2HKFL

Crystal structure of the complex fab m75- peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of antibody structure upon association to a human carbonic anhydrase IX epitope studied by X-ray crystallography, microcalorimetry, and molecular dynamics simulations.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Immunoglobulin Light chain Fab fragment
total genus 55
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfL01
5DGRA 2C4XA 1Q72L 1DBBL 1Q9WA 2DLFH 4BQBA 4R90H 5DFWH 1HIMH 4IS6B 3OAZH 3G04A 4OLXH 1P53A 1E28A 4UV7L 2IQ9H 4YDLB 3HNVL 1K6QL 32C2B 5CMAA 5EU5B 3GMRA 4HWEH 1YC8A 2VDPH 3X11B 2ZCHL 3EGSA 2VDQL 2YUZA 3LMJL 1N3NB 3QDMD 4UT7L 3LEYH 2VDLL 5IMLA 4N5UA 3GSUB 5CZXD 3SOBL 3WIHA 1V7NH 5KOVC 3W9DA 4PGCA 4YFDB 4ALAH 5C2BH 4LGPB 1DANU 4Y4KD 1QVOB 4PGEA 5JTWA 3NH7L 1R3LA 2NY7L 1K8IA 1NCDH 1N4XL 3RHWF 3L7EB 3VXRB 1WF5A 4WW1B 3IF1A 5J4MA 4NBYB 4RGOH 1A7PL 3R0MA 5IIEB 1NANH 4U1JA 4XP1L 4G7VL 1Z3GL 3D69A 3O9WD 4I3RH 1UXSB 3LKQA 5TQ0H 4D94A 5L2JB 1JF1A 4LSDA 5IHUH 3CXHK 3HFMH 2X1QA 1YPZA 2PYEE 4JRYB 4AIZA 4F9PA 4EVNA 4FP8H 4L3CA 1EEUA 2Y5TB 3F6IA 1A5FH 3BPNC 3S4SA 2COQA 4LF3A 4LU5L 5EORH 1BVZA 3WO4B 3GJFH 5ADPH 15C8H 3MRLA 3V0VB 2DIJA 2AW2A 3VWJB 2YEZA 3MLSH 2ZNXA 3VFRB 4X6FA 1P6AB 5ID1B 3K74B 3MFFA 4KK6D 1RZJC 5F6HJ 1JK8B 3CVHL 5KSBF 1IL1A 4K2UH 1NCBL 3BFOA 2XWBA 4X99A 1J1OL 3RA7H 3SQOL 1N0LA 2LVEA 1IEAA 4JKPL 5JDSA 5T1MA 3FAXA 1TCRB 2XZQL 1KN4H 1I1AC 1ED3B 5FDWB 2P8LA 1WCBA 4XC3H 1LEKB 5E9DB 3JXAA 5D2NC 3TA3C 5H8DA 3SDXA 3VCLA 3B5TA 1UWXH 5F3BA 4NQXB 1T5XB 1BEYL 2V7HB 1T1XA 4KROD 4NKQB 1HHKA 1B9ZA 2DDQH 3DX9A 3PWPB 4XNZB 4K8RL 3TJEH 1DQTA 3WHXA 1N5YL 2ZUVA 3MREB 3UTSE 32C2A 4OBSA 4JLRA 5FGCB 1T0MB 2EXYC 3N0PB 4MYWB 3Q5TA 2EZ0C 3DX8B 4QF1B 3BI9X 4E41E 4M1DL 4MB4A 1WWAX 2NX5A 3FT4A 3FONB 4I0PA 1FGVL 3TPUA 1C5BH 2BSSA 3O3DA 4G8IA 3HCVB 1A7OL 3CFJA 1R3JB 3DI3B 2HMIC 1I9JL 3L7FB 1KJ3L 1FGNH 4NGHH 4LBEB 4GG6A 1XR8B 1A6AA 4HWZA 4AEIH 4CUCA 1AQKH 1B2WL 3MV01 3O4LB 1DTUA 1IGTB 2BNRB 1RUML 4DGVH 4ZAKD 3H9SE 3ZT7A 1GJIA 2BC4B 5CCKH 4F58L 5HI3D 3MODH 3V6FA 3DO7A 1O5DT 4IRZL 4KJPC 2NXYC 1MIMH 1MFCL 4X8JA 3GSRA 3WE6B 5F9JA 1OSZA 3RAJH 3DTXA 5SWSD 4YHZL 1AGFA 2LFGA 2C3HA 5FO7A 2VDKH 3D18B 1D5ZA 1BX2B 4XWGL 3FN0L 1ZLUK 1PY4A 5GGUA 1U58B 2DB8A 3KYMB 4NFBA 4BK5A 3OV6A 4NO3A 5IGXL 3BPOC 3IRPX 3VXOA 4MZ3A 3KDMA 3C6SA 3LH2L 1PZUB 1EDQA 4NHCL 3GSNA 3UC0H 25C8H 4HKZB 3MRGB 5BZWB 2PN5A 4R97C 1U8OA 5TE4L 3T0WA 4GG6E 5ITBH 5J3HD 4YHZH 5HYQA 3SJVB 2PR4H 2XN9D 3BQUB 1D6EB 2GJZA 5C0AD 2YUVA 1MI5A 5CEXB 1T7YA 3KPRA 4OZIE 1J18A 2NY1D 2P8MA 5D4QA 4QHMB 4LPWA 3RY4A 4U1HB 3PP3K 1QR4A 2YR3A 5E94A 3QEGH 1AI1H 2I60H 3F6LA 4ZOAA 1HHKB 3PWPA 4L4VE 3S3JA 2VDRL 1S78D 3GI9L 3SKOB 2AKRB 2XZAH 2WUBH 3K4ZA 4PJCA 1CXEA 1FLTX 5D2LE 1IBGH 3GMMB 5KSBB 4KU1A 3C2AH 1BGXL 4TUOB 3U4AA 3QUKB 3UPRB 5HYEA 4JJ5B 2X4SB 3KXFA 1F6FB 2OZ4H 4JCLA 5DR5L 3MYJB 4PJHA 4U2YA 3NCYP 4M1CC 2JLLA 3MNVA 4QF1A 3EAKA 3PABA 2ATPB 4DUVA 4K3HA 4J4PA 1JL8A 2W0PA 1MRCL 4GXVH 5F1IB 3WFEH 4G6ML 5L2KB 4AL8L 3QWRD 4PJXB 2BVEA 3OHXB 4KK9C 1TTGA 2PCPA 4KRLB 2ADIA 2DLFL 3AREA 3BYYA 4JY5L 3O6FC 3ARVA 4I5BB 3BKCH 1C5CH 1A2YA 2FH8A 4PJDA 3QUXB 3ALXA 2PKDA 4TNVK 1UJTA 1J8HE 1MJ7H 2V2TB 1AP2B 1BQLL 4LPYA 1PG7L 3UTZB 4JRYD 1RHFA 2W9DL 4P4KA 1RJCA 3ZYIA 4Y5XA 4ODUB 3OGOE 1A6ZB 5T5FH 3D9AL 4Z0BL 2HMID 2XTJD 2O5XH 4PRAB 3H3BC 1CFVH 5AUMA 4GUPB 4JG0H 3MRPB 5I1JH 5JW4Q 2VN7A 1CGTA 4W4OA 4O51A 4Z7WF 4MCZB 2NX5E 3T2QA 4NO3B 4WHDA 4Z7QF 1EJ6A 4XZUA 4M48H 3S37H 4M1CD 4H1LA 4KV5E 1EUTA 5TDOA 5HI3C 1C5DB 5CWSB 3OKDB 4WWKB 2AV1A 1MIEH 1RUKL 2FGZA 5T5FL 1FNFA 3WJLA 4XCCH 1K2DB 1SYSA 1KBGH 2IEPA 5KSVA 1KJMB 1EO8L 2WWKO 4LKCB 4PJHF 1FDLH 5L2KE 1MAJA 1OY3B 1NPUA 2QJDA 5C0FB 2FX8H 4HV8B 1PYWB 3SGKA 1G1CA 1X5KA 3BP6A 3TJHC 4MNQB 2GY7B 3AMLA 2UWEB 4PRPA 4YGAB 3W9DB 35C8L 4EBQH 1WFUA 2CRMA 4FTVE 2RCSL 4K9EH 4WFHE 4IMLB 1T1XB 1NAMB 3RVTD 4RAUA 4OKDA 2ADJB 3MRGA 4GXUM 5D2NB 2ZUTA 3VXRE 1E4KC 3TNMB 3SPVA 1S7SA 5EG6C 5FUZL 4AL8H 1YEHH 4OCRH 4M3KB 3KR3H 4K23L 4ONHB 4L9LC 5ABDE 1M7IB 2CRZA 5D2LA 1FZKA 5JA9A 5E8EA 3L3JA 1KLGB 1ZHBA 4KRPB 2VDNH 1DL7L 5E2JA 5I6XC 5MP6H 4H8WL 2FB4H 4F80A 3C5ZA 3T0EE 5E8DH 4MD5A 1FAKT 4GBXC 4NHUB 4XNXH 1QA9A 2X4RA 5GRVL 2CSPA 4OZIA 3HG1B 1NCCH 2FH6A 2XZAL 4P48A 2F5AH 4NWTH 5DMGC 5KW9H 1OM3L 3IGAB 4Q9BA 3BISA 3LSOA 4LPVA 4LSQL 3EZJB 2J8UE 1JNNL 2XZCH 1LO5B 4AEHH 1GHFL 1XF3A 2OR9H 3EYOA 5CGYC 1CFSA 2OX5A 3KYAA 4H0GA 1AD9A 1D9KA 2XWBB 4GXUN 4O2EA 1XGTA 3PQYE 5C71A 1I4FA 1JTOA 5C08E 1QHPA 2MOVA 1KCSL 2R0ZH 3QIUD 4OTXL 4G8FA 4YK4B 3BPNB 4OLZL 1IKNA 4N0UA 2R9HC 1EBAA 1FZMA 1ZT1A 3QDGB 4TSBL 2H9GA 5J3HC 1XGPA 5CJXA 1U8NA 1YMME 4PJ7F 3UBXA 1JUFA 1CFVL 3VE0A 1CGVA 5M7QA 3T8XB 4MCZA 2GJJA 3QAZB 1FE8H 3SDAB 2X70B 4MD0B 4WFGE 4OCWL 3SJVD 3GKWH 5FFLA 5FECB 2KH2B 3DWTA 3MUY1 3J7HA 4TYUA 5DJXB 1S78C 2GITB 4MQ7A 3P2TA 1G7LB 2XPGB 5CIPH 5DLML 5LKNA 4ZXBD 5I1CL 1RD6A 1MHPL 3G6JA 5BQ7B 3TA3B 3UROR 4F3FA 4CRPA 3QHZL 4XP9H 4TQEH 1P9MC 3MBEC 5C0FA 3PIQA 1JIBA 3MOBL 1X5GA 3MUGB 1AQKL 3HCVA 1BIIA 4G5ZH 2P1YA 43C9A 1J05B 5INDB 2AKRA 1WIOA 2AERT 5EBMA 3E6HA 4U1NB 3B5GA 5FYLL 1SVCP 2DM7A 4FQHA 4YHIB 2XY1A 3EFDH 1QHOA 5ICXB 3N9GH 4HUWA 1NAML 4OT1H 1U2HA 3MLYL 5EPMB 5FYKH 5IEKA 2OLDA 3VMOA 1FFPA 5T1LA 1NGQH 3CAFA 2X89A 1JHKH 2GSGB 5DTFB 4OZIB 2ZG2A 1ZSDB 5E9DD 4WO4C 1J10A 3P11H 2LU7A 1PX3A 4Z7UE 2E9WA 4YIQB 2ZSVA 1Z9LA 1CT8A 5IFAH 2R0KL 4HH8A 1KN2L 2XICA 3LOWA 5C07D 2W65A 3H7BB 3PWUA 4Y16B 3VFWA 2YRZA 2B5IC 4DW2H 1B0GB 1Q9OB 4HBCH 1P4LB 1JPGA 1KN4L 5JW5A 1NUFA 1WFTA 1X7QA 3MRMB 2VXSL 2CDFB 5EOCL 5DJZB 3KYKL 3N1MC 2YPLB 4RMSA 1NC4B 3DMMB 3O6KH 4G7VH 4DTGH 2ED7A 5D1QB 1AGBB 5DUML 3FOMA 3TYFA 1MVUA 4PJXA 3U6RA 4FFVD 3SDCA 1CXIA 2WIIA 1OP5H 4L1HA 4WI2A 2Z35A 3QDHA 2IFFL 3EHBC 2CJUL 1P4IL 4KY1L 1A5FL 1ZWIB 2JIXD 1NJ9B 4UQ3A 1T5WA 4P3CH 4XC1L 5MEQB 1T03H 4PTTB 5KS9B 3MMEA 5EZJA 1U8IA 3RVXD 1S8DA 3ZL4H 3NFNB 4JKWA 4JCMA 1AO7B 5ALCL 1GVIA 2WNGA 3BZ4B 4H88L 2IBGA 3BKJH 3T8XA 2NLJA 5I8EB 5FKPB 1ZANH 2IH1B 2AXHA 4LCUB 5L2KA 3RIFF 5JOFB 2BZDA 1T21B 3VXUB 5LXGL 2A2QT 3OKMA 3MLXH 5IR1B 2YC1A 1VSCA 1R0AL 2GYSA 4HQQH 1OP3K 4PJ5D 1RIHH 1CXFA 1RIHL 4LAJH 5DLMH 3M17B 3G6AA 1RURH 1TZHA 4Z95L 4ZS6D 3T77B 3TH2T 3LQZB 4NNXB 1L7IL 3HZYB 3SO3B 4M4RA 5AYQA 4OQ1A 1TJHL 1DJSA 3LV3B 3KJ6L 4K9EC 3C2AL 4ZSOA 2YKLH 2LTQC 3ARBD 1I7TA 4I18A 5KVDH 1C1EH 4ODHH 2GSIA 2VLKB 4RMVA 5DGQA 3RWCB 4KK6C 3V8OA 4C56B 4DQOL 4DKAA 3QIWB 1J0JA 3EYQC 3WS3B 1ZS8A 2Q76B 1U9KA 3UBXG 1KEML 1LILA 2MPAH 2PW1A 1D5MB 2YBRB 1KCSH 1RJLB 1DQQB 2DQEH 2JELH 3ZHDA 4RFEB 2AABL 3IU3B 2MMXA 4IJ3B 5DC9B 1J1OH 2PYFA 5FYKU 4HHAB 4U6HB 1J88A 3GMLA 4QHNA 4ONHA 1T04A 3BVNA 3QIBA 2E7CA 4LVEA 3MXWL 5GS0D 2NW2B 1ZLVK 1OW0A 3S88H 1KXTB 2P48B 4JPIB 4GKZB 1MCRA 4X9BA 1INDH 5I2IB 3VGHA 4NQCA 3FFCD 4P4KC 1MFEH 4OGXH 4K3JH 1MHEA 2HLAA 4YHML 1KTRL 5ID1A 2FX9H 5L7XL 4I0KA 3GRWH 1X9QA 5FO8B 2Q3AA 3HMWH 3KPMA 2MKWA 4NM8H 4BSWB 4APQB 1QD0A 4R4FH 1CDJA 1D7FA 3LSOB 4G6KL 1YJDH 3L5XH 1JNLH 1IGFH 1T5WB 4N5EC 5D70H 1PJ9A 4D3CL 3ZYJA 1HQ4B 1IM9D 3KVQA 3TYGH 4H5SA 5TGBA 1UWEL 3WSQL 4WI3A 1C08A 3S3PA 4CDHA 4F15C 3QULA 5D1ZB 4Z5RA 2ESVA 1OGAE 4NCC2 1A64A 1R6VA 2AK1L 1GRWA 5KSAD 5E2VL 2Z31D 2MCPL 3MBEB 3IDMA 1KTLB 4H8WC 1FNGA 2L0DA 4HEPG 1OAQH 2ORBL 1KJ2A 5IMOA 3UBXB 1G0XA 2VZSA 1A6TA 1U3ZA 5I1IH 2PTTB 3QO0B 3F7VA 5MHSD 4YHIA 3UTSD 2NXZC 4D9RE 4WJ5A 4MJ2A 2NW3B 4K94L 1UWGH 4IIQA 4R3SB 2LABA 5B8CC 4XAWL 5EU6A 1S9YA 4GW4A 4NWUH 3WN5C 2EDXA 4NC2B 2VLRD 2BVPB 1ZHNA 4ODSL 1GAFH 5GS2D 2XACC 1CDHA 3BQUD 1BQHG 3FB8B 4Z7VB 3RWIA 4QRUA 1I8KB 5D6CA 5IK3B 3VD3A 5T1KA 3D69B 3EYVB 2QBWA 3ARGD 3FZUD 4LLMB 1OARH 5I1KH 3G08B 1P84K 1AJ7H 1I1FB 1JK8A 1KGCE 1UVQB 4OLUL 1E27B 2BVYA 1TNNA 4UIMA 4XX1G 2BDNL 3E6HB 1UCBL 1VGKA 2OL3B 1JPGB 3DPBA 1J8HD 4LLQA 5ICXA 4WI6A 3B43A 3V0AC 1H15A 1LP9F 3QUYA 3ZE1F 1S9XA 3RU8L 1UM5H 5I1KL 1T0NA 3DI2B 4K7PX 3DV4A 4HC1H 3R06A 5HHMB 3OSKA 3OF6D 4RFEA 1U36A 3DX6A 1E4XH 4LVNB 4GQPH 3RWJB 1ACZA 3U6RB 4M62H 4PS4L 1WITA 1KB5L 3SDXF 2MHAA 5CGYD 4QRPD 4M7LH 5F7LB 4BSJA 4HS6B 4P2CG 1T3FB 4NQDA 1L0QA 3VI4F 5A40E 4N0CD 4LSSL 5GS1C 1N5AB 1U8IB 1JWMA 5DWUH 3VFVB 4MA3A 4K07A 3D3VB 1X44A 3D0VA 5EUOE 3L3GA 1MLBA 4MAYC 1RUPL 4W6YB 4ZODA 4Y1AD 4IRJB 3TCXA 1WIUA 1FORH 2EEAA 3QDME 3ARBC 1MQ8A 1HH9B 2HJKA 2Q8AL 5C2BL 5EIIA 4XXDB 3FQXB 3O3EA 4FQ2H 4X98A 1MCNA 3MXVL 2PR4L 4R7DB 1AGCA 2Z35B 5F88A 3VGDA 1VERA 4C4KT 3CPLA 4ZXBC 1Z9MA 3P40A 1T22B 5ICZB 4KZDH 1JPST 2UZXB 1CDIA 5HPMA 5HGHA 2FL5A 4PJGE 1Q9LA 3T0EA 3QQ9C 2YRLA 2J4WH 3OKKB 5KJRH 1A6VL 3V6BR 4ZTPL 5CJ8A 1CGYA 4J3SA 2JB5H 4PJDE 2YD8A 3DVNB 5HHNA 4H1LH 4N8PA 2NY5H 4OCMC 5EO1A 5GRJH 2WIIB 5ANMB 5IMKB 4LCCB 1DLFL 1FRGH 3U36B 3QPQD 4WO4A 4M48L 4WUUA 4BUGA 4L9LB 5C0IB 2PYFB 1UZ8A 4Y0GA 2AGJL 4JN1H 1FSKB 3V6ZB 1ZAGA 3NGBC 2ILLA 2NY6C 2XA8H 1A7RL 3WBDA 3REVB 5GRJL 2F9BT 3K1DA 1ZLWK 5L8LB 3SBWC 3FQTB 1HOCA 1FFOB 1YYMH 3UDWC 4APQD 1RZIA 5C0RL 4QHKJ 2UYLB 1YY8A 4Y5VB 1L9MA 3EJJX 4MNGA 1OD9A 2W9DH 5T1DL 4Y89A 3UMTA 3GHBH 2ADFL 3EDDA 2IQAA 3ARGA 2EYRB 2NY3D 4PJEF 1S9XB 3VFUB 5LCVL 1TZHB 3I9GL 4KQ4L 5I19H 3TEUA 3I50H 4F7MA 4QYOA 4OGYL 4U6HA 2O61B 4MA3B 5BZWA 3RDTC 4NJAH 4RISL 4XPGL 4XPTH 3PHSA 2ADJA 5D2NA 5HSFA 1YEFL 2PNDA 4N8VA 1ADQH 2J6EH 4OIIL 4TNVF 5EB9A 2OSLA 1S7RA 1JP5A 4F15B 2CK0H 2NY4C 5ECJE 3UPRA 2CIIB 3BEVA 4M9PA 5F93C 1U93B 2DTML 3BQUC 3HC0B 4OCYL 1RJLA 1F4HA 1WQVT 5TPWL 3G5XA 3F7VB 4LSVL 3THMH 4Y5XB 4DAGH 5FYJH 1ODAA 4HIXL 4XVSL 2ESVE 4P59L 4JFPB 1V8HA 5HHOB 2GTWB 1U8MA 1D6VH 3Q48A 5F7EH 4IMKC 2IAMC 2OTPA 4YGVA 1FCGA 4QTIH 4WDIB 3X13B 4JVUA 1FLRH 2XQBL 5FM8A 1SJHA 2V17L 4I0PC 4JDZA 2GK0A 3U4BL 5T3ZE 5F7HA 4WFFE 5E8NB 3K80A 1I85C 2Y25A 4BSVB 3D85A 4GKSB 5T33L 4NKIH 3GB7B 2BVQB 3FFDA 1RJZB 4FQQB 3IDNB 5ITBL 5DD5L 4KJPD 4GS7B 4NDMB 5J8OA 3HR6A 1JWSB 1G9MC 2IG2H 4OD1H 1LEGA 1CDCA 4LIQL 4RWYL 3NFSH 4L8SA 3BPCA 2JCCF 1YEGL 3OAYH 4ZS6C 3ECBA 3RUGE 2E8ZA 2X4SA 4C57C 1MFAH 4UU9A 5DRXB 4NQCE 4G6AD 1GGBL 3MRFB 3GDBA 2B0SH 5GGQL 2KPNA 3N1PC 3CU7A 3QI9B 1BWMA 5IFAL 2PXYD 4X8JB 3VFSB 4V2BA 5J1TC 3EZ8A 3QIBC 5F9WB 3KLHD 1I1YB 4MSWA 1WBXB 4RCAA 2IADA 3B6SA 5GGSY 1NUDA 3FRUA 3TBWB 1ES0A 1SEQH 1V3JA 1U8KB 5C08D 4HXAL 3U48A 3HMXL 3EFFA 4CU6A 4YQXL 4UUJA 4LVNC 3ARFB 4JDTH 4HUVA 2GAZA 1CLCA 1JGEA 5GS0C 1I3VA 4OKVA 4Y4FB 3L3HB 3DV6B 4Y19A 4NP4H 4KQ3H 3MLTA 4KVNH 1J11A 4S1DC 2NNAA 3IFPB 4HUUA 1MJ8L 2R4RH 3DMMC 4XPGH 3LPFA 3S96B 3EOBA 5GGTL 3WNMA 4P2RD 1U8QB 4P5KA 3QRGL 4WEBL 5JXAL 4U1NA 1HSAB 3D1MC 1GIGL 3MOAL 1NDMA 4JN1L 1P2CA 3B5HA 1CFSB 4OD2A 4U1MB 3O6MH 3BMVA 4W4NA 5CJBA 3LN5B 5TF1L 4D0CB 4RA3A 4W68A 2HFEA 5FGBA 1RMFL 4YBLB 4N8VG 2A0LC 1G9MH 4XB8A 5KSUA 3OG6B 3U7AA 4V1DE 5C0RH 3SCMD 5KVFH 3DETD 3ARDA 4FZ8H 1OGTA 4J4PC 1HHIB 3TA3D 2BOBB 2Y36L 4M7ZB 4MDIB 5FK9B 2WSKA 3CZFA 3M1BA 1DP0A 1GYAA 3BSZH 1MLBB 2EIZB 4GW1B 4XCEB 4EN3D 5IG7A 2AGJH 5FHBL 1RZKL 1I9RH 1RPQA 2HVJB 3BOVA 1HE7A 2ADIB 5I1HH 3RZCA 1NFDB 4FQJL 4IRJD 5DQDL 5K9JL 2ICCA 4U1IB 4LHUB 1I4FB 3E3QC 2C3GA 5C09A 3FCTA 1JI2A 2R69L 2XPGA 4Q7DA 4EQ3A 4H20L 3MGTA 3G6JB 4QXUL 1JHTA 3T4YB 4QRQA 3UTSB 4GKSA 3D85B 1LO5A 1M7DB 1YN7A 5ICZA 3X3FL 2XWTB 1U8PB 2ZUQB 3G5ZA 1ZT4A 1TVHA 2WV3A 4KZEL 3T2PA 4MDJA 4PP1D 1XF5B 2W59A 4LLWA 4XPBH 5DD3L 3NPSC 4HPYH 1J0HA 2HG5B 2NR6C 2EDBA 5DVLA 3UEZA 1EVTC 3MRFA 3ZDYF 1UB6A 2X1WL 4JZJA 2R1YA 4OI9A 5L0QC 4YK4C 3GHEH 1MCJA 3MRRB 4H26B 4YPGB 4KJWD 4X4YB 2R1WA 5DC0A 4LHUG 1MRFH 4U2ZA 4Z95H 3WJLC 2JELL 4MQXD 5SX4I 2KBGA 4LRIC 4OCRL 1HDMB 3DUUB 2P8PA 1JZ5A 3KPQA 4A6YH 1NAKH 1YMMB 3RZCD 5BV7B 4NQDE 3ZKMD 3C5JB 1ZTXH 5ACMA 5TPWH 4G9FA 2Z0BA 4ZQKA 3T08A 3MA9H 1MCEA 2QADC 4KFZC 2RCSH 1S7RB 4YDKL 4G6JL 2JE8A 4IDJL 4IDJH 2J7LA 4YR6A 2ZCHH 3IDGA 1A4JA 3PWNA 4I4WB 4L8BA 4MD0A 4P5MA 4Y7MA 5D1XD 1MCPH 3EIFA 1MCFA 4KAQL 1T1YA 3H3PL 5CMAB 5IKCA 4J23A 1EFQA 1JJUA 1FL3B 2XI9A 4OF7A 2X4TA 4HUXA 2X4QA 3ARBA 3OB8A 3KHQA 4OZGB 4RBPK 5DMGD 5JA8B 1JNHB 4W81A 3LPGA 1M7IA 5D7SL 3LPWA 5BMFL 5BOZG 2QSTA 3CH1B 4X6EA 3AS1A 3WCYA 5D7KD 3WIIH 1N6UA 3KPOB 1EAPA 4K7FA 4M7LT 3ARQA 2X4PB 1KGCD 3QHTC 4P3DA 4N0RA 3O6KL 3T0EC 3PF2A 1E6JL 2Z92B 3VRLF 1GOGA 4IRSC 4NQED 2ICWA 1UYWH 5KSUB 4GOSA 5EU5A 2NZ9C 4YC2B 1G7QB 1HEZB 3BUTA 5DS8A 2CD0A 3DSFH 5SWZD 3NFSL 3V7AG 3WHE0 5I73C 1HKLL 2DKUA 3ALPA 3WFDL 1QLRB 2QQLL 5GISL 2WIMA 1F6AA 1PGRB 4HCRH 1U6AH 2X09A 4UZGA 3WN5B 3PWLB 1X5LA 1KJ2L 2NLJB 2HT4D 1AE6L 1SBSL 2DI9A 4WO4D 4WUUD 3V4UL 4LSRH 2Y72A 3HS0B 3QIUA 1YEKL 3BKYH 3QWRA 2XQBH 1HH6B 5JLZB 1MEXH 4R2GB 4TSAL 3X3GL 2Z8RA 5DQJA 5DVMA 5A2LH 2VRAA 5B3NA 3QR2A 2ZCLH 2FYYB 4XMPL 4YWGH 4UQ3B 5DDHA 1QFWH 1HINH 2FBOJ 4IEFB 2H9GB 4JPKH 2V6HA 2ED9A 5I17B 2YUXA 3SBWA 4DKEH 5E2UH 4KTDH 3SDCB 4FZ8L 3FMGH 4HC1A 4IHOA 3DYMA 1IGJB 5IW1B 4FQPA 4JKMA 5C0CE 4R9HA 3DRQA 1R3KA 1FIEA 5L0QB 4GG6B 4KZEH 1TNMA 2OBGA 2X7LB 4UQ2B 5EBLA 5GIRA 3F65A 3MV9B 1IEBA 2D4DA 2HRPH 4LP4A 4DGYH 2OJZL 2WUBL 5BW7C 1QG3A 4DZBA 1E6OL 4S2SA 4OGYH 3BP7B 5C7XH 4PJFB 4MXVE 5I76B 2B4CL 2LU3A 2UV3A 2X05A 3SE4C 3AY4C 4M7JL 3QRGH 4J4PD 3MFFB 4ZTOH 2BOCA 2FWOB 2BERA 2AQ2A 2HT4C 2NXYD 1QFUL 1MCWM 1U3HC 2P5WD 4WEUD 5HVHC 3U7WH 5B39B 3QO1B 1TZIB 1RHHB 5TE4H 5GS1B 3QP3A 1BJ1J 2DQUH 3QNZA 3BQUA 4YDIL 5DJ8A 3NACL 4PP2B 2BMKA 3EHBD 4PJAF 4L3CB 1MAKA 4DQOH 3EOTH 2PTUA 1DBML 2ED8A 1MFDH 4U4BA 4JFFB 4XBEL 1IC4L 1S7WA 3V52L 5F3HA 3ULSB 4HJ0C 5DHXB 5GRUL 4RGNC 2YEZB 5F7YC 4WFFD 1RZFL 1D6EA 4JFYB 1I85A 3G6AB 1IAMA 1MI5B 4WGWB 3HI1A 3V6FB 2EDLA 3ARSA 1CLZH 3PQYD 1FSKC 5IT2H 1YQVH 4OKVB 5DQDH 4Y4FA 3U0PB 3BN3B 2ESVD 3P73B 5E6ID 4JFEA 4OM0L 4P23B 5CP3A 3BRGC 2I25N 3VD7A 5C0CD 4QHLA 4LF3B 1XCTB 1X4YA 3QHFH 4JFOB 1OCWL 4WI9A 1TJIH 5DYOB 5EO9A 3P9LA 1GGTA 2CO6B 2FJHA 1DEDA 1I9JH 3O9WB 3WXWH 1A6UL 2DKSA 1HSAA 2FYYA 4CVWA 5HYJA 4NUGL 5K93A 3L6FB 5FOBB 4ORZC 2IBZY 4YHOL 2PYED 1G84A 4JFZH 5J06A 4LLYA 5D8JH 4XPHH 4XPAH 5C0JB 2D7MA 5F96L 3AB0C 4QTIL 5I1LB 1TXKA 3ARED 2EDRA 2EE9A 1JPFA 3FKUS 4MB3A 4JHZA 2R4SH 1NLDH 3QCTH 3SKJH 4R0LB 4F8TA 1VB9A 3QRFM 3MMEB 5EZJB 1Z9SA 1I3GL 3V2AR 4NWTL 1GCFA 2DOCA 3TJEL 1IGMH 2BRRH 5D1XB 1SJXA 5E5UB 5FB8A 3AM8A 2WINA 3VXPB 3QG7L 4Z5RB 4U1KB 4X6DF 4I0PD 1YEGH 2O5YL 4Z18A 1J0IA 3NCEB 1P5VA 3LKOA 5L6YL 4XPTL 1HXYA 1P5UA 1SYVB 3LEVH 4OJFH 3ZYZA 2A9NL 2R2CA 1D5BA 4Q74A 4MJ5A 4M62L 4PS4H 4WHTB 1CFTA 5IHLB 1HHGA 3K2MC 1NGWB 3CH1A 3ZE2F 2VAAA 2FR4B 1BECA 3KPQB 3OHXA 5D7JD 1X5JA 4P9MH 5IM7B 1TQBC 4JFFA 15C8L 3TT3L 4OGAD 5EOTA 1I1CA 4OM0H 2NXZD 3NIDE 4ZFOA 2MSPA 1J0YA 3KPSE 4YHMH 1RI8A 1PX4A 2PF6A 4NCC1 4NO0B 1A4JB 4P5MB 2DM4A 4GT7A 1EEYB 5CZVL 1BQSA 3KXFD 3ULUH 3BP4B 4GJTB 2P44B 5GRZA 5HYSA 5IVZB 4G7YL 1BHGA 4Y4KB 5TF1H 1RJYB 4RQQA 3PABB 2X4TB 1P7KB 2V5TA 3CVHB 5BS0B 4RISH 5D7IE 5JQ6H 1MY7A 3J8F7 5EBWB 4J6RL 3RX8A 1OW0C 4LLQB 3D18A 1ETZB 5FO9B 4NQVB 1N59A 1E4XL 1IMHC 3KPRB 2X9XA 2P49B 5GSVA 3S37X 3NIGE 4HAGA 1XZ0B 4NO2A 3KYMA 5D2NE 1WBZA 1N2RA 4N5ED 4PJDB 1UVQA 3D9AH 3OKNB 3QXTA 3BRFA 1EEZB 4HMCA 4QOKE 5DFVD 3C5ZD 5CBAB 4X6DA 3KPLB 5CD5C 4ZDHA 1IAKA 1DQML 3TIDA 4DFHA 1OAQL 2ORBH 3P4LA 4O2EB 1DBAH 4TUOA 3BGMB 5IQ9A 3KPPB 4ZUSB 4P2QE 1HILB 5JR1H 1KIQB 1ZT7B 1BVKA 3QDGA 1V7MH 3U46A 3GSOA 4X7SL 1AI1L 3MV8B 5TE7L 3R0NA 3NZHL 4L4VD 4LRIA 5DZLA 4PRPE 4ZUUA 2OJZH 3L3GB 4RIRB 5JLZA 1FYHB 3C09C 3ESVF 3AXLA 5LXGH 2NTFB 1HWGB 4NZTL 1G0YR 2J8UF 3QCVH 5C70A 3VFGH 7CGTA 1ZT1B 5HYSG 5H35B 1ZXQA 4GKOA 1MCBA 2NY1B 2JCCE 1B6UA 3BGFB 3U7YH 4GAYB 3MV9E 3W5MA 3TWCH 5LGJB 1I7RB 1U8JB 4G8EA 3WN5A 1UH4A 4ZTPH 3HA0A 3L3OA 3CPLB 1I3UA 5B21A 1T2QL 1FFOA 4YWGL 3SE9L 3IDNA 2P4AB 2FZ3B 3GBMH 1AY1L 2Q6WA 2BVPA 4M7LL 5HPMB 3QH3B 4KKCC 5FECA 3FN0H 3E8UL 5DJ2B 4EIGB 1YQ2A 3CFKA 3JV6B 1XR9A 1NKRA 4NQTA 1VENA 5EBGA 3VG9C 1NBYB 3VFUA 4FQHB 5I17A 3RVVD 1HHGB 4LASL 5HHNB 4EKXA 5JPNA 3V95A 3HE6C 3O41A 3HI1B 4KHXH 5JQHC 5GRUH 3NCMA 2ZOLA 1JYNA 2Y06L 1H8OA 1K3ZA 2FEEI 1BZ9B 1AY1H 3ULUL 1K2DA 1EO7A 2OR8A 4HKBA 1RJYA 3LKPA 3AMKA 3UXFA 2DTMH 1YEDB 1ZHKB 5DEGA 5B4MC 4WTZA 5D9SA 1XAUA 1XCTA 4JFOA 1KG0A 4XWGH 4L1DA 2VR5A 4XCYA 5ICYB 3TT3H 3IJSA 4OGXL 3OG4B 3PUCA 4QT5A 3QPQC 4LKXA 1I75A 3CVIL 3R06B 5JW3L 4WCYH 4KWUA 3Q2CA 4P2OD 3NABL 4I9WD 3UTTE 4Z7OF 3ZMRA 2VMFA 1II4E 2YUWA 1CZ8L 2GTWA 3NZHH 2VZOA 4HKJB 4F9PC 4MNHA 1GGIH 4CDGC 2LU4A 4E0RA 5TDPA 1HNGA 4U1GB 4KHTH 4NBZB 1HKLH 1AIFB 3GUTA 1BZQK 4OFPA 4HZAA 4OFKA 1NLBH 2JCCB 2F8VA 2Y36H 1RIVH 3K4AA 4CJ0A 4ELME 2QHRH 3HC4L 5J9PB 5MHSE 3HZMA 3UTPE 4C58B 4QY8A 5JHLH 3TIDB 5C0AA 4QNPE 2FJFA 3QFDB 2JJVA 3BGMA 5IQ9B 3FB6A 3MRIB 1S7UA 1W0VB 3FRPA 3B9AA 4N90D 3KS0J 4PRID 4JGMA 1UXWB 1HINL 5JNYB 4HUWB 5HVHB 4NJ9L 3FOLB 1TDQA 3SQOH 4XXDA 3QQNA 5D1QA 4Y16D 3MRKB 2HRLA 3H42H 4ZXBA 1K8DA 3M8OH 4DZ8A 5AAMA 2VXVL 1NBVH 1X6LA 3WMSA 5FF6B 5D7JB 1A1MA 2OJEB 4NHUA 3RWGB 5KBNC 2DDQL 4LCUA 1X4XA 1BJ1H 4CL7A 2ZPKH 4MA1B 4IOFC 5CEYB 1NC4D 1PLGL 3CX5J 3CDYA 4JLRB 1WZ1H 3NCFB 3KYNA 2J12B 2XOTA 4BSVA 5I1IL 2XZQH 4N0UE 1ZLUH 1TITA 1N0XL 4YX2H 1OAZH 2HN7B 2D31A 3QQ4A 4KI5D 4L8SB 5JDJA 1RK1B 4RFOL 2FO4A 1HXYB 3HG1D 2X10A 2FBJH 1YNKL 4JFFE 5IVXF 4TVPD 2FEEL 1JZ8A 4U7SA 4QXTA 5BOPA 4ZSOE 3K7UA 4J8RA 4AG4L 5HHQA 4KJQD 3PXJA 5CEZD 5ICYA 2NX5D 4ZOEA 5HI4D 2AJVL 1MFDL 3KPSB 4L4VA 3TO2B 3UDWA 4XVUC 2QQKH 4LSUH 3KYKH 3LV3A 3AAZB 3DVIA 4D0DA 1QSED 1YJDC 1MCPL 3D39E 3RP1A 4UT7H 4QOKD 1MPAH 1FIGH 1Q0XL 4P3WA 5KANG 2Z91B 1P7QA 3HLAB 2UWEE 3IFPA 1IT9L 1ND0A 1UADC 4M6ML 3LKNB 3BP4A 1ZTXL 4UUJB 3QQ3A 5T1LB 2MCPH 2BFVH 2AJVH 3M07A 5D6DA 2OXHA 5H94B 1Y6NR 5EZOH 4OB5L 1NBQA 1NGXA 1PFCA 5I75C 3ULUD 4PD4K 1MCIA 2WP3T 1KNOA 4LLAA 3VXOB 2MJWA 1SBSH 3VXUE 1KLFA 1ES0B 2H41A 4X99B 5EO0A 1I8MB 4YO0B 1MJJA 2NTFA 1LQSR 2YSSA 3MJ9L 3VH8B 3O8XD 3PE9A 4X6FB 5MEQA 1YJDL 4OAWB 1FDLL 3HC0A 3HZYA 5CILH 2QSVA 3HNVH 2UUDH 3WDHA 4LLDB 3VWJC 4AEIL 2EH8H 1D5XA 4KTDL 4RQQB 3F58H 4XRCB 3SGJC 3DGGB 4PRBA 5ETUA 1FZOA 4I18B 4OLUH 1OAYL 1UB5A 3KPRE 1PQZA 3QH3A 5BCAA 3ZTJH 2C4FT 3VI3F 2VQ1A 2HH0H 2ICWB 4XAKE 5D1ZC 4GRWB 2DQHL 3QUKA 1T5XA 1DBJL 3BW9B 5LCVH 5HI5D 2P43B 4KRPD 3SE8L 1DQLL 4UV4L 2FD6H 1LK3H 4RX4A 3C60B 1BMGA 3B3IA 1Q9OA 4MVBD 3DJ9A 5HVWA 4XAWH 4XNZC 4NRXB 5C0ND 1G7JB 2XKUA 4PTTA 4X4XA 4Z7WE 3ELAT 4ZSOB 5C8JB 3BD5A 4QCIA 1I1AD 1FNGB 2WZPD 1AHWC 4OZFA 4LPXA 3VJ6B 3OKLB 3UBXI 1WLHA 4NQCB 1QBMH 3GSNH 3FO1A 3VH8G 3PV7A 4HGMA 5D6CB 3MV8A 4HSQA 3RQ3A 2Y23A 5HBBA 1X5IA 4X6CF 4P57A 1URLA 3CFJB 3MNWB 1C5CL 3TC9A 4JAMB 1VFAA 2ZKHL 4J6RH 3WIIL 3OKMB 3WFCH 4H25A 3A67L 5T3XD 3KYOB 4XH2A 1A6AB 3AAZA 1MRFL 1OTTC 3K4DA 2P7TA 5F1KC 2X4NA 3IFOA 4JB9H 5IF0B 1IZJA 1GIGH 3WFEL 2AK4A 5IJVA 2F19H 4O58H 1BAFL 4YHPA 3CFDB 3P3YA 5I6XB 4R0LC 3SHSA 4YPGA 3JWNC 1BD2B 5CP3H 1CBVL 2J3SA 2QKIB 1KT2B 4S2SB 3SJVE 4WW2C 1T1ZB 2IH1A 4QHUB 2WWKT 5E00B 3DTXB 4V1DD 4TVPL 1L6XA 4P23D 1JGUH 1AGEA 3RWJA 4BFIA 2DLIA 2R0WL 1MFEL 1G7MB 1W2KT 2YC1B 1BAFH 1QFHA 1U2CA 3BWUC 4YFLI 3QISA 3K8KA 5MENE 5I1GL 4FQ1H 2GW5A 3LN4B 5F1SA 4MNQA 4PRPB 4FQJH 1R3HA 1ZK9A 1P4IH 3LQMA 1F13A 4X5XA 5EU3A 2F5BH 1KC5H 12E8L 4G80B 5KN5B 1NFIA 4J3XA 1J8HB 1AR2A 4P59H 4UAOB 3OJVC 5TDPB 1ZLSH 1KPVB 1TCRA 3SGDI 3DGGA 4PRBB 1FG9C 2CDEB 5GGSA 5DVOA 2R2HB 1MREH 5DJAA 1B0WA 5EUOA 1GGBH 3ZT6A 3UTOA 4U0QB 4WFGD 2Z93B 1KTLA 4MAYB 3P0YL 4JO1H 3ULUC 4KTEL 4L8DB 1IGCH 1TLKA 3CSYA 2VISA 3RX7A 1A6TB 2D0FA 3O45B 3QXVA 5E08H 1LHZA 4LIQH 4RWYH 4CNIA 1GOHA 3OPZH 2VDKL 4FG6C 4NOBA 3QXUA 2I26N 2X4QB 3ARBB 4TSCH 4WGVB 3GMLB 5E2WH 5JIIA 3JTSA 2RGSA 2A6IB 1KB5B 4PRIB 1CDYA 1QSFE 4GRMB 1OWWA 2LAAA 5C3TA 4B5EA 3I75A 4MA7L 1HQ4A 2MTPA 1C7SA 1JV5A 4EI5D 2XN9A 1JHTB 3FQXA 3TBYA 3T65A 5D2LF 4YC2C 1S5HB 4FXKB 4ODSH 4IRSD 5J9PA 1TQBB 2AEQL 1AR1C 1VFMA 1VCAA 5CILL 1J8KA 2MQCA 4BSWA 5CFHA 1Q9LB 2AJSH 4D0DB 4YUEL 4OZIF 1D9KC 2DQJH 1A9BB 3H0TA 4JM2F 4MVBC 5HDBF 4G6JH 4G43B 4G8FB 1IZKA 2PTTA 3O81A 1IGTA 2BNRA 2V2TA 1ITCA 3FFCE 3DVNA 1M4KA 4G6AC 4KKLC 2DQFA 2AJZA 1H0DB 2WBJA 1A7QH 4LL9A 5B4MD 5T3ZD 1NAKL 1JZ7A 2OQJB 4CU7A 2V2XA 4EZMA 4CGTA 1MJUH 2ESVB 1N26A 3PHOA 3L5IA 5FXCH 2Y07H 2X70A 4IRJA 1J5OH 4UT9L 3C09B 4N68A 1IEBB 4LPUA 3KHOA 3EOTL 3H3KA 5D93B 2BY0A 4JFQB 4PLKD 3N85L 3QEHA 3TBSA 1HH9A 4RSVA 1HKFA 4OSUL 3KPSA 2R2EB 3MGOB 5DEFB 1UM6H 2G5BB 1A6ZA 1ZV5A 1OM3H 3PP4H 1MF2H 1YZZA 4Z76B 2W0FB 3CK0H 3HMXA 3HMWL 1CXHA 2HT2D 3ZTNL 1GC1L 1FL3A 3ARUA 2YD7A 2YXMA 1Q94B 2Q86A 4O5LH 3OKKA 1J0ZA 5I71B 2I07B 2RQ8A 4HIHB 4OFVA 2QQNL 1A0QH 4HS3A 2CGRH 5D1QC 1S7SB 1ORQB 1U3HB 1UWEH 3WSQH 3IRZA 3LVEA 3NTCH 2R0ZL 1H5BB 1CL7H 1LO0L 1YEKH 3BKYL 1FORL 1DLHA 5GGVL 1S7VA 4UT6H 2ICEA 3D5OF 1LO2L 4AQOA 1AGCB 4FS0A 2A77L 4IRSA 1P1ZB 4LSVH 4C55A 1TZIA 4DWHA 2NY4B 1ACYH 3VXSA 1VGKB 1CE1H 2OL3A 3CH8A 3CLFH 3FL7A 2VNCA 2F54D 3L3IA 5KSVB 1INEL 3QIBD 4M1GH 4C56D 4D9LH 1WZ1L 1LE5A 3NCBB 35C8H 4EBQL 4NN5C 2CUHA 2QSCL 3B2VH 1FZKB 4QRPA 2Z93A 4WUUE 3W5NA 5IMMA 2OK0H 4U49A 2CK2A 4HIJB 4JM4H 1I7UA 3FQTA 3OL2A 1Z3GH 3PWLA 4TSAH 5D5MA 5LQBL 5CZKA 1U41A 5C86A 3PWVA 4O58L 1Q1JH 1JF6A 2DMKA 4HG4K 4DJMA 3ULVL 3O6ML 5DRZA 1QRND 3A6CH 5LGHH 4EN3C 5DURD 3BP5A 1NDGB 3MNZB 3L95B 1ROWA 4KI5C 1U3YA 3I85A 1UM5L 4DN4L 1A14L 4Z78B 4FQXC 1BOGB 4LQFL 3TBYB 1W0WA 5D1QD 2VH5L 4CMHC 4P4KB 5IFHL 2O61A 4QRSA 4Q6YA 4DVBA 5E70A 1X5HA 4CVUA 5ETUB 1MAML 1KCRH 1KCRL 2CK0L 1G6RL 1F3JB 3SDCC 5BW7A 3L5WA 1A9BA 2M2DA 3L7EA 1J87A 3QG6B 4JO2L 5C07E 1FZMB 2VXUH 1CG9B 3P77B 4YBQD 5D6DC 5F72S 3EYSH 4WEMB 1BF8A 5KS9A 1QBLL 2APXA 3HB3C 2IJ0C 1Y18B 1CR9H 2P46B 2VH5H 5GSRA 3QI9A 4XC1H 4URTB 4M02A 3TO4B 3TA3A 1MWAB 2QQQA 2W60A 1OGAB 5D93C 2OM5A 1HI6B 4Y4KA 5EU6D 1BJMA 5IB2B 1QFWM 2FECL 2IADB 3ARFC 3BWAA 5KN5A 3IYLW 1T7VA 4MD4B 4OUUA 5B22A 1QSZA 5L8JB 3FT2A 4YHKL 3WLBB 1OTSD 4DK6A 3ILQC 1QQDB 3TGXA 2ZZUT 1VPOL 5EOCH 2X5PA 2WWMC 3B2VL 4P57B 4UNVA 1AC6A 2IMNA 2H2SC 4JFDE 3T04D 5ESAA 5B8CB 3ZE1E 2XWJB 2H26A 4PLKC 4Y4HD 5C08B 1FN4B 1FYTA 1QSEE 3D39D 3V8CA 4FQ2L 3MJ7A 3HZVA 5SWSE 2Q8AH 3SY0A 4HEME 4XNYH 4B41A 1Z0MA 2X6MA 4TNWK 5EPMA 3IKCB 4JQVC 1ZLVH 5EZOL 4BQCA 5JHDD 4GLRI 3CZFB 4DGVL 2ICEB 4OGAC 2BSTB 1CGWA 3MO1A 1UH2A 4KJYB 1N8ZA 4BM7A 3RVWD 3BSZL 4X7DC 3TBTA 2R23B 3HG1E 1NCWL 3O3UN 1SY6L 4AMKH 1XMWA 4LHUA 3DBXB 4KI5E 4WU5A 1EO8H 1U93A 3ZKMC 2ENSA 4PD4J 4OZ4A 4TUJA 3HNSH 4GKZA 1QFPA 5CKGA 2W65B 5EOQH 4UOJA 4KK9D 4HFWA 2HLAB 1OLLA 3RRQA 2WBWB 3MPCA 3QEGL 3O4LD 3B9VA 1T83C 4FA8A 3X3GH 2DQEL 5HD8C 3QPXH 2PETA 2VLRE 4OZGE 2V2WA 4JPVL 4YXKL 4M8QB 1S9KC 5E6YA 3T4YA 3AM8C 1BBDL 4XPFL 5FYKE 1LD9A 5E4EC 5BV7L 3UO1L 1RULL 4ZDHB 5MENB 1BZ9A 1F3RB 2Z4QB 2XRAL 2VDPL 2W9EL 5CD3A 2DBLL 2AQ3A 4OF0A 4Z77B 4K3JL 5JOFA 4MX7A 2YD6A 3LZFH 1T1WA 2CUMA 1C5BL 5GZOC 2VWEC 4JQIL 4K8RC 4DN3L 3NFNA 1MEXL 1C16B 4PV9B 1BF2A 1YNLL 2R39A 1NBZB 2M26A 1VFOA 4MJ6B 3PIQB 1IQWL 4XVJH 3ZHLA 3IS1X 1MJ8H 2R4RL 3VFPA 5HGAB 3UJTL 5I0ZA 1FNHA 2FZ3A 3O4LE 4RMUA 2NY4D 4LOUC 3VXRD 1K3IA 1ZGLM 1BM3H 2XRAH 1U8KA 2EIDA 1XF2A 4WFHD 2H26B 1OQXA 1FZJA 2RBLA 4K8RH 4Q2ZB 1WAAE 1RZJL 3T0BA 2IANA 3HB3D 3MLVH 1WBYB 4ZO6A 1VGEL 5HJ3B 4OZGF 1AHWB 1JN6A 3VXSE 5E2VH 4XNMA 2ZOLB 3RVUC 2DM3A 4WI5A 2XQYK 2J88L 3OTTA 2IBBA 3ZE2E 4I77H 4LSTL 5DURB 1BQUA 3MLZH 5DSCB 1U8LB 3VXMA 1RIUL 5I16B 4NQVA 3O4LA 3CU1A 5JHDE 3AUVA 5JPNB 2A6KA 3L95A 3LQZA 4NNXA 1HEZA 2ZG3A 3LKNA 4QT5B 1YEHL 3MYJA 4EVNB 3KPOA 3ARPA 4XHJD 3RL1B 3ULVH 3NPZB 3LS5H 5H94A 3IU4L 1M7DA 2RIKA 4MWFB 4FXLA 4HHAA 4LLUA 3AGVA 4M5YH 2R8SH 3DURB 4PV8A 2ZJSL 2D7OA 2VAJA 5B38G 4QRPB 5F7NC 3OGCB 4G9FD 1T6WA 1I3GH 4FZEL 4BUHA 2WMPA 2D7TL 2Y06H 1CXLA 4MJIE 1IE5A 4XP9L 1CG9A 1EZVX 4ZD3L 2NZ9D 4LDEB 2OTWB 5IJKA 3RA7L 4GW5A 1B88A 1XH3A 4MGXA 3I50L 5F21B 2W1NA 3BX7C 2OTUB 1DDHB 3UJTH 3VXSB 2Z4QA 3A67H 1FYTD 1S7UB 1W0VA 2GY5A 4P2RB 4C4KO 3ARDD 3T3ME 5A2IH 1E4KA 3MACL 5CEXA 3MLUH 4ONOA 1TJIL 4X6EB 5F3BB 5KS9E 2BJMH 4PBWD 3L5HA 1G9NC 4HIJA 3C5SB 1QBML 2EZ0D 1NBZA 3ZTNH 1DVFD 4L3EA 2YPKB 1AFVH 1S7QB 1YQVL 3BGFC 3KG5A 4XGZB 4L5FL 1PKOA 3FQNA 2BRQA 4AM0B 5CAYB 1T1YB 1R5VA 1MNUL 1ZHNB 3JBG7 4ZYKA 4H26A 4ODTL 2DWEB 3LEXA 3MQIA 4LAQL 4QCIB 5ISZB 1W72H 3MODL 3GNMH 2YA0A 1RZKC 5DMKB 5D7JA 1F6AB 1DBBH 2VIRA 1I9IH 2BX5A 5T1KB 2OI9B 1A7BA 2HH0L 3GSVA 1MJUL 5DRWB 1YMMA 4JFXA 4PTUA 3PJSB 1A3LL 1AFVL 5K9OB 5FYLE 1JYVA 5T5NG 3RIAK 4KJYA 5EO0B 4IOIA 1YEDA 1I8MA 3Q3GB 5KVFL 2HJLB 4IOFD 4M03A 3IS0X 2X40A 3VA6A 4QRUB 4WJ5B 3VGAB 2VDQH 2MKLC 2JK5A 3TN0C 1JVKA 4JPWH 2EXYD 3QJFB 4WUKH 3TVMC 5E8EB 4KXZH 3B9EA 5HDOA 5AD0A 1L7IH 2IFFH 4U6YB 4ERSH 3WNKA 3GJEA 1D5ZB 2AJXL 1AGFB 2F54B 2VE6B 2ZG1A 5F9AC 3NIGF 2KKQA 2AEPL 3GI8L 4KKBC 4PJGA 4XP4H 4OM1H 3EDJA 2X2YA 3VDBA 1S9WB 2N4IA 4LLMA 2OK0L 4GBXB 1S9VA 1PZ5A 4P4RA 4YR6B 1LEIB 4P3DB 4JDVB 3CDGB 4Q9CA 2Z8SA 1SHMA 2J4WL 4PJHE 1R5IB 3ARGC 3CFBB 3FZUC 2B2XL 3EYOB 3ALWA 4RWHA 3CLFL 4CN4A 5EU3B 3ZZ1A 3EYFA 4AK1A 1YMMD 2APFA 2XTJB 5MEPA 3MRCA 1HZHL 4NRZA 1RHHA 4LRNL 2K7PA 2FB4L 4F7TA 4OZGA 1PKQA 3RDTA 4KI1A 2VLMD 3SKUD 1W72B 2AXGB 5KTEL 4PJ8A 2P5EE 4Q9QH 3BP6B 3KWWB 3VRIA 1YEJH 3CLEL 2VSCA 1CU4L 1W8NA 4O4YH 6FABL 4PPTA 5C0GB 3CFIC 1HSBB 3CSYB 5F9WC 1MH5A 4Z8FL 3QWOB 3ZTJG 4Y8DC 2CPCA 4HS6A 2Z31A 2L7JA 4YHLL 4PJEA 4M8QA 2Y7QB 1GXEA 2GJ6E 4MQXC 1XF2B 1JWMB 2VXSH 1CGSH 4NQUA 2IAMA 3U7YL 1PG7H 3I02B 5D1XA 5F88B 3G6JF 4E5XB 5IW1A 2ATPA 5E5RB 1YUHB 2Q3ZA 1OGAD 5DVNA 2X4UA 1NGPL 1FZOB 3NCYS 4MCYA 4XP1H 2BVQA 3FFDB 4HS8H 1EMTL 1J1PL 4UIKH 3EO9L 2BP3A 5CSZA 3JUZA 1PDKA 4ELKA 5C8JA 2ARJB 4J1UB 4WV1B 3N50A 4XVJL 5E99H 2M8XA 1AP2A 4L8SC 4FQCH 2WLYA 5CLTA 5BS0E 2J8UB 3K46A 3LEXB 3Q6FB 4JQVA 4CVXB 4LGSB 1FC1A 5D8JL 5I1JL 5JMOC 5CHNB 3NAAH 3EYQD 3BN9D 3EYVA 3MLXL 1G9NL 3CCHB 4R26L 3RVVC 3H3PH 4UMGA 2V5RA 1OP3H 2YN3A 5HGHB 4YBLC 4G80A 1NFIB 3E3QE 3GMOB 4UIMB 1GPOH 1AD0B 3WUWB 1YC7A 2NY0D 2P7TB 4BKLA 4GUPA 3WEXB 1KJ3H 3VGEA 1ULVA 1NFDE 2R29L 4BQ8A 5ANMA 3MV7B 3DV4B 1IC7L 4X4MA 4BQ9A 4JGJA 1K4DA 4MA7H 1FNEB 1JGLL 3BE1L 4U33A 2IH3A 4DFIA 3NGBB 4EOWH 3FHAA 2NY6B 3GJEB 1MQKH 4M43H 3FQRB 2OTWA 3DIFB 4OCNC 4YZFE 3FQWA 5F7DA 5LAXA 1QBBA 1JWUA 4NZDA 1RU9H 2WW8A 1DBJH 4F57L 1D5BB 2DQIL 4NRZB 1BD2A 1LDPL 2GUOA 5A43C 4F3FB 3FO9B 4ELMF 1WBYA 3T0AA 2OZ4L 1QLEH 4L5FH 3DMMA 4PLJD 1VEOA 4UOW0 2QADB 1R5IA 2D0GA 2W9EH 3CFBA 3SDXE 1D5XB 4QHLB 5TE6H 4NYLB 4GG8B 3GI9H 3U7WL 1XEDA 2DLEA 4ONFH 1FL6A 3KPRD 4KDTC 4OZHE 1MF2L 3VXMB 5D72H 4LHQB 2HFGH 3WUWG 3CC5A 5K9QG 2EO9A 4YAQA 1B6DA 4I18C 5C9JA 4U3CA 1ZHBB 1HCVA 3BKCL 5HDQH 4ZYKB 1CFNB 3UCRA 4RDQF 1INQB 2A6JA 3LQAC 1HSBA 5ESVA 1YY9D 4JGUA 2YRPA 1MRCH 4GXVL 5EBWA 5A2JH 4LGRB 3B2UC 3MREA 2HVKB 5DZNA 3TV3L 1UM4H 1BVLA 3C60C 4A2LA 3HPLB 3BP5B 3CK0L 1WVZA 5DJ2A 2HWZL 2NZIA 1TETH 5IW6B 4LPTA 2IAMB 2YZ1A 1RMFH 2VLRA 3NVQA 3GSXB 3GB7A 4X7TB 1U91A 2DQDH 3HUJE 2PW2A 5FYLD 3TFKD 4X6DB 1H3PH 3MGAA 2VZTA 4QO1A 4ZNEE 5IVXE 1OTUD 2A6IA 5AD0B 1X7QB 1TZGL 1JZ2A 4K7PH 2R0LH 4P23C 2AK4D 2ZOKA 2DWEA 5GJTL 5C09D 4K3EH 3JVGC 4XP6H 5BVJB 4GBXD 5DMKA 1QLFB 1XGRA 4CVZA 1WEJL 4OZHA 4POUB 1ZS8B 4BQ6A 1L7TL 5DA4A 2J88H 5JHDB 1DLHB 1FVEA 5D7LE 2ZCKH 3D2UA 2DI8A 4WWID 4JZJC 2IBZX 1D5IL 2A6DA 4PRNA 3QIWC 3IDJB 4XC3L 1NCTA 4XGZA 3IU3A 2GITA 2HJLA 5ADOH 1M6OB 3DRTB 4PUBH 4OCSL 3FO2A 1IGYA 3GM0A 5KAQG 5I73B 3V0WL 3FAWA 2LV4A 5ISZA 2DQFB 5CP7B 1H8NA 3MFGB 5L2JA 4Q97A 4HIIA 1FYTE 4FQCL 1WWCA 3T0XA 4XCFH 3HRZB 2IGFH 2X4OA 5EN2A 3ET9F 2CKBB 1FNEA 4Y88A 2AK4E 3GSOB 3EO1B 5TDNB 3GSQA 1KCUH 2Q8BH 4DKDC 4R8WL 1J05A 1MRDL 1EHAA 4HGWB 3K3QA 3ARRA 3GK8H 4F7PB 2OSLB 5HYQB 1IM9B 2BSRA 4OCSH 4UTBH 3L3IB 3WNPA 2XY2A 1BEYH 1AIFA 4HKXA 3GUTB 4NN7B 4LSQH 4UAOC 4PRHB 4G9FE 4YAQB 4HH9B 2NQCA 5I71C 4PJCE 1FVDA 3LD8B 4NKOA 3DUHA 4HLZG 3IKCA 2BOBA 4MDIA 3NA4A 3DHJA 2DQCH 3WDJA 4DW2L 4YJZL 5E1HB 3QDJE 3BJ91 4MCYB 2EDHA 5E8DL 5IIEA 2F15A 4RBPH 4M7KH 3FRPG 1LMKA 1LEKA 3U79A 1GOFA 2VZUA 1UQSB 4O4YL 6FABH 1S3KH 1UXSA 1MCOL 2DJUA 4XCYB 1MI5D 3LKSA 1SVZA 3HPLA 4NM4H 3H7BA 4Y16A 1UA6H 3H9ZA 3ZE0F 2Q7NA 4JHBA 3AXLB 4KKLD 5E8PA 4HIXH 4XVSH 4M6AA 3TVMB 2WQRA 4CN1A 3THML 3WFCL 4F33A 3RWGA 3EYFB 3VA2C 1SMAA 5DJ6B 4HKJA 4ELMA 3BWAB 1F5WA 4M6NH 5EULV 2ZOKB 3D39B 1F3JA 2J5LC 5DUBA 2QL1A 3F8UB 5TFSL 2EXWD 3DETC 3TV3H 2FX9L 3OR7B 5L7XH 4J12A 3B9KC 4JY4A 3FB8A 4Z7VA 2GTZB 3GEWB 4KH2A 4J3WA 4Q6IA 1KBGL 2PW2B 3O3DB 1MLCA 2GT9B 5C3LD 1MH5B 5HVGB 4S10A 5TJWK 1FVEB 2AJXH 1OGAA 2WAHA 2YS4A 1QNZL 1Q9KA 1E27A 4FQXD 3L5WB 2MWCA 3MROA 5C08A 5E2TL 3DIFA 3RKDC 1AE6H 2BXZA 5ELIA 4ODTH 4JHWL 2YOCA 4JZJB 5TH2B 5MERA 5HHVL 2D7QA 2BC4A 3N1QC 1U3JA 4X83A 2XG4A 3ZKND 2DLGA 1XGQB 4Z0BH 4L4VB 1JGEB 3IDUA 3K8LA 4YFEA 4HCRA 1BFVL 5F9JB 1RK0A 3DVGB 4FP8L 4I4WA 4L8BB 4W6XB 1HYSC 4FMFA 4JO3H 3QNYB 5DEGB 2B1HL 2FNBA 2NXYB 4U0RC 2Y9RT 1RULH 3DRTA 3SE4A 1R3IL 3RDTD 2OS7A 4PJ8C 4F8QA 4G9FB 4UTAH 5DMJB 4PJGF 5HGBA 2NX5B 3FT4B 1NMBH 1ORQA 3QO0A 1U3HA 3DUSA 3ILPA 1HHJB 3QXWA 1SEBA 2G75A 3HZVB 3Q1SH 4TTDD 4BFGA 1JNHA 2V7NA 4OCXH 3S35H 3L7FA 4OAWA 1F00I 2PO6A 2W07A 3F5WB 3MC0A 4IM8A 3V5HB 2VLKA 1VFBB 1A6PA 4NN7C 5FA4A 1NGYA 5E1AB 4AT6A 4HUKB 1NFKA 3DLQR 1BQHB 2QR0A 4QXTB 3VFTB 4MA8L 4NOFA 1P4BL 5KANI 1MELA 1OGTB 4M6NL 3NIFF 3NZ8B 4FQLH 4F37F 4NBXB 3STLA 4JDTL 3OXSA 1F58H 2W0LA 1CK0L 2DQUL 2VLRB 1XGUB 2FJFB 4PRHE 4EN3A 2AEQH 3QNXA 1F11A 1HQRB 3U2SB 2XKSA 3ZDXF 1FH5H 2Z91A 5HYFA 3MLWL 2H2PD 1ZOXA 2YZ8A 5JUEH 3JUYA 4FQXA 4AJ0A 3CSBA 4JR9L 4M7JH 5DO2C 1AKJD 1IRAY 1AO7D 1FJ1A 3WFHA 1NL0H 1DN0B 3CFEA 5IHZB 3EOAA 5C09E 4MB5A 3K0WA 4MQTB 2HVKA 4X7FC 2Z9TA 1FO0A 3IDXL 2MHAB 4FABH 4YXHH 2ID5A 3VFRA 3WXVL 4LLVA 4ISVA 2FX8L 3VGAC 2IAND 4M1GL 5IW6A 4LSUL 4ONGH 3IFOB 3V9FA 3W0WE 3MV9A 4X7TA 1LP9A 5E2UL 1P7QD 2EDYA 4JY4B 3BT2H 4R2GC 3O6FB 4Y4KC 1KB5H 1BFOB 2VJXA 5F6HI 3RTQC 4JEGB 1GGUA 3FTGA 1ED3A 3MNWA 3OAUH 1SJVA 4PJFA 3RAJL 3VFPB 3MUJA 2VDML 1EUUA 5C9KA 1JPTL 4ALAL 4PY7B 1KPUA 1OPGL 5ISZE 4ZOBA 1IM3B 1GGYA 4GRWE 2UVEA 3V5KB 1KACB 4HCRL 4WFED 1MUJB 1IEHA 3ARGB 4J3OC 4Z7WA 1AH1A 2EC9T 1KTDB 3MV11 4HFUH 3VRLE 4R3SA 2NW3A 5K59E 5TE6L 4OD3H 4MS8D 1NAMH 1T20B 4XNQA 2AV1B 3RNKA 3GFUA 5DJ0B 4CJ1A 1FN4A 1FYTB 1FZJB 2HT2C 4UV4H 3GI8H 2BSSB 2O5ZL 1UB5B 3EOYG 3NCCB 3RPKA 5BVPL 3VWKA 4L4TD 4I1NB 1KCKA 4EOWL 1JGLH 1NMBL 3NIFE 1G7HB 2N7AA 2R2BA 5F9DC 2Q7YB 3U36A 3UJJL 4RX4D 2HFTA 1U8LA 4J3VA 2RHEA 4NKMB 4UOW1 1VKXB 5L88H 4F33B 3HNSL 4NP4L 4PGDB 5B38A 1YDPA 1A3RL 2F54A 2FATL 4PRHA 1GZQB 4YHPB 3C87A 1BQLH 2DICA 3P9LB 5KZCD 3SGEI 1MJ7L 4YZFF 5DUBB 3REVA 4YDKH 2IPUG 3KPSD 1CT8B 3HMXH 4ZUTB 1FAIL 3P73A 3S36X 2P5EA 3ARTA 4NO5A 3SE3A 4L3EB 2ZNWA 3LHPH 2E9BA 5I18L 3IKKA 3CMOH 5JW5B 4K2UL 1DQJB 1CZ8H 4FNLL 3HUJB 2IC2A 4NQDD 4KDWA 3DX7B 5E0QA 4PJ7B 1ZA3B 5DFTA 4G6KH 4XMLH 2JB6B 4GQ9H 4PR5B 4ESKA 3O4OB 4ZUVA 1H3PL 5D7LB 5CLWA 1IC1A 2OL3H 4XRCA 4HZLA 2H3NA 4NZRH 1JHLH 4KV5F 4KVCL 4PG9B 2VXTL 5SX5H 4N0UB 4EI5B 4XHJC 1Q38A 1CE1L 4MXQD 4R7DA 3IJYB 1LK2A 1M7XA 2DD8L 7FABL 1FLRL 5E7FA 3S34L 1FPTL 4D9RD 4P46A 5L6YH 2BNUB 3RTQD 5CKAA 5K59F 1QKZH 4IRZH 4TVPE 4R6UA 2F58H 3HZKB 5KVEL 4HGKC 3W2DL 1QRNA 2GFBB 1T2QH 3RZCC 4WENB 2J8UA 3Q6FA 4DCQB 4HT1L 4ODHL 3F7PC 4IS6A 4K71C 3P4NA 4D9QD 1NBYA 4EDWL 1S7QA 4O02H 4PG2C 4MJ4A 3ULVF 4E41B 4DOHB 5C0DA 3O3AB 3HPJB 3ULSA 5IQ7L 4HWBL 3ECBB 1G7HA 1XF4B 1YN6A 3G5YB 4Y2DC 3HE6A 4JO4L 1RURL 3X11A 2OI9C 4IOIB 1P7KA 3Q3GA 4D0CA 5IF0A 3UJJH 2I07A 5HGBB 5F97E 1AKJB 4WY7L 3RIFK 1PKQB 3MBXL 3U2SA 2CLVB 2RJMA 3WEXA 4NNPH 3GJFA 3TCLA 5I18H 1KB5A 4PJIF 4PRIA 3VE0B 2A6KB 4UB0H 3KNBA 1LE9B 4HJJL 4XCFL 2R15A 4JO2H 3BPLB 4X6CE 4EQ2A 3DYOA 5J1AB 5C0GA 1UZ6F 2V2XB 5AWNH 2EDFA 3S36L 1RK0B 5GGTH 1UACL 2UYLA 4Y5VA 1T7ZA 1QFOA 2D0HA 4YX2L 3VXRA 4E42A 1WAAF 1FO0H 4ZFZA 2VSDA 3FRUB 5EWIL 2HFFB 4M1DH 4MNHB 1VEPA 4RDQG 3VG0H 2XA8L 2I9LA 4M61A 4O2FA 3V5DA 1C7TA 2AQ1A 1EFXD 5CINL 2OP4L 5DD6B 5DEZA 5ILTL 1GGIL 2AJYH 2D9QB 1KB9K 3WNOA 2VOTA 1NKOA 4V1DB 2Y5TA 3MR9A 5FV1L 1JFQH 4WU7B 3U83A 2CQVA 1KJMA 1T66D 4LIQE 2C1PB 1OAXH 5I74B 5C0AB 3GNML 4PYGA 4K7PL 1SJEA 3MOQA 5IUSA 1OSPH 2Y7QA 4KGLA 2VLJB 4G7YH 1EEZA 4YPJA 5JNYA 4G42A 3LQAL 5BZDB 1HNFA 2VISB 3NPSB 1CLOL 1UC6A 1IL1B 2I27N 3FN3A 3MV7D 3A0OA 2AJ3B 5JW4R 2R1WB 4AH2A 3FB5A 1IAOA 5I1AA 2ATKA 1JGUL 4NC1E 5T1MB 5JDSB 3H9SA 1ZSDA 2ZUYA 3FQNB 4AM0A 4ZO9A 4OZFH 4PRDA 4KZDL 5EUKB 2P45B 3UYRL 1LO0H 4Q58C 1FHGA 3QB7C 3C5JA 2VDRH 1FVCA 2X41A 2VERN 2V9TA 1RJZA 5DHYB 1UKSA 1ZGLA 5GXBB 3DX9B 3D25B 2EDTA 2VITA 5LJYH 1WTGT 12E8H 1LEGB 4WTZG 1EFXA 2IPTH 4GMTH 4LARH 1NGQL 4O5LL 3BESR 3BHBA 3IXAB 2WBJD 3IGAA 4BFBD 2APTA 2DD8H 3O3AA 2N7BA 2HLFC 3AROA 2BNRE 1QZ1A 5EA0L 4FN0A 4QGTA 3ZKSD 3QIUC 4ZFOB 2RFXA 3W0WD 5IHUL 5K9QI 2C7UA 2X42A 3LH2H 4I3RL 3LD8C 5D9SB 2A73B 4R4NC 3IFNH 5BRZE 4M6OH 1U0QA 5DK2A 3QUMA 5ESQA 4PGEB 1JRHH 4OV5A 2HKFH 3LS5L 4NKDA 2HP4A 2FHCA 1OT1A 1NSNH 4NO5B 2VUYA 4HD9A 1BFSA 1FL6B 3GMQA 4XP4L 1IQDA 4NJAL 5HGGS 1YMHA 1IGIL 2CLVA 5CHNA 1IGYB 2LTQB 2F53D 3IDIB 4JB9L 3DX7A 2EIBA 5E03A 1YPZB 2VDLH 2PW1B 5C0BA 3QA3A 1V3MA 2I9LB 4PJHB 3QT2A 1PVHA 5AZEL 3BAEL 4Q0XH 1I9RL 1YNTA 3QXAA 1TTFA 2EDJA 2VC2L 2VXUL 2CKBA 4DK3A 3MR9B 2IQ9L 4NT6A 4ZFZB 3FQWB 1DBMH 3S96A 1KG0B 4U3HA 4LCYB 1A1OA 3MV7E 4HGWA 2Z8WC 4MHHI 5I2IA 2A9ML 3VI4E 3CC5B 4R26H 1FGVH 2A0LD 4D8PB 4G42B 3IXTB 4U1GC 1B0RB 1I9IL 3GMRB 2Z31C 4PJ9A 3E6FB 3MRDA 4X7EC 2ZWLT 4WU7A 4RGMB 1DANT 2E6QA 2RAMA 3S5LG 2AAVA 4GMSL 5E99L 2BCKA 4KKAC 2R9HD 3ULUE 3TZVA 2AJYL 1VFUA 2B4CC 4Z78A 4PJBB 1M71B 3SY0B 1DN2A 3IAGC 3TPKA 2AVGA 4BYHA 5JR1L 2ZJSH 2ITCA 3KPTA 1OAYH 2X89D 4XCEA 5IMMB 1C16A 4WW2B 4H88H 1LO3L 3MJ9A 2PXYB 4HZLB 4E41D 3L3OB 3BN9C 3MJGX 1E0OB 1NFDA 4JKLA 2CUIA 3W2DH 4PJFF 1DVFC 4YIQA 1YECH 3O2DL 2EDNA 3ZKNC 4KHTL 2ICWI 4KY1H 3C6LA 4DKEL 1I1AB 3ABZA 2A38A 3MRKA 2CIKB 3B9DA 4BH7A 1RIUH 1ZVSA 2EDDA 1RUAL 1CL7L 2ZUUA 5A3IC 4BFEA 2A9NH 4JFFD 4J7RA 4Y4FD 4PB0H 4JO4H 1MCOH 3PWJB 1UEYA 2V9QA 4ODWA 5EZIL 1ZHLB 5A16A 1BD2E 3GBLA 4APQA 4PJ9D 4IMLA 1TVBB 5DK0A 4PJIB 1ZEAL 5LBSL 5AG8A 2BXYA 1A21A 2BVUA 3SDDA 3GMQB 5I16A 2DQCL 1UB6B 1C8PA 3EJZC 3GBNH 4RRPG 4L4TA 3OJDB 5IHBA 4U7KA 2A1WH 1E4WL 1MIEL 4WWKC 1WC7A 1JE6A 5DJDB 3O4OC 5FIEA 1BFTA 1UM6L 1ZWIA 4JRWA 1FL5A 3CVHH 2ADGA 1KT2A 1F8TH 4FNLH 4DKFH 1DCLA 3CMOL 5I1DA 4YHLH 3GIVA 4MXVF 3HZKA 5T5NF 3CZJA 4AG4H 3GGWB 1J5OL 1YEEH 1NC2A 1G9EA 1UQSA 2Y07L 3H42L 1LE9A 3OAYK 3WFBL 1HYRC 5DYOA 5ADPL 2VQUA 3EYUL 4B7IA 5FEBA 4LFHD 1KEMH 2MPAL 4RMWA 4P5TD 2D3VA 3K2UH 3RBGA 4TRPL 1JMXA 4NZRL 3PP4L 4JFEE 4TNWF 3LEYL 5L88L 4BZ1H 4QY8B 5EIQA 2VC2H 2N56A 4JFDD 3DBXA 4RMRA 5H37G 3P0VH 5I1LA 1BBJA 4KRPC 3X14A 4HIIB 5HYJD 5CJ5A 1A6WL 4LCWB 1UH3A 3D85D 3G08A 5LG1A 1IILE 1NL0L 4MMXC 2ZUWA 3QI9D 4OZFG 2AV7B 4XI5C 4K3DH 1EXUA 1K8DB 4DZ8B 3RJDA 5DHYA 2GT9A 5FF6A 4G6MH 3TN0D 1A7QL 4RAUB 2HT3C 1N8ZB 3FJTA 4XP6L 2CLRA 4NNYA 3C60A 3QNXB 5D71H 5I19L 5CIPB 1WZMA 5DS8B 2MQ3A 2JTDA 1DQQA 2BNQD 4OFDA 4ELMB 2Q20A 2NY2B 1DBAL 3LY6A 2UZYB 2CMRH 5MERB 2VABB 4M61B 2DQDL 2E5EA 5I9QB 4EDWH 1WICA 2RFXB 1PY9A 4PJBE 4KUZL 5E8PB 4HFWB 2VDOL 3H9SB 4EJ1C 4YNYB 4P23A 2VAAB 2FR4A 5GGUB 3JVGA 5EUOF 1BIIB 4X4XB 3BKMH 4YEEA 3RUGF 5JZ7C 4PY8I 5HY9A 2BFVL 3LN9A 1IARB 2F5BL 1CD1A 2CLZB 5E2WL 5JMRA 1GL4B 1NSNL 3IJHA 1IC4H 3PWJA 3V52H 5DJ6A 1FFPB 4KTEH 3PL6A 1K8IB 1K5NB 2F5AL 1T80A 3U0WL 2G60H 4NN5B 4M6OL 5IB3B 2DL9A 3IAPA 1B4RA 4DVRL 4YDIH 1JGDA 3L1OH 2F74B 5J6GB 4JM2A 1U8NB 3CSPA 3IU4H 3F62A 1NFDF 2NYYD 4H8WH 1EO5A 1QLEL 4JZNB 4U1LA 3AU1B 4JR9H 3QEUB 4ZTOL 5E00A 1OAXL 5INCA 3BH9A 3RBSA 1VDGA 1WZLA 1HQRA 4HW6A 1SYVA 2HFGL 5GGRB 3S4SB 1F4XH 5FA4B 5D72L 1CK0H 1JYWA 1EIBA 1KPVA 4OIAA 5GRXG 3WD5L 2F53B 4LEXH 2IANB 3HE7B 1S9WA 5C0BB 4CMHB 4U0RB 4RGND 4P2QD 3A6OA 4TVPH 1LEIA 4Z7QE 3UZQA 1EA9C 5J11B 4L4JA 4OV5B 4S1QH 3RKPA 4WO4B 4WUUB 1ITBB 3RKDD 3V4PL 2WUCL 4G3YH 5C0EA 5DSCA 4Y4HB 3I2CL 1BP3B 1UG9A 5ENWB 4HXBL 5GJSL 3VRJB 5FYJU 5EUOB 4Y16C 3N1GC 1F90L 3L3JB 5KSAC 4XVTH 4L29A 2ZCLL 3QHZH 5ITFB 3Q5OA 1JGVL 4JRYE 4NJ9H 4GMSH 1IQWH 2XFXB 3BW9A 2KL6A 3B9KD 1F3DJ 4NQEA 2O5ZH 4Z7UA 5LGJA 3C8KB 1R0AH 2EIZA 4GW1A 3WIFB 3DROA 4PJ5E 5JW3H 3VXQB 5JOPD 4K3DL 3W9EA 5C92A 4PJBA 4QRPE 3VMNA 3HC4H 4GRMA 3ZKXC 4U05A 2FX7L 5I8CB 1J1PH 4UIKL 3OJMB 2E3VA 2RB8A 1NDGA 5GGQH 4NO2B 2BNQE 4LOUD 3OKLA 3HUJF 3P0VL 1UYWL 4G43A 4JVWA 1AXTH 3TH4T 1E4XI 2DQGH 3IXTA 1ONQA 4ZUVB 3I3EA 1TFHA 3LRHA 4L4TB 3KPLA 1SYSB 2XNAA 4I0PB 4CN6A 3NAAL 3CX5K 3JTSB 3OMZA 4P9ML 3JWOH 1FO0B 1H0DA 2WBJB 5E2TH 1A1NB 3PP3H 5DO2D 3NTCL 1FL5B 3VG9B 1ZVYA 2G9HB 3NN8A 1FPTH 4X6BB 2H32H 5DJZA 2APWA 3MROB 3PL6B 4RFNB 5EC2B 1N3NA 4ODXB 3G6DL 5I74C 1RZGA 2JJUA 3T65B 1DSFL 2XTLA 4ZUWA 1KEGH 1QO3A 3TNMA 4EUPH 4RZCA 4PGCB 3TO4D 5DT1H 3OPZL 2NR6D 1T2JA 3SKNB 2WINB 4P4RB 1YYLL 5J12B 4GAGH 4LKXB 4YDJA 2O5YH 3DVGA 1MFAL 1CGSL 2Z31B 3QI9C 4XI5D 3GSWB 2R8SL 5INCB 3MJ8B 3X13A 1J1XH 3O3EB 4BFIB 1HDMA 3DUUA 3S5LB 4AQ1B 5FGCE 4QXGL 2ITDB 4X8XA 4WVRA 5IBUB 1MUJA 3VXNA 1CXKA 4ZQKB 4U1SA 4M5ZH 1U58A 3RZWA 5D96B 3VI3E 1W72A 2AXGA 2P47B 5EU4B 3WV0A 4DCQA 4U3XA 1FG2A 1OAUH 1FFNA 5HGDA 5AAWA 3AS3A 1FFRA 5JUEL 3FO0H 3QDGE 5KTEH 2C4FU 2R2BB 4R2GD 3C9NB 1FAIH 3TYGL 4QXGH 4R7NB 4KUZH 3K81A 1IFHH 3BDYH 4RFOH 2WM0A 5SWZA 1J12A 4M8VA 1Q0XH 3IDYC 1SBBA 4P5TB 1DUZB 2OXGA 3F7YB 4WIQA 3O45A 2NY6D 1UZ8B 1UFUA 4N8CH 3INUL 1BBJB 3TBWA 2X1XR 3NBNA 5FDWA 1H3GA 3GGWA 4HWNA 3IB4A 4GKNA 1OD7A 3QDJA 1EGJL 5CJQH 1NLDL 2C1OB 3QCTL 2D4FA 3SDAA 1KJ2B 2VKXA 4HDIA 2ZSWA 2J8HA 1BREA 4FQIH 3EOAB 4Y19B 3MA7A 4APQC 3V0WH 5I1HL 1QLRA 1I3RA 1KFAH 3W81A 4JFZL 3QUZC 1QSEA 4ZPTB 3GKZA 4L8CA 1IAKB 2HN7A 3QQ4B 3W9EB 1T04B 1VADA 4JG1H 2DIAA 1D5IH 2NW2A 3U0TA 5A2FA 1HILA 1NCNA 2BHYA 5JOPE 1OARL 1ZT7A 4E5XA 2W38A 1FO0L 2RR3A 3R8BB 1A6VH 1ONQB 1I9EA 1U42A 3GO1H 4JPVH 1RU9L 4YXKH 2E7LC 4MNQE 4JZNA 5FDYA 4ZUUB 1UJ3A 5FO8A 1DQLH 5MENA 2ARJA 4J1UA 4WV1A 1XIWD 4PJXE 5FKAA 5DF0A 4PJ7A 2B4CH 2ZUQC 2VO5A 4Z77A 2XTJC 3ARDB 5BVPH 2EKSB 3SGJA 1E4JA 1FNLA 1V3LA 1AO7A 2CKBL 5FYJD 3TBSB 1IC7H 2IAMD 1MHHB 4WEBH 2VABA 2R2EA 4DZBB 5IB1A 5JHLL 3I02A 5FUOL 1INQA 1H3VA 3B4NA 4KAQH 4NQSA 5TFSH 3GSRB 3WE6A 3WLBA 4NN6C 2ICES 3QULB 5D1ZA 2HKFL 2QHLA 1TCMA 3HRPA 4OFYA 5JIPA 5IB2A 5FGRA 4LK4A 1CF8H 1DFBH 3CJJA 3T1FB 3SKMA 1QRKA 1MCSA 3FCTB 2GK0B 2AJUL 4JRXD 4UINL 5D96C 3S4SG 2EECA 4NFCA 4AEEA 4HIEA 1DE4B 5AZ2L 2EKJA 3U82B 5C0EB 1HXMA 1MCDA 5DHVB 5J11C 3DXAE 1SEQL 2IPUK 3VWKC 4PJ8D 3VH8A 5FV2A 1T03L 2W60B 1QSFA 1EV2E 3KAAA 4KHXL 5I9QC 5J89A 3MRMA 1AHWA 3HAEH 3NABH 1S7TA 4ZD3H 2XXCB 1I7TB 5DRXA 2PO6D 5E95B 4NM8L 3HHRB 1QACA 1CE6A 5IMLB 3UAJD 4X80L 5F3HB 4OQTH 4Y5YC 3MRHA 3LIZL 3G9VA 4HC1L 3NIDF 5SWZE 5D5ME 1HN1A 1OF2B 1DEEB 4Y2DB 5I8CA 5HHQB 4NZUL 2XYCA 4QWWD 1M05A 3WO3B 3TESA 2ARWA 4NSKA 3MV7A 4EUPA 4U1LB 3HPJA 1ERNA 1XCQB 4RMQA 3B6SB 5TQ0L 1QKZL 2C3VA 1CBVH 2P8PB 5MI0C 5IVNA 3IDJA 1WT5A 3PWVB 2Z92A 4Y8AA 4KMTL 3MJ7B 5B39G 2H32A 4MXWH 4F9LC 4NT6B 5FHAL 3HG1A 1HWHB 5D7KE 2L4OA 4I2XE 5JORA 1N4XH 4LCYA 3T0EB 2FO1A 3RJQB 4JRXE 5BVJA 4JHAL 4Q9QL 3HRZA 3A6BL 3B8YA 5GRYA 1RY7B 3GZKA 3QFJB 2EDEA 3B83A 5F1IA 3NFPB 3PL6C 4QRSB 4RFNC 3RL2A 1VGEH 4PLOB 3IXAA 4WI7A 5CSGA 2F53E 2X9WA 4S1RH 3Q6GH 4P9HL 1F58L 2C1PA 1MAMH 1UCBH 4IJ3C 1UXWA 3HI6L 5IJKC 5A3ID 3FB6B 5AZEH 4Z7VF 3VMPA 3MJ8A 1A7RH 3MRNA 5C0IA 5DD6A 5JIKA 5J12C 3UJIH 1NMCB 4JHWH 1IAIM 3D3VA 4QWWC 4YE4L 1KOAA 4PBVC 4YBHA 3D0VB 3C8KA 4MJ6A 1MQKL 4M43L 4LSPL 1A1MB 4X7SH 5TE7H 1GAFL 4N1EA 3IDMB 4DN3H 1H9VA 2JIXB 4UB0L 4N1HB 4PRAA 3M1BB 2NY5L 4X9IA 4OV6F 2H1PL 2Q87A 3IDIA 3MRJB 4P49A 4N0FA 3UJIL 2VITB 2XKNA 4PG2A 4HWBH 1HHJA 3ILPB 4NQSB 3ZKQD 4ENEC 3VU2A 2SEBB 3RWDB 1RK1A 1T6VN 1G7IA 3ETBF 3T1FA 5D7JC 5KVMC 3D2UD 4PTUB 1A4KA 2AI0L 4HULB 5DJCB 1X4ZA 3QUXA 4OIBA 1S7XA 2Z8VC 3VDCA 1ZA6B 4PV9A 4HWBA 2HAZA 5C7XL 3PGDB 5DD1H 2CO7B 5IEHB 3MXVH 4CMMB 3WYRA 1P69B 3V6OC 3UZVB 2OCFD 1ZMYA 4PP1C 4KTYA 4Y5VC 3BEVB 4XP5L 5DJDA 3TN0A 4G8GD 1VFBA 2WBJC 1NUGA 2R1YB 1M6OA 2KDGA 3T0VA 4LLUB 2IWGA 1F4YL 4HLZH 4PJEE 4X9GA 5J56B 2JB5L 3MRPA 3HR5B 4HH9A 4FXGB 3X12B 2YMXL 4XNMB 3LAFA 3WXVH 3H7LA 1JV5B 2EDQA 3NZ8A 2GJ6D 5EFIB 4YHYC 3OR7A 1HOCB 4M5YL 4NUJB 3EJYC 1XGUA 1DR9A 2QV2A 5HGDB 5I1EL 1NBVL 3JV4A 1RUAH 5GGRY 3JZ7A 1QR1A 1MCQA 2BCKB 4WW2F 2YA1A 3I6LD 1N64H 2CRIA 2JKXA 2EYRA 4FQ1L 2OR7A 5FM5M 1IJ9A 3P4MA 4HKZA 5I15H 1KLUA 4CBPA 3KWWA 3VRIB 3WS6A 1VPOH 3F5WA 3TYFB 1XGTB 2GJZB 1A1OB 3U0TB 3TWCL 3KLAB 1I8KA 5IK3A 4B0MM 4N8VB 1EH9A 1EAPB 1WEJH 4TQEL 3F12A 4NRYA 2CH8A 4QRRB 5E5MB 2AEPH 3MRJA 4XPAL 3MRDB 3MLWH 3IDYB 3BD3A 3GMMA 1XH3B 4OFIA 3M8OL 1ZLWH 4CNIB 2ADGB 5F7KC 5HHPA 3L3HA 4M4PA 5D1XC 1V7ML 1OQOA 1M71A 4NWUL 1AXSB 2A9MH 3VWJD 5TH2A 2ADFH 1EMTH 4ZFGL 4AT6B 4HS8L 4YDVA 4PJAA 3CUPB 4CADB 3SDDB 4JQIH 3C5SA 2EE6A 5T1LD 4Y2OA 5DK2B 5ESQB 3VGFA 1BLNA 3D87B 3O11B 2E9JA 2VWEE 1DBKH 4ODWB 1NDMB 5J13C 4NSKB 4JFXB 2SEBA 3RWDA 2ZCKL 4RMTA 1CGUA 3DXAB 3HC3H 5J7CC 2H2SD 4LLVB 3S34H 4NC1C 1S7XB 3RIAF 5GS0H 2WLZA 2J6EA 4BKLB 1RZFH 4ODUA 4YH6A 2VIRB 5HVFB 2J5LB 1FFQA 3ESUF 3U9UB 2VDMH 3B9KB 4TULH 1EXUB 1XGQA 3OXRA 3QUZA 3V5HA 1GZPA 3RGVB 3VFSA 4PJAE 1IAIL 1ZVHA 3M45A 4V2CB 1QTYT 3QFJA 4X9FA 4EI6B 5F6IB 4KGJA 4LU5H 2DIBA 4K94H 1WFNA 2IPKA 1FIGL 1NANI