2HKDA

The crystal structure of engineered ospa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
315
structure length
315
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer Surface Protein A
publication title Atomic structures of peptide self-assembly mimics.
pubmed doi rcsb
source organism Borreliella burgdorferi
molecule tags De novo protein
total genus 63
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00820 Lipoprotein_1 Borrelia lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2hkdA01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2hkdA02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2hkdA03
2OYBO 2I5VO 2FKJA 2HKDA 5B11O 1RJLC 2G8CO 1P4PA 2PI3O 2OY1O 2AF5A 5B2AO 1OSPO 2OL7A 3AUMO 5B3MO 2I5ZO 2OY7A 1FJ1E 3EC5A 2OY8A 3CKGA 5B10O 2FKGA 2OL6O 2OY5O 2OL8O 3CKFA
chains in the Genus database with same CATH superfamily
5EEDA 3STKA 2KW1A 5JVHE 4GE1A 5L8IA 1CBIA 3HTYA 1VQLE 1VQPE 1SRGA 1VQKE 5HCCC 5IO6A 1RBPA 2G5LA 1AVDA 1TOWA 3RDMA 3CCJE 1JIWI 2CQLA 4GDZA 4O49A 1DF8A 4EKVA 3BRNA 3PQUA 1VYFA 2OY8A 3D96A 4CPHB 1IJ8A 1T8VA 3JSQA 1GXAA 1N4JA 2FHLA 2K23A 2AKQA 2OVEA 2QOMA 2CAMA 3CCME 1GM6A 5CSEA 5GAGG 1GT4A 5DG4A 1OEKA 4QQ1A 3CF5E 2JN3A 4PJ2A 3NR3A 4HPBA 1X8UA 4QGXA 1WUBA 3RKGA 1GX9A 2N93A 2FKGA 2OL8O 4GJSA 4DCBA 2W2AA 4HPDA 4O3ZA 1I05A 2KTSA 4ALOA 1VWKB 5D47A 1OPBA 4IABA 2AH7X 2BC3A 2RTDB 1A2DA 4U8UO 2OY5O 1QY1A 3WZOA 4BCSA 2GJ5A 1I4UA 4NV8A 2OY1O 2GC9A 2IZIA 2JW1A 3T2XA 1YJWE 3VU1A 4ZGFA 1M1KG 4HPCA 2AT5X 2Y3EA 1HBQA 3FIQA 4YVBA 3RSWA 1SWPA 4TNNA 3BSZE 1K9MG 1SWUA 1E5PA 3JS1A 3SZJA 1QY0A 2IZJA 1BSYA 2OY7A 1STPA 4KT5A 4O4XA 5F6ZA 4ORYA 5HWZA 1KZXA 1LF7A 4ORRA 1IFBA 1JZUA 1KQSE 4TLJA 2FHNX 5LJCA 2QO5A 4I9RA 4GDAA 5H9LA 2X8FA 1YP6A 1KT5A 1VWLB 2IZEB 4OKAA 1NQMA 4HWMA 3U0DA 1X8OA 3CXCE 2HZRA 1EQDA 1U0XA 5HZ8A 3J7ZG 5K06A 1VWAB 2OVDA 1VYOA 3O22A 1TXLA 4IRWA 2G79A 1TVQA 3KQ0A 1GKAB 4ODDA 3S5VA 1ADLA 3KVNA 2A5BA 2RA6A 1FEMA 2QA4E 3G6EE 1RXHA 2O62A 1HXLA 3SOTA 2OYBO 2DJFA 3CCRE 2DM5A 2Q39A 1NGLA 2RTFB 5B2AO 4YCHA 1QVFE 2WQ9A 1SWLA 1PMPA 4EQAC 1SMPI 3D4RA 2UZ2A 5EDBA 3PDFA 3CKFA 5FQ8E 2AL0X 1FELA 2YG2A 3VG5A 1VWFB 3I17A 3VG4A 3NQ9A 2X45A 4EEJA 1OEEA 5KHPA 4PSQA 4ZH9A 1SA8A 4ML7B 1X8QA 3BU9A 5GAHG 4ZJ0A 5IRUA 5CHKA 2M4LA 3TGCA 1P6PA 3OBLA 4FBOA 2CM4A 1RAVA 3ZW1B 1UYOX 1MX7A 3RDSA 4CPIA 4UY8G 4IB7A 2GTFX 3RY1A 3LTWA 1EALA 1ZNGA 3DTQA 1TOUA 3ELZA 1DC9A 3RDOA 1KOIA 1EPBA 2RTIB 4KCAA 1D2UA 4BJ8A 3NP1A 4TQ2A 3H3IA 3WXQA 4TKBA 2VFBA 1Z24A 3P6DA 5HBSA 5F7GA 2NNQA 5IRAA 2ZAGA 3NQKA 3FLLA 3APXA 3ZUOA 1X89A 4JNJA 5HTEA 2GTLN 1BEBA 4FBRA 2Q4NA 4COTA 4GETA 1U17A 1SLFB 2PY1A 2Y32A 2C1QA 4Z2PA 4ZGUA 1G85A 5HAEA 3PIOE 2FR3A 2KD2A 4O4SA 4GJVA 1LCVA 1SWOA 3T6FA 1N9YA 3ZWEA 3G7XA 1S44A 4IAWA 4BX6B 2JU3A 3WBGA 3SLOA 4Y0QA 3U9PC 1HBPA 2IZKA 3P24A 4L3RA 2LBAA 2X34A 3B2HA 2RTCB 1B8EA 3IA8A 4BBOA 4GKCA 3VE2A 3KFIA 4YFPA 1SREA 4BX5B 2G7BA 4ORXA 4O4UA 5IRWA 1Q82G 2OFBA 3ZI8A 1PM1X 3ZUIA 3FDCA 4NW4A 3BX8A 1X8PA 1JQPA 4YBPA 4BX7B 4Z2OA 4GUZA 3UEVA 4QGWA 3IFBA 3CQNA 3WJDA 1VQ4E 3OW2E 2Q2PA 4ZFXA 1SWHA 1EPAA 1KT7A 2ZJRE 2ZAIA 2BS6A 1SXUA 2CM9A 3PH5A 4KH8A 3FR4A 5LJEA 3RBYA 1Y55X 1VQ7E 3CR6A 2A0AA 1W6FA 5FENA 2CBRA 5D45A 3RE5A 2MHDA 3B2LA 3LV4A 2OTJE 3DLLE 3CCSE 2WPUA 5F1EA 3E3CA 1CJ5A 2FGSA 1HMRA 4IAXA 3F6ZB 1VQNE 3CCUE 1MOYA 1LIFA 4AZMA 4IMOA 3UEXA 1SRHA 2GTLO 3QQ2A 4FBVA 1QFVA 2RCQA 1OBPA 4YGZA 2FLJA 1YIJE 4GGZA 1VWJB 1KL5A 2OVAA 4I6SA 1E06A 2X8SA 2QOSC 1H91A 1NP1A 1VWQB 3SLTA 3PECA 2L9CA 2QO6A 3FEPA 3GAQA 3UAQA 3VGWA 2VFCA 4XMCA 2OF8A 2JU7A 4A1HA 3K3LA 5EDCA 4GNYA 2IZAA 1LDOA 3HOEA 1ICMA 1N0SA 2LBVA 4BGFA 3ZZVA 2MO5A 4RUUA 4I3CA 4LQZA 1VWRB 4XMHA 4U67E 4N7CA 1B4MA 2LFOA 1S7DA 1YJNE 1LKEA 1BSQA 2FKJA 4WFUA 5JVGE 1SWKA 2X32A 1HN2A 3MBTA 3WYPA 4WF9E 4IOAE 3WOVA 2R74A 1X8NA 4M7MA 5L8OA 2WSJA 4WFAE 2EU7X 4BOEA 4R0BA 3TZSA 5HTDA 1Y52X 5K68A 1SY0A 1QFTA 3I55E 1MM9A 2Q9SA 5F58A 4YKOA 4QYPA 3APVA 5HA1A 1R0UA 4CDFA 1ACDA 4MEEA 1VWOB 2OFAA 4N7DA 3BDRA 4IB8A 5HZ5A 4O9SA 2W2BA 3CBSA 2Q2MA 1GX8A 3TF6A 3N91A 3WYQA 2OL6O 3VHHA 2HLVA 1FE3A 2FR2A 4IB9A 2MWHA 1KZWA 1GT5A 1ZNLA 1UYNX 1O1UA 1RXKA 3SZHA 3MM0A 1ALBA 1IKJA 4MISA 5L3YA 3AKMA 3CWKA 1FDQA 1QABE 1N8RG 5EZ2A 2RTHB 5FAZA 5LJDA 2PI3O 3PPTA 1ERXA 2DJGA 4ALBA 5H8TA 5FQ7E 4Z2VA 3HOLA 3PIPE 2QM9A 5D48A 5CE4A 4IOCE 5H9NA 1JYJA 1DV9A 2ALLX 3O2YA 2R56A 2RQ0A 1JJJA 5CYBA 3I0AA 1K24A 3EBWA 4I60A 1OBQA 2CBSA 1HMTA 1YIVA 2R73A 3RDQA 1IFCA 1I06A 5AEOA 3WJCA 4GRJA 2QMIA 3HWEA 1KQXA 1AB0A 1ZRYA 4EXZA 3RDXA 2OL7A 4LKPA 1S72E 3VG6A 2AMMX 2P8GA 1RSUB 4L1NA 3WJGA 1HXZA 1SXYA 1ZNHA 1ZNEA 4EDEA 4TKJA 3JQOA 4GD9A 1PEEA 1NP4A 2VDFA 4INNA 4QNIA 4U8UM 1W5RA 4Z28A 1KD1G 5DPQA 3VG3A 2Y3FA 2AT0X 1G74A 4QZUA 2A3FX 5LKFA 2AVIA 4CPHA 5LKEA 3FA8A 1VWCB 5LJHA 2FRSA 3RZYA 4C5PA 1KL3A 5JR8A 1VWIB 1VWBB 1SWCA 3SZIA 5L8NA 4TJZA 1EXSA 1JMZA 3FW5A 3L4RA 4CDDA 5LJBA 4AZOA 1NC9A 2FS6A 1LDQA 1EIIA 2JU8A 4IMNA 2G8CO 1E02A 5F2BA 4Z27A 2RTPB 3LHNA 4YMYA 3FW4A 4K19A 4CK4A 4MVIA 3ZW0B 1LNMA 1DZMA 2Z4HA 1A18A 1O1VA 1YWAA 2RTOB 4NP1A 4LZVA 3P6FA 3Q34A 2IZHB 3P6EA 5AJCA 4I3DA 1W2BE 4NNTA 4CPEA 1S2PA 3D9WA 1MUPA 3CMAE 1DZPA 1SLEB 2L67A 3CPWE 1RJLC 2X56A 3WJEA 3AEHA 3CCVE 1PTSA 2MM3A 4HPAA 4MVKA 4U46A 4ON1A 2IZFB 3OD9A 4OMXA 3NX1A 1YP7A 1LUQA 4HFOA 4WHIA 5H9KA 3CD6E 1VWEB 4ZH6A 3AUMO 3C77X 4GU8A 4BQUA 4WBKA 4NNSA 5B5GA 5HCDC 2CZTA 2JMBA 2ZSCA 1MK5A 4D6AA 2FT9A 2CZUA 2RN4A 4QAEA 3RE6A 3HK1A 1GKAA 1GGLA 4OS0A 1K73G 1STSB 1SWQA 1BRPA 2A2GA 3EC5A 3P6GA 1UZ2X 1SRFA 2BT9A 5KIDA 1P4PA 2HNXA 2RTEB 2RD7C 4ZHGA 1G7NA 4UU2A 1GT1A 4I9SA 2RCTA 5IXGA 1N9MA 3NADA 3BY0A 4NLIA 1EIOA 4JO6A 1O8VA 1OBUA 1CBRA 2C1SA 1Y9LA 1SRIA 2IZCB 3F9DA 3EYCA 3PH6A 4O4OA 3VPJE 4O3YA 4ES7A 1STRB 2OVSA 2W2FA 4IB6A 1YHQE 4YKMA 2A13A 3ZW1A 2AF5A 3X00A 4ORSA 1EW3A 3KFGA 3QKGA 2OZQA 5BVQA 2NP1A 1I78A 2L5PA 4AW8A 4YDAA 2RTNB 4YFRA 3VE1A 3S60A 1MX8A 3FYFA 2X55A 3NQ3A 3PQSA 3S26A 4M6SA 4KIIA 1SWGA 5IO7A 3WJBA 4NYQA 2IFBA 1SRJA 3PK2A 1I04A 2FWVA 1HMSA 4ORWA 3EMMA 1SWJA 2X46A 1HQQA 3V8UA 3D97A 2AT6X 1JJUA 1Y53X 3PEDA 4ZHFA 2IZLB 4O3XB 3BX7A 3BLGA 3IG9A 2RTGB 3WZQA 4YGHA 2LA7A 3D95A 1SWEA 2IZDB 1HQPA 1DZKA 3SAOA 5B3MO 3FEKA 4BX6A 1GT3A 4Y59A 1BJ7A 4AZNA 2X4MA 1JBHA 4MIRA 3CC4E 4JHQA 2ASNX 1NDJA 2OFMX 4NV7A 4MVEA 2BS5A 4XMGA 1M90G 4OS8A 3G71E 3C76X 1NBXA 4JGLA 2YMSA 4BX5A 3CMPA 2RTJA 2ACPX 3B2JA 5BVTA 1VQ8E 3RWXA 4I95A 5K67A 2F01A 1AVGI 4O3WA 4BX7A 2IZGB 2OTLE 4CDCA 4YDBA 2GTLM 1IIUA 1PBOA 1LIEA 1RL6A 5HCEC 1VWHB 4KC7A 5AN9B 1FENA 3KFFA 4EFGA 1VWMB 2QO4A 1KXOA 1KQWA 3KZAA 2OF9A 3DSZA 4AZPA 4FGIB 1LELA 5HA0A 1VYGA 4UU3A 2QCBA 1VQOE 1XCAA 1SY2A 3PP6A 1SWNA 3OE3A 5HZQA 2RTAA 4Y0SA 5B5FA 3T6LA 2XSTA 1AELA 4OELA 3CCEE 1JV4A 3SLJA 3C78X 3T2WA 3HWDA 1UREA 5GADG 2HMBA 1NJIG 1KFFA 4CPFA 3FA7A 2LKKA 4GGTA 3FA9A 3Q6LA 3ELXA 4AZQA 4CSBA 3HWFA 2FS7A 3P6HA 1VQ6E 1GX3A 2IZBA 4WCEE 3O19A 4NLJA 1YWCA 3HWGA 1QWDA 1JJ2E 2WEXA 3FR2A 4CDEA 1CBSA 2A2UA 1ICNA 1HY2A 2XKLA 5GAEG 2G78A 1SLDB 1SWRA 4YGGA 1QVGE 4GH7A 2RTKA 3RY2A 1CBQA 1WBIA 4DNEA 4ZHCA 1SWFA 3CCQE 2POAA 1XKIA 2KTDA 3RDUA 3KFHA 1L6MA 4Y0RA 3F8AA 3NPOA 1OEJA 1ERBA 4ID2A 2I5ZO 5C0NA 2NNDA 1FJ1E 5MLCH 3CKGA 1IKEA 1OPAA 4WFVA 4AZRA 1LIBA 2Z4IA 3ZQ3A 2E4JA 2RTBB 2JGSA 5EEEA 1JMXA 3APWA 1PBYA 3FR5A 1SWTA 5EPQA 1SLGB 5JD2A 4XMFA 2UYWA 1T68X 4A1YA 2OFRX 1B0OA 3VHMA 1BSOA 3CC7E 2ZJPE 2LB6A 3WVMA 3CMEE 3IGEA 5DM6E 2X8TA 2A5CA 1K3BA 3NBXX 2RTMA 1LIDA 1BRQA 5H9AA 1DFVA 4IO9E 4RUNA 4DQ3A 4GZVA 4LKTA 3WJFA 4U9CA 2HKDA 4OEMA 1ML7A 4GNWA 5IO5A 1OSPO 2BLGA 1MDCA 4BVMA 5LJKA 3EW1A 3VG7A 5F6BA 3GE2A 4Y0PA 1SXWA 1YWDA 2I5VO 3MX7A 4GGRA 4DQ4A 5B27A 3ZW2A 4LZUA 3MG5A 3VHIA 5LJGA 2AT3X 2NNEA 3EBKA 3FA6A 4QYNA 2C4IA 1Q7YG 3B2KA 3BS2A 5FQ6E 2BSZA 1DF3A 5FFHA 3HPEA 1T0VA 4XMDA 3TGAA 3U03A 1G5WA 3VG2A 3I56E 4QRLA 4ORUA 3CC2E 2WQAE 1KT3A 1W4TA 2F73A 1X71A 2WR6A 4B55A 3MVFA 4D6BA 1SXXA 1VWDB 5AJBA 1SWAA 1LCZA 1SY1A 3FENA 1SWBA 2QEXE 3FIDA 2L68A 1KGLA 1YI2E 2GH7A 1LFOA 4ZHHA 5HZ6A 2RTLA 1BM5A 3G4SE 1VWPB 1EUOA 1Q86G 5BYPA 4NYRA 3OJYC 1BBPA 1Y9TA 4OS3A 2A8GA 1FTPA 5HZ9A 3STMX 1KT6A 3P6CA 3AKNA 1MVGA 5D8JA 1Y0GA 1AQBA 3EM0A 1KT4A 1U18A 1BLRA 1SWSA 4YCEA 3P02A 1A57A 3S5XA 1NQNA 4TKHA 5BVSA 4GK9A 1A3YA 1N43A 1SY3A 3APUA 3BU1A 2JOZA 2KT4B 2ZJQE 3B2IA 4WFNE 2MJIA 3CQRA 1IW2A 3FMZA 1LCWA 4IBAA 1LPJA 1YUPA 5B10O 1MEPA 1VWGB 1VPRA 1EI5A 1RLBE 1JJXA 1BWYA 4XMEA 4Z6JA 1VQME 4Y5DA 4MVLA 5KICA 4I3BA 1KC8G 3FELA 4QZTA 4A60A 5D4AA 3UEWA 1YJ9E 3WZPA 5H1SI 3UEUA 4QGVA 3CCLE 4ARHA 2AT8X 3TGBA 4A8ZA 4FQBB 1E2TA 1K8AG 1SWDA 5AQ6A 2HYSA 3NX2A 1AVEA 2F09A 1JYDA 1DZJA 1ZNKA 4ZHDA 4U3QA 1Q81G 4YH0A 1RXJA 1TW4A 4AYHA 3ZW0A 1CRBA 1YITE 2FTBA 2WEWA 1VQ9E 3T1DA 2RTQB 1QG5A 3STNA 4YBUA 2WWPA 5B11O 4ZCBA 5B29A 4WFBE 1QY2A 2RTRB 1E00A 3WZNA 4U8UN 4CV7A 2MF6A 1VQ5E 4KC8A 1QQSA 1RSTB 1LICA 2WUTA 1YWBA 3EW2A 2ANSA 4YFQA 3CBCA 1I9HA 5DM7E 1B56A 2HZQA 1D3SA 2ACOA 4ZR2A 1KL4A 2BHVA 1N7YA 5HL7E 2K62A 1VWNB 4OMWA 1ZNDA
chains in the Genus database with same CATH topology
2OYBO 2I5VO 2FKJA 2HKDA 5B11O 3IG9A 1RJLC 2G8CO 1P4PA 2PI3O 3IGEA 2OY1O 2AF5A 5B2AO 1OSPO 2OL7A 3AUMO 5B3MO 2I5ZO 2OY7A 1FJ1E 3EC5A 2OY8A 3CKGA 5B10O 2FKGA 2OL6O 2OY5O 2OL8O 3CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYB O;  2I5V O;  2FKJ A;  2HKD A;  5B11 O;  1RJL C;  2G8C O;  1P4P A;  2PI3 O;  2OY1 O;  2AF5 A;  5B2A O;  1OSP O;  2OL7 A;  3AUM O;  5B3M O;  2I5Z O;  2OY7 A;  1FJ1 E;  3EC5 A;  2OY8 A;  3CKG A;  5B10 O;  2FKG A;  2OL6 O;  2OY5 O;  2OL8 O;  3CKF A; 
#chains in the Genus database with same CATH topology
 5EED A;  3STK A;  2KW1 A;  5JVH E;  4GE1 A;  5L8I A;  1CBI A;  3HTY A;  1VQL E;  1VQP E;  1SRG A;  1VQK E;  5HCC C;  5IO6 A;  1RBP A;  2G5L A;  1AVD A;  1TOW A;  3RDM A;  3CCJ E;  1JIW I;  2CQL A;  4GDZ A;  4O49 A;  1DF8 A;  4EKV A;  3BRN A;  3PQU A;  1VYF A;  2OY8 A;  3D96 A;  4CPH B;  1IJ8 A;  1T8V A;  3JSQ A;  1GXA A;  1N4J A;  2FHL A;  2K23 A;  2AKQ A;  2OVE A;  2QOM A;  2CAM A;  3CCM E;  1GM6 A;  5CSE A;  5GAG G;  1GT4 A;  5DG4 A;  1OEK A;  4QQ1 A;  3CF5 E;  2JN3 A;  4PJ2 A;  3NR3 A;  4HPB A;  1X8U A;  4QGX A;  1WUB A;  3RKG A;  1GX9 A;  2N93 A;  2FKG A;  2OL8 O;  4GJS A;  4DCB A;  2W2A A;  4HPD A;  4O3Z A;  1I05 A;  2KTS A;  4ALO A;  1VWK B;  5D47 A;  1OPB A;  4IAB A;  2AH7 X;  2BC3 A;  2RTD B;  1A2D A;  4U8U O;  2OY5 O;  1QY1 A;  3WZO A;  4BCS A;  2GJ5 A;  1I4U A;  4NV8 A;  2OY1 O;  2GC9 A;  2IZI A;  2JW1 A;  3T2X A;  1YJW E;  3VU1 A;  4ZGF A;  1M1K G;  4HPC A;  2AT5 X;  2Y3E A;  1HBQ A;  3FIQ A;  4YVB A;  3RSW A;  1SWP A;  4TNN A;  3BSZ E;  1K9M G;  1SWU A;  1E5P A;  3JS1 A;  3SZJ A;  1QY0 A;  2IZJ A;  1BSY A;  2OY7 A;  1STP A;  4KT5 A;  4O4X A;  5F6Z A;  4ORY A;  5HWZ A;  1KZX A;  1LF7 A;  4ORR A;  1IFB A;  1JZU A;  1KQS E;  4TLJ A;  2FHN X;  5LJC A;  2QO5 A;  4I9R A;  4GDA A;  5H9L A;  2X8F A;  1YP6 A;  1KT5 A;  1VWL B;  2IZE B;  4OKA A;  1NQM A;  4HWM A;  3U0D A;  1X8O A;  3CXC E;  2HZR A;  1EQD A;  1U0X A;  5HZ8 A;  3J7Z G;  5K06 A;  1VWA B;  2OVD A;  1VYO A;  3O22 A;  1TXL A;  4IRW A;  2G79 A;  1TVQ A;  3KQ0 A;  1GKA B;  4ODD A;  3S5V A;  1ADL A;  3KVN A;  2A5B A;  2RA6 A;  1FEM A;  2QA4 E;  3G6E E;  1RXH A;  2O62 A;  1HXL A;  3SOT A;  2OYB O;  2DJF A;  3CCR E;  2DM5 A;  2Q39 A;  1NGL A;  2RTF B;  5B2A O;  4YCH A;  1QVF E;  2WQ9 A;  1SWL A;  1PMP A;  4EQA C;  1SMP I;  3D4R A;  2UZ2 A;  5EDB A;  3PDF A;  3CKF A;  5FQ8 E;  2AL0 X;  1FEL A;  2YG2 A;  3VG5 A;  1VWF B;  3I17 A;  3VG4 A;  3NQ9 A;  2X45 A;  4EEJ A;  1OEE A;  5KHP A;  4PSQ A;  4ZH9 A;  1SA8 A;  4ML7 B;  1X8Q A;  3BU9 A;  5GAH G;  4ZJ0 A;  5IRU A;  5CHK A;  2M4L A;  3TGC A;  1P6P A;  3OBL A;  4FBO A;  2CM4 A;  1RAV A;  3ZW1 B;  1UYO X;  1MX7 A;  3RDS A;  4CPI A;  4UY8 G;  4IB7 A;  2GTF X;  3RY1 A;  3LTW A;  1EAL A;  1ZNG A;  3DTQ A;  1TOU A;  3ELZ A;  1DC9 A;  3RDO A;  1KOI A;  1EPB A;  2RTI B;  4KCA A;  1D2U A;  4BJ8 A;  3NP1 A;  4TQ2 A;  3H3I A;  3WXQ A;  4TKB A;  2VFB A;  1Z24 A;  3P6D A;  5HBS A;  5F7G A;  2NNQ A;  5IRA A;  2ZAG A;  3NQK A;  3FLL A;  3APX A;  3ZUO A;  1X89 A;  4JNJ A;  5HTE A;  2GTL N;  1BEB A;  4FBR A;  2Q4N A;  4COT A;  4GET A;  1U17 A;  1SLF B;  2PY1 A;  2Y32 A;  2C1Q A;  4Z2P A;  4ZGU A;  1G85 A;  5HAE A;  3PIO E;  2FR3 A;  2KD2 A;  4O4S A;  4GJV A;  1LCV A;  1SWO A;  3T6F A;  1N9Y A;  3ZWE A;  3G7X A;  1S44 A;  4IAW A;  4BX6 B;  2JU3 A;  3WBG A;  3SLO A;  4Y0Q A;  3U9P C;  1HBP A;  2IZK A;  3P24 A;  4L3R A;  2LBA A;  2X34 A;  3B2H A;  2RTC B;  1B8E A;  3IA8 A;  4BBO A;  4GKC A;  3VE2 A;  3KFI A;  4YFP A;  1SRE A;  4BX5 B;  2G7B A;  4ORX A;  4O4U A;  5IRW A;  1Q82 G;  2OFB A;  3ZI8 A;  1PM1 X;  3ZUI A;  3FDC A;  4NW4 A;  3BX8 A;  1X8P A;  1JQP A;  4YBP A;  4BX7 B;  4Z2O A;  4GUZ A;  3UEV A;  4QGW A;  3IFB A;  3CQN A;  3WJD A;  1VQ4 E;  3OW2 E;  2Q2P A;  4ZFX A;  1SWH A;  1EPA A;  1KT7 A;  2ZJR E;  2ZAI A;  2BS6 A;  1SXU A;  2CM9 A;  3PH5 A;  4KH8 A;  3FR4 A;  5LJE A;  3RBY A;  1Y55 X;  1VQ7 E;  3CR6 A;  2A0A A;  1W6F A;  5FEN A;  2CBR A;  5D45 A;  3RE5 A;  2MHD A;  3B2L A;  3LV4 A;  2OTJ E;  3DLL E;  3CCS E;  2WPU A;  5F1E A;  3E3C A;  1CJ5 A;  2FGS A;  1HMR A;  4IAX A;  3F6Z B;  1VQN E;  3CCU E;  1MOY A;  1LIF A;  4AZM A;  4IMO A;  3UEX A;  1SRH A;  2GTL O;  3QQ2 A;  4FBV A;  1QFV A;  2RCQ A;  1OBP A;  4YGZ A;  2FLJ A;  1YIJ E;  4GGZ A;  1VWJ B;  1KL5 A;  2OVA A;  4I6S A;  1E06 A;  2X8S A;  2QOS C;  1H91 A;  1NP1 A;  1VWQ B;  3SLT A;  3PEC A;  2L9C A;  2QO6 A;  3FEP A;  3GAQ A;  3UAQ A;  3VGW A;  2VFC A;  4XMC A;  2OF8 A;  2JU7 A;  4A1H A;  3K3L A;  5EDC A;  4GNY A;  2IZA A;  1LDO A;  3HOE A;  1ICM A;  1N0S A;  2LBV A;  4BGF A;  3ZZV A;  2MO5 A;  4RUU A;  4I3C A;  4LQZ A;  1VWR B;  4XMH A;  4U67 E;  4N7C A;  1B4M A;  2LFO A;  1S7D A;  1YJN E;  1LKE A;  1BSQ A;  2FKJ A;  4WFU A;  5JVG E;  1SWK A;  2X32 A;  1HN2 A;  3MBT A;  3WYP A;  4WF9 E;  4IOA E;  3WOV A;  2R74 A;  1X8N A;  4M7M A;  5L8O A;  2WSJ A;  4WFA E;  2EU7 X;  4BOE A;  4R0B A;  3TZS A;  5HTD A;  1Y52 X;  5K68 A;  1SY0 A;  1QFT A;  3I55 E;  1MM9 A;  2Q9S A;  5F58 A;  4YKO A;  4QYP A;  3APV A;  5HA1 A;  1R0U A;  4CDF A;  1ACD A;  4MEE A;  1VWO B;  2OFA A;  4N7D A;  3BDR A;  4IB8 A;  5HZ5 A;  4O9S A;  2W2B A;  3CBS A;  2Q2M A;  1GX8 A;  3TF6 A;  3N91 A;  3WYQ A;  2OL6 O;  3VHH A;  2HLV A;  1FE3 A;  2FR2 A;  4IB9 A;  2MWH A;  1KZW A;  1GT5 A;  1ZNL A;  1UYN X;  1O1U A;  1RXK A;  3SZH A;  3MM0 A;  1ALB A;  1IKJ A;  4MIS A;  5L3Y A;  3AKM A;  3CWK A;  1FDQ A;  1QAB E;  1N8R G;  5EZ2 A;  2RTH B;  5FAZ A;  5LJD A;  2PI3 O;  3PPT A;  1ERX A;  2DJG A;  4ALB A;  5H8T A;  5FQ7 E;  4Z2V A;  3HOL A;  3PIP E;  2QM9 A;  5D48 A;  5CE4 A;  4IOC E;  5H9N A;  1JYJ A;  1DV9 A;  2ALL X;  3O2Y A;  2R56 A;  2RQ0 A;  1JJJ A;  5CYB A;  3I0A A;  1K24 A;  3EBW A;  4I60 A;  1OBQ A;  2CBS A;  1HMT A;  1YIV A;  2R73 A;  3RDQ A;  1IFC A;  1I06 A;  5AEO A;  3WJC A;  4GRJ A;  2QMI A;  3HWE A;  1KQX A;  1AB0 A;  1ZRY A;  4EXZ A;  3RDX A;  2OL7 A;  4LKP A;  1S72 E;  3VG6 A;  2AMM X;  2P8G A;  1RSU B;  4L1N A;  3WJG A;  1HXZ A;  1SXY A;  1ZNH A;  1ZNE A;  4EDE A;  4TKJ A;  3JQO A;  4GD9 A;  1PEE A;  1NP4 A;  2VDF A;  4INN A;  4QNI A;  4U8U M;  1W5R A;  4Z28 A;  1KD1 G;  5DPQ A;  3VG3 A;  2Y3F A;  2AT0 X;  1G74 A;  4QZU A;  2A3F X;  5LKF A;  2AVI A;  4CPH A;  5LKE A;  3FA8 A;  1VWC B;  5LJH A;  2FRS A;  3RZY A;  4C5P A;  1KL3 A;  5JR8 A;  1VWI B;  1VWB B;  1SWC A;  3SZI A;  5L8N A;  4TJZ A;  1EXS A;  1JMZ A;  3FW5 A;  3L4R A;  4CDD A;  5LJB A;  4AZO A;  1NC9 A;  2FS6 A;  1LDQ A;  1EII A;  2JU8 A;  4IMN A;  2G8C O;  1E02 A;  5F2B A;  4Z27 A;  2RTP B;  3LHN A;  4YMY A;  3FW4 A;  4K19 A;  4CK4 A;  4MVI A;  3ZW0 B;  1LNM A;  1DZM A;  2Z4H A;  1A18 A;  1O1V A;  1YWA A;  2RTO B;  4NP1 A;  4LZV A;  3P6F A;  3Q34 A;  2IZH B;  3P6E A;  5AJC A;  4I3D A;  1W2B E;  4NNT A;  4CPE A;  1S2P A;  3D9W A;  1MUP A;  3CMA E;  1DZP A;  1SLE B;  2L67 A;  3CPW E;  1RJL C;  2X56 A;  3WJE A;  3AEH A;  3CCV E;  1PTS A;  2MM3 A;  4HPA A;  4MVK A;  4U46 A;  4ON1 A;  2IZF B;  3OD9 A;  4OMX A;  3NX1 A;  1YP7 A;  1LUQ A;  4HFO A;  4WHI A;  5H9K A;  3CD6 E;  1VWE B;  4ZH6 A;  3AUM O;  3C77 X;  4GU8 A;  4BQU A;  4WBK A;  4NNS A;  5B5G A;  5HCD C;  2CZT A;  2JMB A;  2ZSC A;  1MK5 A;  4D6A A;  2FT9 A;  2CZU A;  2RN4 A;  4QAE A;  3RE6 A;  3HK1 A;  1GKA A;  1GGL A;  4OS0 A;  1K73 G;  1STS B;  1SWQ A;  1BRP A;  2A2G A;  3EC5 A;  3P6G A;  1UZ2 X;  1SRF A;  2BT9 A;  5KID A;  1P4P A;  2HNX A;  2RTE B;  2RD7 C;  4ZHG A;  1G7N A;  4UU2 A;  1GT1 A;  4I9S A;  2RCT A;  5IXG A;  1N9M A;  3NAD A;  3BY0 A;  4NLI A;  1EIO A;  4JO6 A;  1O8V A;  1OBU A;  1CBR A;  2C1S A;  1Y9L A;  1SRI A;  2IZC B;  3F9D A;  3EYC A;  3PH6 A;  4O4O A;  3VPJ E;  4O3Y A;  4ES7 A;  1STR B;  2OVS A;  2W2F A;  4IB6 A;  1YHQ E;  4YKM A;  2A13 A;  3ZW1 A;  2AF5 A;  3X00 A;  4ORS A;  1EW3 A;  3KFG A;  3QKG A;  2OZQ A;  5BVQ A;  2NP1 A;  1I78 A;  2L5P A;  4AW8 A;  4YDA A;  2RTN B;  4YFR A;  3VE1 A;  3S60 A;  1MX8 A;  3FYF A;  2X55 A;  3NQ3 A;  3PQS A;  3S26 A;  4M6S A;  4KII A;  1SWG A;  5IO7 A;  3WJB A;  4NYQ A;  2IFB A;  1SRJ A;  3PK2 A;  1I04 A;  2FWV A;  1HMS A;  4ORW A;  3EMM A;  1SWJ A;  2X46 A;  1HQQ A;  3V8U A;  3D97 A;  2AT6 X;  1JJU A;  1Y53 X;  3PED A;  4ZHF A;  2IZL B;  4O3X B;  3BX7 A;  3BLG A;  3IG9 A;  2RTG B;  3WZQ A;  4YGH A;  2LA7 A;  3D95 A;  1SWE A;  2IZD B;  1HQP A;  1DZK A;  3SAO A;  5B3M O;  3FEK A;  4BX6 A;  1GT3 A;  4Y59 A;  1BJ7 A;  4AZN A;  2X4M A;  1JBH A;  4MIR A;  3CC4 E;  4JHQ A;  2ASN X;  1NDJ A;  2OFM X;  4NV7 A;  4MVE A;  2BS5 A;  4XMG A;  1M90 G;  4OS8 A;  3G71 E;  3C76 X;  1NBX A;  4JGL A;  2YMS A;  4BX5 A;  3CMP A;  2RTJ A;  2ACP X;  3B2J A;  5BVT A;  1VQ8 E;  3RWX A;  4I95 A;  5K67 A;  2F01 A;  1AVG I;  4O3W A;  4BX7 A;  2IZG B;  2OTL E;  4CDC A;  4YDB A;  2GTL M;  1IIU A;  1PBO A;  1LIE A;  1RL6 A;  5HCE C;  1VWH B;  4KC7 A;  5AN9 B;  1FEN A;  3KFF A;  4EFG A;  1VWM B;  2QO4 A;  1KXO A;  1KQW A;  3KZA A;  2OF9 A;  3DSZ A;  4AZP A;  4FGI B;  1LEL A;  5HA0 A;  1VYG A;  4UU3 A;  2QCB A;  1VQO E;  1XCA A;  1SY2 A;  3PP6 A;  1SWN A;  3OE3 A;  5HZQ A;  2RTA A;  4Y0S A;  5B5F A;  3T6L A;  2XST A;  1AEL A;  4OEL A;  3CCE E;  1JV4 A;  3SLJ A;  3C78 X;  3T2W A;  3HWD A;  1URE A;  5GAD G;  2HMB A;  1NJI G;  1KFF A;  4CPF A;  3FA7 A;  2LKK A;  4GGT A;  3FA9 A;  3Q6L A;  3ELX A;  4AZQ A;  4CSB A;  3HWF A;  2FS7 A;  3P6H A;  1VQ6 E;  1GX3 A;  2IZB A;  4WCE E;  3O19 A;  4NLJ A;  1YWC A;  3HWG A;  1QWD A;  1JJ2 E;  2WEX A;  3FR2 A;  4CDE A;  1CBS A;  2A2U A;  1ICN A;  1HY2 A;  2XKL A;  5GAE G;  2G78 A;  1SLD B;  1SWR A;  4YGG A;  1QVG E;  4GH7 A;  2RTK A;  3RY2 A;  1CBQ A;  1WBI A;  4DNE A;  4ZHC A;  1SWF A;  3CCQ E;  2POA A;  1XKI A;  2KTD A;  3RDU A;  3KFH A;  1L6M A;  4Y0R A;  3F8A A;  3NPO A;  1OEJ A;  1ERB A;  4ID2 A;  2I5Z O;  5C0N A;  2NND A;  1FJ1 E;  5MLC H;  3CKG A;  1IKE A;  1OPA A;  4WFV A;  4AZR A;  1LIB A;  2Z4I A;  3ZQ3 A;  2E4J A;  2RTB B;  2JGS A;  5EEE A;  1JMX A;  3APW A;  1PBY A;  3FR5 A;  1SWT A;  5EPQ A;  1SLG B;  5JD2 A;  4XMF A;  2UYW A;  1T68 X;  4A1Y A;  2OFR X;  1B0O A;  3VHM A;  1BSO A;  3CC7 E;  2ZJP E;  2LB6 A;  3WVM A;  3CME E;  3IGE A;  5DM6 E;  2X8T A;  2A5C A;  1K3B A;  3NBX X;  2RTM A;  1LID A;  1BRQ A;  5H9A A;  1DFV A;  4IO9 E;  4RUN A;  4DQ3 A;  4GZV A;  4LKT A;  3WJF A;  4U9C A;  2HKD A;  4OEM A;  1ML7 A;  4GNW A;  5IO5 A;  1OSP O;  2BLG A;  1MDC A;  4BVM A;  5LJK A;  3EW1 A;  3VG7 A;  5F6B A;  3GE2 A;  4Y0P A;  1SXW A;  1YWD A;  2I5V O;  3MX7 A;  4GGR A;  4DQ4 A;  5B27 A;  3ZW2 A;  4LZU A;  3MG5 A;  3VHI A;  5LJG A;  2AT3 X;  2NNE A;  3EBK A;  3FA6 A;  4QYN A;  2C4I A;  1Q7Y G;  3B2K A;  3BS2 A;  5FQ6 E;  2BSZ A;  1DF3 A;  5FFH A;  3HPE A;  1T0V A;  4XMD A;  3TGA A;  3U03 A;  1G5W A;  3VG2 A;  3I56 E;  4QRL A;  4ORU A;  3CC2 E;  2WQA E;  1KT3 A;  1W4T A;  2F73 A;  1X71 A;  2WR6 A;  4B55 A;  3MVF A;  4D6B A;  1SXX A;  1VWD B;  5AJB A;  1SWA A;  1LCZ A;  1SY1 A;  3FEN A;  1SWB A;  2QEX E;  3FID A;  2L68 A;  1KGL A;  1YI2 E;  2GH7 A;  1LFO A;  4ZHH A;  5HZ6 A;  2RTL A;  1BM5 A;  3G4S E;  1VWP B;  1EUO A;  1Q86 G;  5BYP A;  4NYR A;  3OJY C;  1BBP A;  1Y9T A;  4OS3 A;  2A8G A;  1FTP A;  5HZ9 A;  3STM X;  1KT6 A;  3P6C A;  3AKN A;  1MVG A;  5D8J A;  1Y0G A;  1AQB A;  3EM0 A;  1KT4 A;  1U18 A;  1BLR A;  1SWS A;  4YCE A;  3P02 A;  1A57 A;  3S5X A;  1NQN A;  4TKH A;  5BVS A;  4GK9 A;  1A3Y A;  1N43 A;  1SY3 A;  3APU A;  3BU1 A;  2JOZ A;  2KT4 B;  2ZJQ E;  3B2I A;  4WFN E;  2MJI A;  3CQR A;  1IW2 A;  3FMZ A;  1LCW A;  4IBA A;  1LPJ A;  1YUP A;  5B10 O;  1MEP A;  1VWG B;  1VPR A;  1EI5 A;  1RLB E;  1JJX A;  1BWY A;  4XME A;  4Z6J A;  1VQM E;  4Y5D A;  4MVL A;  5KIC A;  4I3B A;  1KC8 G;  3FEL A;  4QZT A;  4A60 A;  5D4A A;  3UEW A;  1YJ9 E;  3WZP A;  5H1S I;  3UEU A;  4QGV A;  3CCL E;  4ARH A;  2AT8 X;  3TGB A;  4A8Z A;  4FQB B;  1E2T A;  1K8A G;  1SWD A;  5AQ6 A;  2HYS A;  3NX2 A;  1AVE A;  2F09 A;  1JYD A;  1DZJ A;  1ZNK A;  4ZHD A;  4U3Q A;  1Q81 G;  4YH0 A;  1RXJ A;  1TW4 A;  4AYH A;  3ZW0 A;  1CRB A;  1YIT E;  2FTB A;  2WEW A;  1VQ9 E;  3T1D A;  2RTQ B;  1QG5 A;  3STN A;  4YBU A;  2WWP A;  5B11 O;  4ZCB A;  5B29 A;  4WFB E;  1QY2 A;  2RTR B;  1E00 A;  3WZN A;  4U8U N;  4CV7 A;  2MF6 A;  1VQ5 E;  4KC8 A;  1QQS A;  1RST B;  1LIC A;  2WUT A;  1YWB A;  3EW2 A;  2ANS A;  4YFQ A;  3CBC A;  1I9H A;  5DM7 E;  1B56 A;  2HZQ A;  1D3S A;  2ACO A;  4ZR2 A;  1KL4 A;  2BHV A;  1N7Y A;  5HL7 E;  2K62 A;  1VWN B;  4OMW A;  1ZND A; 
#chains in the Genus database with same CATH homology
 2OYB O;  2I5V O;  2FKJ A;  2HKD A;  5B11 O;  3IG9 A;  1RJL C;  2G8C O;  1P4P A;  2PI3 O;  3IGE A;  2OY1 O;  2AF5 A;  5B2A O;  1OSP O;  2OL7 A;  3AUM O;  5B3M O;  2I5Z O;  2OY7 A;  1FJ1 E;  3EC5 A;  2OY8 A;  3CKG A;  5B10 O;  2FKG A;  2OL6 O;  2OY5 O;  2OL8 O;  3CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...