKUA 2DBZA 4BGIA 3IUPA 3H5AA 3OH8A 5F5LA 3BTOA 4R5MA 3ENKA 3KXDA 1PL8A 3HG7A 3K30A 4H16A 4PZCA 5T57A 1Z7BA 3TJRA 2BH9A 5GMOA 4E2XA 1SC6A 1I30A 2UYYA 4XIJA 1XU9A 2D3TA 4PRLA 3BMCA 1ONNA 3PHLA 5ER6A 4YAIA 1Z73A 4XQCA 3TN7A 3FWNA 4XGKA 3ZU4A 1HE4A 2GUGA 2ZCUA 1M6HA 1LDBA 1QYXA 3IJPA 1ENPA 1PZFA 3ZGYA 4A10A 4OQZA 4R1SA 4NBUA 2Y1OA 2D8AA 3MTGA 2VHWA 3SLGA 5A9SB 1YDWA 3C3XA 3OEWA 1UAYA 1EVJA 3U9LA 3WGTA 2J3JA 3WICA 3ZCXA 4BQRA 1A27A 2VHVA 3Q0EA 1YL5A 1F14A 4BNNA 1TLTA 3JYQA 4PZDA 4Y6RA 4D45A 4MIOA 1RM3A 3GUYA 4PLFA 3ZV5A 2QG4A 3WB9A 1ZIDA 4XCVA 4D0SA 4GWGA 3PWSA 1DRWA 4FJ1A 4TROA 3AFNA 5I8ZA 3WQQA 5DF1A 3ZHYA 2PZLA 4CMIB 3JQ6A 4BGVA 4BNLA 3GRKA 4L4XA 4ZN6A 4PG5A 1C0IA 4HFJA 2EW2A 1Y6JA 4DLLA 3GEMA 4IUYA 2PLAA 4QFDA 1L7EA 1FDVA 4QX6A 1VSUA 1YDEA 3GR6A 3TL2A 4R1TA 1UR5A 3ZV6A 5KOIA 3QRWA 1Y9AA 2HMSA 5KKAA 4E30A 1BWSA 4DLBA 3H4VA 2X6TA 5G0VA 2PH3A 4IPTA 2W98A 2QZZA 1YRLA 4WUVA 1C3VA 4CJXA 2J5KA 3DMYA 3DONA 4FJ2A 4CQMD 1DHTA 4HKTA 1DJQA 5BNTA 1YB4A 2Y1FA 4WCFB 4CM1A 2RHRA 4JQCA 3QVSA 2VYNA 3L6DA 4QO7A 3OQ6A 2PTGA 4YT5A 5JAMA 1DDOA 1NPDA 1E7RA 3ROMA 1E5LA 1A7KA 4TKMA 3GVHA 1NPYA 4CMAA 3UUWA 1KC1A 2Q1TA 4BNIA 4MINA 5JDCA 1R4MA 5CP8A 3AY6A 2P9CA 1Z7EA 3PJDA 4B79A 1IZ9A 2AW5A 1MG0A 5KTKA 4NMHA 1MX3A 4QSMA 1XWFA 4CLOB 2PGDA 2Q49A 2WD7A 2NTVA 1HDOA 3LF1A 5TS3A 4CMBA 3KM0A 3V1TC 4DBVO 4F46A 3GZ4A 5JMWA 4IY1A 3V2UA 4ZA2A 4CMGA 4CR6A 1RM4A 2NU7A 2OZPA 2V6BA 3R3SA 3OM9A 5K0ZA 3WGYA 1GQQA 1ZJZA 3IP3A 4W6ZA 3SX2A 5HRUA 1R15A 1F06A 5TJ9A 5IZCC 3QWIA 4NR0A 4NNJA 2HMWA 3DOCA 4AJEA 3KSDO 2F00A 4NG5A 3WX0A 1FJHA 3H5NA 1A7AA 4BNYA 3W8FA 5THKA 3SJ7A 3TPCA 4GSKA 2O7QA 2AXQA 2BFMA 2Y0CA 4IJWA 3W8EA 2NUAA 2V6GA 3VZPA 1X7GA 1LRKA 2NU6A 4DVJA 3ASVA 4J7UA 4RPJA 2VOJA 3LQFA 3JQ8A 1MXHA 1P9LA 3RUAA 1H0KA 2V65A 3F5QA 5BSHA 2AEMA 3A9WA 3A06A 1AHIA 2GN9A 2I3AA 2OFPA 3H9UA 1CIVA 2EP7A 3WR5A 1B0AA 3AY3A 1XA0A 2EEZA 2IODA 3DFUA 4XKJA 4E2ZA 2VUTA 2C2XA 3AM5A 3MJTA 4G2NA 2P5UA 3KZVA 2J3KA 2VCYA 1C1XA 3AFMA 4C7KA 1BDMA 1YKFA 4WCDA 1J5PA 4I5GA 4XYEA 1KVRA 1WMBA 3U0BA 1KC3A 1ZKMA 4FPXA 4FFPA 1M2WA 4D0RA 3GPDG 4B7UA 3P2YA 4BGEA 5DOVA 4Z6KA 2X0IA 1Y8QA 1GCOA 1T4BA 1YVEI 3H9GA 4G5HA 5A9RA 1TEHA 2O23A 3TZQA 5HS6A 1H6CA 4LGVA 4J0EA 3G3EA 3VTZA 1O89A 1EZ4A 5JY1A 1LEHA 5H82A 5T5QA 1XSEA 2VHYA 5MDHA 2X23A 4YJDA 3UFXA 3WGGA 4UUNA 4AL4A 2EXXA 2BRUA 1U2GA 4GH5A 1KY4A 2BHLA 4DIFA 3F6YA 1T26A 3ETDA 5CFZA 4RGBA 3V2GA 1HE2A 2W90A 1QP8A 3IIEA 3UOGA 3KRTA 3JTMA 3E9NA 3AK4A 1S6YA 4Y67A 3ENNA 4ZQEA 3PQDA 1P44A 2B36A 2CMDA 3GH3A 3FBTA 3H6KA 4GLOA 3C24A 3PHJA 5A1TA 5CPBA 5HBRA 1LJ8A 4CM8B 2ZB4A 3LVFO 3TDKA 3RD5A 2CVOA 2VRCD 3RI3A 3O4RA 4BS9A 1GCUA 1GZ6A 4HNHA 2PZKA 3ZWYA 1Q0HA 2DQ4A 2PK3A 3M1AA 5LDGA 5JNLA 5I9MA 3EZYA 2GDZA 3H8VA 4N5LA 5B4VA 3ZU3A 4PLVA 1IB6A 2IXBA 3HNPA 5BNFA 1ZUD1 5AXBA 4U5QA 3JQ7B 2B35A 1FDUA 3WXBA 2IZZA 3U49A 5B37A 1C14A 1SCUA 3ZDFA 1LLDA 4IJUA 1Z6ZA 4KQWA 1ZK4A 1UXKA 3EGOA 4K9DA 4M89A 4MIEA 4IQ0A 3EMKA 2RHCA 5BR7A 5K6AC 3AOEC 2C82A 1ADFA 2EWMA 1LDNA 1BRMA 2Z1MA 5JAIA 1QLHA 1E6EA 2QZ9A 4YYZA 4KQXA 3MJSA 3C1AA 2Q4BA 3ADOA 2FR1A 4GSLA 4R68A 4RPLA 1DRVA 3I9NA 3QV1A 4BNMA 1RYDA 4YJHA 1DIRA 1EFKA 2D0IA 4G81A 4Y8VA 4E6PA 3UXYA 2QW8A 5ITWA 4CQMB 3RIHA 2NVBA 3LDHA 4RF4A 4YJGB 1LQTA 3I4CA 4B8ZA 4RVSA 3U3XA 3PLNA 2P5YA 2Y1EA 1LRLA 1OFGA 1CWUA 2NNLD 1GYPA 3I3OA 3RC1A 4YRAA 1DB3A 1P1HA 5H83A 3E1KA 4E2WA 1XEAA 1EFLA 2Y1CA 1KYQA 1LQUA 3EC7A 3HE3A 4NPCA 2P9EA 4RVGA 4MVJD 4UVIA 4UEKA 4D46A 3PXXA 1DXYA 3FF4A 1IULA 4OYRA 1B16A 3NDJA 4KOAA 1TT5B 4JGBA 1ZMOA 3G79A
chains in the Genus database with same CATH superfamily
2YQ4A 3S55A 1WAMA 3ZGZA 3T5DA 3U9SA 4MSUA 1JVBA 3PFHA 3ZK8A 4HI0E 2EBHX 1EP1B 3HYTA 3RK1A 2YYYA 3HCNA 4TQ9A 4YCJA 2CVZA 2WZCA 2ILTA 3LD9A 3NHLA 3D7NA 2GDJA 2VF7A 3HNRA 4B7XA 2VPIA 3C15C 3ONFA 2I2FA 3AG5A 3KYCA 4WASA 5CG1A 3VH3A 5J4HA 1R12A 1Q77A 2CSUA 3LCUA 2Z04A 3L6OO 3LIPA 4LQ4A 2O5VA 2QTNA 4X84A 4YJFB 5DHRA 5L95A 2JVJA 2PWZA 1NKTA 1UJ5A 4ZCRA 3P94A 2L42A 1E0KA 5L7WA 3A0RB 3HBJA 3KT3A 3IDAA 3SSOA 2JASA 3EWAA 4DKXA 2O7SA 4G9GA 4DB4A 1U7WA 1P0IA 2C29D 2BFEB 2LD4A 3B60A 1R4ZA 1XXHA 4ARAA 5LP6B 4D9GA 5I47A 3HBLA 2QI9C 3IAM1 3PXCX 1JHUA 3EXFB 5IXYA 2O5EA 1QP0A 4HDKA 4NQZA 2QQFA 2GZ2A 1N36B 1TW2A 3AL3A 1CUGA 1RJGA 4LHXA 1DVRA 4TL8A 4U7PB 5L3QB 1FP7A 3E0XA 1PV4A 2ZYUX 4D43A 4AULA 2D0OB 1U5AA 3N8HA 4CFZA 4URYR 3V2IA 1J2UA 5ILOA 4NXNB 2ZE6A 3JVVA 3Q9SA 1H4QA 1HG0A 5EI5A 1ZOIA 3NP7A 2EFEB 4IFIA 4RXUA 1PK9A 1T1JA 4XVQA 3GFPA 2D13A 1JLLB 2F4NA 2ZB2A 3B3GA 1Z7GA 3OQVA 1YRQA 1Z6AA 2M6LA 4AFNA 2GRJA 1Z4IA 2DRIA 5LMCA 4L74A 3QITA 1VFPA 3UAYA 3FDJA 4YQZA 3C7AA 1GU7A 3CKLA 3YASA 1GIAA 3A4YA 4M1TA 3RYHA 3I5MA 1TPZA 3A1DA 1B8PA 1UXGA 2Y1WA 3EISA 3TMAA 4HWPA 2ZPTX 4GZ3A 4FHFA 1E4VA 1GLGA 1GG8A 1UJCA 3EWIA 4KAJA 1LBSA 3CR8A 1CZOA 1AKNA 1YHZA 4JBIA 4PGAA 2XZPA 3QXHA 2DMRA 2PD4A 2JFBA 1AN9A 3O75A 4J03A 3DM5A 4D25A 2O8DA 4ZREA 2AUNA 2LZ0A 2WWXA 3ED5A 4BRWA 5I7EA 3FCEA 1JJ7A 1MAVA 4OQLA 1AMOA 4NG4A 5CCBA 3AF4A 3TG8A 3CUUA 3OQIA 4FZRA 1QR6A 4V1CB 1WV1A 3BMXA 4O29A 1GVHA 4DCJA 4BEWA 1L8QA 2A0KA 1VCNA 1N2GA 3KKNA 4GOOD 5TXGA 2RG1A 3V7YA 5C5IA 1W5FA 4HVTA 5B53A 3WS7A 1IY2A 1JU9A 3BAZA 5CPFA 2PLRA 1QFXA 3E3LA 4G1EB 1BD4A 3M5DA 4FWIB 1QGUB 4HZUB 1HDIA 3HGMA 1E1QD 3AVQA 4F6RA 4MB0A 4Q3NA 2Q2WA 1J33A 2JJQA 2XBLA 1RABA 4G0PA 3VKUA 5LNK1 5G0TA 4BNXA 1JQEA 2XPCA 3Q0TA 4U7TB 4IHJB 4DABA 1AA9A 2V9PA 4CQLB 2EYQA 3E81A 1KKMA 1TO6A 1F8FA 3K73O 4GZMA 2A9JA 1JEYB 2HW8A 3T9CA 1NDQA 1T0BA 1PTJC 3DTVA 1GL6A 2HHHB 2AYXA 2GSWA 1MJGA 3DV2A 4LJSA 1TYCA 3EXIA 3BDIA 3EXHA 5G02A 3ZZTA 4BMOB 5BN5A 1X15A 2GPJA 4G1MB 2QTHA 1A71A 2X76A 4V38A 2NPFA 2WV7A 2REQA 3SFTA 4ARIA 4AZ0B 2RHBA 4TWIA 4XR4A 2WIDA 2XD9A 1DIAA 1SQ5A 4R3NA 4CM5A 4B3JA 3NC1C 5DI3B 1MIOB 1E3WB 2PMCA 3BL5A 4TM8A 4KVFA 4B4KA 4K9OA 1A4UA 2C9OA 4P8RA 1LC0A 3MPOA 3JYOA 4WERA 3GLGA 3H1PA 5G53C 3C39A 2ZPAA 1X7HA 3BILA 4RLFA 4EFLA 5F21A 4DQXA 4RF3A 3B48A 4TKZA 2VCEA 1AX9A 2H52A 4H3HB 4K3VA 4KWEA 2O4UX 5TV2A 1K6EA 1ZQ9A 2FZWA 3Q1LA 1QU2A 2PR2A 1Y9JA 2XE8A 1J9GA 2X77A 3L79A 4C0AC 4ZYWA 1M34A 2B6HA 2H54A 5JXIA 4X1YA 1IU9A 1OAAA 1UKYA 3BPSA 1Z74A 2H2IA 3A9CA 3DAHA 3FE2A 3L7KA 2DT8A 2V97A 2WI8A 1UWVA 5IP5A 4RPHA 3FZYA 3LHSA 4O4LA 1JTEA 2XMRA 5ALTA 3WRXC 4XX0B 3L1VA 3NBKA 5LZ8A 2X0FA 3WQBA 1ZG3A 4Q3LA 1F2TA 2ANBA 1T4CA 3VR3D 3CVVA 4ACBA 2A9KA 5A3RA 1COWD 1JBEA 2OCPA 3NHWA 4Z86A 4E22A 2HUPA 3A9VA 4ZEWA 5K3DA 3NHFA 3P96A 1CUUA 5IJAA 3N2GB 2J9GA 4DYVA 3K1AB 4WBXC 4OAQA 3V9PA 1TZJA 3K9WA 3KEOA 4FOPA 4TL6A 5JLAA 3WGIA 2RGDA 1CRQA 1W4RA 1GQ2A 3OCJA 2E4XA 1GSOA 1LVGA 3G7UA 3IV7A 4U7GA 2ETXA 1OJ7A 3BA6A 3L84A 4OP3A 4U2GA 3HVRA 1YCDA 2Y05A 2ASEA 3F6CA 4G97A 5E9WA 3DE3X 3DLTA 1VM6A 1XJCA 3GZNA 1UEJA 3H8JA 4US0R 3KEFA 4UE2A 5ALZA 1DKOA 2Z2ZA 3PUHA 4LUCA 1U3VA 1IMJA 1BU5A 3NOOA 4CHGA 1A76A 2H0QA 5EZYF 2HPAA 4C7OA 1MX9A 4O4IF 1RPJA 1OASA 1BXGB 1TIBA 1XX6A 1U28C 1ETUA 5K3AA 4HPJB 1D04A 1FVFA 1SHLA 4RGVA 5D1HA 3ZXYA 4L0QA 4PGGA 1V16A 3M4YA 3P5BA 1C0EA 5INTA 4Z4CA 2IH2A 5MGBA 4FX5A 4OSPA 2EFGA 4CT4B 4AZVA 3ZJYA 2EG9A 4LRTB 5L51A 1NW9B 2P6NA 2BDEA 2G3YA 3N8DA 1E3JA 2NAFA 4U3JB 2VP2A 3BM5A 3L7DA 1T2NA 4Y1RB 1ZOSA 1XJWA 5EHIA 5DGTA 1CR0A 2XB9A 1TJ4A 4CKBB 5FNVF 3OCVA 3GRPA 3RADC 1NBHA 3CE6A 1R9NA 1DKNA 2F1HA 1MAHA 5HQ3B 3PPXA 3BSWA 3KKPA 5FYDA 3EVGA 3V6LA 5HZGA 5JCJA 2G80A 1ESMA 4LZAA 2WA2A 5ALHA 3ZCVA 4HDSA 3SAJA 1HYEA 2XYHA 4LOIA 4UHEA 4BUZA 1R7RA 3QVLA 9MHTA 3SK0A 3FYUB 1X1QA 3ZZNA 2CE2X 4IS3A 4R2IA 4X63A 3FYTA 4B0PA 3K35A 1EP3B 1TTQB 1UZNA 2QTGA 4RCYA 3TFQA 2P75A 3V8PA 3VZBA 3GA0A 1A8QA 1KRWA 3PKIA 3K2IA 5DM1A 3UICA 2P4HX 1E79D 1GRCA 1XV5A 5CW1A 1NXWA 1Q7GA 5LDDC 5JH7A 2OHXA 4QE3A 4TS4A 5A05A 4D98A 5FIUA 5JCXA 2QE6A 3JVIA 4HWKA 4P31A 5DI9A 4RTJA 3FTEA 2IS1A 1Z3IX 3GL9A 1NUQA 5BV8A 4U2DA 5KMGA 1SVWA 5H9VA 4X64B 1CVIA 2ZIXB 1MV5A 1PS0A 2IELA 2X8WA 3T7TA 3UWOA 2RCYA 3ZX4A 4MGEA 3ZKWB 1IJFA 2J41A 2GEKA 2PH5A 5B1HA 4RPCA 3KR1A 1K4YA 4XUCA 4DNQA 1DWQA 1EE2A 3EVAA 3FGPA 4C6TA 5CLHA 4QGSA 4BU1A 3B13B 4BAZA 3PHGA 1YUNA 1RZRA 3SMQA 4N3AA 4RK0A 1NLUA 3L93A 3OT1A 1I1OA 5K3CA 1FW6A 1OKKD 1W0CA 3A3OA 3GPBA 2RCNA 3KYIB 3G2KA 1VE3A 2CNWD 5HK9A 4K9SA 4JOQA 4WFJA 1NN1A 1VP3A 3RT7A 2SECE 1DRKA 3M5PA 2Q2OA 2YJNA 3KWFA 4O4JA 1D0SA 3JQFA 2CJWB 3HKCB 4EGJA 3I9V6 2XTZA 5EIHA 3EDOA 2P6PA 3NJ4A 3EYWA 4CPDA 1ZOPA 1OIWA 1YCHA 1B00A 5LA6B 4ZQHA 3WWDA 2QD5A 1A9PA 1TUEA 4C3ZA 2ORWA 4ZT6A 1GPH1 1RAHA 2PUGA 3D1JA 5JHGB 4GR4A 5IM4A 5DULA 1BRTA 5AOCA 4ZVRA 4KXUA 3ENWA 5IARA 2VJDA 4GZLA 4D56A 3OZRA 3Q3JB 1IDN1 3AR9A 2XUAA 2IP4A 3DLAA 4MV9A 3UAZA 5DWDA 2E1PA 3EXEA 3SD7A 2BEWB 4Q24A 4MVWA 2KM1A 2BGMA 1T5IA 4IG4A 5KPDA 4INZA 4BMSA 1OWMA 1VYVA 4MW7A 2FZKA 1R16A 1SBYA 1YJ8A 3IMEA 2A9FA 2NZYA 2UVPA 3QTLA 4UFOA 4XDGA 1ACLA 1RBMA 1E20A 1D6JA 1TECE 3NOXA 4PLHA 2YV3A 4D74A 2OG1A 2FPKA 4OOEA 1XKTA 2GCNA 3BMOB 5EZSA 1RXIA 4GR5A 2A1UB 5FBRB 3WAGA 2WC1A 4H6XA 3L07A 2LUOA 4R0VA 5THXA 2AG5A 1PL7A 2FOLA 3T34A 3DTYA 4BMZA 2F1IA 1FLVA 1AM4D 1P3JA 2GWRA 2HA5A 3IAHA 4LJ6A 4NFSA 4MW0A 5EEGA 1SXHA 2VSXA 1EK0A 4QARA 2FEXA 4PU0A 1HT1E 1YHYA 3WRWA 4IGIA 3FXAA 4B35A 2I2CA 2ZI5A 4OTZA 4EHKA 1PEDA 1T8YA 4U2EA 3BWVA 1VECA 1AKMA 5AI5A 5DBHX 1MW8X 3V4RA 1I10A 1D6SA 3BL8A 4R6WA 2JGNA 4LSGA 4TV8B 4UBIA 1GAEO 4NZOA 3DO5A 3OE7D 4FYPA 3T4XA 1CY1A 5CEFA 3JW8A 4B71A 3OZ7A 5SYNA 2GTPA 4C7JA 4AUMA 2ZUCA 1C7RA 4B2LA 2ZSAA 5DN6A 2NYVA 4P5PA 1E3QA 2I7XA 4ZT5A 1FF9A 1NWHA 1ECJA 1BDHA 1T9KA 1PR5A 5ALLA 4P08A 5ILGA 2EBUA 2DCMA 3VKFA 4XPZA 2ZIEA 4GPZA 5IX8A 2WAXA 4HFRA 5JE8A 2FW9A 3UJ3X 3T3MB 5DMXA 1NDHA 2CDNA 2VT6A 4GQAA 2Q5EA 4M54A 4OQNA 2CD9A 4UZSA 3DHEA 5DYYA 1FDIA 4R6XA 3GLIE 4FJ0A 1E96A 3MFQA 3M6LA 1JIXA 2WKWA 1ZM4A 4AKEA 3IDFA 5AUNB 1ODLA 4CMHA 5B55A 2I7TA 2XT6A 4HJRA 1K8XB 2P9YA 5EE3A 5FHRA 3WVNA 4OL9A 5JBNA 4HQ6A 1PLLA 1RWNA 2GD6A 4M9XA 1UBUS 2IP1A 3VU9B 3VVBA 3MG9A 5EPOA 1AQ6A 1P7YA 2A1TS 2ZYAA 3MHPA 3MS7A 1OLXA 3ZKAA 3DHNA 4OLBA 1XKQA 3O91A 3PICA 2JH8A 4MAAA 4J9VA 3NPMA 4QNMA 5CNMA 5CCEA 1KVQA 3CIOA 1D3AA 3GLSA 1BXRB 3HKDB 3QEJA 4GYYA 4R1PA 3ZCSA 3B12A 3QYJA 1NLZA 4BMDA 2VNJA 2GBLA 3SHFA 3NI2A 1T25A 1ATZA 1FTNA 2ENWA 4UDOA 1ZRNA 1F60A 4P4SB 4DLAA 2JK0A 1P4HA 3JQAB 1ZSYA 3NDRA 3HXTA 4QYXA 2GKOA 1KDZA 2C9MA 1SBZA 3AM4A 1R1DA 3S1LA 4EWLA 1YF3A 1KQFA 3EAFA 1RHMA 1OT3A 2UUPA 2DUJA 3FCOA 2LBPA 3X1YA 3U7JA 4DR3B 2FQWA 4CG3A 3WJ7A 4UAGA 4A23A 2ZULA 4KRYA 2LPMA 2R85A 1HQCA 3DL4A 3CSUA 4MRPA 1JHAA 2I3BA 4JJ6A 4NCIA 1H2EA 4XI9A 3LBHA 3ESDA 3TQSA 2KBEA 4EO4A 4J1QA 1ZKDA 1GKYA 3C3DA 4P82A 5GJWC 3V4PB 1BWRA 4X20A 3TOXA 1AUVA 5FA5A 4DRXA 2D59A 5E4TA 2ZJ2A 1O1YA 2GEBA 4HPWA 1DC7A 5K0ZA 3GGDA 3LLUA 5KNDA 1V8OA 1HYQA 2UAGA 4NMLA 1MOSA 4EJMA 4Y0AA 2XEXA 4K9PA 3AF2A 3LXUX 3R7AA 4WZZA 1GGFA 2DBRA 1IZ8A 1NVFA 2WPDD 4OXYA 1W5SA 2REOA 4NBRA 5J43A 4ZP1A 1HNXB 3AINA 4HFMA 3NRCA 3IRVA 4F6LA 2AWOA 4P7BA 1BC5A 1JDJA 3E8XA 2W7TA 4ZTBA 5LYYA 5BWCA 3FVTA 16PKA 3K5IA 4WKPA 5F78A 3IPLA 4UTRA 5IDYA 5AVUA 4E5PA 3P9SA 2M32A 4BN5A 4MQBA 1QH1B 4ENWA 2X8JB 2PR7A 3NHKA 1OF1A 2NXNA 1ZGCA 2OB1A 1IM5A 3GA7A 3HH8A 1KZ1A 1M76A 2F3RA 4P58A 2W2KB 1Z68A 4P35A 3VOAA 4KAAA 4YMWA 3ZHQA 2WKPA 4F60A 1A5AB 1QU3A 2PV0A 3MQFA 5G41A 4K9RA 1VL2A 1QKKA 3AWIA 4XH9B 1S7GA 5E0OA 2ZVQX 4GECA 2FFQA 3QU7A 3VPAA 1U8UA 3E5NA 4MUAA 2ZRNA 3RUCA 1XLUA 3S2IA 2IITA 4GOXA 4N8DA 5AW4A 3IULA 3RC9A 4W5OA 1TT7A 3WSVA 1K7EB 1ODKA 4J16A 4MP6A 3O94A 1X8KA 2PT5A 2RK4A 4AO8A 4BP3A 4F7DA 2K7FA 3KLMX 1WR8A 2W6JD 1Q6YA 3FIUA 1SVNA 3IPRA 1M8FA 3USZA 3K0HA 4ARZB 1NPTO 1RZVA 4LDPA 1K4MA 1GQSA 2E4UA 1N2IA 2QSYA 2VDOB 3E5RA 3HGQA 4HR7A 4JJAA 4OJTA 4PAMA 4Y7DA 1L8LA 3HXKA 1K86A 3HWRA 2VSFA 2ZUVA 3IVXA 4MS3A 3UBMA 1G21A 2ZI6A 3OU2A 3NP9A 1WDKA 4YCLA 1JDTA 3A4IA 2DWPA 3G0IA 3HCDA 2R97A 2YJGA 1M1YE 1QWOA 3PDHA 5DW0A 2IHZA 3KQWA 2O1XA 1IHOA 3ECSA 1VXRA 1MFPA 2WSLA 3LKZA 4MKHA 4NCNA 3VU0A 5L40A 2B0JA 2VYVD 4GX2A 3FAZA 4IX9A 4BATA 5FI3A 1YOVB 3LHFA 2VS1A 4FSHA 4M1EA 4OIFA 3VH4A 4ERXA 2OLJA 3BB4A 3EDRA 2P5TB 2GD1O 2WAMA 3KHUA 2HJRA 4W5WA 4IGKA 1PKXA 2DH5A 4CIXA 3I3SR 3GROA 1H8HD 3E05A 1U6JA 5HKAA 1EUYA 3OF5A 4H77A 1NMEA 4YWHA 2IXFA 3JAMA 1JQBA 2I99A 3JPYA 4HAIA 3MJVA 3C6QA 1MN6A 1RAAA 3QXJA 2X8LA 3RBVA 2JZOA 3HXQA 2VHZA 2FN8A 1VYHA 3RAJA 1K75A 3LYAA 1MDBA 4U2BA 2QS9A 3ABRB 5DYIA 5KYGA 3U44A 2WF9A 5TQ2A 4B83A 4F91B 1GRRA 3B85A 4AJJA 1ZZGA 4YV1A 3FR8A 5E38A 1CJMA 1TLFA 4NH0A 2Y67A 1TAGA 1ILWA 2DKFA 1O5IA 1D5CA 1XK7A 2WNIA 1NVXQ 2XUGA 4QEDA 5EWLA 4J1TC 4CU5A 1W48A 3RBXA 1DOHA 3Q7RA 3KJZA 4FYWA 3VRHA 5JQGB 3DCYA 3PNYA 1L5GB 3OZAA 2CXPA 5FORA 4A0QA 1Y5RA 5EPUA 4DCOA 3PLAE 1YK0A 1G8MA 2NZ2A 5TT1A 5E2IA 3LIIA 2IWRA 1A8IA 4RTRA 4J4BA 1UJ2A 1BCSB 2ZT8A 4EGFA 3P0FA 1PJQA 3WYDA 3UB3A 4BWYA 2QNBA 2CCJA 3F97A 5TMBA 1OLUB 3EG9A 4PAGA 3IP1A 1V5GA 4EFKA 2VLBA 4M9UA 2GPSA 3SBOA 4D9MA 4KITB 5IWAB 2WFMA 3CZ4A 5MHTA 1EVLA 4UMVA 4JHXA 2JLQA 1NI4B 1YI1A 2P4QA 4OV6B 3WLIA 2NGRA 3HKBB 2A3RA 3AQ4A 4CCYB 4ZQBA 3DHWC 2P2GA 2CXNA 3CF4A 2PUTA 3G8CA 3N6VA 1YA8A 4RUKA 4ZARA 3OWHA 3TJMA 4W4TA 2YV5A 4D41A 1JWBB 1Y3IA 4A6EA 1IHXA 1T15A 1ULUA 2H1CA 4DUPA 3I28A 3E3OA 4J6FA 5FQNA 4A36A 3S68A 2HCRA 5B64A 4EHFA 1LX6A 2Q46A 3MD0A 3B7GA 2GF0A 3NX4A 3U7IA 4EBFA 5LMUB 3PTLA 3BXOA 4NOLA 3KETA 1Z26A 2ZYDA 2C54A 2P1RA 2XDQB 3MTEA 2C2KA 5CA0A 3MJ4A 4Z7JA 4GLLA 3CT4A 3GJ5A 1GSIA 1GQOA 1CUZA 1N5JA 2W6PA 3K8ZA 4KR0A 4Q9AA 3P9XA 4D3FA 1USWA 1R6TA 2OHOA 3JWHA 3ADBA 4L9RA 3QOXA 5DGXA 1Y63A 2PL1A 3Q9UA 4NBTA 2XUQA 1R8JA 3VAZA 1T36B 5EHNA 3H2YA 4OOFA 3FDIA 5JD6A 4YAWA 5KWEA 5C2JB 3FUUA 3NCHA 2WYIA 3EIQA 4HDRB 3NCTA 1U3TA 3WTBA 2FEAA 1XYGA 2HYDA 2VK2A 1E9SA 1XZ8A 3DULA 3PRJA 5KIAA 2R5WA 4FBGA 4ISCA 1T8WA 3BXHA 4NK5A 2FPOA 4YP5A 4Z1OA 3WIOA 4E3ZA 1WXWA 2VHTA 2FPIB 1DDGA 5J1TB 3BGWA 2VQSA 2Q3LA 221PA 2PG3A 4I50F 4NJOA 2OHHA 1VLMA 2WMNB 2YXBA 5FBZA 3SYTA 3BH7A 5HIAA 1XPRA 1SUDA 2VAPA 2Q3DA 3HJCA 2IUTA 4ZZ1A 2E1RA 2R5NA 2ZIAA 3N9IA 2ZWMA 3PX3A 1CK4A 3C1TA 3HLTA 1JSZA 3GDHA 3IOMA 1CS4C 4RFLA 5LOVA 4DIEA 2P3LA 1E0DA 2C5FA 2OECA 5JD3A 1UBTS 3ZI7A 1ZR2A 3BAFA 2DUUA 1A9QA 1JAXA 2JHAA 4AYWA 2JLWA 1CE8A 4HLNA 1ETHA 5A62A 2VRCA 1KXJA 3ZCQA 3OMLA 4OFBA 5I8WA 2D5AA 2HWWA 4PGMA 1HH4A 9ABPA 7MHTA 4TQGA 4L57A 4Z1MA 4OXXA 5EWMA 1JEQB 1XVAA 1PJ4A 1X2EA 4FS3A 1MJFA 1L6IA 2HYIC 1C3OA 3AI2A 5JAUA 4L9SA 5DX8A 3V48A 1MMFB 4MVXA 1V45E 4BC0A 4U0KA 1DSSG 1X77A 1LH0A 5KSYA 1HI9A 1P7VA 4WA7A 6REQA 3T54A 4XJXA 2IWHA 3VO2A 3M2TA 3VYTB 1XEWX 1ZMRA 2WINI 2XKBA 5DHQA 4UTVA 1T3HA 3AHEA 1FZQA 2L69A 1HTBA 2CJPA 3I0MA 4AP5A 2MSLA 4LN1A 2ZUBA 4Y6PA 4ECEA 1KMCA 3SQMA 5LFAA 4PIMA 1DRJA 1XGKA 3R9XA 4CM4A 4J1SA 4DANA 3AL0C 2Q6OA 3P5SA 3MC1A 3KEQA 2I1VB 3ZBUA 3GDFA 1RPAA 1IEQA 1X74A 5TQJA 1IPHA 2PIAA 4ZCLA 4YRBA 4KRFA 3CV3A 3ZEIA 1UKVY 2H07A 2R7KA 2ZRGA 5IUKC 1T8PA 3CLVA 4UU1A 5IANA 3LP5A 2COEA 5HKOA 2BPOA 4WGFA 5CLJA 1O4WA 4IQFA 1X87A 2PBZA 1Y34E 3CCCA 4B9AA 4BKPA 1RYZA 1B43A 2PY6A 4KXFB 1X9IA 1DJOA 1USUA 4UDYX 4WX2B 3RREA 5IN5A 3FKJA 5DBOA 3ULKA 5GIPE 1V6CA 3DA8A 2DTXA 3CN9A 3DEZA 1K92A 2GA8A 2WFZA 2XF8A 3PUIA 1YNSA 4AJIA 4DSUA 1MEEA 4WN9A 1FIUA 1V95A 1CG6A 4IMPA 3EA4A 1T2VA 1RW4A 2JA2A 2VDKB 4MNTA 3BRSA 1U8ZA 3AJ9A 4ZVUA 4KJZA 4A0FA 4PO3X 1C4XA 1P2GA 2ZWOA 3GLRA 4Q02A 1E89A 4OA8A 1QIHA 4U6NA 3W9SA 4HXFB 4RVCA 1TZCA 1L9KA 3GY0A 3M8KA 4IIYA 4L27A 5ADHA 3PYMA 1XMSA 6ADHA 1M66A 4BBJA 1L5KA 1NBMA 4B6FA 2IZ6A 1GJRA 4PFJA 1NBIA 2YZMA 1L7PA 4PLTA 1G8FA 1TGVA 5A0TA 3CX3A 1OHHD 1XWIA 2FV8A 2EBFX 4W9RA 5ELLA 5T4EA 4Y2JA 1BNCA 3ZGVA 3ZWXA 2JKVA 2TS1A 2F3SA 3VH1A 4BO7A 4X54A 1WS6A 1M6YA 4NZ9A 3O84A 3CQ9A 1KDYA 2RHLA 3GG2A 4EB6B 1WJGA 3MD9A 3RVRA 4KYIB 3TW0A 5EMMA 3WY9A 4ABYA 4ENRA 3GDOA 2ZJ1A 1K89A 4GW3A 4RF5A 1M2OB 3F3SA 2R6GA 3LY5A 2A0WA 2XBMA 1U9YA 2ZRMA 2VLIA 3BD6A 2RHDA 3KE8A 1AKVA 1GLNA 1A8SA 4IZ6A 4TGLA 2B5OA 3VR5D 4PR0A 1WZNA 5CYFA 4M1QA 1CNFA 3PUVA 2CXQA 4EG7A 3JQGB 4F97A 4RACA 1S3FA 2PX6A 3MWEA 3ZXIA 4NYJR 5I5EA 1DKQA 1C4KA 4G84A 4JIMA 3OIFA 1EVEA 3L01A 5A6SA 1D4ZA 1TZMA 3B6MA 3VC3A 2IE8A 4CCAA 3GLKA 1ZUIA 3WWYA 4WJZA 4MQFA 5LMZA 3JVDA 2WICA 3GAZA 2FW8A 1G5IA 3IV6A 4NENA 5IFKA 4AQ7A 4KPYA 4EELA 2CNLA 3E9MA 3I2IA 6ABPA 4EPYA 1D0VA 2TSYB 3DEFA 4W6QA 5DBEX 1Y1SA 5ICCA 3ZQKA 3OURA 4EMSA 1IM8A 1O6GA 1WHTB 1ZEJA 1Z45A 2PL3A 2J7KA 3M6MD 3MLAA 1FQWA 1NT2A 3OQJA 4V0RA 3TLGA 1PG5A 4GBMA 1KRHA 4D7AA 4LWPA 4G5QA 3Q85A 3WI7A 4J0DA 4MV3A 2C96A 1BKDR 3PWKA 3QVJA 3VR2A 3WMRA 4EGAA 1PYDA 1RWBA 1KY3A 2ZIZA 1PF7E 4RDXA 5HKKD 1GT91 3O9VA 3PQ2A 3NS7A 4QRDA 1NUPA 1YCFA 3VUFA 1X7ZA 1V3TA 2YASA 2YIVX 2PUFA 3SQOA 1YFZA 1CY2A 1QYWA 4DA7A 2PFGA 3KOUA 1M5TA 2BF4A 4DRYA 1WNTA 1DEKA 1YZFA 2Q2QA 3PZRA 3W5SA 3AVXA 4M0LA 1YR6A 5LXTF 3ZCUA 5K0FA 1DPGA 1KAMA 1HO3A 3P1JA 4RDIA 5T4HA 2O2YA 5EUMA 1FVOA 3L9XA 2D1SA 1THMA 4WECA 1RBZA 3WB2A 1ESEA 3WBBA 3ZE6A 3L0YA 5DIFA 2GJKA 3KJIA 1Z12A 3DMRA 3ANYB 3WZ2A 4HXEB 5A6VA 1EU1A 5FEUA 4QNNA 3EGCA 3PC3A 3HCBA 4E1AA 2DQYA 2PZAA 2Q4OA 3H11A 3KCNA 1BFUA 3OC6A 4H4DA 4ZU1X 1EJ0A 2EP8A 2I78A 1UXJA 3F5SA 3G0GA 3PFIA 2QUIA 1UDWA 2VI5A 4JLJA 2FPUA 3VMMA 4GP7A 1PJ3A 2ASVA 3BD9A 2OMEA 3D2AA 2BFAA 5FRDA 2I1LA 4BE4A 2NTEA 5EMJA 1QFSA 3C4JA 3D6TB 3KBOA 3AOEA 5T6BA 3T7CA 3PXGA 4A9AA 4EUNA 3QWBA 2H06A 2B8JA 1EFVA 1EB9A 3L4EA 3BC1A 2QSUA 3L8YA 3P45A 3WZLA 5NULA 4FYJA 1SXQA 1FMJA 1XTTA 1ZIPA 3RRJA 4M8SA 1W8DA 2BEUA 1MRSA 2ATXA 5B2EA 2AMJA 3FHJA 4FD2A 4EH1A 4Q66C 2P2LA 3R3HA 2P9BA 3VFDA 4IHQA 4ILEA 1NXVA 3R3WA 2AHOA 3C6BA 3EOAI 4OJNA 4OLHA 3HJNA 3X1WA 3U26A 4J91A 3U62A 3D7RA 4UOEA 2BIFA 2XGSA 3KYDB 3A3YA 3JYPA 1MA0A 1M2VB 3R75A 4MVJI 3K2EA 4D4IA 5HF6A 2CBGA 1H5UA 1JQDA 1TVEA 3F4LA 4ER0A 5C52B 1NVEA 5JD4A 1ZCZA 3T7DA 1SRQA 4QDUA 2FSFA 4D4KA 1W5AA 5KSOA 1N2HA 2G71A 5HBGA 3NBUA 2IY7A 3VSDA 1K08A 1NNLA 2H8GA 3MWFA 1JN0A 5EZYA 3E15A 4H1UA 1V3VA 4O4IA 2DBQA 1E0JA 5IAKA 1M73E 5IT0A 1QVAA 2YWFA 4BIIA 1OY1A 5AFSA 2QEQA 1IXKA 1CQIB 1Y33E 2FX2A 2V7VA 3RIYA 3AIMA 4WWHA 4CTOA 2PU5A 1HL7A 2PPVA 5CX4A 3A6DA 3IKJA 3VQTA 1X70A 3B20A 3HXMA 4L22A 3V8MA 2ATVA 4CM3A 2FUNB 4QU9A 5CUQA 2PJDA 2WYWA 2WM9B 5EP4A 5L3ZA 3ZLBA 4I7EA 1LPPA 1SXJA 1P1FA 4OI4A 4D9CA 3LGSA 3UVEA 3HCCA 4A8JC 5E8RA 5IBPA 4DLZA 4EF5A 4H35A 1ZD2P 3OCZA 5U9CA 3G2MA 1RT9A 3LA8A 4TUYF 1G55A 4OHKA 4KFUA 5KNCH 3PVSA 4RJIA 3BRCA 3JYLA 4K9MA 5MGNA 2GYUA 3AEXA 4DWWA 1BCRB 3I6MA 3DOHA 1J06A 1L1QA 1S8NA 3H7IA 4ZC8A 1CR1A 1OLSB 2CL5A 3G7SA 4KXNA 4E4TA 3G59A 4KWHA 1GCAA 4TOIA 1LXCA 4O6VA 4X44A 3GFQA 3U1TA 3UPDA 3PG5A 4HNTA 4KUHA 1B26A 2PL5A 1R50A 3BREA 3GJ0A 1KI2A 3R5TA 4WFKA 5F1KA 5KYUB 3H0CA 3MFYA 2D2FA 4Z3DA 1T5OA 4OQDA 1M7BA 1Y4SA 2VYCA 4I5IA 3UJNA 1Q0UA 1OMOA 3AR5A 3FMOB 3RG2A 4BO8A 2CXTA 2BN4A 1E6CA 2AYYA 2D7DA 1RZUA 1A04A 1AZLA 1JE0A 3MHTA 2B92A 3EHDA 3AR8A 4N5HX 4JUIA 4MDYA 4US1R 3A25A 2C59A 3KOXA 3T1YB 4EPXA 5J5CA 3B51X 4RD2A 2YKGA 4INAA 1JJIA 1XL0A 1QHGA 3RSZA 1AUPA 3O73A 1KSFX 2I2DA 5D3QA 4QFBA 3DNFA 1EFRA 2I0FA 3KSZO 2Q8PA 1YS7A 1ZJYA 2F43B 4P7JA 3K0CA 2ODEA 3QVGA 4HAXA 1CEYA 5AK0A 3FPAA 1KJIA 3U7EB 1I3CA 2AFHA 1Q92A 2E6UX 4E08A 2O8EB 5A04A 4YA6A 3L1HA 4XYBA 1NDUA 3RAFC 3B36A 3G5LA 1KYZA 1ZGGA 1QBGA 2W37A 4GX5A 5EP3A 3TLEA 4AO7A 2D62A 1EESA 1VDZA 3ETEA 3S8YA 2CHVA 1ADBA 1I0IA 2EP5A 2C42A 1JFRA 3EEBA 2H7CA 3NTVA 3OY7A 4KK4A 4RZHA 1ZRHA 3L7CA 3LT2A 1NZFA 3OQHA 5F4ZA 1N32B 4J7CA 1TRKA 4Z54A 1CUIA 2P9FA 4P2GA 1N2CA 3IE0A 4TZ6A 5H59A 2VQFB 2C2WA 5EJ2A 4MGYR 1DEHA 1FDSA 4CFYA 3A1VA 4BL5A 4A5OA 1UBMS 1YWGO 1G4AE 1CF2O 4OFWA 2XLCA 3N0WA 4K88A 4MS4B 4W7IA 3EVFA 3P0RA 4DWJA 3B8HA 3NFRA 1NOJA 3LFUA 5KC8A 1BIFA 4LZLA 1FPMA 1ECFA 5KC9A 1FFGA 5JS7A 1OB5A 1KAEA 1W49A 1GKIA 1X19A 3LPCA 3NIWA 4YUVA 4I2NA 3TZKA 2VXCA 4A16A 4I14A 3KAPA 4LJYA 1GFWA 3ONWA 3PQ4A 3QKRB 3TW4A 2J46A 5FHQA 1PO7A 2E18A 3TIIA 2PZMA 4YJ3B 4ZHSA 1AO3A 4L6CA 3SDSA 4EVQA 1YQ9A 4Q4HB 3SM3A 3NOVA 3CHYA 3EJWA 4JUCA 4P3KA 5JJIA 2RAFA 1VJCA 5AVWA 2YUTA 3TCNA 1NNI1 3R7WA 5LUBA 3ZWOA 1SZPA 1Q0RA 3V6MA 1Y9ZA 3KSAC 2AF4C 1H1TA 4MPDA 4WZAB 1D2NA 3DMTC 2LE0A 1QVRA 2DULA 1ODCA 2WTEA 3T9EA 4R9NA 5HZKA 1WLYA 2XQVA 3KQSA 4YLGA 1W96A 4ND6A 1VJ1A 2VSYA 1TX4B 4KTVE 4MW2A 3Q7TA 4P53A 4P7KA 1C1DB 1CQPA 1U9CA 1P18A 1II8A 5SZIA 3WBJA 4F86A 3DYIA 2YMMA 3JV7A 1MO3A 4I5DA 1Z8NA 1F0YA 3ETNA 1XD2A 1F9EA 2I6GA 5FFNA 3RVLA 4NIMA 1I32A 1DJMA 3X1MA 1USIA 3I42A 5ES4B 2YV1A 3P2IA 5EN4A 5L45A 1XPOA 4BQNA 1KEEB 4X5OA 2BH2A 3O8QA 3EX7C 1N6RA 1SOVA 4XIGS 5TPWA 4MPJA 5LVAA 2XRZA 1XLWA 2XDWA 3AO0B 1CUSA 3GJRA 4FFBA 2GXSA 2FSVA 3LK6A 3R7LA 1OB2A 1E3TA 1R5BA 5KBYA 3AF6A 3FMFA 3BGSA 2PKRA 4HLCA 2Q4DA 3EW7A 4INJA 3LZDA 2TMDA 1R18A 2JDID 2BLLA 5AOAA 4CV3A 1R3DA 2WVJA 4I08A 3GJXC 4MUNA 2WFLA 3A32A 1PCXA 1CF4A 3B8EA 3GRYA 4EEKA 3CUTA 1WULS 4R9SA 2F55A 4AY6A 1PL0A 1PZMA 2FPLA 4JWKA 3U4MA 4TXJA 3BHMA 4DJFC 2GM3A 1O9GA 1J2JA 1HE3A 3AESB 1OBFO 3F6BX 4YI5A 5JCOC 4JAVC 4GBJA 2YY5A 4J90A 3BORA 4C4AA 3HEMA 3BRWD 1YQQA 3N8GA 4DHEA 4KW7A 1Z0KA 4OMCA 1N0WA 4G2TA 3ZE7A 4IHAA 3MLEA 4LNUA 1CB0A 1Q17A 4FILA 3O4HA 4M87A 4DVGA 1Y1PA 1E61A 2YINC 3FHLA 4H1VA 5A7HA 4C7XA 4RFSB 1X7WA 2EOAA 3PGA1 1W85B 2HRBA 4H18A 4HRAA 4NVRA 4ALJA 5LB2A 5P21A 5JT1A 3QWFA 4F3TA 4KDRA 2QIOA 2I3DA 4EGSA 5JQWA 4HQ0A 5CYOA 4BO1A 2GNAA 3LVBA 2X2PA 1JHQA 3IEIA 3OF3A 1CUBA 3QVTA 1TW3A 2NT4A 2JLXA 2ABWA 4HGQA 2C5AA 3VNRA 2B21A 2W48A 4O1IA 3TXXA 4B4UA 4R7TA 4MGKR 3IRUA 1UM8A 2Z6AA 5HIIA 1S4MA 1K8YB 3DE2X 3F78A 3LQ2A 2VT7A 2ZJOA 1H3EA 3ANNA 4YX9A 3NTUA 5HTOA 4F9EA 2FXVA 3TTWA 3PVZA 1O77A 4HDNA 5FAKA 2W43A 4OJYA 1AZTA 2QLTA 2BSAA 1EVKA 2JHGA 2XWJI 1AKYA 4MWBA 4MHOA 1I3LA 4RIEA 2I65A 4L28A 4LZZA 4LVUA 2LKCA 2XHEA 4ZO7A 5KQRA 5KVQA 4HGRA 3HM2A 5AVZA 4RJTA 1W0JA 2ZYRA 3WGGA 4EAAA 1P2TA 4REQA 3F5DA 3A1FA 1QVVA 4P4NA 5CK5A 4A6XA 5COAA 4RETA 1EA5A 2YWEA 5KYVA 1YA6A 1YVRA 1X14A 2W6OA 4RAOA 1L7BA 1DCFA 4OL0A 2V4UA 3CB4A 2O2SA 4LJLA 3R3YA 4F5WA 4BO5A 1QCCA 2A5YB 5CRIA 3JTEA 4TLEA 2OCIA 3E22B 3EN0A 4MVJE 5ED4A 2UZ1A 2ZJ3A 1SKMA 2FSHA 2B3TA 3O38A 5ESRA 5LLSA 2W6ZA 4PTLA 2IX3A 3CT6A 3TFOA 1BKSB 2EGHA 2J7PD 5GPBA 1E3MA 3FJOA 1GILA 1RXEA 3JQBC 4OSOA 5DLQC 4BDTA 2QTRA 5A4MS 5EHZA 4MI9A 1KZ9A 4ED9A 3WSTA 5I7SA 3ZV4A 3EQ8A 2YBEA 4ZDKA 2WJWA 1T0IA 4Q3CA 5DWVA 2COKA 2V8BA 3VU3A 2DPHA 1ZDMA 3G9UA 3LBFA 1NVBA 2MTBA 3I1IA 1CERA 3N1UA 1DL5A 4QPJC 1LF5A 4X7RA 3TKAA 1SCDA 3P9ZA 2PJUA 1FYDA 3GH1A 3MXOA 4HNGA 3NHJA 1L5RA 2XUPA 1HE8B 1R4MB 2KQUA 4YUYA 3SICE 2YTZA 4E5MA 3X1XA 1EM8A 4IYRA 4OMFG 5SV2A 3RK4A 3UIEA 3CX7A 2QRHA 3OE1A 1ADGA 4QUEA 2NYRA 3R0XA 4KDCA 4KL8S 4TRJA 3NORA 2ZE8A 1Z2AA 4R16A 1A8PA 4CF5A 4F45A 1V1MA 2YVLA 1E2FA 1G59A 3P0IA 4Y2QA 5A03A 3TQRA 2XODA 4D80A 1N25A 3U9TA 1NAIA 4FOLA 2Z43A 4NSNA 3FWZA 3VC7A 1ENYA 3ZI0A 1UADA 3LWDA 2JG3A 1TVKA 2YZ7A 4H7JA 3RSHA 2OBBA 4BFVA 3W1VA 1ZEMA 2BISA 3CH6A 4L4UA 4UHDA 1YB5A 1IXSB 3ISJA 2HEGA 1XLVA 2WG0A 3IAS1 4AJPA 1YE3A 2XHZA 3Q40A 3U5TA 4MQLA 1P6UA 2FUG1 3O82A 4FDUA 4IIJB 4LCEA 4MVJH 4RMGA 2OAQ1 3K6SB 3G2QA 4Z4EA 3LK7A 4FI3C 2BEVB 3FI9A 1MW9X 1JG1A 5TRTA 1FQOA 1NULA 4N76A 3KJXA 4L08A 2EVWX 3ZHRA