2HK9A

Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and nadp+ at 2.2 angstrom resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
b'MINAQTQLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDEDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAKLLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate dehydrogenase
publication title Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2hk9A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 2hk9A01
3EW7A 3DZGA 5JCJD 2GN6A 3GT0A 4DYDA 1A27A 1HDRA 4C7JA 1QXSA 3U4HA 4RZIA 4ZJUA 3PHHA 1D1SA 2VCYA 3DZJA 4HFMA 3QWAA 2H6EA 2H63A 2PGLA 4WLOA 2W2KA 4A10A 4PLCA 2P5UA 3VPSA 3W8DA 4E21A 3FWNA 3BIOA 4D42A 1GV1A 3Q9NA 3DHEA 2CY0A 3LVFO 4BNNA 2RHCA 5CDUA 3LC7O 3DMTA 3ETDA 4CQMA 4NR0A 1BDBA 1BDMA 3MOIA 4FQ8A 4DVJA 1VL8A 3GMSA 1H6AA 1R4MB 4R4JA 4U6QA 2D5CA 1ISMA 5A05A 4IIUA 1Y8RA 3O9ZA 4IS3A 2GO1A 3OJOA 1VSVA 1OBFO 4I5FA 4WLFA 3KEQA 1DEHA 5ILGA 4RDIA 2DTXA 4S3MA 3WWZA 3PHLA 1V6AA 1NFFA 2AQHA 1ULSA 2DTEA 3A06A 3WSVA 2FZWA 2V6FA 1OC4A 1E77A 3VHRA 1YDEA 3ITKA 4D44A 4M1QA 1NVGA 5HM8A 5JDCA 1ZIDA 1C1XB 1Y9AA 4NMHA 2B4TO 2Y68A 4AJIA 4D3SA 3BHIA 1LNQA 1PZEA 1OI7A 2BMAA 2ZJ0A 3DXFA 2EW8A 1ARZA 2WDZA 3ZWBA 5HS6A 1HDGO 1Z7EA 4GLLA 3SX2A 2X86A 5IDYA 4BQRA 3PVZA 5KVCA 5L3ZA 1BVUA 1NHWA 3PPIA 4DYVA 1NP3A 3D3EA 5DBFA 1NPYA 1PWZA 2IZZA 3M6IA 4A26A 3JYPA 3GPDG 2EG9A 3OIGA 4OOFA 2GNAA 3QW2A 1GYQA 3RFTA 8ADHA 2YV2A 3A14A 5B37A 5CDGA 1L1FA 4F46A 2VNSA 3P2YA 4PLWA 4QT0A 3F1LA 5L4LA 2GSDA 4RPLA 3TOXA 1BTOA 2QYSA 4MVJI 2G17A 3JQCA 3FRJA 1P45A 3HG7A 2E49A 3JQAA 3GMDA 3DONA 2EJWA 4WGGA 4IQ8A 3N58A 3NJ8A 2QIOA 3H9UA 1C0PA 4J4TA 2BFMA 4XYMA 1LSJA 1U28A 4R69A 5TNXA 4BNHA 1YB1A 2VT3A 5IF3A 4E12A 3NT5A 5BNTA 2FSSA 5HA5A 1K3TA 4FJ0A 5TS3A 3VH1A 2C29D 3AW9A 1EVZA 1DC4A 4O0LA 4U6SA 1O95A 3A9WA 3FWZA 1H94A 1E0DA 2P4QA 4YR9A 1NAHA 1RYEA 4YJHB 3I52A 4PG5A 2GZ3A 3HFSA 2CUKA 3GZ4A 4BGVA 3F47A 2DKNA 3KYDA 5CEFA 3DTYA 3CKYA 2TMGA 4AJLA 2NU7A 3VVBA 3IJPA 5BR7A 3I9MA 2AEMA 1U2DA 5THKA 4IDEA 1DRUA 2Q49A 3BXXA 1A9YA 3LLSA 4MO2A 4OOEA 3UHAA 5LCXA 1CYDA 3PHGA 1IPEA 4Q3CA 2CVZA 3B6ZA 3OEYA 1EVIA 3CZRA 3L9XA 4NK5A 5DCYA 1P1HA 4FOOA 4J2OA 3RKUA 3RBZA 4YRBA 2GR9A 2E37A 4IJKA 5FI3A 1C1DA 4IJVA 2UUOA 3FR7A 1PIWA 3VH2A 3H3JA 4E6PA 1PJ2A 4R1SA 3OH8A 3FPCA 1LLDA 5A3JA 2NVWA 3GHHA 5F5LA 5FFFA 4TRMA 4U0JA 5DN9A 1NPTO 4LRSB 4AJKA 1GPJA 3OEWA 5KOIA 4ALMA 3IL2A 2BFPA 2C7VA 4UVIA 2P9GA 4AVYA 2YHUA 3QLJA 4NU6A 5FI5A 4A27A 4CUKA 5CEJA 3K5PA 2FRDA 3F46A 1EE9A 1ZKMA 2YQ5A 1U7TA 1OFGA 4YAJA 3GDGA 1A71A 1ZEMA 4EBFA 5L95A 3GDFA 1N7HA 1JLLA 3ZV4A 3ANMA 2B0JA 1UDCA 4PLZA 4ITUA 2X9NA 2A35A 2X23A 3D1LA 3F6YA 1HRDA 2V65A 1WDLA 1VL6A 4CM9D 3HDYA 4HADA 4MDHA 4TMFA 2GGSA 1P1FA 1GCOA 3QSGA 1F14A 3SLKA 3ITDA 4XGKA 4NFSA 5U4QA 3NKLA 4H16A 4CL3A 4IMPA 5CPBA 1IYZA 3JD0A 5ER6A 2HUNA 4UULA 4G81A 3VDQA 1NWHA 3P7MA 3PTZA 1GQYA 4J1SA 4CLRB 2ET6A 3GC6A 3PYXA 1UZLA 5TQVA 2CDCA 3AUUA 3HWRA 4B7XA 4TSKA 1ZVMA 3GG2A 1YWGO 4Z9FA 3TL3A 2EP7A 3HJAA 1H6BA 1KC3A 2NVUA 4ZRNA 2YV1A 5B4TA 5JCXA 1MX3A 2RAFA 6ADHA 4E2XA 4LMPA 4MP8A 1HYHA 1BW9A 1QYCA 1WWKA 2NQTA 2GLXA 3H6KA 1ISJA 2IE0A 2NU9A 3A4VA 2UUPA 4O59O 4Z9XA 1R0LA 4LW8A 4BNTA 4A2CA 5IAAA 2C54A 1CQIA 4XCVA 3V1YA 1KY5A 1X14A 4E0BA 1VL0A 1WNTA 2Y1EA 1LDBA 4H15A 3C1OA 3RUEA 4BKPA 1EK5A 4RVUA 1QV6A 3AM4A 3X2EA 5B4VA 2P9EA 2Q4BA 3RVDA 3WGYA 1PL7A 3OQ1A 4OL9A 4Q3DA 9LDTA 4Q3AA 5G0VA 3ABIA 4A03A 1T1RA 3GA0A 3BTSA 4CV0A 3E48A 1U2GA 4P4LA 4IBOA 2C2YA 2DT5A 2NUAA 4QFDA 4JJGA 1UAGA 2ZB4A 1I8TA 4QO8A 4CM8A 5G0TA 4Y98A 3C7AA 4CLHA 1I2CA 4PLVA 5JE8A 3HHPA 2HJSA 1MXFA 3E03A 3KTDA 1TT7A 4MVJG 4NPCA 2VZ9A 3MJTA 3RUHA 2QZ9A 5ENDA 1W6UA 4EYEA 1P44A 4OQYA 3R0IA 3GK3A 2B69A 4CMGA 4FFOA 4NFHA 3VZSA 5CG1A 3NT4A 3TNLA 3VDRA 4FPXA 5BNIA 3RSHA 4C4OA 2O3TA 3HFGA 1ZSVA 4RF3A 4BB6A 2O3RA 1FDWA 1RM5A 3DB2A 4BMSA 2Q45A 4G65A 1L7DA 2IRWA 4MIEA 3F4LA 3ICPA 4PLGA 4PIVA 5TT0A 2QX7A 4IDGA 1LLCA 1GD1O 4YB8A 1UH5A 1I3NA 2BRUA 1QLHA 2IEDA 4F3YA 4H7PA 1NVMB 1IHXA 3Q0EA 3OHSX 3AI2A 4D43A 2Q2QA 4A73A 4S1VA 3ZWVA 1ZMOA 5TGDA 3DBHB 1G0NA 4GX1A 2DPHA 1LRKA 2Y0EA 3B1JA 3P19A 5C7IO 2C20A 4ZICA 3DTTA 4J1QA 1YB4A 4D0SA 3K2BA 1YGYA 3R3SA 5DZSA 1DIGA 3V1UA 3QIVA 4BB5A 3S2GA 4UAGA 3EZLA 3DOCA 5LDGA 5CFZA 2A4KA 1HTBA 4WLEA 5U1PA 2HMVA 3AJRA 4RGBA 3UGKA 1H9BA 1B3BA 1E7RA 1FF9A 1LDGA 1P0FA 3E18A 4MINA 4KQXA 4QO7A 3ROPA 5IFLA 1IZ9A 4R9RA 2GRAA 5JNLA 1E3IA 1I30A 1CIVA 1GTMA 2X7HA 4CR6A 4GKVA 4GBJA 5KJ6A 1GQ2A 2WWRA 4RPGA 1A7AA 3GH3A 1EFKA 4CV2A 3C7CB 1E6WA 3TFQA 4NU5A 2VYND 1QLJA 3FBTA 2Q2WA 5L4SA 5A04A 4GMGA 2Y1CA 1E5LA 2PKRA 4PCVA 3G17A 4LCEA 4DBZA 1J0XO 1T2CA 2I99A 2W2KB 3I4FA 1XYGA 3I9JA 5HWSA 2YV3A 3JYNA 4PN3A 2PGDA 2Q99A 1GADO 3AU8A 3WOHA 1I33A 4EUHA 5EERA 2POQX 1BHSA 2JD0A 1YKFA 4L74A 1E3SA 4ALKA 5KVQA 4CQMB 3Q1LA 4UVDA 3KYCA 2EGGA 4MP3A 4GPD1 1ZMTA 2YHIA 3ZU5A 3LF2A 3RC2A 2AEFA 3I1JA 3GNSA 3PWKA 4PZEA 2BFAA 2UAGA 3U62A 5IZ4A 3W8EA 1DB3A 4JIGA 1Y8RB 4OM8A 1PJQA 4PLFA 3F5QA 1HLPA 4Q9NA 1KVRA 1JKJA 4OYRA 1B16A 3PXXA 1U1IA 4R3NA 1EVYA 1SBYA 2W2LA 3DL2A 3SJUA 3JTMA 3O8QA 4R1UA 1Z45A 3NDRA 2NM0A 3UH1A 3ICCA 1JN0A 2PH5A 3GAFA 4J0FA 3K96A 4B3JA 3L4SO 2NV6A 1J6UA 3OBBA 1KVUA 3HB4X 1AHHA 5A02A 1J49A 4XDYA 5I9NA 4GSLA 1HE4A 3KLPX 3QVOA 4AJ1A 4BNLA 1YH3A 2NTVA 4AICA 4FD3A 3WQQA 5JDIC 3JQFA 1PWXA 1ZK3A 2J3JA 1YQGA 3L6OO 1HDCA 4IMRA 4R5MA 3VZPA 4PZCA 4ZRMA 5T8KC 5FEUA 1WW8A 1W73A 2CSUA 1PZFA 2PTGA 1T24A 3I4CA 3BZUA 4ND3A 4TVOA 2DBRA 2OBNA 1V3UA 2VHWA 4PG4A 3ZWAA 2HK8A 5H82A 1DO8A 2V7PA 2FPIA 2WE8A 4IZHA 2X6TA 4IDCA 4TVBA 1B8PA 4MIOA 3JQAB 1DIBA 3MJEA 3SEFA 1QYDA 4QX6A 3GOHA 1LSUA 3IKTA 1A5ZA 1MUUA 5G4KA 2ZB8A 4P22A 5A5FA 2QHXA 3KXDA 4OXNA 5IDQA 4B8ZA 1HDZA 4GWKA 1ENOA 1PJ3A 4B8WA 4E31A 2CFCA 4JLWA 4KWHA 1YB5A 4XYLA 1Y6JA 1U7HA 6LDHA 1R0KA 4YEDA 1EBFA 3UCEA 2VHVA 2ZYDA 3RQSA 3MTGA 4GVXA 3WGGA 4YRDA 1MXHA 2D8AA 1PJCA 1SZJG 3KYDB 4NBRA 1HZZA 3G79A 3O03A 2J3HA 1DPGA 3RUDA 1ZNQO 1D3AA 3RCBA 2HAEA 3DOJA 1JKIA 2O3UA 3HSKA 5ICMA 4XEHA 3NEPX 3WFIA 2EKLA 2VOJA 3AOEC 4QEDA 4MVJP 3TZCA 5KKAA 3M1LA 2XAAA 3ZW9A 3WGHA 1E5QA 1GQQA 4XGNA 4O5OA 5DCWA 5CDTA 1N92A 2YFHA 5EIOA 3CZMA 1DLIA 3FI9A 2VNAA 2DBVO 4Y6SA 5A9TA 3DZKA 4E30A 1LQTA 1U3UA 3FNFA 5TT1A 2QRKA 5DOVA 1SEPA 1DSSG 1VC2A 3ENKA 1YE3A 5KNLA 2XF8A 3VKVA 3GNQA 3S55A 4ROSA 4XIYA 3PHIA 4W6ZA 3VPHA 1CRWG 4YPOA 2DC1A 5I9MA 3MJSA 1IY8A 2J5RA 1TEHA 4JK3A 3B70A 1QSGA 2E6UX 3RBXA 3BTOA 4BV9A 2A9FA 4CUZA 4BNMA 4DA9A 4BNIA 1NNUA 3GFBA 4XRGA 4N5NA 5I7SA 5DBGA 2V6GA 5JW6A 2I5PO 5KTKA 4BO5A 4FIZA 1X7HA 3OF2A 1A7KA 4GGOA 1PZHA 4WJZA 1PR9A 3VTZA 1CDOA 3H2ZA 1VJTA 4NJMA 5L7WA 2D5AA 2YDYA 4FC6A 5A03A 4Z9YA 3WMWA 2PGJA 2VHZA 1SC6A 1YOVA 3VC7A 2XXJA 1QORA 2OORA 4M89A 4PVDA 3W6ZA 5JMWA 3WDSA 3U0BA 1PJSA 1KS9A 1FK8A 5ITVA 3ETEA 4WCDA 1ONPA 2EHDA 1KEPA 4L0QA 1DC5A 4J49A 2HMWA 5JCJA 2C5EA 4E3ZA 1GUYA 1BRMA 1LSOA 3WGIA 4DRYA 1V35A 4R16A 2YY7A 4N5MA 1AXGA 3I9NA 1IZ0A 2O4UX 5L53A 5JY1A 4RF2A 3GAZA 2PZJA 3DAFA 2D0IA 2AE2A 4I5EA 4CLDA 4PZDA 1T1SA 1P1KA 1MGOA 3Q3CA 4JNKA 4TQGA 1NYTA 2NVUB 5JYDA 4K6FA 3ZWCA 3G49A 4XZ3A 3I5MA 3H5RA 4HV4A 3DHNA 3LK7A 4CODB 4CM1A 1BW9B 1EZ4A 4WCFA 4HNGA 5JAMA 4W9NC 1GYPA 3MOGA 3JYLA 4FB5A 3MJCA 3WIDA 2VZ0A 1VLLA 4PLPA 1T26A 3GRKA 2X0RA 4RVGA 4GI2A 4KTTE 3DEYX 4IZIA 3HUDA 2ZCUA 2GASA 1SEVA 3WGZA 2PFGA 2W4QA 4CMEA 3A28A 4DREA 4XDZA 3AK4A 1NQ5A 3ONDA 4CMCA 3HE3A 1LDNA 5A9SA 4QTZA 5HTOA 3B20A 4CM8B 5JXWA 1HEUA 4J1TA 4DPKA 4IXTA 2AEJA 3D7LA 1CJCA 1B8VA 2FP4A 3NTOA 1U5AA 1HDYA 2ZYAA 4LGVA 1YQXA 1UZNA 2BHLA 3ROQA 2BGKA 2R2GA 2Q3EA 4CUJA 2FY8A 4WLNA 1ADCA 1BG6A 2CZCA 3V8BA 4BIIA 3DMTC 3PLRA 1E7QA 4OH1A 1ENPA 3ZV5A 2D1YA 5L7TA 5CAEA 1U9JA 1HSZA 5KJ1A 4WLVA 5GZ1A 2UDPA 3X2FA 4WNIA 3JQBA 3ZHYA 3GFGA 3K9QO 1PGJA 2E48A 4RZHA 4PFJA 4BS9A 2HSDA 4O63O 2B4QA 4MVJE 2JHGA 4FFMA 4GQAA 1WMAA 3ASUA 4HFNA 3KLMX 4WOJA 5JY6A 3N7UA 5TLSA 2C5AA 3FTNA 4CM7A 1VM6A 5K6AC 3WLFA 2YYYA 3ULKA 4DMMA 4BKOA 2NACA 5GZ6A 2PLAA 2Y1OA 4GAEA 4FBGA 3RJ5A 5JBIA 3WMXA 4N5LA 3IP1A 4M49A 4R3WA 2JD2A 2DTDA 4BQPA 1SO8A 3WWYA 2UYYA 1BSVA 4CM3A 1PJ4A 4FFNA 3KUXA 1HE3A 2QG4A 4M87A 1DIAA 1F0YA 2DU8A 2BGMA 3C7DB 4UEJA 3ZU2A 1I01A 2O2SA 3NGLA 1PGNA 4KOAA 4M86A 3WTCA 1UXJA 4B4UA 2JFHA 2EF1A 1KY4A 2WD8A 3F1KA 1MC5A 2NNLD 3FCOA 1UXGA 3GEMA 1ADBA 2DBZA 5K0ZA 1QYXA 3BTVA 4MVJA 4XR9A 4RPHA 5TJHA 4Z0TA 4DUPA 1F17A 2QQ5A 1A9ZA 4TWRA 1DBVO 4YJFA 3FF4A 2YW9A 1HKUA 3LC2O 1HWYA 1E6EA 4OIMA 4J90A 1D8AA 4Q3BA 1RM4A 2A92A 3I6IA 4QSMA 5GZ3A 1EMDA 1UXKA 1GV0A 3ANNA 1YBAA 1PGPA 1RPNA 5JLAA 4CQMD 3KYCB 4CMAA 2CMDA 2YHIB 1ZSYA 5G2OA 2Z95A 2DBQA 1QYWA 1JDJA 4NIMA 4URFA 4YACA 2XXBA 3AOGA 4OSPA 3NTQA 3WQSB 3JQGB 4MIYA 2EP5A 4FR5A 1K0UA 3TL2A 2GF2A 3ZNQA 4NI5A 5K9ZA 1KVQA 1M76A 4OHUA 3AI1A 4J7XA 1IE3A 4PG8A 1MP0A 1E3EA 4GMFA 3R6DA 5F1OA 3O8QB 4AJNA 3RWBA 3GVIA 2OFPA 4YA6A 1WP4A 1FDSA 1LQUA 3BAZA 1RM0A 4JN6B 4TZKA 2HKIA 2YDXA 3S8MA 1XDWA 3Q9UA 5F5NA 3HADA 2PV7A 3FNGA 3L4BC 4RQTA 1GCUA 4RL6A 5ILOA 3WICA 1KVSA 2AG5A 3DZBA 4AJPA 1A4UA 1HDXA 4J1NA 3L9WA 5TF4A 4MVJM 3A1NA 2AG8A 3DBRA 3SC6A 5A3VA 1DIHA 3ZWWA 3TJRA 1X0XA 3D3WA 2NTNA 4D3FA 3Q11A 1O8CA 1LRLA 1DFHA 2WM3A 1JU9A 3NAQA 2D59A 2FHSA 1GEGA 3GGGA 4ZQEA 3CTMA 5T57A 1SAYA 1V9LA 2BI7A 2OL4A 3JQ8A 4DL9A 4CV3A 3D5QA 2OP1A 4IJUA 3E9QA 5EN4A 3ZWNA 2JKVA 3JQAD 4FJ1A 4JXKA 3Q2KA 3D0OA 4NBWA 4TRJA 5F21A 1LRJA 4J9UE 4ND4A 4ALLA 1U4SA 3U49A 1K2WA 1UP6A 4D45A 4E32A 1X13A 3PIDA 5AQ1A 5G4KB 5IDWA 4HXYA 3DDNA 4QUKA 1RM3A 3ADPA 1DRWA 4IS2A 1RJWA 3KHUA 4A5OA 3BMCA 2EW2A 3PFWO 4UUPA 5EL0A 2FR0A 3IIEA 1S6YA 1TT5A 2YUTA 2FWMX 3WGQA 4ID9A 3PJEA 4K9DA 4BNVA 3QVTA 1SOVA 2PD6A 3TZ6A 2HMUA 3AUSA 4TRNA 4DPLA 3TN7A 5TX7A 1MFPA 4WEOA 5ITWA 5CEEA 3AY3A 2I3AA 1CWUA 1I0ZA 2P9CA 4RLSA 3EVTA 2CVQA 4N54A 1H0KA 4D41A 1T2FA 2NU6A 4FC7A 3QRWA 4YAEA 1LC3A 3LZ6A 1SNYA 3Q2IA 5AVOA 1AGNA 2EXXA 1XHLA 4F6CA 2HQ1A 1FMCA 2OZPA 2VWHA 3U3XA 1T4DA 3M2PA 2HMSA 3I9OA 4E5PA 3TZKA 3PJGA 4J7UA 3E9NA 4FDAA 2WJPA 5C7OO 1XQ1A 3RC9A 4FOSA 3TPCA 3ZGYA 4CMJA 3B1KA 3T4XA 3COSA 3DZHA 1F8FA 3AI3A 5EPOA 1VRWA 4NQZA 1ORRA 3HQ4O 4E5MA 1LI4A 3OQBA 2RBEA 4KMSA 5FF9A 4CM4A 1E3LA 1D7OA 3DBLB 5BSEA 3V1TC 5JFOA 3MEQA 4R68A 4BO6A 3TZHA 2O50A 3IQDB 1XU7A 4GX5A 1P1JA 5GY7A 3WSWA 2Q4EA 1SPXA 1DJQA 3C24A 3NDJA 4YJGA 1I24A 1BXGA 1QRRA 1Y7TA 3RIHA 5KVSA 1DLJA 4LCJA 2FPPA 4IDDA 3WYBA 4OJNA 3EY4A 2BLLA 3QWBA 4E5KA 1DRVA 3H9EO 2FN7A 3ZU4A 2F1KA 1LUAA 4NJMB 5JMPA 5G0UA 1JWBB 3HDHA 3VVCA 2OOSA 1YOVB 2FZEA 3FR8A 3DAGA 5KWEA 4CV1A 4YT8A 4WEQA 3PFFA 4YTEA 3QWHA 4CR8A 2NSDA 4GKBA 2VUSA 1EDZA 1ENYA 3BMNA 3KSUA 1T2DA 2DPGA 4DLBA 3LYLA 1S7CA 4I08A 4RVSA 1JTVA 3K30A 4R1TA 4X54A 3HZZA 4BNXA 1B14A 2GCGA 1B3RA 4Q3NA 4CMIA 5KJCA 3IDSA 3NX4A 5B1YA 4QFCA 1U5CA 2Q50A 1ID1A 4PG6A 4XQ9A 4K26A 3AM5A 4WNCA 3PQFA 1E1NA 4R01A 5DDIP 5JO9A 5KCZA 1EK6A 2C0CA 2X5JO 4AFNA 4WCFB 2BD0A 3OSUA 3QV1A 4WLUA 3STHA 2EGHA 2E4AA 1R4MA 2WE7A 3PEFA 1E7MA 2GN9A 2JL1A 3QVSA 1R37A 3NRCA 3UFXA 4M55A 3C1TA 4CQLA 5A06A 1G6KA 1E92A 2H1SA 3IOYA 4BO9A 1H2HA 1N9GA 1R4NA 1VJ0A 3K31A 1G0OA 1E7SA 4OXYA 3WBBA 1KETA 2QRLA 3WG9A 4KP7A 3EUWA 4ZD6A 3W1VA 4YAIA 5IG2A 3CMMA 2EERA 2VWQA 1OMOA 1AN9A 2PKQP 4ESOA 1CEQA 3JYOA 5A9SB 4J6FA 2WTBA 1UDBA 3BMQA 2B5WA 4Y6RA 4M8SA 1M6WA 5T64A 4FSHA 4DIOA 4U5QA 1QV7A 4YQZA 4DXHA 2CF5A 2A94A 1YO6A 3MZ0A 3B1FA 3QQPA 4XJSA 3LT0A 1DOHA 2B5VA 3CEAA 3V2HA 3D5TA 4ZU3A 2ZTLA 1ZO8A 4JJIA 2DUWA 1WVGA 4U8GA 4CJXA 4B7CA 4CLOA 3PDUA 5L7YA 1OC2A 4ONEA 4YAKA 1Q1NA 2AA3A 3PIIA 2Z1NA 3K92A 3T7CA 5KKCA 2J3KA 1MLDA 1E6UA 4XIJA 1CERA 4AJOA 2ZB7A 3TRIA 4XQGA 4FGWA 1IULA 1AUPA 4MVJF 4ZHSA 4FN4A 4UREA 4A0SA 4BO7A 3IAHA 4R1NA 3H4VA 1WMBA 3DAPA 3FPLA 1GEEA 5TSDA 2BFOA 3W8FA 1GL3A 3IJRA 1ONOA 1HZJA 4IGEA 1NQTA 3INRA 5AOVA 4BNJA 3ZHZA 1V0JA 3MJVA 1KIFA 3QA9A 2FR1A 3L6DA 3SXPA 1BWSA 1ZK1A 1M75A 2HK7A 4N18A 5B12A 2HRZA 5JAIA 4IM7A 3ZWPA 1QKIA 1HF3A 2IZ0A 1R16A 2BKAA 2OBYA 3WTBA 3CXRA 4R9SA 1HXHA 1YDWA 2Y1FA 3EMKA 4RDHA 1X15A 3H5AA 4KZPA 1IB6A 4B3IA 3S1LA 4P4NA 5IZCC 4J3FA 1E3WA 4BOYA 3PLNA 4W82A 5BSHA 2Q46A 4JP2A 4YDRA 4EEZA 5JAQA 4KDEA 2BF7A 2HMTA 2E82A 2Y93A 2DVMA 1XWFA 3IS3A 4EUEA 4R41A 2Y99A 4Y9DA 1ONNA 3D4PA 5L9AA 1VJ1A 2P4HX 1YJ8A 1P0CA 1E7WA 2ILTA 2X1HA 1LXCA 1NHGA 1N5DA 2BGLA 2C7GA 1C0LA 4AJEA 1KEVA 1OZAA 2GPTA 1GAEO 4L9RA 3WJAA 4YJFB 4DWVA 2HO5A 5EJ2A 3HB5X 1W0CA 5JDIA 2EV9A 2VTDA 4NBVA 5AYVA 1LLUA 1R6DA 4RCVA 1I2ZA 4KUEA 1DDOA 1GFSA 5T8KA 3GF4A 2UV8A 3AU9A 4W99A 4YRAA 4MJLA 1LLQA 4JJFA 2Y1DA 3GN1A 2OGUA 2B83A 4DQUA 1B26A 4EUFA 4F6LA 1DC3A 2Q1WA 2X9GA 1ENZA 3PGJA 3PYLA 3ZI0A 1L7EA 4FGSA 5L4NA 3AFNA 5ES3A 3RUIA 5IN4A 4BKUA 3RC1A 1JAYA 2P68A 3AUAA 2HJRA 2VRCA 2G1UA 1PL8A 1YJQA 1SB8A 1TVEA 3AUTA 3VKUA 4ALIA 4E5YA 2O3QA 3ETGA 4IDBA 3LU1A 4IIVA 2G76A 3GEDA 4E33A 2AQKA 1PX0A 4EI2A 3ZDFA 1UP7A 2DUUA 4XR4A 3ZH2A 3M2TA 3EVNA 1K6JA 1PL6A 3O26A 2SCUA 4PLHA 5A9RA 4XYGA 2X22A 1P33A 4DLAA 8LDHA 3NGXA 3IUPA 3GPIA 3LSYA 3MWDB 1W8DA 1ISGA 2XOXA 4D7AA 4BGIA 3WFJA 1C1DB 4YYZA 2PD4A 4W7HA 3AY7A 3NT2A 4GLOA 2WYVA 3PQDA 1T2AA 4GGPA 3TZQA 1R66A 4CLRA 5JAZA 2J8ZA 3KOUA 2I65A 4E2YA 4O1MA 1H6DA 3U9LA 3GVHA 1LC0A 2VYVA 1Y5MA 4FW8A 5EQDA 3WNQA 1NPDA 3DHYA 5I7EA 3ZN2A 2C07A 2IEBA 3AOEA 1PS8A 3MCVA 3JQ8B 1T2EA 3LLVA 4IQGA 4EJ6A 3CE6A 2RH4A 1E3JA 3T4EA 4BGUA 2IXAA 1M2WA 1X7DA 3NV9A 5GMOA 1GY8A 4JX8A 4BNKA 5AXAA 1D4FA 1O6ZA 1TI7A 3EK2A 3TDKA 4BNGA 1F12A 1DHTA 5CDSA 1ZW1A 4BKRA 3EZYA 4XD2A 1IHYA 3HDJA 3RBVA 1PU2A 1NTOA 2WD7A 3BMCB 5KVVA 1KVTA 1QR6A 2X58A 4YCAA 2DM6A 5I7VA 2R00C 3DMYA 3OICA 2QZZA 1TT5B 1P74A 2JAHA 3H3FA 3VH3A 4BMNA 1NR7A 4KQWA 1ZFNA 5AXCA 5B4UA 2C59A 1GR0A 2BI8A 2Z1MA 3E5RA 4IY1A 4G5HA 2FOIA 3GDOA 5DF1A 3FHLA 5T5QA 1YL7A 2R6JA 3OJ0A 3BTUA 4TROA 3O38A 1T25A 3PK0A 5EINA 2VQ3A 3HDQA 3JD1A 2I9PA 2O4CA 1U8FO 4UEOA 1P1IA 4HNHA 2OP0A 4RPKA 1FDTA 1YQDA 2NWQA 4NBTA 4NFYA 2V6BA 2Z5LA 1K6XA 1XU9A 4IINA 4IQ0A 3VH4A 3DZIA 4L76A 3S2IA 2W98A 1IUKA 3JQ9C 3MWEB 3OECA 2D4AA 2Q1SA 4ZQHA 1ZUD1 3PQEA 2FSVA 2I66A 2X5OA 4WECA 3G0OA 1UJMA 1Q0HA 4RJTA 1KYQA 3KYBA 4F45A 1PJTA 1DIRA 1B8UA 4OKIA 1YL6A 3KV3O 3DZFA 4CM4B 1M67A 1E1KA 1WPQA 5KJEA 4UEKA 3TSCA 4BO1A 3SJ7A 3FBGA 2WYUA 2YFQA 4OKNA 2D2IA 4HFRA 1DFIA 5FWNA 2GZ2A 2IODA 1M66A 3E9MA 4YJGB 1UZMA 5BQFA 1DXYA 3ORFA 4I5GA 1Q7GA 4RF4A 4E2ZA 3F4BA 5DT9A 5TIIA 4W9NA 2QW8A 1I36A 4JROA 1X1TA 4XGIA 4WASA 2PZKA 3AFMA 4XYEA 3W6UA 5JPIA 4IGFA 4OXKA 4CMKA 4DQXA 1UP4A 2YQ4A 4XQCA 2FR8A 4W4TA 2PA3A 1JA9A 4IDFA 4NNJA 3EGOA 4UUNA 5JO0A 3BMNB 1Z6ZA 1HLDA 1XIVA 1Q2XA 2NVBA 5BSFA 4ZGWA 1PJBA 1HETA 4CM6A 1Y81A 2PD3A 4PLTA 5JYEA 3IKVA 3ASVA 4Z6KA 4TRRA 4CMIB 3U4CA 4UUMA 4UVEA 5C5IA 3WGTA 1R0SA 1Q7CA 4L4SA 3KSZO 1BXZA 4B79A 3TOZA 2JFFA 3GGPA 3KBOA 3S2FA 3VPGA 2OMEA 4EGFA 3JV7A 4Z0HO 2AQIA 3ZV3A 3WGOA 1UXIA 2J3IA 2Q1UA 3GVPA 5JDCC 3ZWYA 2P2SA 3RU9A 1PS0A 2I6TA 3RUFA 5CG2A 2C82A 3DQPA 3GQVA 4GX0A 4BO8A 3KRTA 2PK3A 3GZNA 3DR3A 3FTPA 4CQLB 1DAPA 2ZTUA 1V3VA 5IXSA 4LRTB 1N9GB 1R4NB 4GL4A 4KWIA 4KUGA 1WDKA 4TKLA 1EBUA 3RAJA 2X8LA 1ZXLA 3GHYA 3I3OA 2CF6A 4TZTA 1I2BA 1KOLA 1WZEA 4IXWA 3UOGA 2HDHA 1H9AA 4J91A 1LJ8A 1V8BA 4B4OA 2VRBA 3OFSA 2ZK7A 4LSMA 3G1TA 5K6AA 4OGWA 3BMQB 3U4IA 4JBHA 5TJ9A 3VOSA 1UUFA 4NHEA 1CETA 4Z3DA 2GUGA 2BELA 2PZMA 3H65A 3D4OA 2EJVA 3CMCO 4UUOA 5I8WA 4BNFA 1K6IA 3EAGA 3ENNA 4BO4A 1UXHA 5C3MA 3PP8A 4J4BA 1PJLA 3T7EA 5G4LA 2X0NA 1XG5A 2AXQA 4YVFA 4CLOB 5CDYA 7MDHA 4HP8A 4O6VA 3NTRA 2TMDA 2PY6A 1J4AA 2VUTA 3JQ6A 1F06A 1RKXA 2CD9A 1XSEA 4NG5A 2GDZA 1D1TA 1A72A 4BMVA 4J0EA 2HLPA 2HRBA 1VKOA 1XA0A 3HNPA 1I10A 3GR6A 5JC1A 2H9IA 2JFGA 1JVSA 3P5SA 3GVCA 5ENVA 3HN2A 1LBEA 2NLOA 2IYPA 1TXGA 1DHRA 3F5SA 1NXQA 1ZEJA 4DIBA 1ZZEA 3MTJA 3GG9A 4JQCA 4MKZA 2V6MA 2AE1A 2VN8A 4TKMA 3PDJA 3IUSA 2W90A 3KM0A 3NDIA 2IZ1A 3VAZA 4CPDA 3E5MA 3PJDA 3BMOA 1PSDA 5T6BA 3G3EA 4CM9A 3WBFA 4EJMA 4EEXA 1R15A 2ZTMA 3CINA 1YL5A 2JAPA 4DC0A 4CM5A 4ZQFA 1ADFA 5IXYA 4I9NA 1TB4A 5A5EA 2I67A 2PKQO 1ISHA 1Z75A 1E3WB 2I3GA 4RO0A 4J2HA 3INGA 3UUWA 1AXEA 1EEHA 1XEAA 3DFUA 3WS7A 4H3VA 3CPSA 1Z74A 4LVUA 1EUZA 4WPGA 4LMRA 4K6CA 3H2SA 2AMFA 4RVDA 1EUCA 4U0KA 5HRUA 2O3SA 2X4GA 3C8MA 3OA0A 4Y8VA 1B2LA 4WUVA 4ND2A 3UN1A 1JWAB 4CLEA 5BNFA 1Y8QA 1C3VA 4MVJD 3KO8A 5BT9A 2VHYA 4RF5A 2YZ7A 3JD3A 4BO0A 1VKNA 4AJHA 4AJ4A 3C3XA 3E8XA 4MKXA 4RPJA 1LEHA 3U4DA 1EDOA 4DBVO 1K5HA 1NBOA 5DNAA 3L4BA 1J5PA 2X5KO 4LK3A 1PTJA 1SOWA 1CF2O 2O2YA 3GVXA 4XKJA 4L4XA 4ILKA 1CQJA 1JAXA 4J9VA 5IN5A 4YAGA 4PVCA 3L0DA 3WR5A 3TQHA 4GX2A 3NUGA 5TRTA 2NU8A 1B0AA 5MGBA 4YWJA 4INAA 1YRLA 3QE3A 1PEDA 4JCOA 5H81A 2OUIA 5KJFA 3TFOA 3L07A 4Y67A 1X1EA 1ZK4A 3ZZNA 1XKQA 2I76A 4BO3A 4HKTA 3V2GA 4DMLA 3JYQA 3C85A 5MDHA 3QVXA 5A4DA 3U5TA 3K2EA 1N7GA 2D3TA 3PRJA 4II3A 2AW5A 1I32A 1JVBA 1LDEA 1QP8A 2Y0CA 2Y67A 5HS4A 3FD8A 3JQDA 4GVLA 3BHMA 4XB1A 1PGQA 5L45A 3ROKA 1U4OA 4YQYA 3H9GA 2J5KA 4JGBA 3I83A 4D46A 2VWGA 1P31A 1ISFA 4A7PA 5COAA 3RI3A 1OOEA 2DFDA 3RFVA 1ULUA 3KB6A 4FJ2A 4IUYA 1VI2A 4GH5A 3W4IA 3ONEA 2DAPA 2WEKA 1TA4A 3PWZA 5F1PA 4JBGA 1YBMA 3EC7A 4EITA 1LX6A 1MV8A 3WX0A 3ZW8A 1ADGA 3GLQA 3P2OA 4BL5A 1XLTA 1LDMA 3D64A 4DLLA 4P4GA 1QMGA 4YBZA 1PR3A 2Q1TA 4EJ0A 5CHEA 3GUYA 3UF0A 2X9VA 1XQ6A 2LDBA 3I23A 3WNVA 4Z3KA 3UW3A 5LDHA 4M54A 4NZ9A 4NBUA 1ZXBA 3UCXA 4BVAA 1OAAA 3SVTA 1PQWA 1WXDA 2EEZA 3JD4A 3JQ7A 4HY3A 4UVHA 1C0IA 2VOEA 1JW9B 2AQ8A 2RIRA 4CL8A 4BKQA 3GY0A 3QVWA 2WD7B 2YJZA 2IXBA 3R3JA 5T67A 3ZWOA 3FNEA 5KIAA 1V3TA 4FFPA 3RROA 3OMLA 2VUUA 2Y1GA 4YT5A 4HFJA 1JKFA 4J16A 2ZTVA 5G0WA 1HE5A 2OXIA 1QYVA 2B4RO 1FXSA 2O7QA 3SBOA 3UCFA 4B4WA 1LDYA 2VYNA 3ZU3A 2ZJ1A 2LDXA 2WYWA 4E13A 2ZB3A 1ML3A 1HDOA 2F00A 2RCYA 3ZNOA 1Q7BA 2HK9A 4MPDA 1ZCJA 1U3VA 2NADA 4L75A 5DOZA 3CUKA 3I9LA 1UAYA 4CMBA 3UVEA 4XJTA 4PRKA 3WJ7A 1KERA 5DP1A 3ST7A 5EQFA 1NASA 1SB9A 1BXKA 2WSBA 3DWFA 1KEWA 2ZKLA 2GN4A 1JQBA 2RH8A 2P91A 1PQPA 3WYCA 3AY6A 4AJJA 5FYDA 2GYYA 1YS4A 1UDAA 2VT2A 4YXFA 4HBGA 1DAOA 3JQEA 4JBIA 1BGVA 2VTEA 1E1LA 2Y66A 3GN2A 5DBIA 4I1IA 4CR7A 3AWDA 3VPXA 3ZWXA 1BVRA 4XWYA 3JCZA 1N8KA 3S2EA 1WZIA 4QXMA 1ZJZA 1EFLA 2EKPA 3PYMA 1KC1A 2VWPA 3PZRA 1SMKA 3RD5A 3VZQA 3V2UA 1Y1PA 3RFXA 3RASA 3WQRA 4DQVA 1MB4A 5AXBA 1T4BA 4D3DA 1C1XA 1GDHA 4DGSA 4KTVE 4AG3A 3UICA 4AJ2A 3UKOA 4HX5A 4W7IA 1H6CA 3TWOA 3ZHXA 1GU7A 3IP3A 3LT2A 2OO5A 3LF1A 3G1UA 3GRPA 3EYWA 4PRLA 3ZCXA 3HN7A 3RUAA 1P3DA 1DFGA 4K1LA 3EHEA 4JP3A 3K6JA 3PJFA 4P38A 5CP8A 3ZNNA 1NFRA 4C7KA 5L51A 4K28A 7ADHA 2IYOA 1B7GO 3VZRA 1WAMA 5BSGA 3LT4A 2NQ8A 1NFQA 3QY9A 2DFVA 1ZSNA 2ZIZA 4QQRA 1YXMA 3LDHA 3QJ5A 4P8RA 4PLYA 1MG0A 1XCBA 4LN1A 3R1IA 4L4RA 1C14A 2DLDA 1M6HA 3IC5A 4II2A 4FFRA 1YVEI 4J4HA 2J5QA 2VZ8A 4FFLA 2WMDA 1E7YA 3PWSA 5C7LO 1MG5A 1IOLA 3QP9A 2ZQYA 3F9IA 3OETA 1FDUA 3DO5A 4XYBA 5F1KA 3GZNB 4B4VA 4BUCA 2VHXA 4DC1A 4OSOA 2GZ1A 2JHFA 3JQFC 4YJHA 3OA2A 4R51A 4J43A 3ZWMA 4AL4A 3FN4A 3JQGA 4ND5A 1E1MA 2JCYA 4KDFA 3JSAA 4DTIA 2W8ZA 4LSWA 1O9BA 3ZHBA 4YT2A 1B15A 4NDNE 3WYEA 1N2SA 3ON5A 5A1TA 2G5CA 1HE2A 3ADOA 1P9LA 4L73A 1O0SA 1H2BA 2CDBA 4B3HA 2ZATA 3BHJA 3DOOA 4DPMA 4MOWA 1ZBQA 1EQ2A 2GERA 1LSSA 4IDAA 3K8ZA 2HCTA 4D79A 3E82A 3MJ4A 5U9CA 5DULA 3BYZA 1PZGA 3D4NA 4ZQGA 4I8XA 1RYDA 3Q6IA 3V5NA 4XQEA 5L40A 4NJOA 5ER9A 2EIHA 2QYTA 1X0VA 4LISA 5IZCA 3SLGA 1WLYA 5LC1A 2H5LA 3LT1A 3RJ9A 2Y05A 5COQA 1U8XX 1LU9A 1NWCA 4BGEA 5ICSA 3WXBA 2QRJA 1PGOA 4KUHA 2JCVA 3I6QA 5C37A 3KSDO 4BNYA 1C0KA 1K89A 2CNBA 3KEOA 2CDAA 4RLHA 1O94A 3DFZA 4R54A 4YJDA 1NX6A 3KVOA 4RORA 3PZBA 2Y0DA 1XGKA 3NJ4A 2EWMA 1O5IA 2EKQA 3U09A 3H5NA 3OIDA 1P77A 5H83A 1I3KA 1I3LA 4E2WA 3TF5A 1N1GA 1KBZA 1RWBA 2PNFA 3OIFA 4PG7A 1TLTA 2W2LD 2HU2A 1BMDA 4PGFA 2FMUA 4BV8A 1HSOA 1NM5A 3KZVA 4I5DA 1HT0A 5COBA 4Z0PA 5HBRA 1XELA 1LA2A 1N1EA 2CVOA 1VPDA 3BMOB 2NTJA 4WKGA 4XX0A 1UR5A 3CH6A 4MP6A 5AXDA 1IL0A 3JD2A 4MKRA 1HL3A 3O4RA 1DJNA 4XB2A 4IPTA 4RVHA 5JC8A 4QECA 3N74A 5I7FA 1ZK2A 4WOKA 1Q0QA 3INTA 1FDVA 1AE1A 5I8ZA 3GEGA 3WB9A 3DBRB 3AM3A 3ONFA 3RKRA 4EZBA 3D3WB 1P1RA 3WIEA 3QHAA 3E6AA 4FS3A 4D0RA 3H9JA 3K73O 4OMUA 2PH3A 4CLXA 3NYWA 5JS6A 2OHXA 3FNHA 1Y8QB 4BO2A 3UXYA 1DC6A 1O89A 2B35A 2P5YA 1XR3A 2Q2VA 4XA8A 1I3MA 2BH9A 3FSRA 3VPFA 4WK6A 2GD1O 5F3RA 4FCCA 1H93A 3BA1A 1YBVA 5DCUA 2X0IA 3W4KA 4RQUA 5I9LA 3ZV6A 3PHJA 3QWFA 1Z73A 4EW6A 4MVJH 4ZVVA 2JD1A 2PR2A 2O3JA 1VE9A 4HUJA 3OJLA 3DC2A 3IMFA 2UVDA 3H8VA 2JJYA 3E1KA 4UVGA 4B7UA 4YT4A 3UAGA 3GUCA 3DBLA 2JCXA 1NVTA 2ZQZA 5J23A 2B37A 1WDMA 1SCUA 3GNTA 2ZCVA 1YONA 2FPGA 1Z7BA 1LTHR 1U3WA 3ANLA 1W4ZA 2AHRA 3RC7A 4Y6PA 1NQOA 4RVFA 3LC1O 5IJZA 4LVCA 3ROMA 1Q0LA 2ZYGA 2VRCD 4OAQA 4IJWA 3PI7A 5TC4A 3DBVO 1X7GA 4E5NA 1I5RA 4BNZA 4BHTA 3GGOA 9LDBA 4GWGA 2J6IA 1MC4A 4ALJA 1Y5RA 2G0TA 4ZA2A 1IPFA 5DP2A 1GPDG 1GZ4A 3M1AA 2B36A 1GUZA 4L8VA 1Z82A 1QG6A 4WCFC 4R5HA 3CIFA 2IDZA 1ZJYA 4BNWA 5G0SA 4ZN6A 2R00A 3H7AA 1ZH8A 1GYRA 1NQAO 1R12A 3VTFA 4WE3A 1H5QA 3OP4A 1MA0A 1AHIA 4I9UA 2PZLA 3H9QA 4GSKA 1F8GA 3W4JA 3SC4A 4NH4A 4NK4A 4OO3A 3CSDA 4BNUA 1GZ3A 2GN8A 4CMEC 1PQUA 3ZNPA 2DQ4A 1HYEA 1GUFA 3OJFA 4EDFA 2VYVD 3RU7A 4CMHA 4RV9A 1MFZA 3OJEA 3WLEA 4XRRA 2X0JA 1VSUA 3DBHA 3OQ6A 3KETA 4Q39A 3EDMA 3F3SA 3L6EA 5CPFA 3I9KA 2PWZA 3LQFA 2O48X 5JSFA 5ADHA 4Q3EA 4G2NA 2O23A 1NR1A 1BXGB 4N7RA 1G1AA 1EUDA 1GZ6A 2RHRA 5EMHA 1KEUA 3C1AA 3JQ9A 4J7CA 3JQ7B 1EQUA 4DIFA 5EESA 1U3TA 1ZK0A 4HWKA 2G82A 3RUCA 2C2XA 1ISIA 3L77A 1PS9A 2O7SA 3QWIA 3OM9A 4ND1A 1NAIA 3PGXA 1A4IA 4I9HA 4ALNA 1HYGA 5IDXA 1EVJA 2XPCA 1FJHA 1Y9EA 3JQBC 4ZQBA 4OQZA 4E4YA 5THQA 4U7WA 1EE2A
chains in the Genus database with same CATH superfamily
2J9FB 1XEWX 4RTKA 3DZGA 5IM4A 4RD1A 2G63A 3NHZA 1NW5A 5IVHA 1VSQA 4C4YA 2AJCA 1K27A 4ZJUA 2E1PA 4HFMA 2GXQA 2H4HA 2H63A 2PGLA 2W2KA 4A10A 2QTLA 1LV8A 3OKFA 1M34B 3RREA 3ZLTA 1RMQA 3L1KA 1FA9A 3FWNA 4G6ZA 1NUQA 2F62A 3Q9NA 4LJLA 1QDUA 2VH5R 2YWXA 3LVFO 3O90A 2V59A 2RHCA 4RPCA 1RFLA 4MR8A 5B3AA 1DCMA 4UHFA 5DXJA 5EMKA 4NLLA 4PSKA 4C30A 2IOHA 2X5XA 3VJRA 1JMKC 2BP7B 3NHUA 4KNWA 2GK7A 1YF3A 1VL8A 2NMVA 1KO8A 3DKPA 3I9V1 2WSIA 4RACA 2XQJA 4IIJB 1R4MB 2OFWA 2M1ZA 2XTZA 2QLMA 2O1WA 2FPWA 3AF2A 3DGFC 2QUJA 3WI7A 5JYBA 2DETA 2GD2A 2IDJA 2IGTA 4CCYA 4IR7A 2GO1A 3OEHA 1XI2A 1Z39A 4GUAA 1V8ZA 2AB0A 4WLFA 4C9BA 4DSNA 2C77A 3IAEA 5I4BA 4B73A 3GLHE 2BZ1A 5HDBB 1TKBA 2PN1A 2ZRFA 3JTEA 5ILGA 3IH5A 1E60A 1N5LA 1SQ5A 5FHQA 5EHXA 1KI9A 3IBYA 4MV6A 4NYIR 1WTAA 1E98A 1V6AA 5B30A 1ULSA 2FEAA 2ONZA 5FV4A 1L3CA 5A4KA 3SEAA 2OBLA 2FZWA 3ZDZB 1E77A 3G8YA 1QZZA 3SC2B 4CM9D 5HM8A 2RGBA 5CLIA 3JWGA 5JDCA 1IQ0A 5AKGA 4AJIA 4NMHA 4D3SA 1X7WB 3N0VA 4HSGA 3FZNA 5LJIA 1NJSA 1IN6A 4ACAA 5K3AA 4FTWA 4P7JA 3DTVB 1Z6PA 1D4ZA 2W6MA 1U31A 2ZJ0A 5SY4A 4ZVTA 1CR1A 2PGIA 3MJDA 1HDGO 1THTA 1Z7EA 1E62A 4GLLA 5IDYA 2E3JA 3PVZA 2NYAA 1XN1A 1HO3A 3QX7A 4I4IA 1VE6A 1BVUA 2NZWA 1WZUA 3PPIA 1NP3A 4DY6A 1UK9A 4RFVA 2VHQA 2X4LA 4I1OA 2GH1A 3QOFA 1OWLA 1YQWA 2EG9A 3CH5A 2GNAA 3N70A 2ZAOA 3NBFA 3OIGA 5UKDA 5CDGA 3A14A 1QPZA 2C92A 3P2YA 3C45A 4C4RA 3K0EA 5FUXA 3K8YA 3V7UA 2R96A 1NX9A 1NF3A 1W0JD 1BTOA 2AOWA 3IFSA 4MVJI 4YMTA 3PPXA 2C9ZA 3NPMA 1GKIA 1USVA 2FG7C 4BTVA 1VG9B 1W29A 4WGGA 4L28A 3PV0A 5EE0A 2B1QA 2BH2A 3W2TA 1IXRC 3B7PA 2A9KA 1H2YA 3F9RA 2AF3C 1C0PA 4QICA 1P91A 3OLZA 2WABA 4J4TA 4BN4A 4BU0A 1MQAA 3BWVA 2BFMA 4XYMA 1KYXA 1JDSA 1T9GR 3IO3A 2CCGA 3QXHA 4MW2A 5CXSA 5FBRB 1Z63A 1N2CA 1U28A 3OVMA 4R69A 4YP6A 1CUWA 4QGGA 5ALIA 4LWOA 4TMWA 2QUBA 3M0EA 2TECE 4OLHA 1DC4A 2BFNA 2PVCA 3A9WA 1E0DA 4TV8F 1T9CA 3T1TA 1WE2A 5CR9A 3I52A 1RTKA 2EDAA 1CUBA 1I5EA 2H7YA 4ZZ2A 1LF5A 3W3ZB 3A31A 2OA0A 1NMEA 3JWIA 4C88A 2CUKA 2YVUA 4FT2A 2QENA 2DKNA 5HZHA 3MWJA 3K0HA 5FNVF 5LBIA 4EZIA 5CEFA 1HNWB 1X1BA 3I73A 3CKYA 2TMGA 4AG6A 1JLMA 2J67A 4LNUA 4EVRA 3AXTA 1I0IA 2NU7A 1QHXA 2KX7A 1DQRA 5BR7A 1V5GA 4D96A 1SOUA 1CSEE 4RLFA 3LCVB 5THKA 1DRUA 4ZVOA 1XRSB 1AURA 4X8MA 1A9OA 3EZFA 3DUFB 1YB7A 4CVNA 4EGSA 4OOEA 3VR6H 4FXOA 4RW0A 1IPEA 2CL7X 2NZVG 3Q88A 2ORED 4Q3CA 5DHTA 4L5JA 5BW8A 3PX7A 2R3SA 2WU3A 1EVIA 4IMJB 2Y4OA 2CLCX 2ZG6A 3TJZA 2OHGA 1FFAA 2R4UA 4B47A 6Q21A 2XTNA 3P9YA 4J2OA 4RTMA 3RKUA 2OCAA 2E37A 2VPTA 2HGZA 2HRRA 4DV1B 5FI3A 1C1DA 3ICWA 1THZA 1PIWA 2QYOA 2UYQA 4KXLA 4E6PA 4UATA 4G0WA 3PQ7A 1RHKA 4R1SA 1E2NA 1LLDA 3WIBA 5K0FA 5FR1A 4DMGA 5F5LA 4DJJA 3E3LA 4FZJA 3RRZA 2CFIA 5FFFA 2D0DA 1NBEA 3OCJA 2JKYA 3GROA 2QM8A 3N5KA 2AMVA 3EXIB 1NPTO 1QX3A 4TRMA 5DN9A 1U11A 4C7MA 3Q7EA 2ISSD 1VE3A 2PKWA 3D7SA 4U2EA 2VAXA 5KOIA 3FYHA 3IL2A 2I1VB 1GT91 4W7SA 4UVIA 4D9CA 3O31A 4EUSA 1KQNA 3QLJA 4HDKB 4NSNA 5FI5A 4A27A 1NZJA 5F64A 3K5PA 2FRDA 3O94A 1EE9A 2IC5A 3E8SA 3QX8A 4M9ZA 4URVR 3LK6A 2IUTA 4UNQA 1OX4A 1V96A 3V46A 5TGTA 1Z5UA 3B9RA 6REQA 2VP5A 3ZD8A 4ZGGA 1CZNA 3PG5A 3ZV4A 4AURA 2DMRA 3MSCA 2B0JA 2W2NA 5SZIA 1KHHA 1TF5A 2QN1A 4ITUA 2X23A 2C0QA 3DVLA 4EMSA 1P2BA 3D1LA 2QN2A 4Q9LA 2ZYRA 4XX0B 3OTHA 2H2IA 3HDYA 1JAIA 2R1ZA 2FX5A 2IHKA 2IUSA 4M1TA 4JB8A 2GQ0A 4R2HA 4DT1B 1GCOA 2WV7A 3QSGA 4LF6B 1E1QA 2XOEA 5C32A 5HPYB 2AR7A 3L8EA 5CIQA 4TN5A 4MW6A 2B7CA 4EG8A 3BGOS 1IRXA 4OUDA 5CPBA 3JD0A 1U2PA 4CL3A 3VR3D 3V55A 1CRPA 3H86A 4GGMX 2HUNA 1IMJA 2ZRAA 4G81A 5IMSA 3OZDA 2VZEA 4G26A 3P7MA 3QKRA 4P7FA 3NI2A 1CPYA 3B2EA 4J1SA 1AGYA 3SS8A 3ZQUA 2R87A 3VU8A 3HWRA 5E0KB 1E94E 1ZVMA 2CXUA 3G88A 2H92A 3D6NB 2GAFA 2QLTA 1ESCA 3O3MB 3QTBA 4N49A 4Q02A 4DNXA 5LP6A 3W5BA 2H07A 1SPBS 3IUBA 3OZAA 3B9BA 4NCJA 2YV1A 4YCMA 1C7ZA 1UBOS 4D9GA 3MINB 1M2VB 1MX3A 2NVOA 4LYFA 4ZCSA 1KDYA 2UUPA 4CDGA 1R5OA 1N57A 1OWPA 3PXAA 5IAAA 5I7RA 4XCVA 3V1YA 4IICA 5IK2D 2OQIA 5C3UA 1WNTA 3ADKA 2Y1EA 4WZAB 1N5OX 2QUZA 1LDBA 4C7OA 1P2DA 3RUEA 1KMHB 5KWIA 3THRA 4DV2B 3EA0A 3OLWA 3VZCA 3KYIB 4RPIA 3O93A 3WGYA 2RCNA 3OE1A 3RVDA 1PL7A 2PAAA 4OL9A 2F43B 1JFTA 1CR6A 4Q3DA 2FLKA 4Q18A 4Q3AA 9LDTA 3KFXA 2A86A 5KNCD 3PNSA 4A03A 1VTKA 3E48A 4U5XA 4V0NA 1SU7A 1VCHA 2XGSA 1ULTA 2DT5A 2NUAA 3E7PA 2A1UB 3KTAB 3QTTA 4QFDA 5I48A 1UAGA 2ZB4A 4WFKA 2DG2A 5G0TA 1WS6A 3C7AA 4Q7LA 5FX2A 2AZMA 1J1UA 5JE8A 1C50A 2R5WA 1ZJ5A 1HFJA 3GCZA 3AR8A 3KWFA 4JLUA 3KTDA 1TT7A 2B9EA 2C2MA 2PMCA 3BUSA 4HLCA 2VZ9A 3RF6A 1V95A 1U80A 5IBPA 1WJGA 4C7VA 3PPWA 5EIBD 2FMKA 5DHPA 3LAWA 2H18A 3EG5A 4LJYA 3DJYA 4S2EA 3T3DA 2AI1A 1N6LA 1J0CA 2F3TA 2P35A 3H2IA 4H7FA 4DLZA 1A3CA 1I1HA 1W5BA 4PICA 1WDTA 2R44A 3ZXYA 4NFHA 3VZSA 1CEYA 3NT4A 3VDRA 3ZE6A 1GKUB 4C4OA 3ZWKA 3ROXA 3UAZA 4KI0A 4Z9BA 2VJDA 4GC5A 3RSGA 2A5GA 2OXRA 1JFLA 3DB2A 3R3HA 2EX1A 4BMSA 1KIAA 2Q45A 1JG7A 2IRWA 2REQB 3ICPA 4F6RB 1NF9A 4NARA 5I7HA 5K8TA 4Q9IA 1KEEB 1NE2A 4BLQA 4YB8A 1XNQB 4O2BB 3R7NA 1QFSA 2YRXA 2IEDA 1NJ1A 1XD8A 2AF4C 4H7PA 1H5NA 3DV0A 4FYIA 4I3FA 4RK7A 1FFXA 2AJ8A 2GESA 3M5CA 3ZJ4A 2CVHA 3ZXIA 3DF9A 4I4CA 4IIDA 1ZMOA 3C3WA 1G0NA 4Y6OA 2WUFA 3KJNA 2WWHA 3B12A 5J58A 1J2UA 1Z18A 5D7NA 3A70A 1QC5A 5AI5A 4YRZA 1EDDA 2VT7A 1EP3B 3P0HA 2E5LB 1Z22A 3GZTB 2C20A 1UL1X 4YALA 5BPFA 3KJFA 3BJEA 4UHEA 3UANA 4D0SA 2YVLA 3R3SA 5ITZB 2VNHA 4BMDA 2JRLA 4XGQA 3V1UA 2AHOA 2HDOA 4UAGA 3D4BA 1TEXA 2JGIA 3CX3A 3EZLA 3L2OB 3OC0A 4JYPA 3WIOA 4ETIA 1ZAYA 2NGRA 3EYAA 3HBAA 3KQVA 1HTBA 4I99A 2HMVA 3UMCA 3THYB 3HO1A 3NP9A 4C07A 4PGAA 3UGKA 1LDGA 1P0FA 4OL0A 1M8GA 1RYBA 3NBMA 1IZ9A 2PQMA 5KWSA 2F59A 4R9RA 2GRAA 2JATA 3QEMB 5JNLA 1GG5A 1GTMA 1NVWQ 4HAOA 4GYYA 2HW8A 2WAOA 2GKSA 4CR6A 4X5OA 5IM5A 2AJLI 3CLKA 4M4SA 1G17A 2D1QA 3ETCA 4CV2A 5CGQB 1YNSA 5EZ6B 3C7CB 3L79A 5JWHA 3VMFA 3LLMA 3I0ZA 1R9JA 3IESA 3ZJTA 2VYND 3O5AA 2DGDA 1SM4A 2Q2WA 2ETXA 1II8B 3E61A 1YFJA 2D5IA 2XZLA 2IQ5A 4GMGA 2RG7A 4DR6B 3GNLA 1KSJA 4L7QA 2QSUA 4PCVA 1YHZA 1J2EA 3R40A 1MB3A 5DIFA 3T3GA 1DDIA 4GI5A 4KITB 4PQYA 3IT3A 1T2CA 3OPYA 3QLVA 1MT3A 1Z5VA 3EX7C 3S40A 3OM1A 1TEZA 5JVDB 5THXA 2BSQA 3UAVA 1I33A 5NULA 4CF7A 3I0NA 2O8FA 5EHNA 2POQX 3FPBA 4QARA 1U3GA 1YKFA 5BYAA 3A9TA 4B6QA 3AV3A 3TRFA 4ALKA 1HLFA 3Q1LA 3R5XA 2DYKA 1WXQA 3CISA 2YHIA 1MIOB 4NBNA 4BEWA 1CUAA 2X1LA 3N75A 4RZ2A 2WFMA 1TVKA 4P0PB 1LNSA 3AKCA 3I30X 2JW5A 5JFGA 1Y4SA 2UZ4A 1B6TA 1Y8RB 3ZTTA 4PLFA 5HYVA 1HLPA 1CTQA 5SICE 3M6MD 4QEZA 4H60A 5HKBA 4Q9NA 4XPIB 3JS5A 1JKJA 4KLRA 3SG0A 4UD6A 1B16A 4JDPA 3RVOA 1QIMA 2I29A 2L0XA 3BRCA 1EVYA 3H1EA 3V7NA 1QO7A 3BSFA 4FLFA 2A0XA 4R1UA 2QVCA 2EFYA 1ZRHA 2O8DB 4HXGA 1JN0A 1WXGA 4IJ6A 3SF8B 1TTTA 4BUZA 5KOJA 4ZVMA 4L8LA 3M3HA 1GGVA 3CPJB 4UTVA 5E9AA 4EY7A 1WCXA 4O2AB 3OBBA 1LNZA 1G3QA 4TTJA 4X60A 5AHRA 3F3MA 4CKBB 5A02A 1E4YA 1EWYA 2IHNA 1VMEA 5GIOE 1HE4A 1F4LA 1BQ3A 1RJ9B 3QVOA 5K4GA 1CJMA 2NTVA 3DTVD 1Y33E 4KR0A 3T54A 4CKYA 4COKA 3F2VA 3OF3A 2I4TA 5JDIC 4LWPA 1LWOA 2POCA 1LK0A 3MYRA 4H6PA 1SD2A 3PRYA 4KYIB 1D6NA 3MUFA 3N3BC 4QBFA 1KO1A 5T8KC 1Y3DE 2J33A 1BMFD 1U8CB 2QP9X 2QU7A 4YH1A 2DB3A 4C6TA 2JAOA 1VIDA 3AL0C 4CQJA 1E9AA 1SC4A 1XDBA 1L4FA 1VLJA 3I92A 3IEKA 4WHMA 3WC4A 1GPH1 2B92A 4ND8B 2PSEA 3CVOA 3OZRA 4FB4A 3BZUA 1X9HA 3SFTA 4OHYA 2ZULA 2RBGA 5H82A 2QTFA 2EZ9A 3GLHB 3AC0A 5I7UA 2QTRA 1JIXA 3DKKA 1L5YA 4G63A 5J59A 1Q1ZA 4LHVA 1B8PA 4TVBA 3JQAB 2P6NA 1U5BB 5HF5A 5H4GA 1PYGA 4JU9A 2ZSIA 3DNFA 1J2TA 3AO0B 3LXRA 1W8IA 2CEAA 2H85A 3P2JA 3RDPA 3CC8A 1DO2A 5G4KA 4IKOA 4QLOA 3W5AA 1QPBA 1EFVA 3JAKA 4P31A 4YP0A 4CE6A 4GKKB 1O0CA 5BN4B 2QHXA 4Y1EA 4ZKEA 3KXDA 4MICA 1PJ3A 3NOVA 3UB4A 4OHWA 2DHDA 3RSQA 3AERA 1IBRA 1OE0A 4XYLA 2HH9A 4PSDA 4IOLA 1R0KA 2FN3A 2VATA 1EBFA 3UCEA 3FJ1A 4HWGA 3HA7A 4ZVKA 4YJ3A 2F67A 3KFLA 2Z8YA 2J0SA 4NBRA 4XASA 2VS1A 3ORRA 2WM2A 3O03A 3CF0A 1I4WA 3E7FA 4G09A 4G01B 5AT1A 1IOZA 1TTHA 3VV2A 3AB7A 1IWOA 3R74A 4XX1A 3HSKA 4F60A 5ICMA 2ZE8A 2LE0A 2ARKA 2N3ZA 2QZSA 3QIAA 5AKYA 5C0OE 5J4LA 2ACWA 1YI8A 3NEJA 4PYKA 4RY8A 3S2SA 3ZW9A 3WGHA 2HF7A 2G9QA 1GQQA 5H59A 5K8VA 4LQLA 1M83A 4O5OA 4OQEA 4TXJA 4LS3A 5EIOA 1SHJA 2XDQA 4LYEA 5FL7A 1DLIA 1L8LA 3FI9A 4I4TB 4Z51A 2ZR7A 3TNDA 4AF8A 5EP2A 4EQ6A 1DQZA 1W5SA 3RVQA 3WE7A 4C0JA 4LEIA 1UF9A 5K3OA 5DLPA 5IJXA 1K86A 1Y1LA 4E30A 2PIDA 3B3AA 1I3CA 4MQEA 5E4FA 2JCSA 4CT0A 4AP9A 5C1OA 1BFKA 5JS8A 3GNQA 1MKYA 1Y8AA 4JP1A 3S55A 4ROSA 3PHIA 4B46A 3HFRA 4W6ZA 4RJIA 2PX8A 1SBNE 1PFQA 4G85A 1CRWG 4OXRA 1V48A 4YFYA 3W77A 4A6DA 3OT1A 3MJSA 3PEWA 3UT5B 1I4LD 4JK3A 2VH1A 3PKJA 2E6UX 4YCBA 1VMKA 3RBXA 4BECA 2ABWA 5FCDA 4B32A 2A9FA 2X14A 5A7HA 1L7BA 4ZALA 1XTKA 5A0FA 3EEQA 5DJ5A 3A0UA 4BNMA 5A7FA 1T6ZA 3EPLA 1UWVA 2XNKA 2ENUA 2XLCA 3NVKI 1UCFA 3CBGA 4RD2A 4JL5A 5DBGA 4CBVA 3DF7A 4O29A 1VFPA 1Z8DA 2JDID 1EEXB 1X7HA 1ZRMA 1JLLB 1A7KA 3IP7A 4KXMA 3RS0A 4F97A 2BEWA 1PR9A 2F64A 1XNHA 1T4CB 2TRSB 3QEJA 4NJMA 1ZHOA 1KYYA 4X6XA 2C3MA 2YDYA 4FC6A 1NOJA 1RI3A 3WLLA 5A03A 1DCTA 4WN9B 4CEJA 2VHZA 4DB2A 3DDWA 3TDNA 3OD1A 3S1AB 3EVAA 1MAHA 3GJRA 2XGMA 1G2OA 4MEJA 3U0BA 1KS9A 1FK8A 5ITVA 3ETEA 1MTOA 3LHFA 4FMCB 4IHKA 1T9HA 5IJ9A 3LQ4A 3PR1A 1DC5A 1OYWA 2BY4A 5AW5A 4BVLA 1YC2A 2HMWA 4XWWA 2AT1A 1K92A 2G06A 1OA1A 2FE1A 1GUYA 3T7DA 5GTDA 2JEZA 5GONB 2GD0A 3HCCA 4FFBA 4TS4A 4GYKA 5CVTA 4RZ3A 5JH7F 3T12A 3WJ2A 1IZ0A 3AHFA 5L53A 3QLEA 3QFRA 3UH0A 3TG2A 3ESQA 4FUQA 3DAFA 2AN1A 5CIWA 2PVPA 2SBTA 4CLDA 2YN4A 2BTEA 1KKUA 4JNKA 5E6UA 1ND5A 4Y30A 4AX8A 5K0SA 2PDAA 3IQHX 3L1HA 4XEUA 3ZWCA 2C8KA 3I5MA 4BMOB 3LK7A 2NNWB 4CODB 2XA2A 1BW9B 1JEDA 4PSVA 3TECE 1F38A 3BCUA 2LNDA 2NU9B 3DPSA 2CNDA 3MOGA 3K9FC 2MMCA 3JYLA 3NHRA 1R74A 1PSWA 5EP4A 3GEPA 3WIDA 1R5BA 1J9GA 3R3ZA 1VLVA 3G85A 2JJQA 3K1AA 3GRKA 3MGGA 1X70A 2J6BA 1IPHA 2R1TA 3RBAA 2YNMA 2WHQA 3E27A 1NR5A 4KTTE 1U90A 3DC7A 5AVWA 3G2QA 2PWBA 4ZZ0A 3OIUA 3GA5A 4CMEA 2MINB 4E4TA 1JH8A 2AOTB 3JRWA 1ODJA 3L4JA 4M0UA 1CB0A 1N2ZA 2QD1A 3ONDA 3PS9A 3NDBB 1LDNA 2IPXA 5TV2A 3C8DA 1NA5A 4HXFB 1GLGA 4DPKA 1W0KA 3TOCA 1ICEA 1G9SA 2Q6OA 3PA8A 3V7FA 4UMDA 2YQZA 4Q0MA 2G4CA 1AB5A 2K2WA 3X1ZA 1EA5A 2FP4A 3FIUA 3M33A 5ECYA 4YRJA 1E0SA 2C97A 2W4MA 3HJGA 1RCUA 2BBOA 3TZBA 4LGVA 5EJ5A 4HVAA 3A25A 5KNCH 1P9RA 2BHLA 3QU2A 3BXEA 3ROQA 3T38A 2BGKA 4MVCA 4NP6A 2JVJA 2FY8A 2IEZA 2TS1A 1ADCA 2GBGA 3DMTC 3KL4A 3Q5EA 1RPZA 2HA5A 1E7QA 1ENPA 2P9YA 3KIPA 5L7TA 2JLWA 5CAEA 1L5GB 4CHGA 1FVHA 2EWWA 5AK0A 1GPBA 5EQTA 2UDPA 3L49A 3QUCA 3FDXA 5DB4A 1NMZA 3ESRA 3EGDA 2WAYA 3PNMA 1CY4A 3IVCA 4JS0A 3WNCA 3IAAA 4YRRA 4F5WA 5DSXA 3K4QA 4WV3A 2PS9A 3A1SA 3NHJA 4YP1A 3CEPB 4NS1A 2AFIA 4AZ0A 2PU5A 5J2TB 2VLBA 2HSDA 4JLSA 5MN6A 2I55A 1XVLA 1TLLA 2XVMA 3BDIA 4GSYA 2J0EA 3C3AA 4Z3OA 2A9RA 4XJXA 3R0JA 3OIYA 3VTAA 2HU7A 2RK6A 1AT1A 2BJVA 3M6XA 3UXMA 1VM6A 3OFNA 2PO7A 4FEYA 4E08A 3D6JA 4PEVA 5DNWA 1HUQA 2YYYA 4IO0A 1IUNA 4DMMA 5AESA 1RCTE 4BKOA 3WL7A 3B38A 1J33A 1Q84A 5LNK6 1GT6A 2DQSA 5GZ6A 4FNAA 2JCBA 2Y1OA 5B58T 4GAEA 4HEJA 1KH1A 5JBIA 3IURA 4HGNA 4M22A 3S44A 4PR0A 1UK6A 2WYHA 3WJ1A 1SBQA 1V11B 4HRXA 2GTPA 5EIWA 2DFKB 4A8JB 2OFXA 3DMDA 4M8NE 4U7TB 2WZCA 3RS4A 1JMVA 5A4IS 1RAGA 5DTRA 3TS1A 2Q3MA 4MQMA 3C8HA 3NWPA 2BGMA 4MX8A 4L4ZA 4MVYA 4RSRA 3Q3VA 1I01A 2GHIA 3ZU2A 2O2SA 1XT6A 1PGNA 4KOAA 1P4AA 2IHVA 3L82B 2JFHA 3W5VA 3YASA 4LRXA 5JSQA 3W9SA 1KY4A 2EBWA 1TFRA 3FPEA 2WD8A 3A9VA 3WKEA 3SQLA 1BO6A 5CTAA 2IPAB 3NXSA 2DBZA 2EBUA 4MYCA 1QYXA 1H66A 2QN9A 1Z0IA 5C1DA 1HOTA 4DUPA 5ALFA 3FKSD 2WKQA 4YMHA 1FS5A 1QGDA 4DHWA 4LJRA 2BC9A 1HEYA 3KNZA 4YJFA 3VR5A 1FBNA 1ZD5A 3FF4A 3ILHA 4OEHA 3WYGA 4E5VA 1PG2A 4AX4A 3M4YA 3NBYC 1HWYA 3VJKA 5DTMA 1FE8A 3VDMA 1M2GA 1RM4A 3ER6A 4MWGA 2QV0A 4UHCA 3I6IA 3E5HA 2IS2A 5KREA 3ZOKA 3NM6B 1EMDA 2WAAA 2Y92A 1PWEA 2F3QA 5FDFA 3NKVA 3LP5A 2V7VA 1ESEA 3KYCB 2C78A 2CJXA 3HKDA 4AIIA 3F73A 1Q0SA 3IUYA 3ZJVA 2CXXA 2CMDA 3F0TA 2Q5LA 2UKDA 2HHCA 1ZSYA 2HNBA 2WIBA 3RVNA 2IZOA 5G2OA 4JBYA 2HSGA 3Q9SA 3QVJA 3ZPXA 3GB9A 4NIMA 4ZAXA 2WTAA 5FEMA 3AOGA 2I2BA 3GQBA 4MARA 1KK3A 3ASZA 4UQOA 1TFUA 3JQGB 4MIYA 4BFSA 4D4JA 4ENUA 2QZPA 4FR5A 4RY0A 2CMFA 3VSBA 2CVPA 2Z8XA 4L6AA 2Z5VA 2ZSEA 4NI5A 3E1SA 4DYHA 3H87A 4MDFA 2XRMA 3CVJA 1HA3A 1FVFA 1JDUA 1KY3A 3A1WA 3F7MA 4J7XA 3ZBQA 2HBZA 1MP0A 1E3EA 2C1XA 4GMFA 5GV7A 4NOKA 3EF0A 3RWBA 4KXWA 2JJ8A 2HGSA 3SC3A 2NSJA 4YA6A 4ZGBA 1FDSA 1LW6E 1USKA 2D1FA 2IS1A 4V0SA 1X2BA 4L16A 4TZKA 1OIXA 3EVBA 1JDNA 2YDXA 3JY6A 4OJMX 5F5NA 4IHAA 4WK2B 5KCMA 3REFA 8OHMA 3L4BC 1GCUA 1T5HX 4KFUA 1E4EA 2QRPA 4OLFA 3WICA 5EZ5A 4F56A 4Y6GB 3EPPA 3DZBA 4AJPA 3SMVA 3EIEA 5BT8A 4J1NA 5JSZA 2Z6UA 2YMQA 1NN1A 1EX7A 4XD7D 1AMUA 5A3VA 2AN4A 2E9SA 1L5FA 2FWJA 3LXXA 2PT5A 1BX0A 2NTNA 4EH1A 3SHQA 1CJVC 1LRLA 3NUZA 4JJKA 2BKVA 1VG0B 5JUWA 3KX2A 4Z54A 1XZMA 4H3KB 1GEGA 4M98A 3R7BA 3BKWA 2OSVA 3Q6NA 1SUCA 4S1PA 1TQ4A 2CT8A 1XZGA 1V9LA 2BI7A 2FETA 3EIWA 2JGJA 2Q29A 2YJGA 3WDMA 2BMJA 2OP1A 4CIVA 4OHVA 3AX6A 2NO0A 1W4LA 3JQAD 1N5RA 4JXKA 1R5JA 2QAGC 4NBWA 1CG6A 1VBNA 4QPCA 3LT5A 2OHVA 1JHQA 3LW8A 4BAGA 1K2WA 1ORWA 3LA8A 1X13A 4ADSG 1Y8CA 1KTVA 1EK2A 1Y3BE 2V4UA 3DDNA 3G2PA 1RM3A 4HXYA 4QUKA 1UWLA 2JFZA 4OA5A 4Q7EA 2FQ1A 4YV1A 2O0HA 4ZIRA 1YRAA 3L6UA 4EHKA 1O5OA 2UVPB 2PR7A 4LWQA 3SXUB 4AWAA 2WB2A 1TT5A 4TT3A 1TJ4A 4ZO4A 2O2HA 2R68A 4K1XA 3PJEA 4K9DA 1G21A 1SOVA 2PD6A 3CH4B 2HMUA 2ADFA 3M6UA 4BFYA 2DCUA 4M8KA 3OURA 2LCQA 4LGCA 4B6EA 2O57A 4ZCIA 1XL1A 3V2IA 5ITWA 1EJ0A 2D1RA 5CEEA 3GW8A 5HHTA 1AXRA 2P9CA 2ODTX 3CH7A 3EVTA 3PXUA 2B7BA 4N54A 5FHRA 1RPAA 2IYFA 4AULA 3T95A 1AJEA 1W85B 5DHQA 3BXPA 1EK1A 1KQPA 3MRTA 5EFOA 1Y6RA 2MSEB 1F8YA 2IIBA 2V7BA 1ZAKA 2WYIA 2AGVA 3IR6A 2IHBA 1AGNA 4FYVA 4MV5A 2EXXA 3S2UA 2E4VA 1FMCA 4N0DA 3U4QB 4LZNA 3HCAA 2WG0A 2IH2A 3I9OA 1TJ3A 1R4AA 2RHWA 4H4CA 2O0MA 1KMMA 1M3SA 2A5DA 2Z5FA 3FOZA 1AKRA 5BXQC 4MS3B 2YXLA 5CD9A 2WKRA 5CT9A 4A0RA 1PT9A 3RANA 1RHUA 3DV9A 2ZRJA 3T99A 4Q00A 4P33A 3RC9A 1PT8A 5IULC 1A04A 3TPCA 3T4XA 4AKEA 3P9NA 3Q12A 2W2OA 2XMQA 5LVAA 4O2BF 1VLMA 5FTLA 4E5MA 1OGJA 2HN9A 3B13B 3TH5A 3H75A 2WF6A 3R2JA 3X1YA 4KMSA 2I34A 2RBEA 3CBQA 5FF9A 3TJMA 4A2PA 2XTMA 4ZEOA 3GD7A 2P2CA 4HH3C 4EGQA 1AY0A 1D6SA 2X1MA 1SPXA 3MD0A 4HYYA 4TLCA 3VNBA 1BXGA 1SXIA 1OA0A 1L5MA 1TO2E 4QELA 5AJZA 5CK4A 4MW7A 3M6LA 1Z5GA 4L02A 2IUUA 1JECA 4L8FA 3MQ2A 1TKCA 3GFPA 3B1ZA 3W9UA 2FN7A 4YRGA 1ITZA 2F1KA 5AKKA 5DW3A 2EYQA 5LZ9A 1MA3A 3RWOA 4N1AA 4IHJF 2JA1A 4JWTA 5DMXA 3WY9A 5JZBA 1MIHA 3RHSA 2XCRB 1U1FA 2FZEA 3DAGA 5DASA 4DG9A 5KWEA 3IAXA 3L0PA 4CV1A 4QDXA 4YT8A 1G8KA 3LUJA 5AK3A 3PFFA 4P34A 3TAUA 4CR8A 1KDPA 1C2TA 4UHKA 5D86A 4B6FA 4L72A 4D9KA 3T9DA 1CY7A 1Z0DA 1FRZA 3UWKA 3RAPR 3ZI4A 1T2DA 3SNKA 1ZD3A 3KQMA 2OWEA 3LG2A 5E7JA 5JSYA 1CJSA 3K30A 4GIBA 4P92A 4X54A 2B1JA 1I6WA 1B14A 1COWD 1DADA 3A1UA 2QG9A 3UK1A 4DJTA 1D2NA 2BTQB 3FOFC 5C4IA 3P97A 2E4ZA 1TIBA 4MI9A 5KDLA 2QZJA 2Q50A 3GPLA 2D0OB 3NVDA 5FPHA 2B4AA 1KRWA 3MC1A 4PG6A 1FFYA 3NFYA 2W00A 3WRYC 5DDIP 3OY2A 1GILA 1LJUA 3FHOA 3GZJA 5FOQA 5LZ2A 2BAGA 2C0CA 1EWVA 1M0TA 1C7RA 1IDN1 2JBAB 3G8CA 5LOVB 3AIKA 3NJRA 3QV1A 1V7CA 1P5JA 2ODQA 4WLUA 3CRNA 3STHA 4YX9A 1L6IA 2WE7A 4IQ4A 3VNUA 3D2LA 5BWOA 4DMCA 1R37A 3NRCA 3AZOA 2V7TA 1R0WA 1U0FA 3BDAA 3K7EA 3N0TA 1SKAA 1KYZA 4BFVA 1E92A 5JJIA 3IOYA 1KDRA 4ZZ3A 2RHGB 2XCQA 1S1CA 1VJ0A 5KYNA 1E6MA 1NW9B 2JA2A 1ESZA 3UWDA 4F7WA 3ZZ0A 1KSFX 5E4YA 2QRLA 4B5KA 1W30A 4ZI5A 3GWGA 4YDQA 1R0ZA 5LN1A 1ZM2A 4G86A 4GPBA 2RGWA 4GMHA 4B3FX 3VSAA 3ET5A 5DLDA 5LXTB 4LY0A 3JATA 5BR8B 1FC0A 4AUEA 1WHSB 4ESOA 4ZJZA 1K68A 2IF2A 3BMQA 3KT6A 2YXPX 3FM9A 4Y6RA 4IRXA 4EHLA 3E3AA 2YH2A 1O5TA 2IOFA 3L3BA 3UV7A 3ZLJA 2V0CA 2XEXA 2Z3ZA 2CF5A 2XKAA 4OI2A 4RH1A 1YZHA 3MZ0A 4OREX 5FA5A 3F78A 4AKSA 1OH5A 1Z7WA 3PNKA 5FIUA 4R8RA 1CUZA 4F3TA 1BE8A 4JJIA 2WJJA 2P6RA 4U8GA 4HNSA 3N8DA 4QOEA 4B7CA 2OCBA 3MOSA 3RSCA 3QUQA 2R6ZA 3KB2A 1XZLA 3CJRA 1US8B 5JD3A 1P81A 4GZ5A 1DG1G 1LPMA 3A58B 1S3FA 3PIIA 1GRVA 2ES4A 4AAYA 4B3MB 3K92A 3VJMA 5KKCA 2J3KA 2HA2A 4R05A 1EINA 1T5SA 2JFOA 5F9MA 2DHEA 2QJTA 2FKAA 2EW1A 1OCEA 4FN4A 2ZIVB 1QG2A 1VOTA 4BLSA 2QMOA 4YPVA 2ZBUA 4R1NA 1Q77A 3FSEA 3H4VA 4OQQA 1X80A 2X4IA 1GL3A 3D3JA 3F6RA 4UFOA 2VPXA 3K20A 1HYBA 2J1LA 1KIFA 2ZR8A 1X1QA 3PFKA 6NULA 2FR1A 4ZOEA 1KJNA 2Q6IA 2FSUA 1ZK1A 1RS0A 3IJEB 1M75A 1N6RA 2HK7A 4QLAA 3VKUA 2EVWX 4CFSA 4HF7A 3VXKA 3OLVA 1QU2A 4ARSA 2V7QA 1DVRA 1QKIA 1XQXA 1HF3A 3FSGA 2L2QA 3AEUB 2ZYHA 2BKAA 2YJ6A 2ZANA 3H2BA 2OBYA 4NCKA 1OXMA 2WSLA 3H19A 4WNYA 5C1IA 1UWCA 1GTRA 1Z47A 4MQBA 1O6CA 1YDWA 3BICA 3EMKA 3IJ5A 4IRMA 1FP7A 4KZPA 4JOSA 2ZJAA 3M34A 1XJQA 3HM2A 4RDHA 4LSGA 2C2GA 3MCZA 3O2JA 3PC2A 1XTBA 4QBIA 4EI8A 3S1LA 3LY9A 2OAGA 5IZCC 4W6QA 2KBFA 2ZRCA 1UBEA 3DLAA 2N1BA 1W52X 3WHIA 4AKGA 4B6PA 1NI3A 1W5EA 1OROA 1CLUA 2J5XA 2JJ1D 1XEFA 2QNIA 3PRKE 2HMTA 5HFAA 5JAQA 2Y93A 1L9XA 3UMMA 1SGWA 1WX1A 2QSYA 2XA9A 3LQYA 3MTIA 1RWQA 3WLKX 1GZHB 2CSXA 3HKBA 3D4PA 4WXMA 1OILA 1VJ1A 2CHVA 2WD9A 1C9NA 1WY7A 4LOKA 5L9AA 3CLTC 2HSZA 1GTL1 1REQB 5AW3A 2XUFA 3JQQA 1YIDA 2H0AA 2BGLA 3C7KA 2QY9A 1P4RA 4BQOA 1FVXA 2Z2XA 3H0EA 4JKYA 4MB6A 1Y3FE 3QPWA 2GPTA 3R23A 1HPLA 4QOSA 3OU2A 1T35A 4H0FA 1KBQA 1MF7A 2PL3A 2VR1A 3R5KA 3A1EA 1N3BA 5FO0A 2Q3FA 1UKVY 3OCXA 1W0CA 1DT3A 1Z8FA 4KLAA 1SQGA 3WGKA 1VMIA 4E4RA 1R6DA 1ZJWA 2GBLA 1HV8A 4H7HA 3L6BA 1XQVA 2RGAA 2FEPA 3GF4A 5MF6A 1YA6A 4X24A 3ZD9A 4CKEA 4A15A 4TV8A 2MU1A 3ZGNA 1LLQA 2PE5A 3BC1A 1PD1A 4JELA 4CKWB 3F6CA 1CULC 1DAKA 1GNVA 3GN1A 1N6PA 2EZ8A 3P0RA 3QPDA 4Y1RA 1B26A 5F52A 4M0FA 4EY5A 5FUMA 2Q1WA 2TYSB 2X9GA 4YDSA 1U6IA 3ZI0A 3PYLA 4FGSA 4K9MA 3FNRA 4BX0A 2XV1A 3AFNA 4I6EA 1IU9A 3CRQA 2XZTA 3OM0A 1H8ED 1E2QA 2HJRA 2ZUBA 1QONA 2X13A 2PFKA 2ZUTA 4YXWD 2HCFA 2IYWA 3QGMA 3AUTA 5SY6A 2O3QA 4HBZA 4MV3A 4FCTA 4R9NA 1IONA 4IIVA 3H5OA 2G76A 4D8TA 2DF8A 4KGVA 1WV1A 2JFXA 3VVMA 4BV3A 4MRMB 3B2NA 4JVMA 1C3EA 1NT4A 2DUUA 4FP9A 4ZDWA 4PAWA 1WA5A 4TTSA 3UBMA 1U3CA 2CL0X 2PBLA 2SCUA 2SKDA 1M0WA 2X9LA 2VZLA 1E63A 1K2VN 1IJKA 2ASEA 1N1DA 3UTCA 1PWHA 3IE1A 3NGXA 2GLUA 4LE0A 4G56A 5EKSA 3MMSA 3U37A 1C8KA 4D7AA 2XE7A 3PNQA 5BWNA 3HMQA 4WZ6A 2FPOA 4NCBA 1F1BA 2PD4A 1TGYA 3AY7A 3PQDA 5D6NA 1R66A 4BEBA 2IV3A 4YONB 4B3BA 1LWNA 3OE7A 4LYAA 1NJ2A 2MR6A 2QRMA 2PLNA 4M0EA 5EQDA 4DDUA 1KZYC 3MW8A 3WNQA 4D9MA 3ZN2A 3AOEA 4X45A 1RBQA 3DP7A 3JQ8B 3BD9A 1OXKB 2COKA 2G1AA 2C8JA 2IXGA 1NOKA 3KWJA 4G36A 1MO2A 3CLTD 3T4EA 3VR2A 1XPOA 1X7DA 1UJ6A 3L7BA 2R8ZA 4QDUA 2B8WA 3NM4A 1GTSA 2FZ5A 5ERYA 1MABB 1X87A 4KQ2A 3EK2A 4EW2A 1IXSB 1F12A 4Q9HA 3SS7X 3CTPA 3AJ8A 1WEHA 1XA3A 1KGDA 4LNAA 3O2QB 1HNNA 1OAOA 4Y2TA 4BNDB 3ZE9A 3LPNA 1N34B 1EHIA 4WBNA 4LIPD 2QLBA 4YCNA 1QIKA 1O57A 4GPZA 2DM6A 5ALQA 3TTTA 5I7VA 4B3SB 1G4UR 2R00C 1G8JA 1P74A 2JAHA 2SECE 4RL4A 3GUZA 1G4HA 1GQFA 1VP9A 1YZQA 3M8KA 5E1OA 1TMYA 3QITA 3BBLA 3SX0A 1T4MA 4H17A 5B4UA 2PH1A 4RULA 3PU6A 2IZ6A 4QYIB 2FQYA 2ZJZA 5DKFA 3KZKA 1EM6A 3KOYA 2EFEB 3PGVA 3PSHA 4BJHB 1VKJA 5T5QA 3RKSA 4Y2UA 5AVJA 3HA3A 3EC1A 2NU6B 1T25A 5J1TB 4F4UA 1WXEA 4Q19A 2FJUA 4LY3A 2HHLA 5C8ZA 2PRJA 3LMKA 1M8KA 5AIBA 2OP0A 3GLGA 2HA7A 3KVYA 2NWQA 3MRVA 4G67A 2W48A 5T3UA 1KXZA 2V6BA 1C3OB 2Z5LA 4H6WA 4KQ9A 3VH4A 4NL4H 2DBYA 2JHCA 4BLRA 5EIXA 2YFYA 4L76A 3S2IA 4X64B 1IUKA 3DT6A 2Q6VA 1I7QB 1ZUNB 3JQ9C 2IYTA 1PV4A 1X7ZB 2DUMA 4LF7B 4RVOA 1B76A 1MENA 3GIWA 2I66A 3H11A 1Y98A 1UJMA 1Q0HA 2WFLB 4JBXA 4EATA 4CIYA 1UOQA 4GS5A 4K9RA 4Y2RA 1PJTA 3PHCA