2HKDA

The crystal structure of engineered ospa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
315
structure length
315
Chain Sequence
NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGELSEKKITRADKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer Surface Protein A
publication title Atomic structures of peptide self-assembly mimics.
pubmed doi rcsb
source organism Borreliella burgdorferi
molecule tags De novo protein
total genus 63
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00820 Lipoprotein_1 Borrelia lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2hkdA01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2hkdA02
3.90.930.30 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2hkdA03
2OY7A 2OL8O 2OY1O 3EC5A 2FKGA 5B11O 2I5ZO 2PI3O 2OYBO 2G8CO 1P4PA 1FJ1E 2OY5O 3CKGA 2OY8A 3AUMO 5B2AO 2FKJA 2OL7A 2HKDA 3CKFA 1OSPO 2OL6O 5B3MO 1RJLC 2I5VO 2AF5A 5B10O
chains in the Genus database with same CATH superfamily
2X8TA 3BRNA 1SLFB 1OPBA 5H9LA 3OE3A 3CCEE 4NV8A 1YIJE 2OYBO 1MVGA 1ZNGA 1YWAA 2UZ2A 4QYNA 3VG2A 1FE3A 4NLIA 3DSZA 4YMYA 1E02A 3I55E 4NNTA 2JOZA 4MISA 2RTMA 3BSZE 5HTEA 3L4RA 2X45A 2RTGB 2G8CO 1YUPA 5EEEA 3CMPA 2KTSA 3AUMO 3C77X 4DNEA 4DQ4A 2JU7A 2A5CA 1SY3A 5IRWA 1S7DA 3EC5A 4KT5A 4CV7A 3EW1A 1VWRB 1X8NA 3HWGA 5FQ7E 4HFOA 1IJ8A 1GM6A 1D2UA 1UZ2X 3PIOE 1I05A 3MM0A 4ZHDA 5LJGA 4BQUA 5KIDA 2Z4IA 4NLJA 1VQ5E 3HK1A 4CDEA 1YWCA 1LIFA 1MOYA 2X46A 1A2DA 3CBCA 2FR3A 1FENA 1ZRYA 2F09A 2RTKA 1E00A 4ML7B 1ZNKA 1SWBA 1N43A 3Q34A 2HMBA 1GX3A 4FBRA 3HWFA 1VQPE 1BSOA 1LICA 1YI2E 1ICNA 1MX8A 3D95A 1LUQA 2N93A 3FMZA 4Y5DA 3P6EA 3ZW1B 1HQPA 3S5XA 2JW1A 2ASNX 3CCME 1G7NA 5KICA 2G5LA 3PQSA 1SWAA 4BBOA 4YCHA 1JZUA 1VWAB 3VU1A 4WFAE 4Y0QA 3PQUA 4U8UN 2IZGB 4XMDA 3WVMA 3UAQA 2JU3A 4NYQA 3F9DA 4BX7A 1JJUA 3B2IA 1AVEA 1Y52X 4JHQA 4CSBA 2IZIA 2GTLM 3NR3A 2POAA 1RXKA 4CDFA 2RTHB 3CCVE 2C1SA 2AMMX 3RY2A 2FT9A 3IA8A 1NGLA 2OY5O 3FR2A 1QY2A 2OF9A 2VFCA 1DC9A 3CXCE 1W2BE 1VWPB 4XMCA 2RTDB 4Y0RA 1AELA 3VE1A 5D47A 4U46A 3RE5A 1ML7A 4CK4A 1GGLA 3J7ZG 2JGSA 1M1KG 4TKJA 1BRQA 1JMZA 1CJ5A 3SZIA 1O8VA 4O4UA 1JBHA 3EW2A 3WJFA 3ZW0B 1VQKE 1IW2A 1O1VA 2NP1A 3ZI8A 1MM9A 4ZHHA 1LIEA 1VWNB 1HN2A 4YH0A 3FA7A 1XCAA 2ACOA 1QVFE 4I3BA 2R74A 1JMXA 3DLLE 1N9MA 5D4AA 3NBXX 4QNIA 3RKGA 2PI3O 3STKA 4IRWA 2RQ0A 1KXOA 4BOEA 3OD9A 3CKFA 3CC2E 2G78A 4QGVA 4YBPA 1W5RA 2L68A 1N4JA 1GT5A 2WSJA 4Y0SA 5HCCC 1K9MG 1STSB 1BLRA 1STPA 3K3LA 1YWDA 2PY1A 4WFUA 3FR5A 3CKGA 3APUA 1LELA 4ZFXA 3P6DA 1RLBE 1YIVA 4UU3A 5JVHE 2AF5A 5FAZA 2X8FA 1SRJA 3MX7A 5EPQA 1MK5A 4AW8A 2F01A 1NQMA 4IMNA 1QFTA 4ZJ0A 1T0VA 2FTBA 4QRLA 1N9YA 4KIIA 2FR2A 3WOVA 1I06A 2FKGA 1ICMA 4NYRA 1EPAA 1VWKB 3RDSA 2QO5A 2FWVA 5H9KA 1SWTA 1EIIA 3UEVA 1TW4A 3EBWA 2WQAE 1I78A 4ZHFA 2FHLA 3F6ZB 1ZNLA 4QGXA 1I04A 1SWQA 3KFHA 3OBLA 1CBSA 3TZSA 2E4JA 1ERBA 4IOAE 1ALBA 1SXWA 1VWFB 4N7DA 3WJEA 1PMPA 5JVGE 1TVQA 2OFAA 3CC7E 4ES7A 5B27A 5JR8A 1YP6A 3CCSE 4B55A 2CZUA 3ZW2A 1LF7A 3RWXA 3JQOA 1SLEB 2RTLA 1VYOA 1RSTB 2A3FX 5H9AA 5B3MO 3O22A 2FRSA 3WYPA 2ZAGA 2IZKA 1BWYA 4NP1A 1VQNE 4Z2PA 1VQ6E 1GT3A 2QA4E 1KT5A 3ELZA 2UYWA 1NQNA 3P6GA 2OY8A 3BU1A 2RTRB 2MJIA 3T6FA 1QFVA 1SRGA 1E2TA 5HTDA 4FBOA 4M7MA 1TXLA 3RDMA 2IZAA 1BEBA 4AZRA 3G7XA 2QM9A 3RDUA 1IKJA 3X00A 2IZCB 4TKHA 4BJ8A 1QY0A 2RTPB 3RE6A 4ODDA 1SRHA 3CF5E 3GE2A 2IZEB 1EW3A 4EKVA 1B56A 4YCEA 2R56A 1PBYA 2ZSCA 3VG4A 4I60A 4A1HA 1JIWI 3FYFA 1RBPA 3BS2A 3VPJE 1EPBA 5FENA 1IIUA 1SA8A 4BX7B 2WQ9A 1HY2A 1PEEA 2IZDB 4A8ZA 1SWDA 2VFBA 1ZNDA 1JJ2E 4MVKA 1JJXA 3VE2A 4KC8A 2L67A 2Z4HA 5MLCH 1LPJA 4L3RA 2RTQB 3NP1A 4WFNE 2IZFB 2Y3FA 2LBVA 4U3QA 2O62A 1HXZA 5AEOA 2RA6A 2ZAIA 3WZNA 3PDFA 1KOIA 3CC4E 1VWQB 2W2AA 1SY1A 4C5PA 1X89A 2YMSA 1VPRA 1W4TA 3FA8A 4OMXA 1HMSA 3HWEA 4CDDA 1LCWA 3SOTA 2A2UA 3IG9A 4AYHA 4LZVA 3PH6A 1OEEA 1R0UA 1E5PA 5EDCA 1GX8A 5GADG 4OS3A 2CM9A 3FEPA 4ORUA 2GTFX 3VG6A 2KTDA 1LIDA 4YVBA 4O3WA 2GH7A 1VQOE 4YBUA 5F58A 4QAEA 3D9WA 2A0AA 1CRBA 3PK2A 1VQ4E 1KZXA 2R73A 2GTLN 4OS0A 1SXYA 1VWDB 1VWCB 3ELXA 3SZHA 2ZJRE 3TGCA 3RDQA 1SWEA 3S60A 4N7CA 3FW4A 3CCJE 1OBPA 4OKAA 1VQLE 2OVAA 2C4IA 2BS6A 1O1UA 3MBTA 4ALBA 2IZHB 1OBQA 2X4MA 1PTSA 4GZVA 3SLJA 4UU2A 1KL4A 1SY2A 4IABA 1BBPA 1ADLA 2OVSA 4RUUA 2VDFA 1YJ9E 3LTWA 1VWEB 3QQ2A 5BVSA 2AT5X 1HMTA 1T8VA 2MO5A 2OZQA 5LKFA 1P4PA 5LJEA 4ORRA 2GTLO 3VHIA 5HZ8A 5HZ9A 1BJ7A 1MX7A 1RJLC 4Z28A 3TF6A 5DG4A 1KT6A 4O4SA 4I95A 1EIOA 4O4OA 3F8AA 3JSQA 1A3YA 5HCEC 4LKPA 2OTJE 1JQPA 2JU8A 3IFBA 4K19A 5BVTA 5F6BA 4O3ZA 2OFMX 3EBKA 3PEDA 4IBAA 3NX1A 4ZGFA 4YGZA 1Z24A 5LJHA 1LDQA 2HZQA 2MM3A 1HBPA 2XSTA 4Y59A 5H9NA 5L3YA 1VWJB 1Y55X 1NP4A 4TJZA 4GE1A 1SMPI 1SWNA 5B10O 4WFBE 2EU7X 2AT8X 4KCAA 4EFGA 1G85A 2RTNB 2GJ5A 2BSZA 1JYJA 3FENA 3VGWA 1X8OA 1DZKA 1SWFA 1NC9A 2I5ZO 4FGIB 3CQNA 3ZWEA 4OELA 1Y9TA 3U9PC 2NNQA 3APXA 3EM0A 5B2AO 4YFRA 1RXHA 4YKMA 3P02A 3WJCA 4WF9E 1LKEA 1KL5A 1SWHA 2AT3X 1LDOA 1TOUA 3RDOA 2Q39A 1RSUB 1N0SA 4WFVA 5HA0A 5HWZA 5LJKA 1GT1A 2DJFA 2X32A 2BHVA 4R0BA 2X56A 1P6PA 3PECA 4LKTA 3P6HA 5C0NA 5HZ6A 4U8UM 2YG2A 3T2XA 2CBRA 4GGTA 2KD2A 1GKAA 2CM4A 5CE4A 1D3SA 1SREA 1SWGA 3FW5A 3JS1A 5H1SI 1AVDA 4A1YA 3AKMA 4KC7A 1FEMA 5FQ6E 2RTIB 5CSEA 3FIDA 1LCVA 1YHQE 4QGWA 1U0XA 4FBVA 4RUNA 2RTFB 4QZUA 1AVGI 5K67A 1KD1G 2G7BA 1U17A 1Y9LA 2OL6O 3WZOA 5K68A 2LFOA 2M4LA 3VG3A 4Z2OA 3EMMA 5B5GA 2QOSC 4IB6A 1CBQA 3PH5A 3CWKA 2I5VO 3KVNA 2Y32A 1DZMA 2HZRA 3T1DA 3UEWA 4AZPA 1JJJA 1Q81G 1VWMB 4GDAA 2IFBA 3AKNA 3LV4A 3P6CA 3HOEA 3ZW1A 1EALA 1MEPA 2MF6A 2OL7A 4ZHGA 2RTEB 4GDZA 1AQBA 4LQZA 4COTA 4GETA 2A5BA 1SWJA 3P24A 2LBAA 2OFBA 3KQ0A 4WBKA 3TGBA 3BU9A 3FA9A 4IAWA 1OPAA 2OL8O 5HL7E 4Z6JA 1QABE 1UYNX 5D48A 2KT4B 3NQ9A 2CZTA 5F1EA 1WBIA 2FS6A 1VWLB 4TKBA 1EUOA 1XKIA 2BS5A 2RN4A 4BX6A 4JGLA 2IZBA 1LFOA 2X34A 4D6AA 1HMRA 1VQME 5IRAA 4Z27A 4GJVA 5GAGG 2OY7A 5F7GA 4CPFA 5IO5A 4TQ2A 1N8RG 3B2KA 1UREA 4BX5A 1NJIG 2WEWA 5HZ5A 1B0OA 3HOLA 3VG7A 3G6EE 2CQLA 1GT4A 4CPHA 5FQ8E 5AQ6A 1IKEA 3NQKA 1KT7A 4GH7A 1DFVA 3OJYC 1GXAA 5B5FA 4INNA 1X8QA 3FLLA 2KW1A 4ON1A 5AJBA 1VWOB 3B2JA 1ZNEA 3UEUA 1QY1A 1DF8A 3KFIA 3WBGA 1T68X 3C76X 1EQDA 1VWBB 3CMAE 5HAEA 4BVMA 3WJGA 3I17A 1YJNE 1MUPA 2HNXA 1FELA 1I9HA 3WJDA 2BLGA 2WUTA 2FHNX 4O4XA 5K06A 3CCRE 4IB9A 1YWBA 4HPCA 1SWPA 3B2LA 2NNEA 2OVDA 1B4MA 3RBYA 1IFCA 4ORYA 4Z2VA 1G74A 2BT9A 2OY1O 1I4UA 1KT3A 4MVIA 1FDQA 1HXLA 1PM1X 5AN9B 2AKQA 1YITE 4IB8A 1WUBA 4O3XB 2W2BA 3PIPE 3SZJA 1NBXA 1SWSA 1K3BA 2IZLB 2ACPX 2Y3EA 5F2BA 3P6FA 5L8OA 3TGAA 2QMIA 1KT4A 1U18A 3VG5A 3WYQA 5H8TA 4OEMA 5AJCA 3Q6LA 2RTCB 4O9SA 1QVGE 2QOMA 4GGRA 2NNDA 4GJSA 4DCBA 3OW2E 1RL6A 4YGHA 1GKAB 3QKGA 3S5VA 5IO6A 2L5PA 2FS7A 3T6LA 5JD2A 5GAHG 3CQRA 2AT0X 3KFGA 4QQ1A 1E06A 3IGEA 4QZTA 3KFFA 4YDAA 1L6MA 2F73A 2W2FA 4I3DA 3RSWA 4IOCE 1VQ7E 4GRJA 1HBQA 4XMFA 3S26A 5L8NA 2K62A 1FTPA 5LJCA 3APWA 1Q7YG 5IXGA 3U03A 1BRPA 2HYSA 1VYFA 2GC9A 3RY1A 4JO6A 2X55A 4NV7A 3FA6A 1LCZA 1SWLA 4GK9A 1DZPA 3APVA 2RTAA 2WEXA 1SY0A 3WZPA 3AEHA 5IO7A 3CCLE 3BX8A 4IO9E 2RTJA 4U9CA 4EXZA 1SLGB 3PPTA 2AVIA 2ZJPE 1S72E 1SXXA 1OBUA 2LB6A 3G4SE 3FIQA 3NADA 3RDXA 3SAOA 1BM5A 3CMEE 4HPDA 4U67E 1S2PA 1GX9A 2WPUA 4YKOA 1LIBA 3NQ3A 3CPWE 1BSQA 1LNMA 2OVEA 2AH7X 4OS8A 2RCQA 3D97A 1CBRA 1VYGA 2FLJA 1KQXA 3BY0A 1SWCA 4AZMA 2G79A 2X8SA 1Q86G 1OSPO 3ZUIA 5BYPA 3FELA 4FQBB 2ALLX 4HWMA 4A60A 3FEKA 4AZQA 4GD9A 5FFHA 3CD6E 3O2YA 3DTQA 4PJ2A 5GAEG 5F6ZA 5HBSA 4BX6B 1OEKA 4BGFA 4D6BA 3N91A 4ZHCA 3VHHA 1PBOA 2LKKA 2L9CA 4Y0PA 4U8UO 4GKCA 3HTYA 4YFPA 1G5WA 3UEXA 1FJ1E 1S44A 2HKDA 4TNNA 2MWHA 2OF8A 4BX5B 3GAQA 1SLDB 2Q4NA 4GUZA 2RTBB 3EYCA 4CPHB 1SWRA 4IAXA 3LHNA 1JV4A 2QO4A 1AB0A 1VQ9E 1A18A 3SLTA 3U0DA 4OMWA 3WZQA 4BCSA 1SXUA 1SWOA 2Q9SA 1DZJA 4ZGUA 5CHKA 4GNYA 1ACDA 2RTOB 1RAVA 4WHIA 4GNWA 1B8EA 2CAMA 2RD7C 1RXJA 2A8GA 1TOWA 4ID2A 3HWDA 5EEDA 4MEEA 1K8AG 4IB7A 3FDCA 3BDRA 3WJBA 3NX2A 1ERXA 3CCUE 1Y53X 2P8GA 3BLGA 2IZJA 5HA1A 2FKJA 1IFBA 3SLOA 4I9SA 1SWUA 4HPAA 1X8PA 2Q2PA 4EDEA 1MDCA 4KH8A 1KZWA 1EI5A 2C1QA 1X71A 4DQ3A 2JN3A 4AZNA 1KFFA 1SRFA 2WWPA 3I56E 3D4RA 5D45A 2RCTA 1CBIA 1JYDA 4ALOA 5BVQA 1K73G 5LJBA 1EXSA 1M90G 4NW4A 3VHMA 4YGGA 4XMEA 3BX7A 5HCDC 3STMX 5KHPA 2AT6X 1HQQA 4I9RA 4LZUA 2MHDA 2CBSA 4MVEA 3FR4A 4YFQA 1NDJA 4GGZA 1Q82G 3CBSA 4XMGA 4MVLA 4M6SA 5CYBA 2JMBA 1YJWE 3CR6A 2K23A 2OFRX 4NNSA 3PP6A 4JNJA 1QG5A 3CCQE 1VWIB 4YDBA 4EEJA 3ZZVA 3T2WA 1KGLA 2XKLA 4IMOA 1UYOX 3C78X 2Q2MA 5LKEA 1SWKA 2DJGA 5B29A 2BC3A 2LA7A 3V8UA 2FGSA 3B2HA 5D8JA 4O3YA 4O49A 1DV9A 1A57A 1NP1A 5DM6E 5DPQA 1K24A 1X8UA 3O19A 1VWGB 2QEXE 2A13A 2ANSA 3MG5A 4CPIA 1KL3A 1SRIA 5EZ2A 5HZQA 1VQ8E 3HPEA 4EQAC 4TLJA 3D96A 4HPBA 2AL0X 3E3CA 1KQWA 4MIRA 1OEJA 5L8IA 4I3CA 3I0AA 3NPOA 4ORXA 3ZW0A 4GU8A 1KC8G 3STNA 3G71E 3KZAA 3ZUOA 2OTLE 4ORWA 4CDCA 3RZYA 1YP7A 5B11O 4ORSA 2WR6A 2DM5A 1Y0GA 3ZQ3A 4ARHA 4XMHA 1VWHB 4I6SA 4PSQA 4CPEA 1W6FA 4ZCBA 2ZJQE 1H91A 1QWDA 3MVFA 1ZNHA 2QO6A 5LJDA 4UY8G 1DF3A 1STRB 2QCBA 2HLVA 4QYPA 4ZR2A 4ZH6A 4ZH9A 4WCEE 5EDBA 5DM7E 3WXQA 1N7YA 2A2GA 4L1NA 1BSYA 1KQSE 1QQSA 5IRUA 4AZOA 3H3IA
chains in the Genus database with same CATH topology
2OY7A 2OL8O 2OY1O 3IGEA 3EC5A 2FKGA 5B11O 2I5ZO 2PI3O 2OYBO 2G8CO 1P4PA 1FJ1E 2OY5O 3CKGA 2OY8A 3AUMO 5B2AO 2FKJA 2OL7A 3IG9A 2HKDA 3CKFA 1OSPO 2OL6O 5B3MO 1RJLC 2I5VO 2AF5A 5B10O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OY7 A;  2OL8 O;  2OY1 O;  3EC5 A;  2FKG A;  5B11 O;  2I5Z O;  2PI3 O;  2OYB O;  2G8C O;  1P4P A;  1FJ1 E;  2OY5 O;  3CKG A;  2OY8 A;  3AUM O;  5B2A O;  2FKJ A;  2OL7 A;  2HKD A;  3CKF A;  1OSP O;  2OL6 O;  5B3M O;  1RJL C;  2I5V O;  2AF5 A;  5B10 O; 
#chains in the Genus database with same CATH topology
 2X8T A;  3BRN A;  1SLF B;  1OPB A;  5H9L A;  3OE3 A;  3CCE E;  4NV8 A;  1YIJ E;  2OYB O;  1MVG A;  1ZNG A;  1YWA A;  2UZ2 A;  4QYN A;  3VG2 A;  1FE3 A;  4NLI A;  3DSZ A;  4YMY A;  1E02 A;  3I55 E;  4NNT A;  2JOZ A;  4MIS A;  2RTM A;  3BSZ E;  5HTE A;  3L4R A;  2X45 A;  2RTG B;  2G8C O;  1YUP A;  5EEE A;  3CMP A;  2KTS A;  3AUM O;  3C77 X;  4DNE A;  4DQ4 A;  2JU7 A;  2A5C A;  1SY3 A;  5IRW A;  1S7D A;  3EC5 A;  4KT5 A;  4CV7 A;  3EW1 A;  1VWR B;  1X8N A;  3HWG A;  5FQ7 E;  4HFO A;  1IJ8 A;  1GM6 A;  1D2U A;  1UZ2 X;  3PIO E;  1I05 A;  3MM0 A;  4ZHD A;  5LJG A;  4BQU A;  5KID A;  2Z4I A;  4NLJ A;  1VQ5 E;  3HK1 A;  4CDE A;  1YWC A;  1LIF A;  1MOY A;  2X46 A;  1A2D A;  3CBC A;  2FR3 A;  1FEN A;  1ZRY A;  2F09 A;  2RTK A;  1E00 A;  4ML7 B;  1ZNK A;  1SWB A;  1N43 A;  3Q34 A;  2HMB A;  1GX3 A;  4FBR A;  3HWF A;  1VQP E;  1BSO A;  1LIC A;  1YI2 E;  1ICN A;  1MX8 A;  3D95 A;  1LUQ A;  2N93 A;  3FMZ A;  4Y5D A;  3P6E A;  3ZW1 B;  1HQP A;  3S5X A;  2JW1 A;  2ASN X;  3CCM E;  1G7N A;  5KIC A;  2G5L A;  3PQS A;  1SWA A;  4BBO A;  4YCH A;  1JZU A;  1VWA B;  3VU1 A;  4WFA E;  4Y0Q A;  3PQU A;  4U8U N;  2IZG B;  4XMD A;  3WVM A;  3UAQ A;  2JU3 A;  4NYQ A;  3F9D A;  4BX7 A;  1JJU A;  3B2I A;  1AVE A;  1Y52 X;  4JHQ A;  4CSB A;  2IZI A;  2GTL M;  3NR3 A;  2POA A;  1RXK A;  4CDF A;  2RTH B;  3CCV E;  2C1S A;  2AMM X;  3RY2 A;  2FT9 A;  3IA8 A;  1NGL A;  2OY5 O;  3FR2 A;  1QY2 A;  2OF9 A;  2VFC A;  1DC9 A;  3CXC E;  1W2B E;  1VWP B;  4XMC A;  2RTD B;  4Y0R A;  1AEL A;  3VE1 A;  5D47 A;  4U46 A;  3RE5 A;  1ML7 A;  4CK4 A;  1GGL A;  3J7Z G;  2JGS A;  1M1K G;  4TKJ A;  1BRQ A;  1JMZ A;  1CJ5 A;  3SZI A;  1O8V A;  4O4U A;  1JBH A;  3EW2 A;  3WJF A;  3ZW0 B;  1VQK E;  1IW2 A;  1O1V A;  2NP1 A;  3ZI8 A;  1MM9 A;  4ZHH A;  1LIE A;  1VWN B;  1HN2 A;  4YH0 A;  3FA7 A;  1XCA A;  2ACO A;  1QVF E;  4I3B A;  2R74 A;  1JMX A;  3DLL E;  1N9M A;  5D4A A;  3NBX X;  4QNI A;  3RKG A;  2PI3 O;  3STK A;  4IRW A;  2RQ0 A;  1KXO A;  4BOE A;  3OD9 A;  3CKF A;  3CC2 E;  2G78 A;  4QGV A;  4YBP A;  1W5R A;  2L68 A;  1N4J A;  1GT5 A;  2WSJ A;  4Y0S A;  5HCC C;  1K9M G;  1STS B;  1BLR A;  1STP A;  3K3L A;  1YWD A;  2PY1 A;  4WFU A;  3FR5 A;  3CKG A;  3APU A;  1LEL A;  4ZFX A;  3P6D A;  1RLB E;  1YIV A;  4UU3 A;  5JVH E;  2AF5 A;  5FAZ A;  2X8F A;  1SRJ A;  3MX7 A;  5EPQ A;  1MK5 A;  4AW8 A;  2F01 A;  1NQM A;  4IMN A;  1QFT A;  4ZJ0 A;  1T0V A;  2FTB A;  4QRL A;  1N9Y A;  4KII A;  2FR2 A;  3WOV A;  1I06 A;  2FKG A;  1ICM A;  4NYR A;  1EPA A;  1VWK B;  3RDS A;  2QO5 A;  2FWV A;  5H9K A;  1SWT A;  1EII A;  3UEV A;  1TW4 A;  3EBW A;  2WQA E;  1I78 A;  4ZHF A;  2FHL A;  3F6Z B;  1ZNL A;  4QGX A;  1I04 A;  1SWQ A;  3KFH A;  3OBL A;  1CBS A;  3TZS A;  2E4J A;  1ERB A;  4IOA E;  1ALB A;  1SXW A;  1VWF B;  4N7D A;  3WJE A;  1PMP A;  5JVG E;  1TVQ A;  2OFA A;  3CC7 E;  4ES7 A;  5B27 A;  5JR8 A;  1YP6 A;  3CCS E;  4B55 A;  2CZU A;  3ZW2 A;  1LF7 A;  3RWX A;  3JQO A;  1SLE B;  2RTL A;  1VYO A;  1RST B;  2A3F X;  5H9A A;  5B3M O;  3O22 A;  2FRS A;  3WYP A;  2ZAG A;  2IZK A;  1BWY A;  4NP1 A;  1VQN E;  4Z2P A;  1VQ6 E;  1GT3 A;  2QA4 E;  1KT5 A;  3ELZ A;  2UYW A;  1NQN A;  3P6G A;  2OY8 A;  3BU1 A;  2RTR B;  2MJI A;  3T6F A;  1QFV A;  1SRG A;  1E2T A;  5HTD A;  4FBO A;  4M7M A;  1TXL A;  3RDM A;  2IZA A;  1BEB A;  4AZR A;  3G7X A;  2QM9 A;  3RDU A;  1IKJ A;  3X00 A;  2IZC B;  4TKH A;  4BJ8 A;  1QY0 A;  2RTP B;  3RE6 A;  4ODD A;  1SRH A;  3CF5 E;  3GE2 A;  2IZE B;  1EW3 A;  4EKV A;  1B56 A;  4YCE A;  2R56 A;  1PBY A;  2ZSC A;  3VG4 A;  4I60 A;  4A1H A;  1JIW I;  3FYF A;  1RBP A;  3BS2 A;  3VPJ E;  1EPB A;  5FEN A;  1IIU A;  1SA8 A;  4BX7 B;  2WQ9 A;  1HY2 A;  1PEE A;  2IZD B;  4A8Z A;  1SWD A;  2VFB A;  1ZND A;  1JJ2 E;  4MVK A;  1JJX A;  3VE2 A;  4KC8 A;  2L67 A;  2Z4H A;  5MLC H;  1LPJ A;  4L3R A;  2RTQ B;  3NP1 A;  4WFN E;  2IZF B;  2Y3F A;  2LBV A;  4U3Q A;  2O62 A;  1HXZ A;  5AEO A;  2RA6 A;  2ZAI A;  3WZN A;  3PDF A;  1KOI A;  3CC4 E;  1VWQ B;  2W2A A;  1SY1 A;  4C5P A;  1X89 A;  2YMS A;  1VPR A;  1W4T A;  3FA8 A;  4OMX A;  1HMS A;  3HWE A;  4CDD A;  1LCW A;  3SOT A;  2A2U A;  3IG9 A;  4AYH A;  4LZV A;  3PH6 A;  1OEE A;  1R0U A;  1E5P A;  5EDC A;  1GX8 A;  5GAD G;  4OS3 A;  2CM9 A;  3FEP A;  4ORU A;  2GTF X;  3VG6 A;  2KTD A;  1LID A;  4YVB A;  4O3W A;  2GH7 A;  1VQO E;  4YBU A;  5F58 A;  4QAE A;  3D9W A;  2A0A A;  1CRB A;  3PK2 A;  1VQ4 E;  1KZX A;  2R73 A;  2GTL N;  4OS0 A;  1SXY A;  1VWD B;  1VWC B;  3ELX A;  3SZH A;  2ZJR E;  3TGC A;  3RDQ A;  1SWE A;  3S60 A;  4N7C A;  3FW4 A;  3CCJ E;  1OBP A;  4OKA A;  1VQL E;  2OVA A;  2C4I A;  2BS6 A;  1O1U A;  3MBT A;  4ALB A;  2IZH B;  1OBQ A;  2X4M A;  1PTS A;  4GZV A;  3SLJ A;  4UU2 A;  1KL4 A;  1SY2 A;  4IAB A;  1BBP A;  1ADL A;  2OVS A;  4RUU A;  2VDF A;  1YJ9 E;  3LTW A;  1VWE B;  3QQ2 A;  5BVS A;  2AT5 X;  1HMT A;  1T8V A;  2MO5 A;  2OZQ A;  5LKF A;  1P4P A;  5LJE A;  4ORR A;  2GTL O;  3VHI A;  5HZ8 A;  5HZ9 A;  1BJ7 A;  1MX7 A;  1RJL C;  4Z28 A;  3TF6 A;  5DG4 A;  1KT6 A;  4O4S A;  4I95 A;  1EIO A;  4O4O A;  3F8A A;  3JSQ A;  1A3Y A;  5HCE C;  4LKP A;  2OTJ E;  1JQP A;  2JU8 A;  3IFB A;  4K19 A;  5BVT A;  5F6B A;  4O3Z A;  2OFM X;  3EBK A;  3PED A;  4IBA A;  3NX1 A;  4ZGF A;  4YGZ A;  1Z24 A;  5LJH A;  1LDQ A;  2HZQ A;  2MM3 A;  1HBP A;  2XST A;  4Y59 A;  5H9N A;  5L3Y A;  1VWJ B;  1Y55 X;  1NP4 A;  4TJZ A;  4GE1 A;  1SMP I;  1SWN A;  5B10 O;  4WFB E;  2EU7 X;  2AT8 X;  4KCA A;  4EFG A;  1G85 A;  2RTN B;  2GJ5 A;  2BSZ A;  1JYJ A;  3FEN A;  3VGW A;  1X8O A;  1DZK A;  1SWF A;  1NC9 A;  2I5Z O;  4FGI B;  3CQN A;  3ZWE A;  4OEL A;  1Y9T A;  3U9P C;  2NNQ A;  3APX A;  3EM0 A;  5B2A O;  4YFR A;  1RXH A;  4YKM A;  3P02 A;  3WJC A;  4WF9 E;  1LKE A;  1KL5 A;  1SWH A;  2AT3 X;  1LDO A;  1TOU A;  3RDO A;  2Q39 A;  1RSU B;  1N0S A;  4WFV A;  5HA0 A;  5HWZ A;  5LJK A;  1GT1 A;  2DJF A;  2X32 A;  2BHV A;  4R0B A;  2X56 A;  1P6P A;  3PEC A;  4LKT A;  3P6H A;  5C0N A;  5HZ6 A;  4U8U M;  2YG2 A;  3T2X A;  2CBR A;  4GGT A;  2KD2 A;  1GKA A;  2CM4 A;  5CE4 A;  1D3S A;  1SRE A;  1SWG A;  3FW5 A;  3JS1 A;  5H1S I;  1AVD A;  4A1Y A;  3AKM A;  4KC7 A;  1FEM A;  5FQ6 E;  2RTI B;  5CSE A;  3FID A;  1LCV A;  1YHQ E;  4QGW A;  1U0X A;  4FBV A;  4RUN A;  2RTF B;  4QZU A;  1AVG I;  5K67 A;  1KD1 G;  2G7B A;  1U17 A;  1Y9L A;  2OL6 O;  3WZO A;  5K68 A;  2LFO A;  2M4L A;  3VG3 A;  4Z2O A;  3EMM A;  5B5G A;  2QOS C;  4IB6 A;  1CBQ A;  3PH5 A;  3CWK A;  2I5V O;  3KVN A;  2Y32 A;  1DZM A;  2HZR A;  3T1D A;  3UEW A;  4AZP A;  1JJJ A;  1Q81 G;  1VWM B;  4GDA A;  2IFB A;  3AKN A;  3LV4 A;  3P6C A;  3HOE A;  3ZW1 A;  1EAL A;  1MEP A;  2MF6 A;  2OL7 A;  4ZHG A;  2RTE B;  4GDZ A;  1AQB A;  4LQZ A;  4COT A;  4GET A;  2A5B A;  1SWJ A;  3P24 A;  2LBA A;  2OFB A;  3KQ0 A;  4WBK A;  3TGB A;  3BU9 A;  3FA9 A;  4IAW A;  1OPA A;  2OL8 O;  5HL7 E;  4Z6J A;  1QAB E;  1UYN X;  5D48 A;  2KT4 B;  3NQ9 A;  2CZT A;  5F1E A;  1WBI A;  2FS6 A;  1VWL B;  4TKB A;  1EUO A;  1XKI A;  2BS5 A;  2RN4 A;  4BX6 A;  4JGL A;  2IZB A;  1LFO A;  2X34 A;  4D6A A;  1HMR A;  1VQM E;  5IRA A;  4Z27 A;  4GJV A;  5GAG G;  2OY7 A;  5F7G A;  4CPF A;  5IO5 A;  4TQ2 A;  1N8R G;  3B2K A;  1URE A;  4BX5 A;  1NJI G;  2WEW A;  5HZ5 A;  1B0O A;  3HOL A;  3VG7 A;  3G6E E;  2CQL A;  1GT4 A;  4CPH A;  5FQ8 E;  5AQ6 A;  1IKE A;  3NQK A;  1KT7 A;  4GH7 A;  1DFV A;  3OJY C;  1GXA A;  5B5F A;  4INN A;  1X8Q A;  3FLL A;  2KW1 A;  4ON1 A;  5AJB A;  1VWO B;  3B2J A;  1ZNE A;  3UEU A;  1QY1 A;  1DF8 A;  3KFI A;  3WBG A;  1T68 X;  3C76 X;  1EQD A;  1VWB B;  3CMA E;  5HAE A;  4BVM A;  3WJG A;  3I17 A;  1YJN E;  1MUP A;  2HNX A;  1FEL A;  1I9H A;  3WJD A;  2BLG A;  2WUT A;  2FHN X;  4O4X A;  5K06 A;  3CCR E;  4IB9 A;  1YWB A;  4HPC A;  1SWP A;  3B2L A;  2NNE A;  2OVD A;  1B4M A;  3RBY A;  1IFC A;  4ORY A;  4Z2V A;  1G74 A;  2BT9 A;  2OY1 O;  1I4U A;  1KT3 A;  4MVI A;  1FDQ A;  1HXL A;  1PM1 X;  5AN9 B;  2AKQ A;  1YIT E;  4IB8 A;  1WUB A;  4O3X B;  2W2B A;  3PIP E;  3SZJ A;  1NBX A;  1SWS A;  1K3B A;  2IZL B;  2ACP X;  2Y3E A;  5F2B A;  3P6F A;  5L8O A;  3TGA A;  2QMI A;  1KT4 A;  1U18 A;  3VG5 A;  3WYQ A;  5H8T A;  4OEM A;  5AJC A;  3Q6L A;  2RTC B;  4O9S A;  1QVG E;  2QOM A;  4GGR A;  2NND A;  4GJS A;  4DCB A;  3OW2 E;  1RL6 A;  4YGH A;  1GKA B;  3QKG A;  3S5V A;  5IO6 A;  2L5P A;  2FS7 A;  3T6L A;  5JD2 A;  5GAH G;  3CQR A;  2AT0 X;  3KFG A;  4QQ1 A;  1E06 A;  3IGE A;  4QZT A;  3KFF A;  4YDA A;  1L6M A;  2F73 A;  2W2F A;  4I3D A;  3RSW A;  4IOC E;  1VQ7 E;  4GRJ A;  1HBQ A;  4XMF A;  3S26 A;  5L8N A;  2K62 A;  1FTP A;  5LJC A;  3APW A;  1Q7Y G;  5IXG A;  3U03 A;  1BRP A;  2HYS A;  1VYF A;  2GC9 A;  3RY1 A;  4JO6 A;  2X55 A;  4NV7 A;  3FA6 A;  1LCZ A;  1SWL A;  4GK9 A;  1DZP A;  3APV A;  2RTA A;  2WEX A;  1SY0 A;  3WZP A;  3AEH A;  5IO7 A;  3CCL E;  3BX8 A;  4IO9 E;  2RTJ A;  4U9C A;  4EXZ A;  1SLG B;  3PPT A;  2AVI A;  2ZJP E;  1S72 E;  1SXX A;  1OBU A;  2LB6 A;  3G4S E;  3FIQ A;  3NAD A;  3RDX A;  3SAO A;  1BM5 A;  3CME E;  4HPD A;  4U67 E;  1S2P A;  1GX9 A;  2WPU A;  4YKO A;  1LIB A;  3NQ3 A;  3CPW E;  1BSQ A;  1LNM A;  2OVE A;  2AH7 X;  4OS8 A;  2RCQ A;  3D97 A;  1CBR A;  1VYG A;  2FLJ A;  1KQX A;  3BY0 A;  1SWC A;  4AZM A;  2G79 A;  2X8S A;  1Q86 G;  1OSP O;  3ZUI A;  5BYP A;  3FEL A;  4FQB B;  2ALL X;  4HWM A;  4A60 A;  3FEK A;  4AZQ A;  4GD9 A;  5FFH A;  3CD6 E;  3O2Y A;  3DTQ A;  4PJ2 A;  5GAE G;  5F6Z A;  5HBS A;  4BX6 B;  1OEK A;  4BGF A;  4D6B A;  3N91 A;  4ZHC A;  3VHH A;  1PBO A;  2LKK A;  2L9C A;  4Y0P A;  4U8U O;  4GKC A;  3HTY A;  4YFP A;  1G5W A;  3UEX A;  1FJ1 E;  1S44 A;  2HKD A;  4TNN A;  2MWH A;  2OF8 A;  4BX5 B;  3GAQ A;  1SLD B;  2Q4N A;  4GUZ A;  2RTB B;  3EYC A;  4CPH B;  1SWR A;  4IAX A;  3LHN A;  1JV4 A;  2QO4 A;  1AB0 A;  1VQ9 E;  1A18 A;  3SLT A;  3U0D A;  4OMW A;  3WZQ A;  4BCS A;  1SXU A;  1SWO A;  2Q9S A;  1DZJ A;  4ZGU A;  5CHK A;  4GNY A;  1ACD A;  2RTO B;  1RAV A;  4WHI A;  4GNW A;  1B8E A;  2CAM A;  2RD7 C;  1RXJ A;  2A8G A;  1TOW A;  4ID2 A;  3HWD A;  5EED A;  4MEE A;  1K8A G;  4IB7 A;  3FDC A;  3BDR A;  3WJB A;  3NX2 A;  1ERX A;  3CCU E;  1Y53 X;  2P8G A;  3BLG A;  2IZJ A;  5HA1 A;  2FKJ A;  1IFB A;  3SLO A;  4I9S A;  1SWU A;  4HPA A;  1X8P A;  2Q2P A;  4EDE A;  1MDC A;  4KH8 A;  1KZW A;  1EI5 A;  2C1Q A;  1X71 A;  4DQ3 A;  2JN3 A;  4AZN A;  1KFF A;  1SRF A;  2WWP A;  3I56 E;  3D4R A;  5D45 A;  2RCT A;  1CBI A;  1JYD A;  4ALO A;  5BVQ A;  1K73 G;  5LJB A;  1EXS A;  1M90 G;  4NW4 A;  3VHM A;  4YGG A;  4XME A;  3BX7 A;  5HCD C;  3STM X;  5KHP A;  2AT6 X;  1HQQ A;  4I9R A;  4LZU A;  2MHD A;  2CBS A;  4MVE A;  3FR4 A;  4YFQ A;  1NDJ A;  4GGZ A;  1Q82 G;  3CBS A;  4XMG A;  4MVL A;  4M6S A;  5CYB A;  2JMB A;  1YJW E;  3CR6 A;  2K23 A;  2OFR X;  4NNS A;  3PP6 A;  4JNJ A;  1QG5 A;  3CCQ E;  1VWI B;  4YDB A;  4EEJ A;  3ZZV A;  3T2W A;  1KGL A;  2XKL A;  4IMO A;  1UYO X;  3C78 X;  2Q2M A;  5LKE A;  1SWK A;  2DJG A;  5B29 A;  2BC3 A;  2LA7 A;  3V8U A;  2FGS A;  3B2H A;  5D8J A;  4O3Y A;  4O49 A;  1DV9 A;  1A57 A;  1NP1 A;  5DM6 E;  5DPQ A;  1K24 A;  1X8U A;  3O19 A;  1VWG B;  2QEX E;  2A13 A;  2ANS A;  3MG5 A;  4CPI A;  1KL3 A;  1SRI A;  5EZ2 A;  5HZQ A;  1VQ8 E;  3HPE A;  4EQA C;  4TLJ A;  3D96 A;  4HPB A;  2AL0 X;  3E3C A;  1KQW A;  4MIR A;  1OEJ A;  5L8I A;  4I3C A;  3I0A A;  3NPO A;  4ORX A;  3ZW0 A;  4GU8 A;  1KC8 G;  3STN A;  3G71 E;  3KZA A;  3ZUO A;  2OTL E;  4ORW A;  4CDC A;  3RZY A;  1YP7 A;  5B11 O;  4ORS A;  2WR6 A;  2DM5 A;  1Y0G A;  3ZQ3 A;  4ARH A;  4XMH A;  1VWH B;  4I6S A;  4PSQ A;  4CPE A;  1W6F A;  4ZCB A;  2ZJQ E;  1H91 A;  1QWD A;  3MVF A;  1ZNH A;  2QO6 A;  5LJD A;  4UY8 G;  1DF3 A;  1STR B;  2QCB A;  2HLV A;  4QYP A;  4ZR2 A;  4ZH6 A;  4ZH9 A;  4WCE E;  5EDB A;  5DM7 E;  3WXQ A;  1N7Y A;  2A2G A;  4L1N A;  1BSY A;  1KQS E;  1QQS A;  5IRU A;  4AZO A;  3H3I A; 
#chains in the Genus database with same CATH homology
 2OY7 A;  2OL8 O;  2OY1 O;  3IGE A;  3EC5 A;  2FKG A;  5B11 O;  2I5Z O;  2PI3 O;  2OYB O;  2G8C O;  1P4P A;  1FJ1 E;  2OY5 O;  3CKG A;  2OY8 A;  3AUM O;  5B2A O;  2FKJ A;  2OL7 A;  3IG9 A;  2HKD A;  3CKF A;  1OSP O;  2OL6 O;  5B3M O;  1RJL C;  2I5V O;  2AF5 A;  5B10 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...