2HKFH

Crystal structure of the complex fab m75- peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
210
Chain Sequence
EVQVVESGGGLVQPKGSLKLSCVVSGSTLNNYAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMIYLQMNNLKTEDTAMYYCVTYGNHPFAYWGQGTLVTVSAAKTTPPSVYPLAPGCTGSSVTLGCLVKGYFPESVTVTWNSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin Light chain Fab fragment
publication title Stabilization of antibody structure upon association to a human carbonic anhydrase IX epitope studied by X-ray crystallography, microcalorimetry, and molecular dynamics simulations.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 210
sequence length 218
ec nomenclature
pdb deposition date 2006-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfH01
1X4XA 2ZG3A 4LARH 2P49B 1QFWI 4H5SB 5EU6E 1G0XA 1KJ2H 4F80A 5FYKD 4PRDB 3VFPA 2UYLB 3R1GH 3LQZB 1ROWA 5DRNA 5C9JB 4ODWA 3HNVH 5D1QC 2VAAB 1KB5L 3IRPX 3KWWB 4NO0D 3QIBA 1KIUA 5D72L 1YEJH 2A73B 3V6OA 3O6LH 3V4UH 3KXFD 2IPTH 4X99B 3EFFA 4Y4KA 4HS8H 3CMOL 2NZ9C 3W2DH 1X7QB 1CLCA 3RDTC 4MAYA 4WFEE 1BBJB 5HHME 4WI3A 5F9JA 3QIUC 4PRPD 1HKLL 1YC7A 4ONFL 4OD1H 4K3JL 3MBEB 5EZJA 3S96B 2JJSA 1A7QH 5DURD 1G7IB 1OD7A 4MXVF 4X6BA 3SQBA 4AT6B 4UIMA 5DUML 4KUZL 1C7SA 4DOHE 1AQDA 2YD6A 3NAAL 2DJUA 3DMMC 5HYJD 3TYGH 2X9YA 3EYUL 2BSED 1EHNA 1ZT7A 1F00I 1B4JL 4X5WA 1DUZA 2DMCA 2LU3A 3NGBC 3ARWA 4LPVA 2ARJA 5I73B 1V7NL 4KRNA 2RBLA 2Y06H 1BFSA 1P1ZB 3CSYA 2D3VA 3GIZL 4GSDL 1B88A 1ZHLB 4M1DL 4ERSH 4NPYB 3PDDA 3MSPA 4H20H 3PWPE 4ZXBD 2XZCL 4FG6C 4OGZA 1CIUA 5E8OB 1F02I 3QULA 4APQA 1R0AH 1I3RA 2RIKA 4PJIA 1CLZL 2QTEA 3DRQB 5DJ2B 1WBZB 3ULSB 2OCFD 5LGJB 3KPPB 5CEYB 1AO7A 2I25N 1MFCL 1TZGL 2UUDH 5IQ7L 1ZT1B 4LCIH 1MCSA 4LIQL 4LLYB 1KJ2A 4QXGL 5AYUL 2JB5L 1I1AB 4LRIC 4JY5H 4PJEA 4F9PC 1IZKA 1MF2L 3LEYH 4CBPA 2V9RA 5FKAB 5MEOA 4RGOH 3P4OA 3QUYB 4MX7B 4U1LB 1OTUD 1ZWIA 4F3FB 1F58H 2WUCH 3DTXB 1E6OL 3GSXB 5FUOH 1QLRA 1MEXH 3BN9C 4RBPK 5EBWA 4GQ9L 3PGCB 5D70H 3BZEA 1TPXB 4YBLB 1KOAA 4QRRA 2H45A 4TSAH 4WWKB 3B9KD 3UAJD 4MJIE 5MP6H 3OJ2C 1MJJA 2DQEH 4ZUUA 1S9WB 4IBLT 3UYRL 4GRMA 1QR4A 1LO0L 2VLRE 5F3HB 1JPSH 3QNXB 3MACL 5D7LB 1OTTD 2XNAA 4R3SB 4U1NA 4UZGA 5EH1A 4HIEB 3NIFE 4JRWA 4IRJC 5EORL 4MD0B 2J2ZA 1KYOK 1DJSA 2CDGA 3IDNA 2AJXL 5D5MB 4XPBL 4P3WA 4RMVA 5J4MA 5J89A 2FX9L 4F58H 5I9QB 5DO2D 3CDGB 2VDKL 4N0FA 1CLOL 5I8OH 2XG4A 1GOHA 2XT1B 3HPJB 3F6IA 3NABL 1JRHI 1AHWC 2YKLL 4P3DB 1KPVB 3O41B 4POZD 4Y8AA 5D1XC 3WFEH 3LEXB 1A6WH 2ADFL 4N8CL 2BCKB 3M8OL 4HK0A 5LCVH 1RUQL 3SKOA 4X4YB 3FB5A 2BRRL 5AD0B 4AENA 4L4VE 3QCTH 4QRTA 2APVA 2CH8A 4LOUC 3VRLF 1IEAB 2OMNA 2XWJA 3K46A 4GRWB 2WAHA 1IAOB 3I9GH 2D2OA 5FA4B 3CZJA 3FHQA 4Y88A 2DQTL 1RZ8B 4K2UH 3OKOB 4HUXA 5MERB 2GT9B 2XZAL 43C9A 1PSKL 4FFVC 4R0LA 4X6DB 1EEZB 4JFFD 5HYQB 2YUXA 6FABL 3PWNA 2CLZA 4N1HB 4OGXL 5HHOB 5D6DA 4RAVA 5B4MD 3MLSH 4UBDC 1K5NA 1SM3H 1QZ1A 3CLFH 3MLXH 1KIPB 2X10A 4RWYL 2ZZUT 5MEPA 1Z0MA 4QYOA 5C07E 1KENH 3O4LE 4Q6IC 4KUCD 3W39B 4U6VH 1SYSB 2A9NH 3ARQA 2R56H 4UINH 4MNHB 3VXPA 1F3DH 1OAKL 3QIWB 2FBOJ 1XGYH 5TE6H 2Z0BA 3BDYH 5ICXA 3U0TB 3HCVA 2G9HB 1Y18B 3VFVB 3PP4H 2XQYG 4XWOD 3QEQB 5E8PA 4P49A 4Y1AD 3MRMA 2FH6A 1CICD 4BQ9A 2VC2H 1YY8A 3UTTE 1MY7A 5BMFH 3GHEH 4O2CA 1NUGA 4WCYL 1A1NA 1BZ9A 5SX5K 3B6SA 3DYOA 5E2WL 4U1KA 4DUXA 1E0OB 4NQCA 2AQ1A 3ES6B 3RHWK 4JHWH 1I8LC 3RI5K 3Q1SH 2XFXB 4PD4J 2GJ6B 2V17H 1BX2A 4BSJA 2D7MA 4MNQB 4OZHF 2EDHA 2X6MA 3ZE1E 4NFCA 3LS5H 4NYLA 1DN0A 5EBMB 1UM5H 5C0BB 3WXVL 1NBZA 3IT8D 2GAZA 1J8HD 5F1IB 1UACH 3OGOE 3VCLB 5KJRL 3IJYB 5GJSH 3JTSB 2IANA 2F53D 5L9DL 2O5YH 4KJWC 2YZ1A 2H32B 2MQ0A 5A2JH 3MODL 4X6CB 5DZNA 5IMLA 2VDLH 3NFPA 4LMQI 5IB2A 4KK8C 4L8SB 5KANG 4O2FA 3HC4H 3JWDC 3NCYS 3P4NB 3T0DA 1MY5A 3D87B 4UDTB 2Q3AA 3EUUA 1UG9A 1EAJA 4I48B 4OIIH 2Z8WC 3TEUA 4QHLA 2R8SL 2IWGA 3MRDB 1XGPA 5GSRB 4NN5C 1GHFL 3OGCA 2AK1L 2R1YB 3QCUL 2F5BL 4LKCB 3QUKA 5GRUL 1AFVL 4H26A 3PHQA 1MVUB 2O5ZL 1Q9KA 3U9PL 3QHTC 3O4LA 3TGXA 1S7RA 4PRBA 1CFQA 5JHDB 3WIHL 4XVTH 15C8L 2IBZX 2CK0L 2DRUA 5KSBF 5JXED 3MV9B 3U0PA 4LP4A 3EIFA 3B3IB 5CGMA 4EJ1C 4HH9A 3N85L 1NEZB 3IDJA 2W9EL 3TN0A 3WLBB 5D7KE 2B4CH 4QF1A 3ULUE 1WAAE 3C9NA 4G8GA 3HRPA 4O9HL 3QDMD 2VH5H 3X3FH 3OR6B 4NKIL 4RFEA 2Y5TB 4DFHA 4JZNA 3SGEI 5CP7A 4K7FB 5KVDL 4M3JA 3MLTB 4Z7VA 4G8IB 4S1RH 3S3PA 3E6HA 2I9TA 4OFPA 5I15L 2D0HA 1H8NA 3GIVB 5F7DB 1AP2A 3K2MC 4G6MH 5EU3B 3WBDA 5B38G 5DZOA 4E42B 1QBAA 1RIUH 1PDKA 3N1FC 4N90E 4WNQB 5JUEL 5CFHA 3V5DA 3TBWA 1QVOB 1TJGH 5L8JB 3VDBA 4WUUE 3SE8L 3OJVC 4H0GA 1CT8A 4CMMB 2YK1L 5JPMA 3CX5K 1J0HA 1KTRL 2ZCLL 1X6LA 5K9QI 3V4PH 2C1OA 1VGKA 2VZ3A 2ADJB 2AJ3B 3WO4C 5E9DB 1T2JA 3QHZH 1I8IB 1NL0H 3QEUB 1INQB 2PF6A 2CO7B 3KPNB 4Z7QE 2Y9RT 4HHAA 2FH8A 4ZPVB 5GRVK 3WEXB 3C6LD 1F3JB 3VFOA 1YUHA 1H5BC 2H6PA 1ZLSL 1K8DB 4V1DD 5DD0H 1K9TA 4EI5C 5BRZD 4RGMB 5I1GL 5DJCB 1MJ8H 2FL5A 4U1SB 4NZJA 4OZ4A 2UUDK 3G5VB 4ODVL 2O61A 2COQA 3TA3A 1JGDB 1FN4B 5TF1L 4L9DA 1IC4L 3EJZC 5F6IB 3SDCC 1E4XI 1TZHA 1RHHB 4GRLD 5KZCB 3IDGB 3UTSD 3QZWA 4WGVB 1T80A 1MQKL 4LPWA 2HJLB 2PETA 2NY2B 2DLFL 2FYYB 1NAKL 4ODHL 3GMNB 4YX2H 4A6YB 2BNRE 4JG0H 3BIBX 2BSSB 1QLEH 1EA9C 1OGTB 2X1OA 3G08B 4U05A 4M9OA 3KR3H 5IVXF 1MRCH 4GKZB 1UA6L 3QFJE 3BO8B 4J4PD 4PTTB 3TJHC 4PREB 3CVHB 5JZ7D 3HAEB 4D0DB 1TLKA 2R1XA 3FMGL 4C4KT 4NHCL 3BI9X 3GSRA 4XPAL 1YY9D 1NGXB 3QAZB 3DRTB 2AK4E 4NBYB 3MV8D 2AGJH 1B0WA 2Z31B 3S34H 1OLLA 3BOVA 4RQQB 3UO1L 4KDTC 5DC9B 5J06A 5GS0D 3MRLB 1I3GL 5AG9A 4V2BA 3P0YL 5I30L 4P5TC 1NAMH 2GI7A 3AREC 3HE6D 3OPZL 1CGSH 1MWAL 5LAXB 1EERB 3V6ZA 4Y19E 4UDUB 4MYWB 4LCCB 4M8QB 2AV7B 3VRJA 1SEBA 3ARRA 1R24A 3KPRE 3Q6GL 4XMLL 1BOYA 5C6PB 2Z4QB 1TQCB 1L0XA 1UWGL 2ZSVB 1OGAD 1S9VA 3N9GL 3RGVC 5A43C 4HS6B 4P9HC 5IFHL 4OI7A 1B2WL 4JY6B 1NKOA 4TOYL 1T5WA 2OL3H 4KK6C 4KDWA 3SJVB 4WY7L 1U8MB 3UTZA 2YBRB 1XR8B 2CLVA 1E4KA 4WO4C 1LK3H 5D6CB 2XXMB 4JRXB 4G6KL 4GW4B 4DQOH 4GUPB 1MAJA 3MOQA 2YN5A 1EJOL 4Y4HB 5HHQA 1A14L 4X8XA 4ELKA 1A1MB 2VXSL 2LAAA 4HAFA 4MJ5B 2IBBA 4DJMA 3WIFA 4RGNB 3ARDC 2W92A 3VWKD 3ARVA 4JR9L 3VD5A 1FIGH 1IGIH 5I74C 5C0NC 1NUNB 4LCWB 3O2WH 1FV1B 3QWOB 1CD8A 2WBJC 5KS9A 5E08H 3RVTC 2IF7A 3PQYE 2J1KA 4JLRB 3TLRA 4X9HA 1PKOA 1ZVSA 2QSVA 4TULH 1NGZB 3EO1A 3MQIA 4G9FD 3FCTA 3HZVB 4QOKE 5CD5C 2ADIB 2R9HC 3LS4H 3C60B 1K6QL 1N5AB 3HNTH 3OAYH 1UYWH 3THML 1D5BA 4KZDL 2Q6WA 2EKJA 4PJHA 5F6HI 5T5NG 4GH7B 4N8VB 3RZCB 1D3CA 4OFYD 2YD7A 4ZO9A 1NAMA 3MLRL 3TCLA 5J13B 4O51B 1IT9H 4YZFE 3RDTA 1TTGA 4MZ2A 5T1LA 1HSBB 3ULVE 2NPLX 4PJBB 3QIUA 1R3HB 3KPTA 1GGYA 3SKMA 3QCVH 3N50A 4IIQA 4OM0H 1QBLH 3OF6A 3VXRD 3LH2H 1VENA 1IGCL 5IR1A 2CXGA 2ICEB 5GGTL 3ZTNL 3DBXB 2B7DT 3ARBD 3OR7A 5GRJH 5SX4I 5IHZA 2OL3A 2P8PB 4P46A 5C08D 1D6VL 3O2VL 5T5FH 3WJLC 5FYJE 2BERA 1MFNA 3MZTA 4NRYA 4NDMB 3OKKA 3WDJA 3GKWL 4YDKL 5E00A 3BQUD 2YD4A 3RWDA 1MFAL 5IT2H 3DXAA 2BOCA 5D8JL 4EDWH 1NBVL 3EOBA 4QXUL 3LRHA 4KFZC 1NGPL 3WCYA 5L8KB 1JFQH 5E2VL 4L5FH 4B41A 5MENE 3EZ8A 1N0XH 5D7JB 5TH2A 4UTAH 4HXBL 4HJJL 3GHBL 1LP9F 1R3IH 2IQ9H 4S1QL 2VQ1B 1OQOA 3U4BL 3HZYA 1SY6L 2OJZL 1P2CB 4IM8A 4NN7B 1XF4B 1MJUL 4ODSL 3P77B 2FJGA 3WYRA 2DQIH 3KG5A 3REVA 3OXRB 1D6EB 4LRIA 2O26U 4F9PA 4JN1L 2XIDA 3ARZA 3IFOA 4OCWH 4KK5D 4ZG1A 4D9LL 4M1GL 1G7PB 5HHNA 1JHTB 3EGSB 5TQ0L 3I75B 3BP4A 2HT4D 1EH9A 4HGWA 3WUZA 3I85A 1C16B 1XF1A 4KMTH 2MPAH 3BAEH 4HKXA 1AIFA 4V2CB 4I3RH 4NQDB 3L5XH 4FQXC 2YXMA 3SE9L 3ELAT 1Z9LA 1S7WA 5KBNC 3QUML 5ADPL 2CPCA 3PWLB 5HI3C 4F7MB 2W59A 4NKOB 3BDXA 1P84J 2M26A 5EZLB 4Y4FA 4UIKH 5B8CB 3O3BA 3BGMA 1ND0A 5KSUB 2JIXB 4J3TA 1B6UA 2DM7A 2AJSH 2ZWLT 5D71H 4NN6C 5I19H 2PTTB 4ZD3L 4YLQT 1NC4A 4ENED 4ETQB 2BVOB 5L2KA 2BY2A 4M6NL 4WI8A 1TITA 3CC5A 2NY5C 3G04A 2IH1B 2P5WE 3WHXA 1S3KL 1U9KA 4FTVE 5FHAL 3UBXA 3VFMB 3R0MA 2AJYL 2DM4A 3AMLA 3G6JA 3KYMA 4HFWA 4ZQKA 1JPTL 2Q8AL 1AHWA 1CF8H 4MDIA 1ONQA 3IGAA 1G0DA 5D1XA 4D3CH 4NQEA 5JORA 2BSRB 1WZMA 5DUBA 1OQXA 2N7AA 4EBQL 1C12A 1RJLA 4AEHH 4ZSOA 3OB0H 5HJ3B 4FA8A 3UTQB 4BZ2L 4IRZH 2P7TA 1GSMA 3PHOA 1KLUB 4N68A 4EN3A 3UJIH 2NW2B 4O02H 3AB0B 3MJ9L 3TNNB 2OK0L 3O9WB 2IC2A 4NBXB 5HPMA 4XI5D 2YHGA 1H9VA 3G5ZA 4WHYH 3B2VL 4KKBC 3IAPA 1UC6A 2VQUA 4E41E 2B8OT 3WUWB 3I3DA 4RMRA 5J56B 3HR6A 2JK5A 1OLZA 2HLFD 3VMPA 2CKBH 5DFTA 4Z6AT 4Z7NE 4E0RA 4Q6IA 4HC1L 1N6QL 2ARJQ 5CJOH 4NZUL 1I1YA 1JPST 2CJUL 3BH8B 1QHPA 5ESAA 1Y0LA 2ZKHL 3VFGH 3VXSA 3R0NA 4K7PY 3QIBD 3S37L 3QYCA 1O0VA 4XVUD 4LEOB 3RUGA 1BLNA 4XCNB 1TVBB 3C6SA 4M48L 5C71A 1PYWB 5GZOD 1AGBB 4YGVB 1AJ7H 4MAYD 2DYPA 4OD2B 1I8LA 4ZYKB 3E6FA 3QDJA 1YEIL 3DSNA 1CN4A 4K8RC 3HE7C 1U8NA 4LVNB 2DQHL 3RWJA 3EYOA 1LDPH 1VERA 3CK0L 4U1JB 3SO3B 4HK3N 4BQ8A 1WBXB 3LSOA 5BVJA 4Y16C 4FFWC 2F19H 1QUNA 3IETA 4Z0BL 5E24E 4CU8A 4QNPE 1QFUH 5GGQH 5CINL 4OB5H 5L6YH 2D03H 4HG4K 3MV7E 1XAUA 3NCBB 3LQAC 3GSVA 4LGPB 4BKLA 4C57C 3BP5B 5E6ZA 2WLZA 3R1GL 3WKMH 2VABA 2A0LC 4JO2L 4APQD 4UILL 3VXQA 3FQWB 1K4CA 5FO9A 1BBDH 5M7QA 3IU3B 4JDVB 2FR4A 4UNUA 5HVHC 3AY4A 4F7PA 1TCRB 3IJHB 3FHAA 2RB8A 1AO7D 1NMBL 3CDFA 3P30H 2OZ4L 3ZSSA 2CKBA 3VA2C 4K3DH 3W2DL 3PWVB 5GRWA 4DGIL 4YHPB 2X09A 5F97E 3DVNA 4JREC 5C0RL 1FL3A 3J8F7 4QRPE 2DWEA 2EIEA 4P4KB 1NBYA 4PTUB 4MA1B 1U8KB 4DEPB 5TGBB 5TDPA 4LGRB 2W0PA 2W60B 2X2YA 4YDLB 1RJCA 2VE6A 4NIKB 4QRQA 3FOLB 1HNFA 4P2YA 1S7XB 2DIJA 3RFZC 1FZKA 4L8BB 4QRRD 2HTLC 5EU7C 5E6IC 4TUJA 1KTLB 4CL7A 4HIXL 2JE8A 1RURH 1I1RA 1IGFH 1VPOL 4PJFE 2C1PA 2YD1A 4Y2DA 3C5SB 3PUCA 5J3HD 3U79A 4XP9H 4NUGL 1U8QB 2C4XA 5EUOA 1HQRA 4I5BA 5FUZL 4OZHB 5K9JH 3CXHK 4ERSL 3H7BB 4HXAH 4HUVB 1CE6A 1JVKA 2ZCKH 3DSFL 5CGYC 3LRSB 3UZVB 3W9DB 4PRAA 4YHZH 3HKFA 4DGVL 4ODUB 4MD4B 4PBVC 1E28A 3IFPB 1J05B 1FNEB 2GK2A 4U1HB 4F7CB 3FQTA 5EOTB 3TBTA 2PYEA 5ITFB 1YA5A 4XB7A 3FN0L 2EH7L 2DI7A 3VXTA 3GMRB 1KCVH 4LVOC 3JV0A 3VU2A 4KJPC 3BEVA 3PNWA 3QUXD 5FUCE 2RJMA 2HLAA 3TO4B 3MRBA 5DC0A 5HY9B 3BGFB 1DBBL 4MDJB 5FUOL 5CD3A 3BW9B 4RAUA 4MAUH 3VW3L 2B2XH 3C2AL 5ENWB 4P9HH 4X80L 1JTPA 3PV7A 4OAWB 1HHJB 3O8XD 3VH8B 2R29H 3F5WA 2ZUUA 4KU1A 5C1MB 1RQ5A 3U4EB 1ZGLB 1S7QB 3SDCA 5MI0B 4LHJB 5KSBB 2PXYB 2ADGA 1I8KA 1F42A 4FZEL 2NY0D 1NANI 3TYFB 1MH5B 1A2YA 2EH8H 3LCYA 4LNVA 3W81A 1NUDA 1NJ9B 3MXVH 1JZ4A 2I9LB 5M94B 3LPWA 5KSAC 4Z7UA 4ZFOB 1RMFH 1AI1L 1RZJC 2VYRE 2GKIA 1UXWB 4NGHH 4R26H 1FL6B 4FFZL 3MYJB 3H42L 4F58L 5DJDA 1JIBA 4FQIH 4R96A 4R97B 4YJZL 2X4OA 5I8OL 3ALPA 1UB6A 3GI9H 1AE6L 4O5LH 4MJ4A 2PNDA 3I02A 1CDGA 5F3BA 3OV6A 1DQQB 5L0QB 3CFCL 3NCFB 5I66B 5T33H 3FFCE 3KDMA 2VLLB 4KDTA 4NQCD 1INDL 4BFGA 3HI1B 4I2XA 3MGTB 3MUHL 3S4SG 3R06A 4P5TA 4YIQB 5DRZA 2ZCHL 3AREA 1WK0A 4J3OC 1I7ZB 3EJYD 5ACLA 3RZWA 4LLUB 5IVZB 4LK4A 1TJHH 2AABH 3MRGB 1QFWH 2F74A 2VL5B 1H8SA 2FRGP 3LQMA 2IADA 3A6BL 3BKCL 2EYTA 2IAND 3ARYA 5T1MB 3JUYA 2ZPKL 3ZT6A 5HD8C 1YECH 4OLVH 3MLSL 4ETYA 4WW2F 5C0EB 1JI1A 3RGVA 3FONA 1DBML 3KLAA 3MLXL 3JV6A 5GISH 5FGCE 2OR7A 2R0WL 1D5XA 3GM0A 1R5WB 3HZKA 3O6KL 4U6VL 3GMLB 4PRHA 3BP7B 4UINL 4WI2A 4FQJL 4XZUA 1UVQA 2RAMA 4L29B 1TDQA 1U2CA 1M6OB 4WO4A 1NQBA 3ZDXF 1KLGA 4XP4L 2VR9A 2VDPH 1NKRA 3PP4L 3D5OF 5A3ID 1ZHNA 1XF3A 5F96L 1G1YA 4UQ3B 2R1WA 3O4LD 1J1OL 2VC2L 4FMFA 4JRYA 3ARDA 3SDYH 1JZ6A 3MLWH 2XA8H 3MOBL 5FECB 5L7XH 5IVXB 2CRYA 3RU8H 2WBJA 1EJ6A 4NJ9L 1A3RH 3OJDA 5T1DL 3ARFB 3MCKB 1W72H 4OCSH 1BAFL 4KKCD 3T3MF 3N0PB 1LEKB 4H25A 3TN0D 4HFUH 3E1F1 4ZUWA 4PJDF 5F7EH 5FHBH 3INUH 1OB1B 4G8GD 3MBEC 3QI9A 4JG1H 3L7FB 1QSEA 3LN9A 1H3VA 4G3YL 3T0BA 3HC4L 3QRGL 2WZPD 1T21B 3L5IA 3QBTB 4DKFH 5GGRY 3V52H 3UJJH 5I73C 4MB4A 4S10A 4AEIL 1JGLH 4TUKL 4HWNA 4YR6A 4PGZA 4DN3H 2DBLH 2XWTB 4RZCB 2JJWA 3LV3A 1WEJH 2R0LL 2YD3A 4UTBH 3VFPB 1RZKC 1UB5A 1H3UA 4MXQD 4R4FH 3BGAA 1R6VA 4JKKA 2NY5H 5C0AA 3TBYA 4WGWB 4GW5A 3MRNB 4Q6YA 2I07B 2NXYB 5JA9A 1K8IB 2BSTB 5ESVA 4BZ1H 4PGCB 2VDOH 4Y4KB 1LO5A 1O7VA 4G9DB 3T04D 5T3ZE 1CFSA 4LSQH 4TSCL 1I1AC 3JZ7A 3ULUL 3MRFB 1M7IA 3HG1A 1Z3GH 4X6EB 2AJZA 2A77L 3H9HA 3QUYC 3BDBA 1CTNA 2A2QT 3G6AA 3TA3D 1U8PB 4YC2B 1NDMA 2UZIH 2DQGH 1HZHL 4X6BB 1EDQA 5E0QA 3BZ4A 2OMBA 4M6MH 5E99L 3PWUA 3V6FB 1W72A 3BUTA 1AQDB 1UCTA 4YBLC 4QTIL 2XKSA 4WWKC 5LBSH 1UM4L 2NZIA 1T4KA 3T09A 3HLAA 2L0DA 4G6ML 2GK0A 4FRWA 2OLDA 3CXDH 1JPFB 2QQQA 1BGXH 3G6JF 2ARJB 3DI2B 4LSUL 3U48A 1IKFH 3OKNB 3RPKA 1NMAH 2KH2B 1E4WH 2EEAA 2HG5A 5HDLA 3W0WB 2C7UA 2NY1B 3QPXL 2DQUH 4JAMA 3QFDB 1ADQH 5H35B 1A21A 4L4TB 4DFIA 3EFDL 3QULB 3ABZA 1MREL 1SBBA 3T8XB 1DFBH 4NO2B 4KHTH 2P48B 2EDNA 4ZUTA 5I9QC 3NOIA 1RJZA 3ZTJG 3IKCA 2VIRB 1JF6A 4YHIA 4OZFH 3ILPA 4LKXB 1PJ9A 4OD3L 5INDB 2AS5M 3MRQB 1KELH 1OAYH 4OSUH 4OUUA 4PJ5E 3U6RB 2X7LB 2LFGA 3NACL 5IJVA 1DBJH 4R8WL 5SWZE 2WINA 1EAPB 3PGFH 3FO0H 3PP3H 5IB4A 2NQCA 3QQ3A 3NTCL 4GAYA 3O11A 1EHLL 1T04B 1MFDH 3C8KA 1SEQH 4K8RH 3MRHB 3BZEB 4ODTH 4HCRH 5FM5O 4LAQL 5DMYA 5IW1B 3L1OL 3T3PF 3V0AC 4PV9B 2A9ML 2NX5E 5JDSB 2ZUWA 1LQSR 3S6CA 4CU7A 3VDAA 1Z5LA 4RCAA 4I0PB 3FQXA 1D5ZA 3DO7A 2OXGA 1X5XA 4KPHL 2RGSA 5C6TH 5IW6B 1LP9B 3ZDZF 1YEKH 2XNAB 1GGCH 2X9XA 2Y07H 3LKRB 2C3WA 4XVSL 3H3PL 3VFWA 1BQLL 2D0FA 5SV4A 1OHQA 3DVGB 3ESUF 3DUSB 3LQAH 4HW6A 1FGVL 2FX7H 4FXKA 1JK8B 5DQJB 3L7EB 3GSUB 2F9BT 1FO0B 3DUUA 1I7TB 2VLKB 1U6AL 4RMSA 4XP6H 4XB8A 2X42A 4QY8A 3I84A 3MUZ1 1S8DB 4OLXL 1ADQA 1TTFA 2Q20A 1QSFE 2JCCF 2BDNL 1ZTXL 1SJEA 2P8LB 4YQXL 4LMQE 5DA0B 4YXLH 1BIIB 1FLRL 5IMMA 4AENB 5BJTA 3KJ4B 2DWDB 2VXQL 4OZFA 4QGYA 2BMKA 2UZXB 1P4IL 2XOTA 5C0FB 3U7YH 1DQTA 1A9EA 1O5DT 1FNGA 2YUVA 5IBLC 4P2QE 1OP9A 5JR1L 4G42B 2FB4L 1IGTA 3RDTD 3PWNB 4UUJA 5T1LD 3ZKMD 2EICA 5JQ6L 1FZMB 2GFBA 2AEQH 2ORBH 5DEFB 1S5IL 3QIUD 2LU7A 2ZNWA 5JW4M 1S9YB 3V2AR 1MCKA 5HSFA 4L8SC 5DJ0A 5F89B 1NFIA 3OF6D 5F72S 3EYVB 1P4BL 2LQRA 3HE7A 5CKGA 4HCRA 1HQ4A 1EVTC 3B9EA 2C3XA 1KTDA 3CFEA 4Q2ZA 1MCHA 2R2EA 2QQKL 4P46D 3NZ8A 3WSQH 4Y16A 3RAJL 3E8UL 3H9SB 5EB9A 2P24A 4JM2F 3VXOA 4XBEL 3SDDB 3GB7B 2A6KA 5IHUH 4NZRH 1OM3H 1G9NC 1OSZA 1ZXQA 3DXAD 3Q6FB 1UXSA 4LCYA 4MCYB 3SGEH 5KW9H 5A16A 3DECA 3T0AA 1BZ9B 3B6SB 3C5JA 1ZSDB 4FG6D 4PR5B 1ZK9A 5GGUA 1Q94A 1TIUA 3MJ6A 1G7HA 1CVSC 4ZS7H 2WUBH 3SCMB 5IB3A 4XT1C 4M93B 3VGEA 3WFDH 1MLCA 3MXWL 1ZEAH 5GGVY 1S7UB 2ZJSL 4WEBL 4NYLB 1U41A 2J12B 3WS3B 4YNYB 3VGHA 5I76A 4LSVH 3R4DA 4PD4K 1D9KB 4HX1A 2NY7L 3Q5TA 1KJ3L 5DJAB 2FWOB 1K4DA 1V8HA 3QO0B 1BQSA 4O2FB 4URTB 1NCCH 3A0OA 3BN9D 2P5EB 3LH2L 3EDEA 1QHOA 4XXDB 3GJFK 5F9DC 1NLBH 1I8MA 4LFHG 1JNNL 4DW2H 4MNGE 2AXFA 3T1FB 5E6IA 1QBBA 1Q9LB 5HYSA 4UOW1 5FYJL 5I1IL 4XVJH 1RZJH 4X7FC 3WHE1 1I3UA 2VISA 4YHOH 5DHYB 4LSRH 2CR3A 4U3HA 3WHE0 1AR2A 1BF2A 3QUKB 2YPLA 1BZQK 4G80B 4Y4FD 5IT2L 1E4XH 1S7RB 3WFCH 1RU9L 2CRZA 5JO5A 3VD7A 4IRJD 1NC4D 2V2TB 5L2KD 1S7SB 3F65A 1T1YB 3WFBL 4CMHB 1TNNA 2VOTA 5F93C 4LLQB 1R3IL 1AGFB 5C2BL 3C8DA 3TT1H 3NFNA 2EYSA 4ZAKB 3GSQB 4HH9B 1U36A 3E2HB 4U49A 1KT2A 4PGBA 4Z7UF 5GJTL 1YN7B 4AL8H 5ICYB 3CFIC 4L3EB 5D1XD 1DLHA 4G8GB 4OT1H 3MRCA 1EFXA 3BE1H 2YUZA 4NQED 5F6IC 2Y25A 2E7HA 5GPRA 4ACPA 4GJTB 4Z7WA 4OZIA 5T3XE 2VXTH 4HUWA 5LWYH 3E6HB 1HXYB 1FORH 5HHPA 5E4EB 4PS4L 2R69L 2NY2C 4LOUD 4KMTL 2XN9E 1KB5B 3BAEL 1JZ5A 3O3UN 3ZHDA 3OZ9L 1MHCA 3TBSA 2BZDA 4OLZL 4PRNA 1MIMH 1O7SA 1JF1A 2YMXL 2W65B 5ID1A 4FXGA 2UWEE 5E2UH 2H2SC 4F7TB 3TBWB 5IGXH 2ICWJ 1CVRA 2UY6A 5I0DA 4CNIB 2GEEA 1CT8B 5DA4A 2GQHA 4WFGD 3FL7A 1T83C 5DMIH 5DLML 4LP5A 4ZXBC 1XH3A 3CH8A 4ODXB 3CU1A 4G5ZH 3OKMB 1ITCA 5E70A 2HA1A 3VJ6B 1C08A 3BFOA 5DTFA 3OJMB 5D71L 1I75A 4OZGA 3GK8H 4A2MA 3MA9H 1CQYA 4JFPA 5KSAA 2Q7YA 4J12A 1MNUL 2KBGA 2BX5A 4NT6A 3CPLB 3IDMB 3MGAA 5TE7L 5C09A 2R2BB 4PJAF 1CBVL 2PR4L 4PJ7A 1EMTH 3VXSD 5E1HB 1DQJB 2DDQL 3RKDC 2FL5B 3F7PC 5I1DA 1CF8L 3RWGB 3HI5L 3RIFK 4LCCC 2NY3B 1HINH 4YHYB 3ECBB 1ZOXA 1W0WA 2DYPD 2FGWL 4R4BA 3VGBA 3QZWB 3QWQB 1U3YA 4IRZL 3QDJD 3EO9H 2BNUB 4G8FA 5CCKH 5I1EL 4NHUA 1DBAL 3VXUB 3JWDL 4X0KB 3P0GB 3T0EE 4HZLA 1DDHA 1WTLA 1HYRC 5DVKA 4XPTH 5F70A 3WD5L 3C08H 5D2NE 1OTTC 3BPLB 4HH8A 4KJWD 2FO1A 4Y4HC 3RRQA 2H41A 4KKLC 4PJ9B 4IJ3B 4KK8D 3PJSA 4FQQB 1ACYL 1X5FA 3GMQA 1UZ8A 2ATPB 1RZKH 1X4YA 4NUJA 3MNWA 1JNLL 3TPUA 3U36A 1SBSH 3LDBB 3NIDE 1OF2A 1MCOL 3SKNB 4C58B 4ZTOH 4OCXH 4P2RE 2HJKA 5FAAA 4E41D 4XNQA 4RA3A 5FF6B 5ECJE 4PRDA 2UYLA 3LQZA 1T7WA 5C9JA 2QSCL 4TNWK 2I24N 4KVCL 2VAAA 5SX4H 2MHAB 3C60C 4DTGH 2MCPH 3ME0A 4LSSH 4AH2B 1OWWA 2A73A 1HXMB 4JHZA 3AGVA 3RZCC 1GGUA 1S9VB 2HRPH 4X99A 5J13C 1A7NL 5SWSB 2V5SA 3LKOB 1CFTB 2AAVA 4K23H 2WIIB 1T5WB 1X7QA 3ARXA 1IFHH 1LDPL 3FRUB 1BBJA 5D93B 3B43A 3U9UA 1NFDE 5I1CL 4FABL 1GPOL 1KN4H 5B4MC 1IZJA 3MBEA 1L4IA 1I1CA 5DMJB 2D9QB 1G7IA 1I9IH 2LABA 5HHVH 5D7LE 4OB5L 3IU4H 1BFOB 3CSPA 2OTPA 4OKVB 1KEGL 3U1SL 2W0FB 4AEFA 4LPXA 4S11A 2E8ZA 4DVRL 3MO1A 4X7SH 5EO0B 3RIAK 4M5ZL 4JKPL 1U58B 3T08A 4D9RE 1P1ZA 4U0QB 4XCFL 1YMME 2BNQE 2E6PA 2CMRH 4KZEH 4NPYA 3P30L 4WW2B 2PYED 4YDIH 3O3EB 1F45A 5E8OA 5EDXA 3EO1B 1LO2H 3FCTB 5D7JC 4AIXA 5DJ2A 1T20B 3DRQA 4NSKB 4Q58C 2OBGA 1WBZA 4OLYH 5LGJA 2J5LB 3KPPA 5CEYA 1HDMB 4NN7C 1V3MA 1DQMH 1WIUA 4LSDA 4GRWH 5ISZE 1GZPB 3TCLB 1NAMB 1ZT1A 3BKMH 2DN7A 3WS6A 1P69B 4I9WE 4LLYA 3RVUC 4EI5D 5JW4N 5I0ZA 4CRPA 3HZMB 4KI1A 2I60L 4X6DE 3AS2A 5FKAA 3UTOA 4MX7A 5I1KH 4F3FA 4Z95L 1RURL 3DTXA 4FXLA 3I6KB 3NH7L 3EJZD 4YE4L 3SDCD 1KEMH 5DFVD 1FNSL 3PGCA 1E27B 4WWKA 2OL3B 1UEYA 4P46B 4F57H 1S9WA 2BVEA 1XGTB 4FQCL 2J6EH 4PJDB 4GXUN 1FRGL 5B8CC 3QNXA 3PL6B 3RWDB 3TJHD 5H37G 4OJFH 2FJFB 3LD8B 2HFFA 4ZNCD 5CJ8A 2FECL 2MQ3A 3EOBB 2E5EA 3QEQE 3D3VB 4ONGL 4U6TA 1EZVX 1HHGB 3NIGF 4HUUB 4MD0A 4XCEA 3UBXG 4KI5E 5SWQA 5HDOA 1OAZL 4OLWL 5C7XH 1CIDA 1D5IL 5D5MA 4D8PB 2IBGA 5FYLH 3AMKA 5L2JB 3DHMA 3JWNC 1HHKA 1IC7H 3CSBA 2GJ6E 5MEQB 4GMSH 3FRPA 4M7JH 4MNQE 4P3DA 1KPVA 1Q1JH 4LCUB 3HC3L 2B2XL 3O41A 4P5TD 3ARED 3PE9A 1Z0NA 4HDIB 3WFZA 3S36H 3DIFB 2R29L 3LEXA 5EC1B 2BCKA 2JJVA 2DBJA 4X4YA 3TZVB 5AD0A 5E2TH 1IM9D 1JHKH 5HHNB 1A6UL 3IDIA 3A67L 4HGWB 4OFIA 1VFUA 1IEAA 4X6CE 35C8H 3AB0C 1AIFB 1GIGH 5FA4A 1RZ8A 3OKOA 3O9WC 5MERA 2GT9A 3RGVD 2WANA 3LKNB 4X6DA 3MXVL 5HYQA 1WFNA 4JFDE 4NO5B 3KPOB 1FPTH 3D39B 4KQ4H 4KK6D 4WTWA 4K7PH 4W70A 4PRHD 3EZJB 4MA8H 4DK3A 1U8HB 1Q9OA 5HHOA 3LAFA 1YNLL 3SPVB 4WO4D 3RIFF 4FQIL 3RP1A 3H3BC 1T7VA 5D2LE 3VRIA 1G9NH 1KIPA 1AKJB 1KGCE 1NSNL 4XNXH 5HVWA 5J1AB 1NC4B 1P84K 3MLZH 5JIPA 1SYSA 1HH6B 3LIZH 4MNHA 3CC5B 3DX7A 3QIWA 3ARDD 3U0TA 3V5KB 3T0VA 3GSWB 2J6EA 2G9HA 1Y18A 3VFVA 5C0ND 5BS0E 3G6JB 4NFDA 2WBJD 4NO3B 3RVTD 3G5XB 2X89D 3KPSB 1RUKH 1Z2KA 5LGHL 3UROR 5AYQA 3VWJB 5GZNC 3ES6A 3OL2A 1C12B 1L0QA 3FFCD 5E8DH 5CD5D 3IDYB 4WEUD 5JW3H 2XFXA 3CFBB 3AU1B 2QQLH 3QI9D 4EN3B 4K94C 1QSED 4MJ2A 3RVXC 4OLVL 1BVZA 1PVHA 5ALCH 4LVNC 5EBMA 2VDML 1YJDL 3JUZA 3FB6B 5C0BA 1R3LB 1W2KT 3U0WL 3SO3C 5FYJU 1YNKL 3VCLA 2OX5A 2X4UA 1A0QH 1A4JA 1XGRA 2FHCA 3QDGE 5FK9B 2XV6B 1BD2B 4XNUH 5KAQG 3D2UB 3P4NA 4TNWF 1FFRA 2BY0A 4UDTA 4JM4H 1YMHA 5FYKE 1W8OA 4ELMA 2F54B 5E9DE 3TO2B 3WIIH 3RY4A 2W1NA 1I1YB 2NTFB 3MLWL 1X3DA 3MRDA 5GSRA 5C0AD 1EXUB 1L7TL 2R1YA 2ZUYA 4LKCA 3KXFE 1OAQH 1MVUA 5JXAH 1FHGA 1RULH 1A3RL 1P7KB 2ESVA 4OCSL 5JHDA 3ZE1F 3GDBA 5GGSB 5JOFB 2HP4A 3HG1D 4PRPE 4P4KC 1KBGL 3MV9A 4MA1C 4XAKD 5EA0L 3INUL 1RFDL 1OARH 4MB3A 2HT3C 1SVZA 1KCKA 4JG1L 3B3IA 3QXUA 4ORGB 3MLVH 4X7DC 4XP5L 2O93L 1PZ5B 3CDYA 1NEZA 2F8OA 1ETZB 2V7HB 3WLBA 1MIEL 5HYJE 4NFBA 4A6YH 3HR5A 1N5YL 4F8TA 3I2CL 5DHVB 2JCCB 2X4PA 5BVJB 2YSSA 4GG6A 5BOPA 3MFGB 4LF3A 4IOFC 4FQ1L 1MWAB 1ZA6B 1WT5C 3CVHH 4K7FA 4X4ZA 3HAEH 1D7FA 4G8IA 5DWUH 3PXHA 2VLJB 3GIVA 1J1XH 1MI5B 5F7DA 5TE4L 5JA8B 1NLDL 3GSVB 3VWKC 5EU3A 3DWTA 3X12A 2W9DL 2VERN 4E42A 4XC3H 1CL7L 3RA7L 4WNQA 1QVOA 5IWLC 1EUTA 2NY5L 2XI9A 2XYCA 4PBXA 1I9RH 5HI3D 8CGTA 2FR4B 4CMMA 3RWCB 2VUOA 1DUYB 1F4XL 3HI6H 1FG9C 2AXGB 5IMKB 5T3ZL 2J4WH 4M5YL 2CKBB 1OL0A 2AJ3A 4YBHA 4NQUA 1ULVA 1YPZA 1I8IA 1INQA 3HUJE 5I8EB 3WDHA 3KPNA 5JMOC 1J11A 2O5XL 3V4VL 3MREA 1LEIA 5FM8A 3TO4C 1T0PB 4ZPVA 3ULUF 1WAAF 3WEXA 5TDPB 3BGFC 5FO8B 1F3JA 4XCYA 4B0MM 2DQGL 4UT6H 1K8DA 4JM2B 4PUBL 1HSAA 3A6CH 4ISVB 4M6ML 5DJCA 3V8OA 4OI8A 3G5VA 5IESH 5LBSL 4EOWL 1JGDA 5JNYB 1FN4A 1JRHL 3C87A 3HHRB 5MI0C 1BGXL 1RHHA 4Y2DB 2D9CA 1MPAL 2J88H 3IDGA 1JYVA 1CG9B 4JO3H 1IKFL 5HDBE 5I71C 2HJLA 4XWGH 1XR9B 2FYYA 2LVCA 1K2DB 4LASL 3GMNA 4A6YA 5E5RB 1JI2A 3G08A 3GO1H 4L8CB 4GKZA 3BO8A 2FBJL 3L3HB 4I0KA 4C56A 4PREA 4R97C 4XPGL 4Z7QF 3CVHA 1N2RB 3GSNA 3HAEA 4KKBD 4M4RA 4D0DA 1F4WL 4E5XB 2R0ZH 7FABH 1MCJA 3X3GL 4KRMB 1KELL 1OAYL 3BT2H 5FCUL 1NGXA 3F8UB 3DRTA 3P11H 2WQRA 4MLSA 5L0QC 1ED3B 3BUYA 4TUOB 2Z31A 3S5LG 5JW4R 4K9EC 3PNWB 4RQQA 5IKCB 1T7XA 4N5EC 3FO0L 2V7NB 2Y5EA 5LJYH 4GAJH 4X9GA 2PYFA 4K8RL 2PUQT 1V7MH 4PJ5D 4F37K 2EE6A 4YWGL 3V0WH 4HCRL 4JFFE 5LAXA 4UDUA 4KK5C 4LCCA 4M8QA 5EWIH 1VADB 2AV7A 5D7IE 2EXYC 1MLBA 1MFBH 1LO4L 3ISWA 3V0VB 3VGDA 5C92A 3MJ7B 2Z4QA 3JV4B 5C6TL 1JE6A 3ARGB 4RA0C 4HS6A 4WUKL 1Q0XL 4K8RD 4NQVB 4JY6A 4KVNL 3HE7D 1W8NA 1DVFB 2J8OA 5I2IB 3SJVA 5GS2H 4NOBA 4Z7UB 1EHAA 1U8MA 2YBRA 2IEPA 1XR8A 5KVGH 3NCYP 4J6RH 4U2ZA 2FNBA 1JGUH 1FP5A 5D6CA 4MXWH 2C4FT 3MRRA 4FFWD 4JRXA 4Y16D 3EO0B 4GUPA 5DK3A 1LE5B 5H94A 4Y4HA 3E0GA 3RWHB 3P3YA 5J1SC 4J3VA 4GMTH 1T2XA 4HF5L 4X6FB 4MJ5A 4TQEL 3I02B 5TPWL 1QBML 3IF1B 4GBXB 1RIVH 2SEBA 4S0SD 1RHFA 4GS7B 2A0LD 4LCWA 1FV1A 3QWOA 4FQLH 1XGQB 4N9OB 3UPRB 4OCRL 1YEGL 5B22A 2Q86B 1MRFH 4M62L 1A3LH 4X9BA 4JLRA 3ARFC 3VI4E 1MAMH 2X1PA 5I17A 4UU9B 3LOWA 1NGZA 3HZVA 4DKEH 1J8HE 2ADIA 2MQCA 1S5HA 2E9BA 4MA7H 2F53E 4CVUA 4ZTPL 1C5DB 3C60A 1N5AA 1GGIL 2ORBL 1F90H 1CFNA 2Q8BH 3DHJA 4N8VA 3RZCA 3GKZA 1QEWB 3K4ZA 4C54A 4PJAB 3S4SB 5C3LD 4O51A 1XCTB 5K9KB 4KH2A 4O4YH 4RX4D 4MQSB 3FO9A 4NQDE 12E8H 2AEPL 4G6JH 1NMCB 4AG4H 1HSBA 2OQJB 5CWSB 3HZKB 5B21A 4PJBA 5E6ID 5F88B 1N8ZB 3IRZA 4OQTL 3MV01 2M1KA 5D4QA 4L1DA 4P3CL 5E8NA 3WSQL 2R4SH 2AV1B 1IAII 2ATKA 3CVIL 3VXMB 1CXIA 2ICEA 2APXA 2YPLD 3DBXA 3AM8C 5ANMB 2KQNA 3GBLA 3QDAA 4MXVE 4CDHA 5F1NB 1LO3H 4GFTB 2P8PA 1ZHKB 4JRYB 1IGMH 4HPOH 1CU4L 4HJGB 4NDMA 5CGYD 1TFHA 4JPVL 4EVNB 4OV5A 2OI9B 2NXYC 4HK3J 4Y4KC 1ZEAL 5CILH 1DQDH 1TXKA 4L9LB 4XP1L 4KTYA 4M3KB 3QXAB 2YD8A 1FYTB 3CLEH 3KAAA 3FOMB 4H25B 3JSSA 1F8TH 1MFEL 5D7JA 3QDME 4YZFF 4KV5E 4YC2C 1EFXD 3G6DH 1RPQA 4KJPD 5DK0B 3ULVF 2VQ1A 2WMPA 4FFYL 1QFWM 3SKUD 3P77A 4W81A 1SJHB 4HPYH 5HGAB 4OM1H 4ZUVB 1QYGH 2D7TL 4QRUB 4IRSB 4DW2L 3PDOB 2FD6L 4Q97A 1G7PA 1JHTA 3EGSA 4YR6B 3I75A 5HVFB 4JO4H 4DZ8A 4JO1H 4XHJC 1C16A 2NY1C 4JFHD 3KJ6L 1QRNB 5DZLA 3LV3B 5GHWH 1T7ZA 2KQMA 3TH2T 1YEEH 1UB5B 2NLJB 3T0XA 1N6VA 4LDOB 4F7MA 1N64L 3U7WL 5KSAD 1T89A 3AROA 1MHHB 3TBYB 4NKOA 4GW5B 1A7RL 1U8OA 4B7IA 4CGTA 3EHBC 5EZLA 1NCAH 3C5ZB 1IBGL 5B8CA 2IBZY 5KSUA 5ESVB 5C09D 1LO5B 2JIXA 4V1DE 5BRZE 4XAWL 5JOEA 2DTSA 4OIAA 2PTTA 4J2XA 5KVEH 3CFDB 3PABB 1M7IB 2BVOA 4ETQA 2DM3A 5CZVL 1JWUB 3H9HB 2I5YL 2Z8RA 5DJZB 5IEHB 3AFLA 4OT1L 1HILB 1N4XH 2IH1A 5EU6B 1X4ZA 1VEPA 2BHZA 3VFMA 5T3XL 1KXVC 2XTLA 5E2JA 4TYUA 3B9AA 5I6XB 3BZ4B 4FQ2L 1VKXB 3PWUB 2Y4SA 5ILTL 5EOCL 5DK2B 1J1PH 4Y5YB 1JBJA 3EJJX 1BF8A 2GK0B 3MBXL 3OAUL 3X17A 3KLSA 5CJXA 1JZ7A 2W91A 4I0PC 5EOQH 2E27L 5HJ3A 3UTQA 1A8JH 3GJFB 2HVKB 5HHMB 5IFAL 2C7UB 2NW2A 5HD8D 3TNNA 3M45A 3O9WA 4XCCH 2CUIA 4ZFGH 1I85C 3GJEA 4HWBH 4JGMA 2WWKT 3P40A 4QTHB 1YEFH 3MA9L 4DOHB 4TN9A 4ZUTB 3VFRB 1RJZB 4F37F 4KXZI 4YHIB 4OGYL 1WSST 3WUWA 4AQ1B 1FDLH 3REWB 2B1HL 2CGRH 3JBG7 4HBCL 4XPFH 3RVVC 1FCCA 4OUUB 1R5VA 5C0DA 3MGOB 2ED9A 4OZFG 3BEWA 1EX0A 4M6OH 1HINL 1H3PH 2Z93B 3BH8A 3VE0B 3PWPB 1C1EH 3O11B 5C86A 3KJ4C 3DV4B 1NGQL 4YEFA 4MS8D 3PWJA 1OGAE 3SE3A 1MHPH 4XCNA 1TVBA 5FOJA 1HI6B 1WZ1H 5E7FA 3GBNL 4ELMF 1AGBA 4YGVA 1JYXA 2APFA 4WVRA 1Z5LB 2A6DB 4OD2A 4RMUA 4YHNA 1BJ8A 1QO3B 3FQXB 3BMVA 5JPNB 5D6DC 5HGGS 2HAZA 1ZHBA 2DQFB 3BESR 1GAFL 3MBED 4I3SH 1TCMA 2C3HA 1J88A 1YN6A 3EYSH 1G9ML 1OCWH 1VFBB 4D0BA 3BRGC 1B0GB 4U1JA 1WBXA 2FX8H 5GGVH 2HWZH 4U1MA 5L88H 1SBSL 3L3GB 4ORZC 3UDWC 3MUGB 3WNMA 1FBIL 2DQJH 4ZTOL 4JPWH 4MJIB 3SDDC 4QHKJ 1AY1L 5FGRA 5A2IH 1FFPB 1N7ML 2F58H 1MJ7H 3SHSA 1RZFH 3N1GC 1V05A 2VLRB 3BWAB 2NW3A 2QJDA 4G9FE 4HWBA 4GG6F 1NUFA 3BP5A 1FQ9C 4YPGA 3ZO0A 3NFSH 5TF0A 3CAFA 3FQWA 1RVFL 4KAQH 1A3QA 4WI9A 3IU3A 4M93C 4DTGL 4JDVA 4XMKH 2MCPL 1KCSL 3S35L 3IJHA 4X83A 1GXEA 1M7DB 2OJEA 2BOBB 9CGTA 1IEHA 4K23L 5INCB 5E56A 1D9KC 1I1AD 2DAVA 3PWVA 4YHPA 1IFHL 1RIHH 4RISH 4KTEH 5CAYB 4P4KA 2GFBB 4PTUA 3QUYD 4TPRL 1U8KA 2BJML 3MRPA 1WJ3A 2W60A 3VXRE 5HYSG 4XGZB 4QNPF 2D4DA 1YPZF 4LNRB 1HQ4B 3FOLA 1S7XA 4L4VB 3IU4L 3CFEB 4L8BA 5C08E 4WWKD 2R2EB 4PJGE 1KTLA 4KJQC 2VDRL 4LPTA 4HLZH 1FFOB 2DTMH 2DQCH 3C5SA 1OW0C 1WT5A 2EIZB 1GOFA 5E6YA 1U8QA 5D7LD 1OSZB 3K2UH 4OZHA 1QFPA 3HRZB 4P99A 2VXVH 3H7BA 5JIHA 4HUVA 1JMXA 3GMPB 3OTTA 3C5JB 3LRSA 3W9DA 4CMHC 4K9EH 4ODUA 1PX3A 4MD4A 3IFPA 5I1HH 5C07B 1J05A 3EDKA 4YXKH 4OLYL 5CS7A 4D9RD 4U1HA 4F7CA 3WXWH 5FDWA 4I77H 4O58L 5EOTA 4ZAKC 4EUPB 3TF7C 2XZQH 3E2HC 4WHDA 1OP3K 5DD3L 5ITFA 4OKDA 3D0VB 1CFVH 4HX1B 3BIAX 1G7LA 3GBMH 4RBPH 1ITBB 3U83A 2DKSA 4Y5XB 5IFJB 3UTTB 2WBWB 3TO4A 5HY9A 1YC8A 5K9QG 3LHPL 4MDJA 5E4EC 3BW9A 1KEML 2EDTA 1FH5H 1FJ1B 4W68A 5ENWA 4I9WD 5DVOA 1QLFB 1OAXL 3I50L 4KK9C 4YHMH 5EZOH 2HKFH 2GJZB 4K3EL 3U4EA 2UV3A 1ZGLA 1S7QA 4XPHH 5BV7L 4JFZL 3WV0A 1J9CT 1ZVHA 4TVPH 5I8KL 5KSBA 2PXYA 2FATL 2CLRB 2YPLB 3BD4A 5HHOD 3DO3A 3TYFA 3R8QA 1MH5A 1PAMA 4MXQC 1DCLA 1M05B 1NJ9A 2I9LA 2XACC 2YPVH 2D0GA 4ZFOA 4LLVB 3QQ4B 2P1YA 5IK3B 1UXWA 3S97C 3QIWD 3ORJA 4ZO6A 1FL6A 3MYJA 1G6RL 3O3AB 3S36X 4MCZB 4MWFA 3NFNB 4XBGB 5I18L 3QEQD 1B4RA 4RFOL 4R9HA 3F7QA 3IYLW 5DFWH 4P9MH 4LGSB 5ALBL 2CRIA 3ZYIA 1DQQA 2NY3C 5CLTA 4PJXE 4YHYC 3MRCB 3SDXA 5CHNB 5I66A 1DL7H 2VLLA 8FABB 1RY7B 1J5OH 5FYLD 1RK0B 2DI8A 4HUWB 3HI1A 1VB9A 2JJTC 2QQNL 2GJ6D 1P7QB 2IMNA 3MGTA 5AAWA 1OOAA 4K7PX 1QQDB 4MNQD 4YIQA 1HIML 3FN3A 1UM6H 1WIOA 3M07A 1I7ZA 1NC2B 1CD1A 4JJ5B 3LPFA 4H8WH 4LLUA 3O0RH 3QJHA 5C0BD 3BSZH 3MRGA 2VL5A 5IBLD 5ID1B 5JQHC 4KQ4L 4CN1A 1TETL 4G8EB 2JF1A 3BPLC 5T1MA 3GSOB 5EULV 2DQDL 4PFEA 2H9GB 2FO4B 5FGBA 1LMKA 4RFNB 4XXCC 4DKAA 1XH3B 2OS7A 4IJ3C 4L8DB 4NQXB 5DTFB 1G7MA 4XNXL 1T0MB 1RJYB 5IHBA 1R5WA 4QCIA 3GMLA 3LDBC 1C5CH 2GW5A 4NT6B 4L29A 3VG0L 1QSZA 5IBTH 3EYQC 2V2XA 3V6OE 1G7JB 5BZDB 1KCUL 4NM8L 2IG2H 1UKQA 4WUUB 4LRNL 4JZJB 4GQPH 4W4OA 1RUKL 1TVHB 2IGFH 2QHRH 4BSWB 5JHDD 4AIZB 1LD9A 1ORQB 4F9LA 3NBNA 3FT3A 5FECA 5IVXA 5E8DL 1RZ7H 3MV9D 4OUOA 2BXZA 5BQ7B 3D9AL 3BRDA 4GO6B 3IDUA 4KY1H 3ARFA 3MCKA 5JOPD 3NZHH 4HZLB 1LEKA 1BREA 3PXJA 3VD4A 2VMFA 5D93C 1X5HA 3RY5A 5EUKB 4LLWB 1LILA 1MCPL 1OB1A 1G84A 1A0QL 5EFIB 4PGDB 3L7FA 3JVGC 4XNUL 4AM0B 3FO1B 1JZ8A 4K3GA 1E6JH 2A83B 5FYKL 1T21A 4JM4L 3UYOD 3DGGA 1ZANH 1WVZA 4OCYL 2WNGA 2FSEA 3G5YB 5DVLA 5J57B 5KVFH 3U36B 5GS1B 3EAKA 2CIKB 4JY4B 3WIIL 5F44A 1A6ZB 3TWCH 4PJIE 1FVCB 2B0SL 4AJ0A 5DR5L 4KRPB 1AO7E 4G7VH 2XWTA 4RZCA 3AM8A 2B1AH 3QFJB 4WW2C 3WNNA 1CLYH 4JE4B 4ZUSB 3HPLA 1JGEB 5K9OB 5E9DD 4JHAL 4PJEE 1IKNA 2AJVH 1UWEH 3HMXH 2J5LC 3MRNA 1UEMA 1AGEB 1BM3H 2AK4B 2VSCA 4M7KL 3UC0H 1H15B 2CK2A 2I07A 5DHXB 1K8IA 1GC1C 2BSTA 1KIQB 4PGCA 4YHKH 4G9DA 1FGNH 5GXBB 1EGJL 2VN7A 5D1QB 2CUMA 1DE4B 1HOCB 2R0KL 4QRRE 3ZKMC 3MRFA 1JGVH 4R90L 4X6EA 5CMAA 3U9UB 1DANU 2XQBH 2W07A 1U8PA 3QHFH 3MOAH 2BC4B 4IIQC 3STZB 4Y19B 5KZCD 3KHQA 1F4YL 3V6FA 3KPRB 3QNYB 2NY2D 1CR9L 2Y36H 4M7LL 4HT1L 4CVXB 4P46C 3BPNB 1KB9J 3MO1B 4MHHI 1HCFX 1JPFA 4UQ2B 5J6HB 3CU7A 3CCHB 1FO0H 2H2SD 5FA3B 3OKNA 5IOPB 3PL6C 1DTUA 2ENSA 1H3XA 3NCJL 3DMMB 4JPIB 1A7OL 2X41A 4RNRB 3W0WA 2BFVH 3HI6L 4H1LG 4JFQA 3IFLL 3QFDA 4CN4A 5H35A 4NWUH 4L4TA 2EE9A 2J4WL 5AWNL 4G7YH 5CP3H 2FLBT 1T66C 1YYLH 3FRPG 1A7PH 3ROLB 3T8XA 3S88L 4NO2A 3PHSA 4PG2A 2Z31D 2BP3A 1CK0L 2VIRA 1WC7B 1OTSC 1NCDL 4LKXA 4Z0XB 5INDA 2Z8SA 3MRQA 2VRAA 1BEYH 4LQFH 3EW3B 3P0VL 4P4RB 5GRZA 1MRDH 3RKDD 3U6RA 43CAB 2X7LA 4HULB 3PQYB 1G7QB 5FOBB 2FHFA 1EAPA 1DEEB 3HMXA 4PB9L 1T04A 2OR9H 2HH0L 3SOBL 3EDDA 3MNZB 3NVQA 1CI5A 3HFMH 3MRHA 2QSQA 5F9WB 3RQ3A 5IJKC 3DX6B 1T1ZA 4PYGA 5IW1A 1SMOA 4PV9A 1BWWA 4TSBL 4JB9H 5JDSA 4XMPH 2L4OA 3KLHC 1GL4B 3SJVD 2AI0H 4AEEA 3HNSH 1UJTA 1KG0B 4I0PA 5DVNA 1DBKH 2JELH 3P9MB 2X4RB 4Y4FC 4IHOB 5IW6A 3BKYH 3QG6A 1LP9A 5DJXA 4JRXD 2HFFB 3H9SE 2PO6B 1GGBL 4R7NB 1YEHL 3LKRA 2R0ZL 2EDFA 4K07A 4Y4HD 3DVGA 4KKLD 1QKZH 3DUSA 4PLKC 4XCEB 5IEKB 5SWQB 2XRAL 3Q5YA 1IGJB 1I85A 3LN5B 2IPUG 1JK8A 1XIWA 5DQJA 4TRPL 3L7EA 3GSUA 4LU5L 1BJ1J 1AGDB 1WIPA 4RGND 3TVMA 2EE2A 2RHEA 4QO1A 5BW7C 1C5BL 1KPRA 5DD1H 4NQCE 1FO0A 1HHKB 1I7TA 2VLKA 3QEGH 4LCWD 1A47A 3ZE2F 3SQOH 2IH3A 3ZKND 3F62A 1S8DA 5HGDB 1HYSC 3MUJA 4FQHB 5CP3A 3VWJC 3V0WL 4Z8FL 2P8LA 2OM5A 1BIIA 1QNZH 1L9MA 2X9WA 4LSPH 3IDYC 4YBQC 5AZ2L 2IANE 3IDIB 3C60D 2DWDA 3D0LB 5MENB 2X4TB 4EN3C 2OP4H 5C0FA 4F8QA 5CEZH 3RZCD 4NZDA 4CJ0A 3P73B 1CGYA 1T22B 4LSTL 1IQWH 5J11B 2DF3A 1S7TA 4G42A 4NM4H 1FZMA 3P4LA 5DEFA 1Q9OB 1CTOA 5CSGA 1C8PA 1JGUL 1S9YA 3OB8A 1IC1A 2BXYA 3TPKA 4QGTA 4HQQH 4RIRB 5A2FA 5E8EB 5F89A 1AXTL 3KLDA 3EYVA 5ERWB 3VRIB 2MNUA 5EIIB 1W0VB 1QA9B 2LAGB 3DX7B 3I6LD 1K3IA 2E6JA 5GS2D 2VZOA 1UCBH 2A1WL 3DX9A 5E5UB 4QWWD 4YK4B 3H9SA 5BO1L 1AXSB 3UDWA 1X5ZA 3SDDA 3GB7A 2PN5A 4KC3B 1CDBA 4FP8L 4ZDHB 1D5MB 2MCG1 4BQCA 1MRFL 3Q6FA 4MCYA 4DAGH 1L6XA 1MAML 5FDYA 5AZEL 3LZFL 3BVNB 2VO5A 4YH6A 1ZSDA 2VDQH 4PR5A 4PRIA 1ORSA 4G8GE 5D7JD 3SCMA 1NEZG 3U7AA 1I3VA 1T03H 1A6AB 2ZOKB 1JN6B 1QTYT 3VFSB 1S7UA 3LKSB 4Z7VE 3ZHLA 2P5WB 5B39B 1KB5H 2FCBA 1JUFA 4FTVB 3WS3A 4MA3B 4PJCF 4YNYA 5D72H 3RVUD 1D9KA 3K1DA 5DJAA 2BY1A 5H8DA 2X4UB 1XGRB 1A4JB 3CMOH 5IHLB 1FL5B 1ES0B 2FWOA 3QO0A 3BZFA 1VGEL 2P5EA 5LQBL 2WWMC 1HKLH 1YMHB 2AQ2A 4HIIA 4XXDA 4ONFH 5DRWA 4K3JH 4NQDD 4H0HB 3DNKA 1F13A 4QKXB 3T1FA 4ELMB 1Q9LA 2VWEC 3UPAA 4Q9QL 5DUMH 4KUZH 4HPOL 5DHYA 3NAAH 4XC1L 3AY4C 3PV6B 3EYUH 3Q0HA 4OLUL 1OW0A 2IMMA 4G80A 1B4JH 5GRYA 4TTDC 2ESVB 5CILL 2JIXD 4RDQG 1F11B 2GTWB 4ODBD 1V7NH 2FEEI 2V2TA 1X5IA 2MJWA 1S7SA 4GSDH 1T1YA 4M1DH 4ZFFB 5F7HA 4LLQA 4NCC1 2XZCH 1AGFA 1WWCA 1YEDA 5E5MB 4ZAKA 3GSQA 4JM2C 3NA9L 3AXLB 3NN8A 4NO0A 1YN7A 3HR5B 3BKJH 5ICYA 4X7EC 4L3EA 1MFCH 1TZGH 2X4PB 2OTWB 3ZL4L 2YSSB 4GG6B 3QEHB 3U2SA 5IQ7H 3VA6A 4LF3B 1JTTA 4LIQH 1DLFH 2G60H 4Y2DC 5AYUH 2JB5H 3D69B 3LN4B 1AXIB 1RI8A 1REIA 2R2HB 1MF2H 1HXYA 1KB5A 1KV3A 4PB0L 1E6OH 2NYYC 3SDXF 3X12B 3O9WD 3HAEG 4S1SL 4GQ9H 2W65A 1U8JB 1I7RA 3FKUS 3QDHA 4F7TA 4U7KA 5DI8B 1UH2A 4J3UA 4CNIA 4L3CB 5KTEH 4Z5RB 1XEDA 1NCAL 2YZ8A 3QG7L 3FN9A 2D31B 3UYRH 4ODXA 3LEVH 4FNLL 3OKMA 1LO0H 3VJ6A 1YPZB 3K3QA 4RSVA 5B38A 5KVEL 4OBSA 5EZIL 3FB8B 3MV7B 3TV3H 1LEIB 3MREB 3CPLA 3IDMA 5EORH 1MCDA 1WQVT 1WICA 2R2BA 4XCYB 3U30B 4PLJC 2AJXH 5GQBA 4GKNB 1DQJA 4XPBH 2P44B 1HSAB 4K94L 4B50A 3C8HA 3RWGA 2VDKH 1CLOH 3V6BR 1JYNA 3ALXA 5DQDL 3ECBA 3UP1A 2YKLH 4KJYB 5GZND 1KJMA 4DN4H 5DFVC 4J23A 5EOQL 1CE1L 2JJTA 3HB3C 3ARGC 5A1AA 2BNUA 4N8CH 3M8OH 25C8L 5FYKU 2HYMA 4QRPB 1RUQH 3MYZA 4X0KA 3VXUA 4HEME 2BRRH 3RVXD 1DVFC 1TJIL 4XCCL 4DCQA 3P2TA 4HJ0C 5HPOA 2DQTH 1HWHB 1KCLA 5GS0L 4C56B 4H88L 1NCBL 2BHUA 2XZAH 1PSKH 1UKSA 2DMKA 3GSNB 5KS9E 4XXCA 1PKQA 6FABH 4O2EB 4PJ9A 3GGWB 3MCG1 4FQQA 4OTXH 4OGXH 2GITB 2ATPA 4GBXC 1JYWA 3BUYB 4YXHL 2YEZA 2KL6A 5IV2B 4W4NA 4M6OL 4GS7C 4OF5A 1H3PL 3EDJA 4RWYH 3SKNA 1EO8L 2BVUA 1GC1H 1OSPL 5FF6A 1OAKH 4PJHE 2PYFB 2D4FA 5IBUB 4BUHA 1IAIH 5BOZG 4NZTL 2XQYK 1NGYB 4DK6A 4J1UB 2HT2C 1TZIA 4N8VG 1MLBB 1N3NB 3T0WA 1CCZA 5CBAB 2MHAA 4J3XA 4AH2A 4P4KD 4P59L 4WCYH 1HE7A 4NQSA 1HXMA 2HT3D 5SWSA 3LKOA 5AUMB 1CFTA 4QHMB 2WIIA 3WNKA 1A1OB 4POUB 1NMCC 5D7SL 4Q9CA 3DURA 3FRUA 4I13B 4C59B 1A7BA 2FX8L 4MJ6B 2H1PL 2HWZL 3MRRB 5L88L 1WCBB 1Q8MA 3RPIA 3RL1B 4IOFD 5H94B 1LE9B 3JVGA 5B3JF 1J10A 3GUTB 4U6XB 1FNAA 2F58L 2OXHA 3DXAE 1BFOA 3MTRA 5L9DH 4OKVA 3DUHA 3MODH 3ZT7A 2W0FA 4B53A 2OYPA 1ZLVH 2SEBB 1QACA 1YQ2A 2F8VA 3F58L 2Y23A 4P2OB 1CWVA 3NFSL 4S2SB 5EO0A 1VESA 2VLMD 4KAQL 1BHGA 1BOGB 2OI9C 1U58A 3EOAB 3O6FB 2G2RB 4HMCA 4WJ5B 2R8SH 4L9LC 1XGUB 2VXUL 5I17B 4WW2A 1OAUL 4ALAL 3L3IB 1GHFH 4DUWA 3O3EA 2AK1H 1ZS8B 3QCUH 2F5BH 4CDGC 5GRUH 4Y1AA 1CZ8L 4HKZB 5LKNA 1S5HB 2M8XA 3FB7B 1T20A 2O5ZH 3L3JB 3U9PH 4NSKA 3UJTL 1KFAL 5JDJA 1CXFA 3QI9C 2QR0A 4D0CB 5DJYB 3M17A 1CFNB 1HDMA 1NFDF 3EOYG 3TO4D 3TP4A 3QISA 3WIHH 5IB1B 15C8H 1GZPA 1ZA3A 2DD8L 3BJ91 1Q0YL 2KKQA 5K59E 4PGEB 3FO9B 4ZS6C 4UT7L 4U1GB 2WK2A 4U6YB 1GRWA 3HZMA 4IRSC 4CW1B 2ZUQB 2I26N 1H3WM 4IDJH 4JN2B 4X98B 1CDHA 5E8NB 1R3JB 3ZMRA 1IC5L 1ZT4B 2W9EH 1NGWA 3I6KA 2ATKB 4KROB 5KSVB 2PXYD 4O9HH 5D1ZB 1E27A 4GAGL 1FZJB 4K55A 3K8LA 3CZFB 3G9AB 5DD5L 1A4KA 4PG9A 3QA3A 1XGTA 5L2KE 4UV7L 4NNPL 4LEXL 4HGMA 5F9OH 4JFYA 4PJDA 5FGCB 3TJEL 4JJHA 5I1HL 1I7UB 3C5ZC 4OV5B 1NH6A 3PL6A 4YXKL 2FJFA 2A74B 2DOCA 4NRZB 3G6JE 3F6LA 3Q2CA 4UMGA 3L6FB 3D3VA 3QH3B 4XNYL 1HHGA 4HUUA 2Y72A 1UGNA 2YK1H 4NNXB 4JKMA 2R4RL 1CFVL 2L7UA 4D8PA 4NQEE 4MQ7B 2AKRA 2K3TA 4Q0XL 4Z77B 5L2JA 4PP1C 2GTZB 2IFFL 4ZSOE 2K7QA 3PG2A 4N5ED 3TH3T 5MEQA 5I6XC 5C3TA 2NTSP 5GGRB 3RX7A 3TBVB 1EEUA 2WSKA 4KXZH 1IILE 4EKXA 1FH5L 4LCUA 4Y5YC 2JLLA 3SKJL 4HDIA 2I27N 3DIFA 5F9AC 5EC1A 3CFJB 1ZLSH 3KGRA 3F12B 4PV8A 4XPHL 3TZVA 5I1GH 2EXYD 3IXTB 5EO1A 5IVOA 4XTRC 4U6HA 1EBPA 4DZ8B 3WIHA 4WFGE 3OHXA 3RNQB 5TF1H 1T3FB 1IC4H 5IJKA 2RCSL 3B5GA 4ZPTB 5I16B 3LKNA 4NO5A 2VSDA 3KPOA 3D39A 1MQKH 2YPVL 1WTGT 4KI5F 1VFAB 5EO9B 3SGJA 2DLFH 1NAKH 1U8OB 1U8HA 2ZSWB 4ODHH 3SPVA 3T2NH 2GSIA 4FQXB 4JKLA 2E9JA 4HMEA 2C5DC 4TVPD 3VXSE 1FE8L 1AKJA 4BFIA 3RUGE 5J1AA 5DUPL 1MHEB 4NOFA 1HH6A 3JWOL 4EDXB 3FMGH 4NHCH 1MQ8A 3V5KA 5BW7A 1I9JL 3GSWA 1DL7L 1AQKL 4XPAH 4Y5VB 2NY6B 3MFFB 3QDJE 4NO3A 1FNLA 1BECA 3G5XA 3UO1H 3B2UC 3KPSA 5E94B 3C6LA 3ARFD 3O4OB 2C3VB 3VWJA 3O81A 5IQ9A 5DHVH 1KC5L 3GI8L 3ROOB 3P0YH 4WV1B 5I30H 2HJFB 4MB5A 3MLUH 3OPZH 2X4NB 4OV6F 3CH1B 1DR9A 3CFBA 3AU1A 1MWAH 1UADC 2DJ4A 5DEGB 1ZGLP 2EEDA 3MCLL 4JQVC 3T65B 3Q6GH 4JVUA 3FB6A 2NR6C 4GRLA 4XMLH 5I1LB 3WKNA 3GJEB 1R3LA 4N0YL 3UTSA 5D2LF 1AGCB 4JQIL 1T0NB 1UWGH 4KTDL 3N9GH 1U8LA 3ZYOA 3RJQB 4EEEA 5IFHH 5FK9A 4X4ME 3WLWC 1BD2A 4M1CC 1X5KA 3D2UA 3TFKC 3O6ML 2ICCA 3QR2A 2W0LA 1P9MC 1TVDA 1R5VB 4XRCB 3ZE0F 5C0DB 4F33B 3GMMB 3BEWB 4HV8B 2F54A 3TO2A 1EJOH 2LVEA 5ADOH 5JLZB 1U95A 1A14H 2NTFA 3MNVA 2VXSH 1I1FA 5T1KB 3QUZB 1EXUA 3OG4B 1LVEA 3FQNA 4LVHB 3FTGA 3MV8A 1KCRL 3PWJB 4G6FB 4JR9H 2NXYD 1P7KA 4Y4KD 1T5XA 2EECA 4M02A 5GGSA 5JOFA 3T1WA 2P42B 3ET9F 4YHNB 4GKSB 3N1QC 1ZHBB 1RUAL 3B9DA 4YHLL 3TNMB 1ACZA 4ORGA 1YN6B 5SWZB 1PZ5A 1F6AB 5EUOE 1ETZA 2V7HA 4D0BB 1BQHG 4KQ3L 3DYMA 4MMXC 3THMH 1ZKAA 3AVEA 4KZDH 5DHVA 2JCCA 4HUMB 3WFHB 4U1MB 4QT5B 1A6TB 1T2QL 3LMJH 1MWAA 1ZA6A 3D25B 4KHXL 2NX5B 3OKDA 3AS0A 2AJUL 2ICWB 3HMWL 4XHJD 2VLJA 4PY7A 1MI5A 4LARL 4K71B 1RZGB 3BD3A 4RDQF 1MCWW 2NY1D 4G7VL 3W0WD 5KG9B 2NW3B 3T4YB 2PYEE 1KJ2L 1CLYL 2AQ3A 4L4TD 4D9QD 4YPGB 5CSZB 3V95A 3VDCA 3ZTNH 2AJVL 3HNVL 4X4MA 1ZLVK 3KYOB 3RWCA 1YEJL 2OJEB 3RTQB 1DUYA 3EHBD 4AMKH 3O6LL 3V4UL 1D6VH 2AXGA 5IMKA 1G9EA 2EDRA 2IPTL 3GKWH 4HS8L 3X14B 1FGNL 2V5TA 4LLAA 1MFAH 4N1EA 5I8EA 5D8JH 5HDQH 1NBVH 4QXUH 2BVTA 1QR1A 3L95B 1CFBA 4Y5XC 1NGPH 4KGJA 3VH8G 3MRPB 1QSFB 5E2VH 4OD1L 5FO8A 3QHFL 1MCQA 1A7QL 1P6AB 1BIHA 4JM2A 4ISVA 4HXBH 4HJJH 3GHBH 4CUCA 2X40A 2ITCB 4S1QH 1SQ2N 3TYGL 5IP4A 3U4BH 1SY6H 2OJZH 1MJUH 5CKAA 5JNYA 1P53A 4J3SA 2YUWA 4Z7UE 1IJ9A 4JANB 4I0PD 4P2QB 1CG9A 6CGTA 2Y06L 2YRPA 4JN1H 4JEGB 5CJ5A 1LK2B 4HEPG 3NPSC 2YOCA 1XR9A 4HLZG 4D9LH 4M1GH 4H20L 1K2DA 4NNYB 4AQOA 5TQ0H 2IAMB 4PJCB 3H2WA 1XIWD 1YYLL 1R0AL 4L8CA 3W5MA 3L3HA 3SE9H 3HUJF 3CJJA 1N2RA 5FDWB 2VLKD 5ADPH 4E5XA 4I2XE 2YPKB 5J0BA 4LCIL 2V9QA 3X13A 3RVVD 2QKIB 2KUTA 3BQUA 3PIQB 4JY5L 1G7LB 1ED3A 2WLYA 3LEYL 4X8JA 2W38A 4TUOA 1KUMA 5EU4B 1MCCA 5GGTA 4RGOL 1B0RB 2XWBB 3TT3H 5IKCA 5C0CA 1F58L 2V7NA 2WUCL 3EYFB 4ZD3H 1NBQA 2B5IB 3WN5A 1CXHA 4N0CC 1MEXL 1KN2H 3D85B 1ZGLM 4M6NH 2DLGA 5D70L 1WZLA 1S3KH 5HDBF 1MVFA 4FQPA 2AJYH 4TSAL 1JPTH 3PGDB 1VADA 5MP6L 2DQEL 2Q8AH 4R2GD 4PRHE 3V0VA 2YD2A 4UNTA 3MJ7A 2H3NB 4RFNC 3ULUC 3JV4A 1JPSL 1IE5A 3K4DA 3ARGA 3VXME 4HWUA 2FECI 4EBQH 5GSVB 4NQVA 4YFLF 4BZ2H 1T7YA 1DVFA 5I2IA 1SY6A 2GCYB 4JRYE 4UAOB 3MJ9H 3LKPB 2OK0H 5HI4C 1T6VN 1EZVY 2PCPB 4MNGB 4MWFB 3EO0A 1LE5A 3H9SD 5F1OB 3RWHA 5FB8B 2EDOA 3SDDD 4LDLB 2DIAA 4LVEA 4X6FA 1J8KA 2R2CA 1FZOB 4ZODA 3IF1A 3UXFA 1Y6KR 4GBXA 3WFEL 3MA7B 3SDXB 1A6WL 3WNLA 5LCVL 4LSPL 1XGQA 5D7IF 3SCMD 5FV2A 5IMOA 4GT7A 4BYHA 4HC1H 5CBEA 3UPRA 3QUMA 3QCTL 3RX8A 2Q86A 1QSEE 4NZUH 3I9GL 3PF2A 4K2UL 1WISA 1CD1B 4UU9A 3KNBB 2ZKHH 3QJHB 1CD9B 5DMGC 3S37H 3CFKB 4U7SA 1D9KD 4F15B 5JIIA 3STLA 4KUCF 4MD5B 1C5DA 2HMID 3OG6B 3RVWD 4N0RA 2F8XC 4JQXC 1QEWA 1SM3L 4PJAA 3S4SA 3CLFL 4OBRA 1XCTA 5K9KA 5JW5A 2P5ED 5DC4B 5CEZD 1G7MB 1QRNE 1KENL 3DV6B 4Z76B 2OQJA 4JFEA 5CWSA 3KPQB 2A9NL 4QCIB 2R56L 2UVEA 5GS1C 2P8MB 4UI2A 5F88A 1N8ZA 2XN9B 4LAJH 2D7OA 1XGYL 5TE6L 3FAWA 4KJQD 2DQHH 3BDYL 4JFXB 1JNHB 5C0AE 1J0ZA 2AV1A 3VXMA 1L7IH 3CK0H 2V2XB 5ANMA 3NMEA 1RZIA 4Z0BH 1TQBB 5F1NA 2ITDB 5BMFL 3GHEL 1X5JA 1ZHKA 3VI4F 2DM2A 1LD9B 4HJGA 2EO9A 5CINH 3HG1E 1UT9A 4WU5B 3FT3B 5EPMB 3MJ9A 4XAKE 4MS8C 4JHWL 2BVQB 4EVNA 1T03L 3Q1SL 2V17L 4JFOB 5T5NF 3BD5A 1RK1B 2ZUVA 3IKKA 4JO2H 4L9LA 4ZAKD 4UILH 3QXAA 3LS5L 1FYTA 3FOMA 4PJ8B 4MGXA 1UM5L 2KZ1B 2Q3ZA 5TQ2H 4L3ED 1NMBH 4OF7A 2OZ4H 1UACL 2CSPA 5GJSL 5DK0A 1NCNA 2O5YL 2FLRT 4NKMB 3GJFH 2VDLL 4HC1A 3V7AE 3F7YB 3HC0B 3TIDA 4DGIH 4ZFZB 4X5LA 5C0RH 4HUNB 1SJHA 3DGGB 2FIRT 4OIIL 3BPNC 5HGAA 4ZUVA 2FSEB 4QRUA 4IRSA 4OCMC 3AS1A 3PDOA 4KK9D 1TTUA 5C0GB 3T0EB 2IALB 5DT1H 2OSLA 5IM7B 1B90A 3C09B 3MROB 4HIXH 5D2NB 4LHUB 1QRNA 1VPOH 1MCFA 3HPLB 3SEPA 1GOGA 2NLJA 4XVTL 4NUGH 2G5BA 5ESQB 5FUZH 1MHHA 3DETC 2XTJB 3ZTJH 3L3OB 3C5ZA 3KPMB 4KV5F 2GJJA 1IL1B 3DSFH 2EC9T 3WS6C 4WW1B 4QRSB 4DGVH 1EK3A 4P2RB 3EKCA 3CFDA 3PABA 2B4CL 3BKJL 5CMAB 3QO1B 4DGYH 1FC2D 1JWUA 5I75B 4ONOA 2NY3D 3NIGE 5DJZA 3SDAB 1HILA 1NCUA 5IEHA 3H0TB 5EU6A 1EEQA 3FN0H 2VH5L 3X3FL 2EH7H 1DLFL 2G60L 2YA0A 4OFVA 1FFNB 2RR3A 3T2OA 3DI3B 4S1RL 1PQZB 5F9WC 1VKXA 1TPXC 5DK2A 1J0KA 1WWBX 4Y5YA 3RWIB 3VXUD 1QPXA 1RV6X 1DBBH 3D18B 1INEH 5BXFB 1RIUL 2OZ4A 3VW3H 3C2AH 4KDVA 4P5KA 4X80H 1CL7I 2UVFA 1U3HB 4I18B 1TJGL 2YWYA 3ULVC 2PO6C 3GJFA 2HVKA 5KTEL 1UQSB 2EEBA 1CD0A 5E03A 1KB9K 1NFDB 1J87A 3V4PL 4JFQB 1F4AA 4PJ9D 1VEMA 3LEVL 3FT4B 3QJFA 2NXZB 2KPNA 2QSTA 3NCCB 4F2MB 5HI5C 4QHUB 1U92B 3QHZL 1NL0L 4QTHA 4FZEH 3VFRA 3TV3L 2WV3A 4HSQA 4YAQB 3ESVF 3P9LB 3ZHKA 1PLGH 3REWA 3EYQD 4BELD 1AI1H 5DD0L 3K74B 1PFCA 4H1LB 1MJ8L 4FFZH 3H42H 3MGOA 4XNZB 1U0QA 2EZ0C 1YMMB 2BNQB 1AE6H 3VGAB 1GZQA 2Z93A 2CDFB 3VE0A 3PWPA 4NRXB 3U46B 3DV4A 4DN4L 4WFFD 2UY7A 3WL9B 3CFCH 3H3KA 1T1ZB 3SGKA 3QUXA 1HI6A 4NWTH 1FVEB 5SWSD 5J11C 1INDH 4YX2L 5TDNA 1AC6A 3B4NA 4JG0L 1Q9WB 2DS4A 4EXKA 5ISZB 1QLEL 2X05A 2VKXA 1EEYB 4XH2B 2A6DA 1QO3A 3KR3L 2AXHA 2ZCHH 5JPNA 1MRCL 3O8XA 5DYOB 5DJXB 3QG6B 3RBGA 2DQFA 4G6AC 3A6BH 3BKCH 5D9SA 4JQVA 2VZTA 1VFBA 2E7CA 2CQVA 4JGUA 4OTXL 1B0GA 2ZPKH 1XIWB 3OAZH 3QIWC 3TVMB 2AGJL 1GVIA 1KPRB 1DBMH 3S34L 4EI6A 4IS6A 3L3GA 4YK4C 3MUGA 2GY5A 2QV2A 2R0WH 2R23B 4MJIA 2IH3B 3W9EB 1FFPA 2NY4B 1H8OA 4OCNC 4EUPH 3O6KH 2GSGB 2P45B 5ITBH 1GC1L 4FQJH 1NAML 5BV7B 1P9MA 2LU4A 2VLRA 3BWAA 1CGSL 1IAIL 1J0JA 3BH9A 4XP4H 4NC1C 5DGRA 4P23B 2ICWI 3Q3GB 5F96H 1AC0A 1J1OH 5IIEB 3L3DB 1M7DA 2YXFA 3MOBH 1G6VK 5TJWK 2BOBA 4Y7MA 3P4MB 5INCA 1G6RB 2J8HA 1ERNA 1S7TB 2OL3L 1IGYB 3ZYZA 4R2GB 5EU7E 4NJ9H 1HHHB 5T1DH 1WZKA 4YEEA 2E7LC 1BAFH 1CXKA 3AAZB 1LK3L 4RMQA 1QSVA 2DKMA 4DQOL 4XGZA 2YPLE 2H8PB 4LNRA 1AD0A 3T77A 4OQ1A 4L4VA 4XX1E 3MRIB 2ZUSA 5JMRA 1S9KC 4G3YH 2CR6A 1FIGL 1IGIL 3DX9B 3QRGH 1FFOA 4BQBA 5K33A 1ZLUK 1SVCP 3O2WL 3MMEB 2BY3A 4JFDB 2EIZA 5E08L 5BZWB 3PL6D 3V5HA 3TH4T 4PP2B 3U82B 3DROB 3HRZA 2Z35B 4JZOB 5GRXG 3D3VD 4AEIH 4TULL 3GMPA 4TUKH 2QADB 4DZBB 4PRIB 1ORSB 1IMHC 5D2LB 1KXTB 1T66D 2WBKA 4X7TB 3LS4L 2EC8A 5C07A 1S7VB 4QLRA 2R0LH 3HNTL 5KN5B 1UYWL 3K81A 4Z7WE 4OZIE 4EUPA 1OTSD 2MKLC 4N0UB 1JUFB 2APBA 1IT9L 3D0VA 5BS0B 2YS4A 1E4JA 1MAKA 2EO1A 2P47B 4IDJL 4Y5XA 5IFJA 3UTTA 4TSCH 4PJGF 1N6UA 3TZVD 3BZFB 3QCVL 4BH8A 3ULUH 3QSKB 2MOVA 3ARTA 4OM0L 1QBLL 2A77H 2NCMA 4JFHE 4ZOAA 1FJ1A 1XZ0B 4HIIB 1QLFA 5DRWB 5GRJL 2EDDA 2X4QB 1HZHH 2ZUXA 2GJZA 4EZMA 4OZGE 1FVDB 5T5FL 5E99H 3D39D 4J7RA 3KLHD 4HS3B 4QTIH 1UM4H 5F9OL 2CLRA 5IF0B 3ZYJA 4IMLB 4P5MB 5C09E 4PJ7E 5ID0B 4EDWL 3QDGB 1M05A 1JFQL 4L5FL 1AKJD 4LSUH 5IG7B 4KWUA 2YA2A 4Z7OE 4PLKD 1JTOA 3ZKXB 1MOEA 4LLVA 3QQ4A 2FHBA 1FNHA 3QPXH 1N0XL 5IK3A 1FC1A 3CUPB 4UTAL 2IQ9L 3O3AA 3EFDH 4MCZA 3U30C 4Z78B 1YEDB 4XBGA 1MREH 3OKLB 3DVFA 4RGMC 1NDGB 3NN8B 2N1KA 4NO0B 2DQIL 3TC9A 3KPSD 3QZWG 3KXFB 1HYSD 5CHNA 4OD3H 3VWJD 4I1NB 2M2DA 3U2SB 4OCWL 3MUY1 8FABA 1RK0A 3NACH 1P7QA 2EYRA 4R8WH 1CS6A 4YBQD 2V6HA 1J18A 3EDFA 4PRPB 1QQDA 2MPAL 4EN3D 4I3RL 3NTCH 4LQ1A 3L5XL 1NC2A 1EHLH 4JJ5A 5DURB 2DMBA 5FO7A 4JVPA 4Q9RH 1X5LA 1DP0A 1I7RB 1OVZA 2FJHB 1WF5A 4LAQH 4G8EA 5HYJB 1Z9SA 3L1OH 3GSOA 2H9GA 2FO4A 2A9MH 1WAAA 3T2NL 4UIKL 1BD2D 3D2UD 4L8DA 3QAZC 2AJSL 4NQXA 5I19L 2YA1A 4KPHH 5HGHB 1T0MA 4GKOA 1RJYA 1FSKB 1LNUB 5B38B 2EE3A 2Z31C 2J8UF 4WTZA 3S3JA 2G75B 3BXNB 2F54D 4UV4H 3K4AA 4XVSH 3H3PH 1S78C 4ZXBB 1BQLH 4PJXF 1FGVH 5ACZB 2UZYB 1G7JA 5BZDA 5M95B 4WUUA 3JV5A 4JZJA 1U6AH 5ACMA 2A6JB 1TVHA 4BSWA 4D3CL 1PY4A