2HKFL

Crystal structure of the complex fab m75- peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of antibody structure upon association to a human carbonic anhydrase IX epitope studied by X-ray crystallography, microcalorimetry, and molecular dynamics simulations.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Immunoglobulin Light chain Fab fragment
total genus 55
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfL01
3R0NA 4QF1B 2CKBB 2XY1A 5I8KH 4M8QA 5BQ7B 2YD6A 4LARL 1HKLH 5C0ND 4Z7WB 1P7QD 3FO9A 1PX4A 4GKZB 2V5SA 1HHHB 3TA3A 2R8SH 5D1QD 1N6UA 1U8NA 3I3DA 5BS0D 4K3JH 4XMPL 1IGFH 2QR0A 1CVRA 3AS1A 1UYWL 4NWTH 4OJFH 3RDTA 4NO0B 3QDAA 1YN6A 5HYJB 2CIKB 2EO1A 2R29L 2XRAL 3FFCD 5HHVH 4TRPH 1N6QL 4TSAL 3CVIL 5D96B 4XWGL 4NQXA 3WJLA 4RRPA 4KAQH 2MQ3A 4TSCH 2DLGA 4KZDL 1WJ3A 2CD0A 1INQB 3VGEA 1DLFH 5DHVA 3FB7A 5KSAB 1IE5A 4L8CB 2WIIA 4ACPA 2UZXB 1CGXA 3W39A 3QG6A 1I1AB 4O02H 5DF0A 4LDLB 4MD5B 4CBPA 3U4BL 1ONQA 4Y8AA 5EBWB 1HIML 2AXFA 4QOKB 3DGGB 5SWZA 5B8CA 4ODSH 5EO0B 1FNHA 4AIOA 4XVSL 2EKSB 2DKSA 4GXUN 5DMKB 1S9XB 1H8SA 3V6FB 5ACZB 5BRZD 1G9ML 4JM4H 4M4RA 3M1BA 3L3JA 4QCIB 1MFEL 1KB9J 5IBUG 2OI9B 1NDGB 4GW1B 2ZUSA 1UWEH 5D5MF 2JB6A 3MUHL 2GJJA 2ZG2A 5DR5H 4L8CA 4NN5C 4AEHH 2I9TA 2VE6B 1A6TB 3IXAB 4KUZL 3S3JA 3W39B 5J06A 1KPRA 4R2GD 1J8HB 4JFZL 1H5BA 4YBQC 3IDYB 5DQDL 2ICCA 3WV0A 2F8XC 5DQ9B 3U4EB 1OARL 1IGFL 3PWPE 1VKXB 6CGTA 4PJIA 2R0KL 4N1HB 3FT3A 1OT2A 4NQDD 4L9LC 5DJXA 1PEZA 4RMSA 2NY3C 3GO1H 1DANU 1LVEA 4F2MA 4WHDA 5FOBB 3GSQA 1XGTA 1QNZL 1TXKA 2G2RA 2BNRD 3IF1B 2R69H 4MNGA 4MSWB 5H94B 1HHJB 1X44A 1TVDA 3CX2A 1JN6A 3T0XA 3U9UA 2I9TB 1NCNA 2NY1C 3QQ9C 4QXUH 4EN3A 3MLRH 2ZUYA 3GJEB 3HE6D 2DYPD 5B4MC 4HEME 2FBOJ 4IRZH 2VERN 2P46B 1A6PA 2I60L 2WZPD 4ZFGH 2IJ0C 1WGOA 4N8VB 4G5ZL 3MACH 3WIHL 4JJHA 3BZEA 3RWCA 1MHCA 1BEYL 4JY6A 3QEQD 4FMFA 4P4KA 3KPRD 3AY4C 2LU7A 3OJVC 2ZUXA 1ZA3B 2W0KA 3QI9C 3RPKA 2PO6C 4V1DD 4DGVH 4L8SB 1P53A 3DVGA 3QB7C 4KKCC 4XNZB 3RWHB 4LSRL 2PW1A 1JYVA 3B9KD 1DVFD 4Y19D 2FH8A 4JRYD 2GFBA 2DTML 3SJVD 5KS9A 4JFFB 3V5DA 4HGMA 1R3HA 3BGFB 2IAMB 4XB8A 4M02A 1JGDA 1MFBL 3HLAB 4LSSL 4A6YA 4DZ8A 3TA3C 1NAMA 4J12A 2W07A 4ZODA 5C09D 2QEJA 3VI4F 3SDDB 1CGUA 2FSEB 2EC9U 3QO1B 1NL0L 1MIMH 5JZ7D 2VLKE 4R96B 2V2XA 1K3IA 5E5MB 4AG4L 2IH3B 4UIKH 3DX9A 1CLOH 1FBIH 4ZUVB 2VC2H 5E6ZA 4KGJA 3LIZH 4JM2C 1RK1A 3O4LB 4YXKH 1YN7A 1JL8A 2XIDA 5EOTA 5CGTA 2YD7A 4G42A 4U6HA 3V52L 1FNEB 2X4TA 1XGPB 4OFYD 5KS9B 4L4TD 5E2UL 1SMOA 1HH6B 1HSAB 4G6AD 4YWGH 5MENE 4ODXB 1W2KT 4RFEB 5MERA 1NFIB 1XF4A 5C70A 4JQIH 3ZMRA 1KJMB 1I1AC 2NYYD 1YY9C 3ARPA 5EORH 3RX7A 2OTWB 4GS7B 2HTKD 1N5YH 4PJ7E 4MS8D 4DJMA 2Y06H 5TQ2H 3ULSA 3QFJA 1MCSA 2D7MA 2DLHA 3WFDL 2FWOA 2AQ1A 3NCYP 2L7JA 4WWKD 5ITFA 1FVDA 4OCSH 3HHRB 4JRWA 5E94A 2ZPKH 3QIWA 2BXZA 3KPMA 1PEWA 5I66B 2FHFA 2QLVB 2EIZB 3LDBB 3BDXA 1X4ZA 3BOVA 5DVMA 4OCRL 3QCTH 1U8MB 4F58H 1UJ3C 1FL3A 2VR9A 4P0DA 5DJ8B 3ROOA 1D5BA 3IFPB 3VD5A 5GGTH 1H5BC 3ECBA 2KZ1B 1YJDL 5DFVC 1OM3H 2E27L 1RZ8B 2ADJA 2WNGA 3LPWA 5E6ID 3GJFB 2QSCL 2AK4B 4PGEB 4CU6A 2O5YL 3ZYJA 4I0KA 1YDPB 2FWOB 2R0WL 5E70A 1FFRA 5ITBL 4QRUB 1VADB 4RGNE 5I2IB 4NZUL 4LSQH 4KRLB 1IFHL 5GGTL 4LPXA 4NCDA 5FFLA 3ULVD 1C12B 1OCWH 1XF1A 4UB0L 4Y7MA 4FQCL 5EBLB 1JRHI 3O4OB 3KPNA 2YZ1A 3V6OA 1Q9OB 4N5ED 1I1RA 1C16A 5EZLB 2XFXB 2LU3A 4XPBH 2NQCA 1CL7H 1QBMH 2EDJA 2P8PA 3NTCH 4HIEA 5D72H 3VXUB 4UQ3A 5F7FA 1BPVA 1IEBA 5F9JB 1X5XA 1HHIA 1IJ9A 1KCUL 1PLGL 3UPCA 4DVBA 1JHTB 2HA1A 3OKDB 4KKAC 2VDNH 2BDNH 2KZWA 3P4NA 1TCRB 3MRJB 3TYGH 2FD6L 1AD9A 1BFSA 1JF5A 2HVJB 4Q7DA 3F7VB 3CX5J 2CRZA 5F7MC 3UDWA 5E95B 5E2TH 4RNRB 1DQJA 3OHXA 3RPIB 1XR8B 3QFJD 4P2YA 3A6OA 4DOHB 1U6AH 3QUMA 4ISVA 4JDZB 1AXIB 2FRGP 1QQDA 3ORJA 4OGAC 3BI9X 2FNBA 2XV6B 2HTLD 5GJSL 3PDDA 4JPIA 2BY3A 2BVUA 4EI5C 2VO5A 3BYTA 3ZE0E 1FDLL 5FYJE 2BDNL 5KN5A 3ZKXB 3MV9A 4YHYB 1I9IL 4NNYA 5INCA 5DEFB 4F9LC 3I6GA 4FQPA 3ZDXF 3M8OH 5ESAA 3S3PA 5C0GB 4UI2A 1OGAA 3U0WL 3JBG7 4U1GC 1F90H 2IANB 4P9MH 4OLZL 5EO9A 5KS9E 1IGYB 1NC2D 5C08E 4XPGH 4EQ2A 1T1ZB 1VHPA 2FR4A 1JNLL 4PLJD 3TV3H 3VXOB 4HF5L 3P9LB 5DWUL 3B5TA 3DBXB 4MCZB 3JWNC 1ZK9A 3JV5A 2DWEB 3O6ML 3PWVA 3Q6GH 1RUQH 5K59F 4O2FB 4U3XA 2J3SA 1U3HD 4WCYH 1RJZA 1D5IH 5E9DE 3GMNA 1XIWA 5JXAL 3TIDA 3OPZL 3QWRA 4DGYH 8CGTA 4PJFE 2P5WD 3V4PL 3EDJA 5CGMA 3S4SG 4Z0XB 2ID5A 5LBSL 1I7UA 3KPSB 1LMKA 4IRZL 5GRWA 4KKBD 1K2DB 3IDNA 4OCRH 1DBMH 4X6DE 4ODUB 5GRYA 2FR4B 2YPKA 4E0RA 1GGTA 4LKCB 1YEJH 5CBEA 4QYOA 1U8HA 4OF6A 3QH3B 4F9PC 1P84K 3IT8D 3CAFA 1JGLH 5DURB 3RVVD 5I8OL 1I9RH 3PWVB 5L2JA 5DJYB 3FONA 5JDJA 2A9ML 1SY6A 3U2SB 3DI2B 2Z8SA 1PZUB 3UO1H 3HAEH 4XBPA 3HZMB 4HQQH 1G84A 5IP4A 2CDEB 5LQBH 4CMMA 4LSUH 4HH8A 4CNIA 4J4PA 3HMWH 4X5WA 5JPMA 1Q9WA 3G5XA 1R0AH 2PTTA 4JHAH 5J3HD 5FGBA 4JFZH 3P3YA 1NUFA 4RSVA 1I8MB 4FOMA 3MXVH 3LPGA 1HNFA 1BFOA 2AVGA 5H37G 4AEHL 3O3AB 4KVNL 2B5IB 3VMOA 1CICA 3VFOA 2EC9T 3WXVH 2GHWB 4AMKL 2NPLX 2FX8L 3VMPA 1XF2A 1NCDH 3MO1A 1FZOB 3BPLB 2EDQA 3OKKB 5FAAA 2DLEA 2H9GA 1HYSD 2ZG3A 4PRIA 1MVFA 5JR1H 2GUOB 4LHUG 1K4DA 3MRPA 1HILA 1QA9B 2EDYA 2YA0A 1I7RB 3D39E 3IFOA 3P9WB 5MEQB 1AP2A 2GJZA 4HXBH 2JJSA 4Q0XH 1YNTA 3HNVL 4UQ2A 1NDMA 5HGDB 4JRXD 5DHYB 2YBRA 2FHCA 2O5ZL 3W9DA 3SGJA 2J8UE 5B21A 2EH8L 1NGZB 5CEYA 4R7DA 4PY8I 4FQXA 1CZ8H 4JFQA 2ZG1A 4TSAH 1ZMYA 3L3GA 1DEEB 3VRLE 1KLGA 4QTIH 4I2XE 4ZFOB 1YNLH 5IB1B 5L7XL 2J6EL 1QPPA 3QHFH 3QDHA 4KI1A 1FE8H 4U1LB 3DGCR 4B7LA 1P7HL 2IH3A 3UBXI 3DSNA 4FFVD 4M48H 1CGYA 3DX9B 4YPJA 4G6JL 5KSBA 3ZSSA 3DSFL 1MHHA 4OIIH 5HHMD 3IETA 5JOPD 5GRJL 1UACH 4PV8A 4M93B 5C0BD 5ISZB 5FUOH 5FM5O 3PHOB 4HXAL 1WCBA 5E08L 5FGCE 5GRJH 4NPYA 4XPAL 4YNYB 1LNUA 3WBDA 4Y4HA 5TE7H 1QFUH 1UB6B 4EVNB 1MUJB 1VFUA 3G6JA 2MCG1 4PRHA 1I8KB 5I1DA 4OGAD 1S9WB 4PJAE 3LRGA 3GMLA 1HNGA 4Z7VE 3RA7H 3O9WD 2C1PB 4JFOB 3PWPA 5F9WB 4WI2A 4YBHA 5F7DB 5ANMA 5L9DH 5I16B 2CXKA 4L3CA 4PG2C 5C1MB 2FBJH 1I1AA 1KT2A 3I02B 4NZDA 4X6DA 4X7EC 4OF5A 2E6QA 1XCQB 4FABH 1TJHH 3MX0A 5CZXC 5FA4B 4UT6L 3SKNB 2Y23A 2YN5A 5F89A 1OSPL 1UWGH 2GCYB 4YAQB 5C2BH 2JTDA 1G7JA 2ATPB 2M26A 2W9DH 2C3VB 1A1MA 5FDWB 2GI7A 1DUZA 3V95A 5E8PB 3TESA 3K4AA 3ULUD 1ZHNA 2AV7A 4C55A 4O2EB 4NO2A 3TYFB 2ZOLB 3SJVA 4HK0B 3EO0B 5BW7A 3CFDB 2E7CA 3LD8B 2RFXB 3JWDL 2E6JA 3QEGH 3TVMC 1FC1A 1FVCB 1UJ3A 1AO7D 1DBKH 3VGAB 3LKPB 2CKBL 1BJ1J 3CPLA 3DVNB 5D71L 4M6ML 4O58L 4LCCA 5GZOC 1G7LB 1K6QH 1RJLA 5T5FL 4ZD3L 2RAMA 3ZE2E 4Q6YA 4XPHH 3MV7D 4X0KA 1TZHB 5F93C 3EYFB 4K7PX 2Q76B 5HHPB 1D9KC 2YK1L 2EIBA 1A1MB 5FDWA 1S7UB 1UYWH 4NWTL 3SOBH 1XF5A 4D9RE 4YFDB 4NO2B 5GRXG 1OP5H 3TYFA 5HXMA 1WLHA 1HSBA 1U8KB 1MFCL 1KG0B 3K8LA 1J5OL 4NDMA 2ARWA 4KROD 4F3FB 5CJ8A 3FQXA 1L7TH 1AD9B 2HVJA 3TV3L 1LO4L 5HHMB 1H3GA 3LN5A 3GSNL 4LNRB 1QSEE 2OL3L 3QJFA 1F4WH 5HI4D 4WU7B 2GY7B 4QRRE 3PQYB 4MD0B 3RNKA 3TM6A 1A2YB 4K7FA 3GSOA 2PYFA 4LQFL 3OR7A 2HTKC 1BBDH 3HMXA 2ATKB 1K8DA 5D6DA 3CFBA 3MLXH 3V79C 4X80L 1RSFA 2NYYC 3PGDB 1W8OA 5DUML 3U7YL 2P7TB 3MRBA 5HHOE 5HGHA 2K1MA 3F7RA 2VR4A 3VXMA 4B0MM 1Q94A 3BKMH 2IADA 2HH0H 5FF6B 3OXRA 1EVUA 2UY6A 4LIQE 4X6CE 1P69B 4K23H 4CDHA 3Q3GB 3LEYL 4Z7UF 3EDKA 1OGTA 1Z6JT 2GSIA 1NSNL 2ZZUT 4M6OH 1K8IB 4KI5C 3L3OB 1CE1L 4L8DA 3GMQA 5DQJB 4FHBD 4JRYA 3WL9A 2D03L 4OTXH 4NQCB 5T5NF 4R2GB 5C0FA 1W72H 4HEPG 5CIPB 3MV8E 4K7FB 2F19H 3BESR 3MRFB 2HG5B 5HHQA 4BZ2H 4U6XB 3QSKB 1A4JB 4XXCC 3O2VL 5A3IC 1N3NB 5IBUB 4FXGB 2Z35B 5GSRA 4RFOL 5CP7A 4Y4HC 1B6DA 3GJFK 3G6DL 3NFNB 5HGHB 3O4LA 1FGVL 5BRZE 2YS4A 1F2XK 1JPSH 4P9HC 4PJDF 4HIIA 4HUWA 1NBZB 1XT5A 4IDJL 5D9SA 3GI9L 1XR9B 1I9IH 2VXQL 1UM4H 1CFSB 1K8IA 2RCSH 2WUCL 4XT1C 3KR3H 2CMRL 1F8TL 4XH2B 2NZIA 4MS8C 5J12B 3KPQA 5JO5B 1SM3L 1VFAA 2R0WH 5GS3A 4X7CC 4K7PH 2VDOH 3SE4C 2OTWA 5HPMB 2DQCL 4ZDHB 4KUCD 4HDIA 5CBEB 2PCPA 3VE0B 3N50A 5F7KC 1HQRB 1EHLL 2VDOL 3VXME 2O61B 2OI9C 5DJYA 2DMBA 4X7FC 3BQUC 4N0UB 4J1UB 3ARFD 4L1HA 4S1QL 2NY4C 1NH6A 3FFCB 1XR9A 3D25B 1FC2D 3T04D 3C6LD 1CLCA 3TVMB 1ZHBB 3D2UB 4MA1B 4WDIA 4WGWB 5F88B 5GS0H 5IFHH 3G9AB 3SEPA 1T03L 1MY7A 1M6OA 1JTPA 5BV7B 5AZ2L 3HUJA 2LV4A 3BZFB 1CFQB 1FJ1B 3QQNA 3IDYC 4AJ0A 4CGTA 1YYLH 4OI9A 4ZTPL 4DFHA 1FPTH 5DRZB 2PXYB 1FLTX 2H6PA 5F3BA 3T3PE 5E24E 4KJPC 1BAFL 3GIVB 1KEGL 1HQRA 1TLKA 2HTLC 3NFPB 4UTBH 1HI6A 2AP2A 4UU9B 5I1GL 1FL6B 5AUMA 1KEMH 1N2RB 1L6XA 4YPGB 5FV1L 1R3LA 1IAOB 3V0WH 3BMVA 4MX7A 1A8JH 3RDTD 4GKNB 1TTGA 1NBVL 1YMHA 2BSRB 2EYTA 2F58H 2VLJD 2Y7QB 4Q2ZB 3O11A 2NY1B 1H8NA 1ZANL 4I48A 4LHUB 5IJVA 3B9VA 4JFHD 4JRXA 1WVZA 5IR1A 4U49A 4KTEH 1QSZA 4R4BA 4D9QD 2XYCA 4PY7A 3C6LC 3INUH 1CF8H 5IVXE 1VA9A 4QXWA 4HW6A 4YC2C 1AGBA 1NGZA 3EYUL 1MCPH 1DBKL 5FGSA 2BERA 4Y4FA 1G9NH 3VXRB 1ADQH 4JFDE 4H5SA 1C5BH 3WYRA 2IGFL 2PYEB 3RWEA 2JELL 3IU3B 1MCJA 3LS5L 5EBMB 3O4LE 2E9JA 1DUYB 3C87A 2EIDA 3IVKB 2EYRA 5TPWH 5ESQA 3FT3B 3T4YB 4PJ8B 3FTGB 5HSFA 1NKRA 1Z3GL 4LHUA 5IJVB 2BNQA 1A6ZB 4JO4L 3IAQA 2XKNA 5E0QA 3F58L 2MCPH 4X99A 3DO7B 4ZAKB 5H35B 1PG7H 4I5BA 2LVEA 2AXJA 4W4OC 1BM3H 4NQVA 5J8OA 1X4XA 4NCC1 4PJFB 4JRYE 2P49B 4YHPA 3TF7C 1G6RA 1WCBB 1JN6B 1FCCA 3U9UB 5HYSA 2QKIB 1CDCA 4RMTA 4S1SH 2QBWA 3QUYB 5ACZA 1FGNH 4JQXC 2I60H 4C56D 2CJUL 3RWEB 2EIEA 1CR9L 4EDWL 1W0WA 1JYWA 4Y5YC 2Y07H 1FIGL 4LAJH 1QFUL 2Y5EA 1FNLA 3MZGB 3RZWA 2XT1B 1HHKA 7FABH 2PUQT 4HUMB 1NAKH 1Q9KB 1T22A 2Z9TA 2OL3H 4L4VD 4AT6A 1A6ZA 3D3VE 3GMMB 5DS8B 5MENA 3GMPA 1BVKA 2PXYD 4X99B 3DO7A 3Q5YA 2MPAH 5E8NB 5DRXB 1V3KA 4FZ8H 4L4VE 1RZGB 3SKNA 4KFZC 5DQ9A 3U4EA 4PS4H 4U05A 4JREB 4M48L 2IH1A 4I2XA 3QYCA 3P30H 3QPQC 3WKMH 4ZFFB 4DGVL 4I0PD 1AC6A 4XGZA 4O9HH 4PJBB 2ZOLA 1M7IA 1EEUA 2V7NA 2YD2A 1T4KB 1CZ8L 1J1OH 4G9DA 2EO9A 1LEKB 2X6MA 2IALA 4HUKB 1FNAA 2Z92B 1ZSDB 3E6HA 1Q9KA 3HI1B 2DRUA 2BSSB 3FB6A 1P7QA 4YDKH 35C8H 1TITA 4HS8H 1ZGLA 5JZ7C 5HGAA 5E8OA 3UBXA 2J4WL 3QUML 2IPKA 5D2NE 3LS4L 3BZEB 1E4JA 5SWQB 3MBEA 3VJ6A 3VFRB 1YYMH 3A6BH 3RU8H 5JMRA 3SCMA 1EIBA 4P46B 1IGML 5A2IH 1R24B 3L5IA 2Q86A 3P4LA 1YEIL 3OGCB 5I15H 5ALBH 3BGMB 1NCDL 4P5TB 5DQDH 4P48A 1TJHL 3FQXB 3F62A 2Z92A 1G0DA 4NQEE 5E7BA 5IBLC 3O6FB 4L8SC 3KYOA 2QL1A 4O5LL 4OGXL 4JFEE 3HE7C 5E94B 2J88H 5E8OB 3UBXB 4BA8A 1EMTL 1Z9LA 5DRNB 1JRHH 3MRPB 2P8MA 3O41A 3IDGA 4HKZB 3H0TA 5C0DA 4WO4D 5ANME 5E9DD 4GW5A 3ZKMD 5KVGH 5FK9A 1KIRB 1ZVHA 2BRQA 5IBTL 5F6IB 3P0VH 4HC1H 4Z8FH 1QHOA 5C0EA 2XTJB 4FA8A 4IRJD 4Z18A 3SGKA 3SGDH 2XNAB 3UTSA 2VOTA 3S8WA 4PRHE 4ODSL 4XVJL 5GGVL 3BGMA 2ZUVA 2OTUB 5C0IA 1I9RL 2NY3D 2HFFB 1XF3A 3T3MF 3TBSA 3R4DA 3QUMH 1H3PL 2LE9A 4JFQB 4G6JH 4Z6AT 4N0FB 4ETQB 5JTWA 2ZCKH 1G6VK 3VCLB 3PHSA 2VXUL 4QEGA 4WFHE 5DRNA 4ZFZA 2FX8H 1RIHH 4ORZC 4MJ4A 2VZ1A 4JO1L 3MRQA 1YEDB 1JPTH 4X9GA 5E9DA 3RFZC 1J1OL 1N6VA 5IHLB 2XWJA 5L8LB 3RIFF 3QAZB 3BPCA 1TTFA 4JQXA 4NUGH 5C0EB 4MQXC 1KCRH 6FABL 1BJ8A 1HEZA 1OLZA 2QSVA 4LKXB 5E6YA 4Y5YA 1MRCH 3OKDA 5GZOD 3P9MA 4NKOB 3SKMB 1PYWA 1FFPA 3S9DB 2R8SL 5DI8B 4L4VB 3E8UL 1EEYB 3VWKD 1KIPA 2FB4H 4RNRA 4LARH 2XXCB 3NPSB 1JF6A 2DF3A 4QRSA 2VDQH 4OCWH 4HT1H 1I8KA 3EIFA 1HDMA 4TVPH 2EYSB 4WGVB 1JGLL 2YXMA 4EKXA 3WIHA 2G5RA 4P9ML 2W92A 5E99H 5HHNB 3LRHA 4ODHH 4JREC 1IQDA 2CK0H 5HYQA 3MTRA 3BPCB 5D1XD 4NKMA 4WUUD 3WFHA 5J89A 2VXVL 3QG6B 1BECA 4WTZA 5E4EB 3KPSE 5IW1A 3CLEH 2UVEA 2H45A 5IVXB 3O6FD 3WJLC 4EUPG 3WFCL 3RVWC 1GC1L 4JZNA 1MFDH 3SDXE 1FLRH 3LEXB 4GMTH 4OZGB 3R1GL 4LBEA 1KIPB 2OSLA 1OD9A 2P42B 5F96H 3STLA 3BXNA 5CEZD 1CFQA 1FJ1A 4R97C 1S7SB 3GNMH 2Y1VA 5DGRA 2X4PB 2ESVE 1IBGL 1L0QA 1YEKH 3X3GL 1NLDL 4L4TA 4P4KD 4JANB 1AE6L 3ILPB 1XH3A 3OKEB 5F1IB 1R5IA 4FZEH 3RWDA 3WXWH 1DLHB 3S35H 5DD5H 3MC0A 4WV1C 5EOCJ 2HLAA 3E3QE 2FL5B 4IMKC 1YEHL 2R2HB 3KHOA 1RZKC 1MCPL 5FB8A 1NGXB 1MJUH 1ZT1B 1KACB 1RZFH 3BKYH 4BQ6A 1Q9LA 4WI9A 2B4CL 5JW4M 3VFGH 5IFHL 1A14H 1GZPB 2VLJB 2F54D 3F7YB 2AAVA 4FQCH 3EFDH 5C0BB 1TJGH 3AB0B 5ISZD 5DK3A 4HD9A 3P4OA 3UJJH 3FJTA 5F72S 2V17H 1QO3A 3EOBA 4LPWA 4AQOA 3KPLA 5KVMC 5KG9A 5D7KD 3ULVE 4QHUB 3KYMA 1U8HB 1Q1JH 1KIQA 5DK2B 3HC3L 1DN0B 4U6VL 5BZDA 2OCFD 3CXDH 4UV4H 1MREL 2IMNA 1HH9B 2XXMB 3U4AA 1B0RA 3O45B 2J1KA 4ZTOL 4OM0L 1SJHB 4I13B 2R2HA 1LK3L 4P5MA 5TGBB 2V17L 2BOCB 4PJBF 1F4AA 4Z7NF 2IG2L 2BFVL 4U1IA 2WINA 3VGFA 1P9MA 4PRAB 3WIFA 2XA3A 5I19H 1EAPB 3KJ4C 2VXQH 4JG1H 4N0YH 1YPZB 3QRGH 5IVNA 5T1KD 2YRZA 1J9CT 3SY0A 3GMNB 4MHHG 4K2UH 3ARRA 1CU4H 3UEZA 4QWWC 1VPOL 4MQ7A 1OCWL 4U1JA 3RWFA 1GPOH 3I75A 3CMOH 4LF3B 5J4MA 4LSVH 4NQCA 4X6BA 2X10A 3NGBC 5BVPL 3BP6B 2AK1H 3IDNB 3A67H 4W81A 2APBA 4XNQB 3LQAL 2QSCH 4S11A 1QYGH 4R96A 2V5TA 1AD0B 2VDMH 3S5LG 1FNGB 4FXGA 1JZ8A 4H8WH 1MRFL 1T22B 1S7RA 4JZOA 3L1OH 4G6MH 1GAFH 5F3HA 1FP5A 3DV6B 3GMPB 1RK1B 2KQNA 1MFDL 3EJJX 3NZ8A 2XKUA 1ZXQA 1LE9B 5D5MB 3TT1L 1TENA 1RULL 2FEEL 3UJJL 3W11D 5ECJE 3AXLB 3O3DA 1GOGA 3VXRD 2VB5A 4LOUD 1IM3A 2G5BB 4CMMB 1FNEA 5DZOA 4LLUA 5I73C 1JGUH 4GH7B 5DVNA 3QIUC 2YPLE 2RJMA 4ZFFA 3N9GH 5EWIL 2YD3A 4PJIF 5JO5A 3C6SB 1SBBA 5E4EC 5HYSG 3JXAA 1KXQE 4PGZA 5D1XB 3TN0D 2R4RL 5DD6A 1CGWA 2PCPB 4XAKE 1CTNA 1AGFA 3TJEL 1WV7T 1ROWA 4XMKL 2ITCB 1IGJA 1HINH 5KSBB 1J5OH 3P11H 5C71A 2VZ3A 4HCRL 1UA6H 5AYQA 2JJWA 4G8EA 1UENA 3WIIL 2WBJD 1QP1A 2FO4B 4TOYL 3BJ91 4NO3B 1TIUA 1IM3B 1H3VA 3GK8L 2RIKA 3NIFE 4B5EA 5FUCC 5A2LH 2YRPA 3V6FA 2MNUA 3TO4D 4MXQC 5EC2B 1LP9E 3SBWC 3MACL 3FRPA 3WD5H 2O5XH 5HGDA 3DRQA 2VC2L 1FG2B 4GQ9L 1CLYL 5D71H 4KQ3H 4KXZH 3CLFH 5FO8B 2EZ0D 2VWEE 3MLVH 3VH8G 5B8CC 5D7IB 4Z7NE 2ITCA 1INDH 2R4SL 4IRSA 5LJYH 5EO1B 4QRUA 3OSKA 1T20B 2CUHA 3BN9C 4LSSH 2PR4L 2E8ZA 3GSNH 3LV3B 4FFWD 5FKPB 4U3HA 1G0YR 2DDQL 4FNLH 4WI6A 4XNMB 2GIYA 1UQSA 4H1LA 1Y6MR 1XGRB 4WI8A 4OQTH 3ELAT 2BZDA 5F89B 2ZUQC 4OZHE 3PNWA 4HC1L 2D3VA 4JGJA 5CZXD 5E2WL 1CK0L 2XFXA 3OKMA 5ADPL 1WAAE 4UDTA 5CILL 1IL1A 4YFLI 1MJ7L 4CVXA 1KGCD 5LGJB 1S7WA 1CDBA 4Y89A 3GSQB 5ESVA 2YK1H 2AEPH 1AIFB 1FFOB 5FO8A 1QBBA 3VXMD 3CDGA 5IT2H 3X11B 3MV8B 4GW4A 4IOIB 3SGEH 4YXKL 1KIUA 4KV5E 1A22B 3BH9A 4G3YH 4OLWL 4QNPF 4OZFG 3CPLB 1QFOA 3SGKC 5IFAH 4AEIL 1DQJB 1NC2A 3RPIA 3ZDYF 4UT9H 3GSNB 3PHQB 5FUCE 4ETQA 3D0LB 2WW8A 3RWCB 3DUSA 3NIGF 4K9EC 4PJXA 5CUSL 1ZLSH 2V2TA 1NC4D 4LLWB 5B3NA 5IJKA 4LLAA 3FO0H 1JPFB 1OGAD 2XWJB 1WTGT 1OWWA 3O3EB 4L3CB 3HNTH 3QUZA 2GKIA 5KOMC 5K9JL 4PB0H 5DVOA 5C0CD 4L1DA 1KPVB 4P3CL 5ETUB 3I6LE 4X7SL 2J4WH 4ERSH 2GFBB 1JPGB 4DZBB 1KTRL 5SX5H 4KRPD 35C8L 4XHQA 4K3GA 3WFBH 5J6GA 1R3HB 3BKJH 1S9KC 2AJVL 1JWUA 5E6IC 2IANA 2IQAB 3HLAA 4XCFL 4K3EH 3G9VA 1EMTH 5JW3L 1QLEH 1YQVL 4I1NB 1KTKE 1LD9B 3G5ZB 1RZKL 1BX2B 3LMJL 2BP3A 4JAMA 3TH3T 4M93C 3CX5K 3T0DA 4ZUUB 4GOSA 4ZQKA 5GXBB 3QUZB 5GJTL 3NACH 3DWTA 4PJ9B 3H6JA 2AI0L 4PREA 2C3GA 1LDSA 3KNBA 4QNPE 2I5YL 2UVFA 2N7BA 5E08H 2GSIB 4HZLB 5I8CA 3RU8L 1ORQA 2XA8L 3MSPA 2XA8H 1WWAX 3GMQB 1TQBB 4KKCD 4M5YL 2VDRL 3MXWH 5GGQL 1EZVY 4DKDC 4JFYA 5D1ZB 1DQMH 5CUSH 5C0JA 5ABDE 4RDQG 3WJJC 1K5NA 3RGVD 1VFBB 1FIGH 4GT7A 3WLWD 2Z4QB 3DRTA 5TF1L 4BSVA 2LAAA 5BCAA 1S7XA 2B1HH 1WFNA 4LLQA 4AEIH 1K3ZA 1L6ZA 5SV3A 3GI8L 3ALXA 2AJZB 3LMJH 3IDUA 5A16B 1C5CL 3QULB 4KVNH 2OXHA 3MRIA 1QUNA 5HHVL 2DQEH 2ADFL 4R90H 5I66A 1PKQE 2XQBL 5LAXA 4O51B 3RNKB 3HC0A 3TFKC 2A6JA 3QUYD 3ARDB 3S98A 1Z5LA 4YHNA 5FGCB 4CNIB 4PRDB 1JZ2A 1RZIA 1T1YA 4XMPH 1JHKH 1BHGA 3PWJB 5E2WH 5GQBA 4P46A 3QNZA 5E8DL 3FZUC 2EDTA 1Q94B 1I4FA 3QA3A 5I74B 2GSGB 3AS2A 4OQTL 5EBGA 4XVSH 3QIWC 3D0VB 3T8XB 5CS7A 2AJ3B 3RVVC 3O3AA 1TVBA 3O4LD 2HFGH 3TJHC 5F7EL 4EQ3A 4XAWH 3RZCC 2G75A 4JZJC 1AY1H 5M95B 4LPUA 3FT2A 4Z95L 3GRWA 5BMFL 1AR1C 3PL6B 3INUL 4KU1A 5I17A 3N1GC 2H3NA 1OPGL 5C09B 4KJYA 3P0YL 3CZJA 3K0WA 3LKSB 1ZHBA 3D2UA 5EU7E 2IAMD 5GSRB 3BD3A 1G9NC 2DYPA 5J0BA 3NFNA 3FAXA 5TDNA 1NDMB 4ONFH 1NUNB 4GKZA 3B9AA 4NNPH 3GSXB 4EDXA 4Y19B 2B2XH 1CN4A 3OG6B 4KK5D 5JHDD 1E4XI 1A6WL 2AKRB 4W6YB 2OTUA 2H32H 5C0IB 2YC1A 2B0SH 3SE9L 2DQHL 1CG9A 1KCLA 3GRWL 4R7DB 5AAMA 5I75B 5ILTL 1E27B 2LTQC 5I18L 3I75B 5FXCH 3ARFA 2Y25A 4DK3A 3VDCA 3L3KA 1QSEB 4YHML 3KXFD 4UILL 2Y36L 3REVB 1OLLA 4HWNA 3QDMA 1EGJH 1S8DA 3QIBB 4RDQF 3BIBX 4J3TA 4Z77A 4C83A 5SX4H 4H26A 2OJEB 1BF2A 2BMKB 1A6AB 4JPIB 2QTEA 3TO4B 3RKPA 4DQOH 3LZFH 1A3LL 3QHZL 3QJHB 5D96C 1S5HA 4GQ9H 4YBQD 1IEHA 3SPVB 1UCBL 4QXGH 2VRAA 4EOWL 2GAZB 4L5FL 1INEL 3V4PH 2G5BA 5ISZA 3KXFB 2AXGA 4WDIB 2EKSA 5DMKA 4YHZL 1ITBB 1I75A 4YNYA 1LNUB 3OZ9L 1R5VB 2HJFB 5FYKH 4WEBH 4M61A 1L9NA 3ARFB 3LKRB 1Y0LA 1MCLA 4HKJB 5DLML 1SJVA 4J3OC 3V4VL 5ICYB 2OK0L 1UXWB 1UA6L 1DZBA 5JHDB 1RJCA 3HMXL 5E5RB 1A02N 5LKNA 4NNXA 4PJAB 1GPOL 1R3KA 3AMKA 3GIVA 4JG0H 1UJTA 4ZOAA 3KPRE 1A6AA 3U30B 4K94L 1YEFL 2Q8AL 3L3IA 2R23B 4NFCA 5MEPB 3RRQA 1MFAL 2JLLA 4YH6A 1HHHA 4XCNA 4QHKI 1HCFX 2PTUA 3MRGB 4PJFA 2YPLB 5DO2C 4JZNB 4E42B 2BVEA 3TNMA 3V0VA 4DN4H 4YDIH 1HQ4A 1VKXA 1T03H 1AQKL 5SWSD 3CFEA 4G8IB 4YXLH 1LO2L 1IKFH 4K9EH 3RY5A 4HKJA 3VG9C 5IWLA 2IG2H 2C1OB 4I4WB 1AFVH 3ARZA 3HMXH 1X3DA 4NZTL 4OBRA 4XTRC 4NIKB 4OM0H 2ZOKA 1A7NL 3BZ4B 4GXVL 4H8WL 2EDHA 4ALAH 4P46C 1MWAH 2FEDD 4DW2L 4PTUA 3GKWL 1J05A 2OR7A 4PP2B 5FYKL 4DVRH 3PWLA 3KWWB 1OAYH 2E7LA 2E27H 3BHBB 2AK1L 3LEYH 2VH5H 2HFEA 3ARDD 4KROC 3VFSB 4XI5D 1AFVL 1G7IB 2CDFA 4EOWH 1R5WA 2HKFH 1TNMA 4OCYL 5SWZB 1TJGL 3GSUA 1PDKA 4H25A 4GAJL 1S9XA 1LQSR 3FTGA 5IMOA 4ESKA 4F7TA 4DCQA 2R39A 4JN2A 4YHIA 5D72L 1R3JA 4YR6B 2ZPKL 1JIBA 4KH2A 4IOSD 3K8MA 3EKCA 5I1CL 2I26N 1Z9OA 3B9DA 1X5AA 1QR4A 2VITA 4G7VH 3U6RB 3X11A 3ZLQC 4E5XA 1T0PB 5CEZE 3TBTA 2AK4D 1YY9D 3CVHB 3T2NH 1V8HA 2IAMA 2BSSA 2Y06L 5KAQF 3KPPB 2VNCA 4HBCH 4L3EB 1FH5H 3SDYH 4D3CL 4NZUH 4O4YL 4KKNA 3BHBA 3GMOB 3PHQA 4R4FL 1B6UA 3EO9H 3GBNL 3BAEH 4NSKB 3SDDA 1MCDA 1QSED 1HILB 1RY7B 3ETBF 3O3UN 4OGZA 5DMIL 1EGJA 3MYJA 1NC4A 4PUBL 5SWQA 4J3WA 1HWHB 3CXDL 5IF0A 2DI9A 5E5MA 1ZKAA 1ZTXH 3VFRA 5D8JL 5E2UH 3CXHK 4OCMC 3QDGB 5I75C 4LLVB 3SGDI 1EO8L 4I3SH 1C8PA 5ALCH 1G7MA 3Q48A 3CDFA 1X5JA 4HSQA 3V6OE 4ZO9A 3N1FC 1JPGA 3AROA 4NRYB 4UIKL 5DJDA 5EU6A 4I0CC 2B4CH 1UM6L 4PJBE 1B4JL 4GG6E 4MJ6A 5CD5C 4LF3A 1H0DB 4PB9H 1AY1L 1URLA 3BX7C 4GRLA 5EU3B 2XTJC 1T89A 4Y5XA 1M7IB 4ZAKC 1FYTA 2F5BH 2EDOA 4TVPL 3MYJB 1BQLL 2F53A 3LQMA 1N7ML 1A0QL 3DROB 3W9EB 3IDJB 4MJIA 5K59E 1A6UL 4UV7L 1D5ZB 1ZSDA 3BO8A 3E6HB 1UB5A 2VLLA 4ZO6A 1IBGH 2QQLL 5F9OL 3CFCH 4RGOH 1FVDB 1NKOA 5D5MA 1FRGH 3AXLA 3N1PC 4P57A 3O2DH 4WTWA 1RAMA 5A2JH 4M7LH 3V5DB 1T2XA 2A0LD 4XP5H 1N64H 4WUUB 3U48A 4S1DC 4M62L 2IQ9L 4LVOB 2Q86B 4PJGF 3OAUL 3D85A 1SBSH 3QFJE 1RZ8A 2VXVH 4KHTL 4ZDHA 3BRFA 5J9PB 3PWPB 3IDJA 4MJIB 1LE5A 4M9OA 1H3PH 2J5LB 4EUPH 1LK2A 2X09A 1CXIA 4CVWA 1G9MC 5GS1A 1DQML 1CIUA 5C08B 4OI8A 3QCVH 4TVPD 5IWLC 1FSKC 3CUPA 4NN6B 5INDB 1HEZB 4LKXA 1DVFB 4OCWL 4G6FD 4P57B 4O51A 1QEWB 5GGTA 2ED7A 3BPNC 3GHEL 5I0ZA 1XGPA 1ZOXA 2HT2C 4JGMA 4D9LL 2A9NL 2Q6WB 4NN5B 5KVGL 3Q0HA 1EEQA 4MLIA 2GK0A 5HY9A 1MRCL 1I4FB 1MNUL 1M05A 3QA3B 1HDMB 1HHIB 3IS1X 4YZFE 1PGRB 1FZJA 1NCCL 1RZKH 1WC7B 4Z0BH 5HVFB 5T1DH 5T1DL 4JFHE 5HHOD 2A1WL 3JTTB 4ODTH 2DQTL 3VFVA 4PJ5E 1JV5B 4BFGA 1MEXH 1F3JB 3RA7L 1P5UA 2CIIB 3MNWB 1BZQK 3U7WL 4OLEA 1PJ9A 4LCCB 1T20A 2MOVA 1ZHLA 2NY3B 4M43L 3UTTE 1AGCA 5FUZH 4S1DD 4R97B 3MLYL 1XZ0A 5DJAB 3PE9A 3NCBB 3TIEB 4H1LB 3T0EA 2W60B 3ULVC 4KV5F 2OX5A 4D9LH 4JM4L 1X5GA 5EN2B 1U8MA 1Q0XH 4MX7B 1H3WM 4XC1L 3PIQA 4Q2ZA 1IGMH 4KTDL 1A3RL 4RQQB 4G8GE 5BO1L 4JB9H 2Z0BA 1F4HA 3DX7A 5K9JH 1B0WA 5KVEH 5KVEL 3RHWF 2GK0B 3BXNB 1PY4A 4JRXB 5F7LB 3ZE0F 1UACL 1T83C 2HMIC 4XWOC 1HSBB 5HI5D 4O02L 4WI3A 2DN7A 4X7DC 4P59L 3KLDA 1BGXL 2XTLA 4WW1A 4L4TB 4XMLH 1BQHB 2XG4A 4PY8J 3U7AA 5IB4B 3W2DL 4NFDA 1OGAB 2D0FA 2FEEI 3WUWB 3WE6B 3LN5B 5D6CA 4G3YL 4QRSB 4J2XA 1ZHLB 3JTSB 3N0PB 5D2NB 4M3KB 2N4IA 5IT2L 4MVBC 4OFPA 2R9HC 5EBMA 1NGXA 3FRPG 5DR5L 1PX3A 4N8CH 5GRUL 3VXOA 5DYOB 2UUDH 1KELH 4P99A 5SWSB 1IM9A 4P46D 3W2DH 1WT5C 3VXMB 3NGBB 4G9FB 4C56A 4QOKD 4Y0GA 1I1YA 4X7TA 1T89C 4Y5XC 4Z7WA 5F9OH 4ZAKA 2AV1A 5H35A 1MCFA 4PJFF 2NR6D 1FYTD 2F15A 4X6EA 2V5RA 4JGUA 2GT9A 2D7TH 3GHBL 2FJFB 5HYSB 4RZCB 5BO1H 3S7GA 3UBXG 1X5HA 4JRYB 1GSMA 5I8OH 2HP4A 3MRMB 5ADOH 4OLUL 4RX4D 1IC4L 4I9WE 1INDL 2GJ6D 3ZKSD 4F9LA 1P6FA 3I9GL 4XNXL 3LN4B 4ISVB 4Z9KB 4LKCA 2WINB 1A4JA 3WIFB 1CR9H 1SQ2N 2WQ8A 4EDWH 5JPNB 3U7WH 1JP5A 5CSZB 4AH2A 5FA3A 3T0EE 4OGYH 4AT6B 2EDEA 3T65B 4L29B 2HLFC 1GXEA 4I18C 3Q6FA 3GM8A 4CN1A 3HE6B 4PREB 1BD2D 3C8DA 5D1QB 4FRWA 4YFEA 2WWMC 3GSVA 1RZGA 3AM8C 1R0AL 3PWUA 4M4PA 1V7ML 4FS0A 4TQEH 2BNRB 2J5LC 1I85C 4PS4L 3MGTA 4QRPA 1HXYA 5J1SC 1JFQL 2PF6A 1D5MA 1J0KA 4KRNA 3MRDB 1JCKA 1DVFC 3RUGF 5DJ6A 3JWOL 4X6CB 2HN7B 3D69B 1RJYB 3DVIA 4XRCB 4AH2B 3FFDA 1U3YA 1A6TA 3IXAA 3PWLB 3NZ8B 3M8OL 1TPXC 4KQ3L 3ARGB 5D1QA 3KJ6L 4M9PA 2GTWB 4ORGB 4JFFE 2CJUH 1DQLH 5TGBA 1KCVH 1HXMB 4J3SA 5F88A 3IFOB 4OZ4B 3SKUD 1KJ3H 3LVEA 3PXHA 4HIXH 4P9HL 3VXPA 1NBQA 4QHLA 5JIHA 3S35X 4PJGE 3FCTA 4M6AA 3BP4B 2Z31D 3D0VA 3SY0B 1SEQH 1XGTB 3EJYD 3EYQC 2NW3A 3WNNA 4TOYH 3V9FA 4OD2B 1EERB 1CD1B 5F7WC 3BAEL 5I1GH 4I77L 4X5XA 2PYED 1JZ5A 3NFPA 1RVFH 4GRMA 5GS2D 4D3CH 3EW3B 1J1PH 4L3EA 3UJTL 3ALPA 1A0QH 3KDMB 2FATH 2OLDA 3PABA 1ZVYA 4M6NL 4ZTPH 1MLBA 3PJSA 4LPTA 2H3NB 3RAJH 3H9SD 4YDIL 3OX8A 1QLRB 3U36A 2P45B 1AD0A 4H0IA 1QBML 3NTCL 4JEGB 3IDXL 1CFTA 2ICWA 2VLJE 4QHLB 1VSCA 5C0AB 5IROC 3RWIB 2VISA 4FQ2L 4Y19A 4PV9A 3K74B 2HJKB 1NUDA 4OCYH 1BJMA 2AKRA 5D2NC 1NBYB 3CU1A 3KGRA 3TT1H 3WDJA 1LK3H 4CUCA 2JJSC 2D7NA 1JZ3A 3CSYB 3VWKB 1FZOA 1KN2H 2EDBA 3QXUA 1K85A 4HIHB 4MDIB 4TVSa 4MXVE 4GRLB 1C1EL 4XP1L 5EU3A 4Q9CA 3C6SA 2DQCH 4TPRL 4GKSB 5EIQA 1V3MA 1MIEL 1NEUA 1Q1JL 2AQ3A 3EO9L 2WLYA 2HWZH 5DD6B 2F53B 4OUUA 4P5KB 2OJEA 1BD2B 1CXFA 4WI7A 3IJSB 2OMNA 2XKNB 4Y4FC 2OJZL 3K46A 4MA3A 1KT2B 4KDVA 1YYLL 1V7NL 3SPVA 2A38A 2FO4A 2WBKA 4YDJA 3SO5A 3QDMD 1KENH 2P1YA 4QGYA 1AIFA 1HOCB 2A77L 2E7BA 3KXFA 4RWHA 3G6DH 2GCYA 4JY4A 4YAQA 3Q1SH 1NEZB 4EUPB 1R5VA 2HJFA 4WUUA 5DJ0B 2Q8AH 1HZHL 3A0OA 1TZIB 5DD3H 3R0MA 4O2EA 4H0GA 1W0WB 3F5WA 2RFXA 5CJOH 1CLZH 5IB2A 2OBGA 1A9EA 2CPCA 5ITBH 4W68A 1V3JA 2R9HD 3HI5L 4J6RH 4JQIL 25C8L 4APQC 1BD2A 1IQDB 5HYQB 4NC2B 4K3DL 2B2XL 4KRPB 4FFZL 1MHHB 5KSBF 4K7PL 4XCNB 5IQ9A 4WO4B 3SKOB 2VR5A 1CT8B 3KYAA 4HFWA 1DVFA 4YDJB 3RTQC 1GC1H 5HDOA 3IRPX 3I6KA 4XNUL 4L8BB 2XZCH 1INEH 3NCEB 2HLFD 4OM1L 3H7BB 4AYFA 3VW3L 4LSTH 2WUCH 1FL3B 2VZUA 1N4XL 3MROB 5DJ0A 1IAKA 4UDTB 1J0ZA 4NQSA 4AG4H 1D5XB 4DQOL 1QFWH 3ECBB 5EU6D 1MCBA 5HDQL 4KDWA 1CDYA 1QFHA 3T77B 4HWEH 1TPXB 1A9EB 1N26A 4PRPD 3HZKA 5F71A 1CI5A 3TGXA 2ZJSH 1LEKA 3KYNB 1FFOA 2AABL 3MNVB 5BV7C 1NFDB 2APTA 1A9BA 3C5JB 4KC3B 2ESVB 2IPTH 1FIEA 2W0LA 3P77A 2DMCA 2ENSA 2VLRA 5C0BE 2O93L 5C0CA 1F3JA 1J1PL 5I74C 1NLDH 2K7PA 3E8UH 1QRNB 1BQHG 2BOBA 4Q6IA 5D70H 3GSNA 1BZ9A 3DYMA 4ETYA 3QWOA 3T4AB 1A2YA 4E41E 2CLZB 5EOCH 4YE4L 5EN2A 2B5IC 4WEBL 1UG9A 5IMOB 2FH6A 3MREB 2P8PB 1UGNA 2OZ4A 4Z7WE 1R3JB 4YR6A 4PJ7F 4WV1A 1JPTL 5FEBA 4OV5B 3GI8H 3BVNA 3LB6D 1CLOL 3E0GA 1DJSA 3UTOA 3G5YB 1Z9SA 3F7VA 1F4XH 3IFLL 2DWDA 2VLRB 2VLRD 4C54A 1BBDL 2H2SD 1JTTA 4HV8B 4HCRA 4PJCE 4QHMB 4W70A 3QDJE 3VRJA 3D6GA 4UILH 5HHQB 3UTPE 1BX2A 1MFNA 2OR8A 5DD1H 4PRAA 1VDGA 3G6JF 1A4KA 2VDLL 1T04B 4KK6D 3HB3D 3RIFK 5L8JB 1JHKL 2GSGA 3AAZB 5I71C 4KY1L 1LO0L 3EOAB 5GJTH 3OJDA 4GMSH 4NKDA 2NY2D 4R3SB 1W72B 1RFDL 5CIPH 4YK4B 4IRJB 2I27N 5EUKB 5CKGA 4KUZH 4NM8H 2IANE 1ORSA 3RVXD 5IVXF 1KXVC 1MCWM 3EDFA 3MGOA 4ODWB 1I3VA 4P2OC 5EOQL 3FL7A 1M7XA 5DHVH 4UOW1 5T1MA 3HR5A 1K6QL 3VXSA 5ICZB 4GAFB 2EDRA 3E1F1 4AZ8A 1BOGB 2Z91A 2R1YB 2YKLL 4G9FE 3TEUA 4FFYL 4HC1A 5IG7B 4P5TD 3Q5TA 2JKXA 2IADB 1N5AB 3RNQB 4Y5YB 3VD3A 1I8IB 2DQJH 3KS0J 4R2GC 1AHWB 2X4UA 3PGFL 2AK4E 3WHXA 2I5YH 3ARDA 4LEOB 1IKNC 1RUPL 5I0DA 3QQ3A 5EA0H 5D7JC 4L4VA 3OB8A 3VXNA 3L3DB 1CDHA 4WFED 3S37X 4WUKH 2R2EB 1Z0NA 1DLFL 2EDDA 4LGSB 1B9ZA 1MEXL 4HJ0C 4DK6A 5I6XB 1JMXA 1T6VN 3T8XA 4NZJA 5GRUH 5JA8B 1AHWC 3T0WA 2Z91B 5DRZA 3SDAC 1H8OA 3WMSA 5E7FA 4NKMB 1IGJB 4GLRH 3SKJH 1A3QA 1RFDH 5IM7B 5HBBA 4U6TA 5T33H 1OAXH 3V5KA 8FABB 4GAGL 2GITA 4ZPVA 1JNJA 3MMEA 4XMLL 5DRWA 2LFGA 5I15L 4LU5L 1IAOA 3H9SE 2UWEB 1NEZG 4ERSL 3TO2B 3LQZB 2AS5M 5C9JA 3QCUL 3PGFH 5I8KL 2CDGA 4HXBL 4IRSD 2A6IB 1NFKA 4X8JA 3F12B 3O2DA 4J4PD 43CAB 3CFKA 4LDOB 5GGRA 5TE6H 1VFAB 4XBGA 1U3ZA 4FFYH 3PP4H 4OIIL 4PGCA 5ERWB 4LU5H 1GH7A 4HKXA 2NTFB 4RAVB 2COQA 2DQFA 3I84A 4L9LB 2F53E 2NW2B 3H2WA 3NA4A 3ZE1E 1CLYH 3CSBA 5T33L 4U33A 2EXYC 4IRSB 4GRMB 1R5IB 3ULUE 3WFEH 5IFAL 4F37K 3KDMA 1OAQH 2W91A 2IQ9H 4XWGH 4BK4A 1MCOH 2FL5A 2BRRH 3EYOB 3REVA 5JHLL 3QIUD 5I76B 3VWJD 4NT6B 1UQSB 3OF6A 2L7UA 4QT5A 4GG6A 1ZT1A 4Y4HD 2EYRB 12E8H 2F9BT 4U1HA 4JKMA 1OAZH 1PG7L 2AJVH 3O2WH 4Q9QH 4FTVA 4RGNC 3F12A 4FQJH 1E4KA 4WUKL 5C0BA 4IRSC 2YWZA 4LP5A 3RL2A 2O5ZH 2JB5H 1VFMA 4LLYA 5EA0L 3SQBA 3GGWB 1WZ1L 2B1AL 2YN3A 3C60C 2G9HA 3MRJA 3UTTA 1BQLH 1BQHA 2PR4H 3C60D 4OLYH 1C5BL 1FV1B 2BXYA 4CU7A 4CADB 1F5WA 1JVKA 4OZGE 2HFEB 3VFSA 1EJOL 4OF7A 4NJ9L 4ELKA 3SE8H 1QSFB 3ZTJH 5I1KH 2YPLD 1GGIH 1INQA 2ADGA 1BBJA 1CD0A 4GUPB 5J7CC 1PSKH 4KDTA 2XN9E 4ZXBB 3B9EA 4OM1H 4XI5C 1H3XA 4R7NA 3RP1A 3EHBC 1Y6KR 3GMRA 4XX1G 4OQTA 1RU9H 2G2RB 1F4YH 1QBLH 1S9YA 5I1AA 4JHAL 4MSWA 5H94A 4KUCF 4K3DH 2VITB 3BN3B 1KTDA 4KKBC 1AGBB 5TFSH 2MKLC 2VL5B 2BVQA 4NPYB 5DMJB 4Y4KD 3CFCL 4G8IA 1PKOA 4JY5L 4KK9C 4EUPA 3QQ4B 4RMWA 1LGVA 1ZA6B 1GGCL 4UTBL 4WY7L 2Z31A 4X4XA 3LKNA 1UWXH 1LP9B 4PRHB 2HJLB 1WBZB 1J0HA 3MJ7A 4OAWB 1S7TB 3BZ4A 1AC0A 2WK2A 5LG1A 4WHCA 3KPSD 1IT9H 2BNQB 3BGFC 2W0PA 5DO2D 1SJEA 5E6IA 1I8LC 15C8L 1KOAA 1F4XL 3PG2A 2ADIB 2P5WB 3NIDE 4P23B 3SKOA 1DBML 3B2VL 4FTVD 4JJ5A 3QUKA 5KTEL 3I50L 4HWBA 3PP3K 4APQA 5I6XC 3KNBB 3QIBD 3OKLA 4U4BA 3DMMD 4LVHB 3GSRA 5J1AB 1WFUA 3FQTB 3SDAD 3TVMD 3B8YA 5DT1H 4JM2B 1SVCP 4TPRH 3BW9A 2CKNA 3IDIA 3EO0A 1D5MB 3T2PA 3B8SA 4NN7B 1QYGL 43C9A 4ONGH 1FVCA 3IRZA 5MHSD 4BFBD 1SYSB 5GRZA 1AGDA 3K80A 1E6OH 1M1SA 4UNTA 5C07A 3GMMA 5DS8A 1JZ6A 5GZNC 4EN3B 3T2NL 1QRNA 3IS0X 5EOTB 2C9AA 2AQ2A 2CDEA 2XTJD 1EK3A 2HT2D 2ZUWA 1FAIH 1MHCB 2X4TB 5C2UB 3P0GB 3RVWD 2L0DA 5JPMB 5HGBA 4MLSA 4Z7UE 3G5VB 3QRGL 5MERB 4JHWH 4OZFA 1ND0B 4Q6IC 4OFVA 5TDPB 1A7QL 2J7LA 2IC2A 1T6WA 2J8OA 1KJMA 1DL7H 4M6NH 3MBXL 1OAKL 2F54A 3MBEC 1YMMA 3VI4E 1II4E 1NCTA 4QHNB 5CD3A 2VH5L 4L4JA 5ID0A 2E8YA 5DJDB 5EU6B 1CXEA 3QUXB 2E3VA 3SCMC 4HKBB 4U7KA 4FFZH 4MJ6B 2D03H 4OTXL 1MCIA 4UV4L 4ZOCA 5EIVA 5K93A 1U8OA 3LQAH 4M6OL 5GGSA 4WTXA 1AKJA 3OX8B 4MAYB 1AGEB 4X98B 5CJBA 1BD2E 1KTLA 3WFCH 5E8EA 1OW0C 5FM5M 4NP4H 1IL1B 2F74A 5K9OA 3RZCA 1R24A 5CMAB 1IC1A 4PP1C 1U58A 4WHTB 4DTGL 1YN7B 2HJKA 4KMLB 4HG4K 3L3HB 4LQFH 5JOPE 4GSDL 1LEIB 4PYGA 4URTB 5FGRA 5FKAA 2YC1B 3ZL4L 3PP3H 5J1TC 2OJZH 1NFIA 1P4LA 5EU5A 4XZUA 5FO9B 5I2IA 2FATL 1A7OH 1RK0B 3B6SA 4YHYC 1TFHA 1P5VA 3MRRB 3ARVA 4M1CC 3MNZB 2P8MB 5KSUB 3QDMB 1E6OL 3H3BC 4JQVC 4NGHL 2EEBA 2NY0D 1UXSA 3MUY1 2L4OA 4F7PA 5GGVY 1G7QA 5F9DC 5I1JH 3ZHKA 3SOBL 2WWKO 3MOAL 5ITFB 2DS4A 2DQDH 1FO0H 3VH8B 4DVBB 4LRIC 3TA3B 3HPLB 5DFTA 5JUEL 1AH1A 1I8IA 4Q9RH 4Y16A 5L0QB 1U8PA 3BE1H 4QY8A 4XPHL 4KZEH 4IDLA 5JNYA 4GRLD 1Q72H 1ULVA 2BVYA 1ZGLM 4Z7QF 1CFSA 2RBLA 3B5HA 4NQEB 4NRXB 3LZFL 2HAZA 3SE8L 4ZMAT 4JN1L 5ENWA 1KLFA 1RK0A 4GXUM 4MJID 4HIJA 1MIML 3BUTA 3NCJH 5D7IE 4P23C 3FMGL 3W81A 3ZKXC 3NA9L 1EGJL 5I73B 4A2LA 1KF9B 3RBSA 5ID1A 5TQ2L 4MCYA 5I16A 2D31B 2W9EH 4ZUUA 4TULH 4XVJH 4W6WB 4HHAA 3RWDB 3MNWA 2VLKB 5CCKH 5E8DH 4TQEL 2X41A 4JDVA 4R6UA 5J6HA 4FQ1L 4PLOB 1ZHKA 3SDAA 3GBML 3DGGA 5C9JB 1MVUA 4H1LH 1CE6A 4RQQA 4NQUA 4XCYA 4N8CL 3RIAF 1BJ1H 3BT2H 2VIRB 2WBJA 5C0JB 2D7QA 4UQ3B 2CO6B 4HK0A 3FQUA 3FT4B 3SDDD 1RIHL 5JW5B 1OPGH 5JPNA 1FQ9C 4ZUTA 2VQ1B 3KJ6H 4G6KH 1YUHB 3QPXH 1YEIH 3VFWA 3DVNA 3O6KH 1HI6B 2NLJA 3FN3A 4O2FA 2C4FU 4NBZB 5D6CB 5CEZH 4OFYA 5F7EH 4UUJA 1GGYA 4YDVA 3RVTC 4LEXL 5LAXB 4CL7A 1XIWB 4G43B 5EZIL 1PKQB 5T3ZL 1OTTC 1X6LA 2VABA 5T3ZD 1DQQA 4UAOB 1WZ1H 2B1AH 2NY1D 3QQ9D 3QHTC 4V1DB 5IB3A 1NMBL 1NCWL 2ARJB 1NMAH 3STLB 4F7TB 1I1YB 4X7TB 4P4RA 3EBAA 3KPRB 5ELIA 1CS6A 4LSRH 4WV1B 4WEUD 3T1FA 3GZKA 4QRPE 3KLHD 2BHZA 5GGUA 1JRHL 4QTHA 5IVZA 2A6DA 2HN7A 3BP7B 4Z78B 3U6RA 3L95A 3PUCA 2FBJL 2MMXA 3H42L 2DWDB 1HHGB 3K1DA 3V7AG 5AZEH 2NLJB 4QRQA 1J8HE 5HJ3B 4K3EL 3U0TB 4A6YH 3JV4A 1BWMA 1E4WH 3MLRL 1QSFA 5GIRA 1X9QA 4OBSA 1DQTA 3SO3B 2VZOA 4OLUH 5ADOL 1ZA3A 5IOPA 4XP9H 3J7HA 4HWUA 4M7KH 5DXWA 5JIIA 4HUXA 5D7KE 2R0ZH 3VXTB 3CK0L 2DQJL 1T7ZA 4FTVE 2PW1B 5GGVH 1QO3B 2W1NA 4LCWA 5EPMA 4AIZB 1RD6A 3IDMB 3MR9A 4KKLD 1IM9D 3U82B 3NFSL 3FZUD 2VLME 5EIIA 4OZHA 5AG8A 3V7MA 2GK2A 4M1DL 1F2QA 2IAND 4LGPB 4YDKL 3QZWG 4NZRH 3U9PL 1E4WL 1P6AB 4A6YB 4DZ8B 1F97A 4EI5B 5HGGS 2FLBT 4YHKL 5T1KA 1EZVX 1FYTB 4MD4A 1KB5B 1RHHB 3U0PB 1EUUA 1X5ZA 3OAYK 1ZT4A 1NCCH 5CLTA 1SHMA 3VWJA 3ZKND 1YPZA 1DP0A 1TZGL 1N5AA 1TVHA 3L7EA 1LO0H 3ZYOA 4KGLA 4GRLC 4I3GA 4ZS6C 3MRKB 4XBEH 2QR0B 3CDYA 4KK8C 3GHEH 2R15A 4XB7A 4Q0XL 5E1AB 5HYJA 1MAJA 4FXKB 3OKOB 1OHQA 4HG4J 1C08B 3BRDA 4MNHA 3HPJA 3ARGC 4PJBA 4UZGA 5IB1A 1I8MA 2I07A 3NA9H 3BP4A 1P1ZB 3RY6A 3RVUD 2DKMA 2NW3B 3T08A 1T4KA 1OD7A 4G7YL 3UX9B 4YBLC 5DURD 3H8NA 2KL6A 4KTEL 2R23A 3WXVL 1HKFA 3DIFA 3MV11 5JLZA 3CUPB 5SX4I 4KZEL 3VGHA 3ARUA 1GGBH 3KPMB 2P43B 3O3DB 2Y72A 4HWBH 4NM8L 2YPLA 2QHLA 4AENB 2KBGA 3VGAC 2V9QA 1D5IL 2UWEF 5MEQA 1VGKA 4HJGA 3OXSB 1C5DB 3FN0H 3ZT5A 1A1OA 3M1BB 4QCIA 3Q6GL 5JW4Q 3ARSA 2P4AB 4JO4H 4KRPC 4CVXB 4J8RA 3F5WB 5HHOB 1XAUA 4IHOA 2ZCHL 3P73B 2BY0A 3KPTA 3PQYD 3MFGB 4ZNCD 4GLRI 4NYLB 4WRLA 2DLTA 1A7OL 1F3DH 1FPTL 3HUJE 3BSZL 3QDJB 2D9QB 2ZWLT 5CEYB 4UAOC 4XPGL 4QRRB 4C4KT 1EFXD 4IIQA 4LGRB 3ZE2F 1MAML 2HKHL 1FL6A 1VADA 3EYUH 4PJ5B 5GSVA 4D9RD 4X4ZA 1WTLA 3AFLA 4G6FB 3H7BA 5H37H 1AKJB 5FYKU 3HI6L 4PBVC 4LLWA 3EAKA 4PJIB 4U1HB 2CRIA 3WD5L 4PG9B 4LCYB 5I1HH 4KPHH 1RULH 1ADQA 4HIEB 1NLBL 3A6CH 5HD8C 1D5XA 3DUHA 5CMAA 3V4UL 4M1CD 3PWPD 2E7LC 2P8LB 1JPST 4LLYB 5C0NC 1JHTA 1J87A 2MKWA 4MNGB 3S88H 2EDLA 5I1JL 1U6AL 5A2KH 5A3ID 2W9LA 4XVTL 1OW0A 2ZUQB 3QDJA 4J4PC 4E5XB 4HPYL 1SYVB 3S36X 4KXZI 1NEZA 1Z3GH 3HS0B 3KJ4B 2F5AH 1B2WL 1MI5A 3LV3A 3B9KC 3BEVA 1BZ9B 5JMOC 1BAFH 4P3DA 4XNMA 1ACYL 5DD3L 3MJGX 4M7ZC 3OL2A 3WHE0 3BUYA 4IM8A 2ADGB 2R56L 4J3UA 3Q1SL 1NPUA 1QQDB 1I9JL 2EEDA 1T21A 1EHXA 5EWIH 4IDJH 3MREA 1T1WB 2GJ6A 3BDBA 2DL2A 2K3TA 4HFWB 2D7PA 1VCAA 4NKOA 5C3TA 5IJKC 4M7ZB 1K9TA 5ESAB 5C0GA 1UCTA 4GW4B 5E00B 1QVOA 3IFNL 1U93B 1JGDB 1UM5L 1QG3A 3O9WB 4RMVA 5BOZG 4LNRA 5DDHA 2J8UB 5IHBA 1MIEH 1ES0A 3SJVB 5IFJB 1N0XL 1X5YA 3JWDC 1U95B 2ZP0T 5ISZE 2ATKA 2X4NB 5I9QB 3JZ7A 25C8H 4PJ7A 4MZ3A 5F21B 1K4CA 2X4SB 4NZTH 1T04A 2ZUTA 1NGPL 2HRLA 5CJOL 5A16A 2FD6H 4UINH 5E6IB 2B7DT 3LKOA 4HS6A 1OAKH 3STZB 3O9WC 4FQXC 5FDYA 5F1KC 5JXEC 3QXTA 1G6RH 2CMRH 1I1FA 3BP5A 4P23A 3TWCH 1RJZB 5JIKA 3VU2A 4F33A 3QCTL 5IHZA 3MYZA 3GSRB 2XZQH 1MJJA 1QVOB 1HSAA 4YHOH 3EHBD 1OWRM 1KULA 3WL9B 3MGTB 1XF5B 2R56H 4GAJH 1B3JA 1IAII 3O2VH 2EECA 4BH8A 3KYKH 4NUJA 3O8XB 2X1WL 1B2WH 1RJYA 4XRCA 3OAZH 2FGZA 1A7PH 4HFUL 1PQZA 5IB5A 1XH3B 3OKEA 4HS6B 3STZA 3RX8A 5F96L 3QIWB 3WJJA 1CD9B 3TZVB 3ARBB 4U6YB 2HLAB 4JFPA 3I6LD 3DTXA 3GSOB 1EV2E 4CN6A 4KRMB 1K8DB 4MB3A 3VGGA 1CGVA 5KZCD 4WJ5B 4QXGL 4X5WB 1CDUA 4Y5VB 2OYPA 3CLEL 4LVEA 1GGIL 5BZWB 3GSXA 2C5DC 3GI9H 1BFOB 1A1NA 2SEBB 4Z95H 1NUGA 2Q8BH 1BWWA 5TQ0H 1GHFL 4Z7WF 4P5TA 3AC0A 3SJVE 1BVLA 1CD1A 1JF1A 3UPAA 5IVZB 1YEEL 1RZJC 2H32A 4ZS7L 4AL8H 3WFDH 1E0OB 4HH9B 3K7UA 1MFBH 4MAUL 1HHGA 3C8HA 3D5OF 3OKKA 3MV8D 4G8FA 2P24A 1B0RB 3O45A 5DUPH 5I18H 4QKXB 1RVFL 3HR5B 2GQHA 5BW7C 3F6LA 4YK4C 4IRJC 2Q3ZA 5TE4L 1AXSB 3F8UB 4XP6L 3V6ZB 1MFCH 1HCVA 3NIDF 2XICA 4HX1A 1AO7A 1P4IL 3V4VH 2OK0H 5EZLA 2IEPA 5CP7B 3QNZB 2BMKA 3NMEA 4PIRF 43CAA 4F8QA 4OFIA 2APVA 2WBWB 4I0PC 4TSBH 3O6LH 4W6XB 3R8QA 3QJHA 1Q0YH 2JJUA 3SDCC 4P9HH 1UVQA 3LH2L 4OD3L 1DBJL 3B9KB 4K23L 3ZT6A 4NHCL 1MCOL 3DETC 4LVNC 4UBDD 2I24N 2AXGB 4L9LA 2DQIH 1XF3B 3TBSB 3WFEL 3ZTNL 3L9RA 1V5JA 4P2QD 1D9KA 3DETD 5DUMH 4UU9A 4JM2D 3QEQB 1MLCB 2CKBH 4P2RE 2H41A 1WEJH 2XTJE 1D7FA 3EDDA 1LO3L 1X5FA 5IROA 2R1XB 1PD6A 3EZ8A 2P5ED 3HZVB 4TNVF 2X42A 5JHDA 2X40A 2FECL 3FB5B 5IGXH 4LCUB 4P2RD 3JWOH 4OUUB 1REIA 2JIXB 4WNQB 4Z76A 4ZG1A 5KSAA 4S2SA 4FTVB 1LO4H 2GW5A 4UTAL 4FN0A 3W0WB 4WFFE 5F7YC 5IM7A 3WSQL 3MV9B 5L2KE 2E9WA 3WCYA 5CSBA 5SWZE 1WCQA 1U92A 4UDUB 2EXYD 1ZVSB 3AY4A 3UTTB 1FFPB 3PHOA 5IHUL 1ZS8B 3QRFM 4NQDB 1QFWM 5HVGB 1CL7I 1IGYA 2DQEL 5T3XH 1W0VB 3HZYB 3B2UC 4PR5B 3NZHL 2HRPH 3L3KB 4YEEA 2EE2A 2I07B 3UTQB 5TDOA 3LN4A 2PW2A 1RUKL 4JPKH 1P84J 1EDQA 1DUYA 3P9LA 5IW6B 1G9EA 2I9LB 3QPQD 5C0RH 2C1PA 4HLZH 5CSZA 5HHXL 4S2SB 4OF0A 4LCIH 4PP2A 1FFNA 2HMID 2ZCLL 1V05A 1OOAA 5IESH 1QKZH 1T7WA 4WFGE 4PLNC 4DKEH 4PJ8D 2HFGL 4TTGA 1YYML 4XX1E 4Y2DA 4OKVA 1A3RH 1B0GB 1U0QA 4H8WC 4QRTB 5D93C 1VGKB 2HT3C 5HDLA 2QKIA 3S34H 4M7JL 1DCLA 2DAVA 2AJYL 4LCIL 4LSPL 4LLDA 1PAMA 4F2MB 3L7FB 3MLZL 3P73A 3FQUB 3FT4A 3O81A 1OAXL 5TDOB 5C0RL 3BWAA 3IF1A 4QRPD 3ARBC 2IF7A 1EEZA 1UJ3B 1PW3A 2XQYK 4Y8DC 4TSCL 5D7SH 4U7SA 3TBTB 1YUHA 4UT7H 5D93B 4U1NB 5L9DL 4TUKL 1QLEL 1YQVH 3HA0A 4OLXL 4IOFC 1OAUH 4RIRB 3TPUB 1DTUA 4MD5A 2DQGH 1LO5A 3CCHB 2APFA 1ONQB 1MJ7H 3LB6C 2VAJA 3MRGA 3PDOB 4P5TC 3VFTB 4BK5A 1HN1A 4G8GD 1N0LA 1BGXH 3X17A 4OZ4A 1DBBH 2A9NH 1G9MH 3EYFA 1Q9WB 2VDLH 3NFSH 2PTTB 3HE7B 5DJCB 3OKMB 1DBAL 3HNSL 3L3JB 5EUOB 3H7LA 2MPAL 2A6KA 5DD0H 4OUOA 3GMRB 3EJYC 1RQ5A 4P2OD 1T1XB 1S9YB 4YGVB 2BHUA 1QKZL 4PJ8C 2AJUH 3AS3A 5F6IC 1KUMA 3MLVL 5DMYA 5D1ZD 2A73B 4N9GA 3X13B 2YD1A 4I0PA 3TCLA 1N8ZB 1YY8A 4CVUA 1DFBH 1KJVA 3UMTA 3PQYA 4OLWH 1IGIL 3DURA 4G80B 3VFTA 5J13B 3D2UD 1A21A 1QD0A 3ZE1F 3VG0L 1T80A 2LQRA 4RBPH 4YC2B 3QUXC 3RWJA 2FZ3B 3SCMB 2VLLB 1L0XA 3QUZD 4POZD 5T5NG 5DJCA 5GPRA 3VFNA 2QADB 2YA2A 3O2DL 4JVWA 2MCPL 3BKJL 2IWGA 4G8GA 3WIIH 2YUWA 4ZNEA 3UZQA 4XXDB 1NBYA 4R3SA 2UYLB 3NAAL 4FP8H 3K1KC 2X44D 1HINL 4WWKB 1BFVH 5DWUH 3TH2T 3QAZC 3HNVH 5DUPL 1L7IH 4QLRA 3OV6A 3MV7E 3O6FA 2W9EL 4LNVA 5MEOB 1JI2A 4U0QB 5HHME 4XNYH 1SMAA 3BP6A 4HLZG 3GMOA 2DIBA 1ZLWK 5C6WH 1T5XB 5JR1L 4RCAA 5HD8D 3D48R 3OB0H 4U1LA 5IEHA 3IU4L 2M8XA 1JGUL 1XCTB 4B41A 4M00A 3HI1A 4MA3B 3FB6B 3UPRB 3QUYC 4S1SL 1DANT 4PRPE 3C2SA 1ETZA 3MZTA 4HUVB 1XGUB 1ZGLB 1CQKA 3C2AH 3DHMA 1NBZA 4ODVH 4POUB 2XZCL 4EBQL 2NX5B 4YX2L 1HOCA 4GAYB 4KJWC 1LEIA 1BM3L 2HVKB 2BNUA 5BVJB 2PTVA 4JKLA 3ROOB 1G1YA 2CO7B 1P4LB 1P4IH 5HVWA 4N0FA 1A7PL 4HCRH 2VXTH 5TE4H 4IS6A 5B39G 1JGVH 3ARQA 4Y2DC 5DTFB 4HF5H 1WAAA 5JW4R 1J0JA 2IPTL 4NFBA 1JUFB 1WBXA 1BZ7A 3PXJA 5D7JA 4B53A 2J8HA 3OJ2C 3FQWA 1F90L 3V5HB 3RTQD 3PV7A 3MLUL 1TTUA 1GHFH 5AZ2H 4C57C 3NVQA 4N0UA 3L5HA 3MJ9L 5DJAA 1U8PB 3J8F7 4TNWK 4F57H 2A6JB 5BV7H 5A43C 1UZ6E 1RURL 5HDBE 1HH6A 1C16B 2ZSWA 2WAHA 4O2CA 4RFEA 1A1OB 5EZOL 1UFUA 3H9HB 4X83A 3TBVB 4JLRA 2BSTA 4WFHD 4PJHE 3QXAB 3HRZB 3MOAH 4Y1AA 3LDBC 1C1EH 3DMMB 1MREH 1PG7W 1TCRA 1MWAL 4DW2H 4FFWC 1N0XH 1UEMA 4PJDA 4AEFA 2D31A 2E5EA 2WV3A 4POZC 4W4NA 4KK8D 1S9VB 4P23D 5FO7A 5AEAA 4YQXL 2XY2A 1ZV5A 5D7LA 1X4YA 2QHRL 3S37L 5GISL 2DICA 4MA8H 1BIHA 1TCMA 3VCLA 5IVXA 1QEWA 3CH8A 3EFDL 3X14A 3MV7B 1LO2H 4N1CA 3EOYG 2X1OA 4XVUD 1FZMB 3U0WH 4ZPTA 3H9HA 3RGVA 4MXQD 4FQIL 1FN4B 1MCRA 1DN2A 1DSFL 3L5XH 3HC4H 1I9JH 4N0YL 1UVQB 2KH2B 3OJMB 3HPLA 5HYFA 5F7HA 5E2VH 4TVPE 1MWAA 4NP4L 1PYWB 5JNYB 1KFAL 4JG0L 3JTTA 3ME0A 5DI8A 4BZ2L 3B3IA 2FGWL 5GISH 3MV9E 1YEKL 3VXRA 2VXTL 1MCHA 3QJFB 3RL1A 2IFFH 1S78C 3AB0C 1AGCB 1QSEA 1IC5L 2VDML 2R1XA 1M71B 4MNQA 5IMLB 1MF2H 3BEWA 1NSNH 3HUJF 5FCUH 3N1QC 4KI5F 1FLRL 4MNQE 4Z77B 4GUPA 4V1DA 4YX2H 3O3EA 1NLBH 1S7QB 4M8QB 1ZGLP 1T1WA 1U8LA 3GB7B 3QNYA 2VLKA 3EOBB 1DQLL 1UADC 3BN9D 3I50H 1NFDF 1A3LH 1NCUA 3QHZH 3P4NB 1DSFH 3L5XL 3OAZK 2UWEE 3WN5B 2CK0L 3DYPA 3VI3F 4NO0A 1U93A 1FAIL 4Z0XA 3LRSB 5D2LE 1XR8A 1L0YA 4BSJA 1E4XL 3RAJL 3LKRA 4V2BA 4WW2A 3LKNB 1KLUA 3WNMA 4OCXL 5EUOF 2QADD 3IJYA 1ACYH 1A64A 3L5WB 2FB4L 1I3GH 2F19L 1LEGB 1YC7A 4PJXF 1WZLA 2V5MA 2QQNH 4J3XA 3VDBA 5IOPB 5DFWH 1C7TA 5DLMH 3C5ZD 5KJRL 4TTDD 3RBGA 2OP4H 4OZHF 2XWBA 5CZVL 4LLMB 1ZAGA 3PQYE 3FO2B 4KMQA 5IHZB 3OKLB 1MSPA 1D6VH 3CFIC 1BVZA 5J1AA 5FV2A 3WEXB 5FECB 4M6MH 4F58L 5GZND 4NJAL 3KPRA 2V7NB 5DSCA 2BY2A 3JUZA 1CICB 1IEAB 1NL0H 4U1KB 2XOTA 4JR9L 1DN0A 2OM5A 4X5XB 1DE4A 3VGBA 5BZDB 3AGVA 3M17A 3MO1B 4QXTB 2VDQL 1IZKA 4J1UA 5TH2A 2Q20A 3W11C 3MMEB 5DRWB 2Y9RT 1FNSL 4NM4H 3HC0B 5EORL 1MJ8H 4WU5A 3PDOA 2JB5L 4MHHI 1I7RA 5AWNH 3H9SB 1EX0A 2OR9L 4PJEA 4L4TE 2H2PD 1HWGB 5T1LD 3T0AA 4K8RD 2BNRA 4JFEA 2ICWB 4QRPB 5C6TH 4XHJC 1A6VH 4IBLT 1FORL 4P2QE 1OAUL 2D0HA 1CXHA 3VXTA 4XP4L 2VN7A 1S5IH 3FRUB 5KSVA 1QLFB 4YGAB 1GGBL 2FDBP 1YMMB 4UNUA 3RKDC 1HHJA 4U1MA 1NAMH 3WO4B 3ROLA 5T5FH 2VZVA 1D3CA 2WIMA 5C09E 1IAMA 4HKBA 4LHJB 3RGVC 3N85H 4R4ND 4H0HB 5EFIA 5L2JB 3MLZH 3VFMB 3DIFB 3L3GB 2W0FA 4MDIA 4EI5A 4D9QE 1B88A 3HG1D 3DURB 1JYNA 4MD4B 4HKZA 2VDRH 3MXWL 3HFMH 4AY0A 3RVUC 1VEPA 5EDXA 3ARGD 2FZ3A 4DAGH 1S7RB 4M7KL 3UYRL 2FYYB 2YD4A 3BD4A 3BPLC 5IR1B 2EH7L 4R4BB 3P0VL 3UTSB 3EZJB 3TC9A 1D6EA 3R06A 3C09B 2G9HB 3VFOB 4ZS6D 4Q9QL 2DQGL 1I7TB 1ZLVH 3MUGB 2VUYA 4NO5A 4X4YA 5E1AA 2YRLA 2D0GA 3CVIH 3ZKNC 1E4KC 4CADA 5I30H 4B50A 3PABB 3BIKB 1U2HA 4S0TD 4OZFH 3HZVA 1MHPL 5KSUA 2OTPA 5J3HC 1NANI 2V2XB 3DROA 3T4YA 3W9EA 1YEGH 4LFHG 3WN5C 5ANMB 3QISA 1YNTB 3W0WA 2BJML 3C08L 3D3VA 2AJUL 5JLZB 1RUPH 3WNPA 3MLWH 2YBRB 5DJ2A 2AEWA 4NO3A 3EJZD 3I6KB 4MQSB 2YPVL 2YPVH 5DD0L 2B4CC 2UZIL 4YBLB 1FZKB 2NZ9C 2ATPA 3QUYA 1T5WA 4ODXA 2IBZX 4FQXB 1JBJA 5EC2A 1NC2B 3PGCB 2YKLH 4IEFB 3UTSE 5K9KB 3RTQB 4I18B 1WBZA 4KHTH 2NNAB 1FE8L 1U42A 5FM4A 4OZIB 3NBNA 2R2CA 1EBAA 5DHVB 1R3KB 3G6JE 2A1WH 3MCKA 5D7IA 4LASL 3TP4A 3ET9F 3HKFA 2NY6C 4IIQB 5IKCA 3MXVL 1T66C 2BNQE 2RQ8A 4GBXB 3MA7B 4YXHL 3S36H 1U91A 4WVRA 5J6HB 4BKLB 1JK8B 5ADPH 4JE4B 5D1XC 1FO0B 5AWNL 5K9QG 5DVKA 5A2FA 1T7VA 3LEVL 5KSBE 3QEUB 3HCVB 5JW4N 4PLJC 1I8LA 1V3LA 2DDQH 3A6BL 4FNLL 3WS3B 3D39B 1M05B 4N90E 3EJZC 4FQHB 4QO1A 2F5BL 2OZ4L 3GMLB 5EG6C 3LS4H 2X4NA 3FMGH 2N7AA 3CDGB 2VWEC 5H8DA 3G5YA 3HB3C 5TQ0L 3ESVF 3LOWA 2V9TA 2Y07L 1VENA 2F8VA 3BH9B 3F7QA 5F1IA 5T1LA 1QR1B 3I02A 2ORBH 3VXUD 2DIAA 4BZ1L 4K71C 1XCQA 3SE4A 3ZTNH 4YDVB 4BKLA 3D0LA 4U1SB 1RZ7H 4NHCH 3UJIL 1BMGA 4U2YA 3VJ6B 3O8XC 4TUOA 5T3XL 2XRAH 2QQQA 5AYUH 3QEUA 5CZVH 2NXZB 5C8JB 3MLTA 3MCG1 4ZFOL 1T66D 3D39A 3GBMH 1OF2B 3O6MH 4K3JL 3VDAA 2YD5A 3AREB 2Z4QA 1JHLL 3T1FB 3RWGB 5LQBL 2BCKA 4V1DE 5CD5D 5ID0B 2YUXA 5GGUB 3MNVA 3IAPA 3TN0C 4JKPL 5LCVL 1KEGH 3UO1L 2D9CA 1IILE 4L8DB 5L2KA 1JNLH 1O0VA 4I0PB 3TCLB 4BZYA 1J12A 2I25N 3W82A 1U95A 3NABH 2JCCF 4U1SA 2ICEB 2B8OT 3GDBA 5ACMA 4JDZA 4M5ZL 4DTGH 2NY2C 1G1CA 5CJQH 3VFNB 1FGNL 4JZJB 2EE6A 4YO0A 5J11C 2H8PB 5C8JA 2Q7NA 4WTZG 4Z7UA 3BE1L 3GJFH 4F7EB 1A1NB 3HE7D 5EC1B 5INCB 1KG0A 3IB4A 4JFDB 4HUUB 4NRYA 5IIEB 3O6LL 4E41D 1O7SA 4MQ7B 4NKQB 4CVZB 4ALAL 1F42A 2QQNL 4MMZC 5BXFA 4XP6H 5I8EB 3SDCB 4DKFL 5I17B 5D7LE 3IJYB 4KJYB 5DEGA 5DJZA 4POYA 1DR9A 5HPMA 4HBCL 4NC1E 4PJDE 4ZUSB 1F8TH 2FCBA 4OCXH 1HZHH 2X89D 2X1PA 1D5ZA 3BO8B 5CKAA 5E1HB 4O00A 3NCFB 5BRZA 4PJHA 4N5UA 4OLZH 1ADQL 1G9NL 4KMTH 4APQD 3Q6FB 4MB5A 4TNVK 5FF6A 4YHOL 3L7EB 3FHQA 4Y16B 4K8RH 4JFPB 2CGRH 4MNQD 3CFJA 4JFDA 1BFTA 4HMCA 3TVMA 2HVKA 3MCLL 2DLFH 1FL5A 1YEFH 3DV4A 4Q58C 1FDLH 1XEDA 4JPWL 3QWRD 3QP3A 1KBGL 3WUWG 3EDEA 4OF8A 1U8JB 3QXVA 3SE3C 4XNUH 5ENWB 1NGPH 3QUZC 3BZFA 4N0UE 1U8IA 1X5IA 3ES6B 5ICZA 2NY7H 3MRFA 4HPYH 4Y16C 1MPAL 5D1XA 4G6AC 1X6NA 1CE1H 4X6CA 2C3HA 1BZ7B 1LK2B 2DQUL 5B4MD 4YHLH 4HH9A 4IMLB 4KVCH 1TQBC 1AJ7H 5KVFL 4QXTA 5D1ZC 4IJ3B 1KFAH 3ARGA 1AHWA 1G0XA 2H2PC 3CFJB 3LD8C 4K9EL 5BS0E 4H20H 1A7QH 5BV7L 3LEXA 2F8OA 3O11B 3IDXH 1MJUL 2DYPB 2CH8A 1B4RA 2C4XA 2H1PH 2PN5A 1N59A 3K2UH 4OT1L 3VXQA 3QO0A 2ADJB 4P4KC 1UT9A 4PJCF 4P2RB 5I1LB 3W5NA 1IFHH 3L9RB 5FO7B 2PO6A 3VD4A 4DKFH 2X7LB 3SE9H 3S4SB 1DLHA 2Z8WC 4UUJB 3V5KB 5FHAL 4BUGA 8FABA 1A6WH 4DFIA 4G43A 5EBWA 1SEQL 2X9XA 4PRNA 2FIKA 3MV7A 2AXFB 5HYIA 3WO3B 3QI9D 1Q9LB 1IARB 1OM3L 2D7OA 4GMTL 3PNWB 1UM5H 1O7VA 3DX7B 3RUGE 4DUVA 1MCQA 2EZ0C 5I1EL 3X12B 3BGAA 3LKQB 4YIQB 1RMFL 3QIBC 5I1AB 1KJ2A 1IQWL 2NTFA 4K8RL 15C8H 1G6RB 4XXCA 4S1RH 1E28A 2PO6B 1JGEA 1YN6B 1FGVH 4OKDA 2CIKA 4N5EC 2OZ4H 4HIHA 2JK5B 4N68A 5EU7C 2MHAB 4YHMH 3OKNA 1NGYB 4KK6C 5K33A 3X3GH 4MJ5A 1UWGL 5L8KB 5SWSA 4C4KO 3HE7A 2P5EA 1PG7X 2IFGA 4EI5D 5M7QA 5E8NA 3FQRB 3VRIB 3I85A 4PJAF 3UYOD 1RUML 4HWBL 1KJ2B 3WN5A 1TJIL 1BEYH 1B0GA 3A6CL 2LABA 5E00A 4U1JB 4OGYL 4JO1H 2YOCA 1KCSH 3QI9B 1CGSL 1CFBA 2EE9A 4BZ1H 5DDHB 2P48B 3NH7L 3PGCA 3QIWD 2D4FA 5I1KL 1KLUB 2ZCKL 3L7FA 3OKNB 4NO0D 1T2QL 3BWAB 3G5ZA 3CSPA 4MZ2A 3DBXA 4WWKC 1RUAH 2EKJA 4RRPG 3LSOA 1Z9MA 2YUZA 5F70A 2Z31C 1P7QB 3W0WE 1KPRB 4OF3A 3ARFC 3HE6A 1A7BA 1XGQB 4X6FA 4Z5RA 5IUSA 3ZKMC 1OSPH 3IKKA 3GIZH 2GEEA 1IZJA 3FFCE 1OARH 1JYXA 4UT6H 2CLVA 5DJXB 3KPSA 4HMDA 3HCVA 3RVTD 3U30C 5ICXB 2AV7B 3KS0H 3VFPB 4E0RB 1J18A 2FSEA 5F44A 1MQKH 1VFBA 2LVCA 3NIGE 2Q3AA 3V6OC 4BH8B 1HHKB 2YD8A 4YHKH 5B39A 4MA1C 2DL9A 1AQDB 4U3CA 3V8OA 1NJ9B 2EDNA 3WFBL