2HKFL

Crystal structure of the complex fab m75- peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin Light chain Fab fragment
publication title Stabilization of antibody structure upon association to a human carbonic anhydrase IX epitope studied by X-ray crystallography, microcalorimetry, and molecular dynamics simulations.
pubmed doi rcsb
molecule tags Immune system
total genus 55
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfL01
4MQXD 3GK8H 1UYWL 1FGVH 4G80B 4KKAD 3S5LA 2AK1L 4OLWH 4U7SA 3WFBH 4NN6B 1J1OH 2VUYA 1UB6A 3HUJA 1W0VB 5IJKC 2DM4A 2EYSB 1WSST 2ZUSA 2NY7H 3NIFF 1UC6A 5DWUH 3GBLA 3MRRA 1JE6A 3BJ91 3LHPL 4ENED 3B9DA 1YEGH 3DURA 3MA9H 3O3DB 3SKMB 1MHPL 1K4CA 1JYXA 1C5BH 4GRWE 4Q58C 3DETD 2A38A 4WFHD 3QNYB 3VFSA 1T1XB 5IHUH 4PJHF 3VFWB 1MLCB 4HWBH 4PJ5B 1HH6A 2XY1A 2R0KL 4G8GA 5E9DD 2W60A 5D1QC 4YHLH 1A2YB 1A1MB 4KK9C 5A2IH 3NFSH 3C6LA 2DLTA 2H3NB 4L9LC 4HS8H 5KVMC 4N1EA 2QBWA 4DVBA 35C8L 3IKCB 2AQ2A 3I3BA 2QHRL 2H45A 3HE6D 4HSQA 5CEZD 5IIEA 3FONB 4ZD3L 3PQYD 1PSKL 1KPRA 5M95B 2AGJL 2XV6B 2HFFB 5C92A 2JB5H 1BOGB 1C5DA 1N6UA 2X40A 1JWSA 3O3BA 1FCGA 5DZOA 4KRPB 1AGEA 4RAVB 1I4FB 1AKJB 5HDOA 2PF6A 3UX9B 1EK3A 3BXNA 1ZVYA 1A4JA 4NQCD 3G6DH 3OKNB 2EE3A 4GUPA 3JTTA 3HZYA 2XRAL 2X4TA 5FO9A 2AK4B 5DHVA 1S7VB 2ERJB 4L8SC 2DWEA 2NY3D 3L6FB 4Z7QF 2OI9C 4I3SL 1MFDL 4M7JH 1FVEB 5FDWA 5EO1B 2X89A 4M8QB 5FYJL 3TIDA 2DMCA 2W9DH 4PB0H 3V52L 3LZFH 5KS9F 1P1ZA 5D7SL 4FQJL 5D2NC 4GOSA 4G80A 4YQXH 3WE6A 4WFGD 2V6HA 1PX4A 2FEEI 2B1HL 2Z92B 2DQFA 3RWHB 2FGZA 1M7XA 3PGCA 3ZKMC 2WMPA 4O2FB 2CO7B 4PJEE 3PL6D 4L3CB 3BKCH 3TNNA 1NCWH 5EOTB 4XAKD 4HLZH 3GSWB 3NCJH 2HH0H 4PG9B 4NOFA 3M07A 1U95A 3MRMA 1MWAH 1B0RB 1KEMH 3QNYA 4JPWL 3GHBH 3GSUB 4OQTL 1C08B 1T1XA 1U6AL 3ARDD 2NZ9D 3IDIB 1MLCA 1P4IL 1CG9B 3BP6B 4PJ5A 4UMGA 4PJDF 4JM2C 2NW2B 1DN2A 1I7ZB 4G8EB 1QACA 4FQQB 1A2YA 3MA7A 4IDJH 3A67L 4YC2B 5HHVL 5JZ7D 3ZE0F 1D9KA 4ZNCD 4LIQH 3U30C 4D8PB 1U8OB 2FWOB 1ZANH 4KHXL 1U3HC 3AMKA 5EUKA 5FKAA 3NPZB 5F89B 4EXPX 1HYSC 1I8IB 3OR7B 1G7IB 1IGYB 1ZLUK 4KHTL 4YZFE 4FXKA 1RJZA 5DUPL 1BX2B 1EMTL 4DN3H 2DD8L 4N8VG 4CADB 4UNVA 1BZQK 4KDTA 4GW4A 4RAVA 3WFZA 1AKJA 4PGBA 5D96B 1AE6L 1DBJH 5FYKH 4Y4FB 4DW2L 5D70L 4AM0B 1FL5B 3WFCH 4P23C 1H3VA 5E08H 2AK4A 4Y8DC 1MI5E 1J88A 1SQ2N 2YMXL 3L6FA 1FIGL 1BF8A 4TSCL 3E2HC 5B4MC 4EI5D 1RK1B 4PIRF 1FVEA 5ITFA 1VB9A 5EO1A 4M8QA 4Y0GA 1NUNB 5DJ2A 4WHYG 1CFSB 4M1DL 4Z0XB 5FUCC 4M3KB 5I1IL 1ZGLB 1OSPL 4ZFOB 3V6OC 4Q9BA 4WW1B 3O2DA 1M6OB 4Y4HC 1S9VB 5DD3H 1JI2A 5ALBH 2FH6A 4EDXA 4Y2DB 5IWLC 2ARJA 1YEIL 3BESR 1N4XH 2R4RL 3CLFH 3HG1E 3AS1A 1K4DA 5CD5D 1KXVC 3RWHA 5E94B 2X4UA 4NP4L 4P5MB 1FH5L 4O2FA 5GJTL 2GJ6B 4L3CA 1GGBL 1NUDA 3VMNA 4ZUSA 4KVNH 1TPXB 5CSBA 3CFDA 3QDMB 4OKVA 1EHAA 4B53A 4LPYA 1ADQH 5EBWA 3RL1B 2Y07H 2WQ8A 4PJ9A 5ESQB 1QSEE 2Q8AH 4R4BA 4X5XA 2FIKA 4MB3A 1B0RA 5E2TL 2Q1EA 1C08A 3VGAB 3LS5H 1MJ8L 1ZS8B 4WI9A 3IDIA 1CG9A 3BP6A 1CGVA 3BMWA 3LQMA 1MVFA 1QG3A 1I7ZA 4IOFD 4G8EA 3T77A 3HZKB 2UYLB 2Y7QB 3D39D 3B5HA 4FQQA 5EOQL 5KJRH 2MQCA 3MGTB 4HEME 2XACC 4D8PA 1I3VA 2EXWD 1U8OA 2DQGL 2FWOA 2LABA 3GMLA 3VXRA 4PBXA 5E2VH 5CJBA 2GSGB 1OAUH 1WF5A 4AEHL 1YMMA 4U6XA 5F89A 3S37L 4XCFL 1I8IA 3OR7A 4TOYL 3L3OB 1MY7A 1CL7L 4NHUB 4LOUC 5E6IA 4YBLB 1BBDH 1JV5A 1ZHKB 1BZ7B 5HHQB 2J6EL 5IMLA 1KCUL 4A6YA 5F1IB 4CADA 5KSBF 2PO6C 1GGCL 5FIEA 4J6RH 1E6JL 3LRSB 1ACYL 1HHKA 1R3JB 1LK3H 3WL9A 2A1WH 3QRFM 4X9GA 3IF1B 1INEH 1AY1L 3V4VH 4Y4FA 4HUVB 4AM0A 5E2UL 3S34L 3MMEA 1AJ7L 3UAJC 3REVB 3DVNA 2IFGA 1FG9C 3RIFK 2I60L 3R4DA 1ORSA 2AW2A 1RK1A 3V7MA 4NPYA 1IQWH 1VESA 2FYYB 2VDKL 1G0YR 2WM0A 2Z93A 1J9CT 1ZMYA 4YFLF 3MJ9H 2OL3B 1S7WB 1SY6L 3AU1B 4S10A 4Z0XA 4ONOA 1OAQH 2EH7L 2UUDK 1OW0C 5DVNA 3V6ZB 4WW1A 4JEGB 4AEFA 1M6OA 2CSPA 4DTGH 4EN3D 3GMQB 4Y2DA 4Y1AD 2H32H 4PV9B 5AZEH 2BVOB 2VYRE 2GTWA 3L3IB 4XPBH 3RRQA 5C0BA 3UJTL 1M05B 4L4VD 4P5MA 2GJ6A 4QRPD 1NGWB 1JHTA 3TBVB 3HZVB 3VJ6A 3U7YL 2D4DA 5LXGH 3QDMA 1P4BL 5FOJA 4PJFB 3VXMB 2DQIL 5GGRB 1F6FB 5ESQA 2UWEE 2PYED 3MFFA 3D18B 2AJZA 1ZS8A 5GHWH 2X1WL 3ZYIA 2QQNL 4XMLH 1RZFL 3H7BB 1W72L 3IU4H 3ABZA 3HZKA 2UYLA 4H8WC 1YNKH 1HSAA 4N5UA 5FYJE 2C3HA 3TT1H 2JIXB 1MHEA 4LDLB 5ISZB 4MJ6B 5ECJE 4OZFG 2GSGA 3U4BH 3SDAA 3T2NL 4JKMA 3SJVD 1ES0B 4LL9A 3QUML 4KU1A 3L3OA 3P73B 1NBVH 4HC1A 4NHUA 3SO3B 4XVTL 1UKSA 5HHXL 4UTBH 5HHQA 1KCRL 3THML 3UTSD 4XWOC 1DQTA 2IGFL 2V7NB 5F1IA 5IV2B 3TYFA 3LRSA 1AQDB 2ZG1A 2DIAA 3QEUA 4O5LH 2Q87A 4YH6A 3LEXB 1DQLH 3B43A 4GRWB 4HUVA 1IGCH 2WBJD 3QUKB 2OS7A 5I6XB 1MJ7L 4I48B 3T0DA 3U1SH 4M9OA 4HQQH 3ES6B 3DYMA 2IBZY 2OR8A 3JWDC 1SYVB 3KG5A 3FQRB 4PV8A 2CDGB 3BDYL 3ILQC 2YWYA 3EYVA 4P9ML 1FYTE 3GSNH 3ARSA 2OL3A 1S7WA 3GSXB 5IQ9B 4WFFD 5J13C 4LQ1A 2Z8VC 2Z31B 4NC0B 3V6ZA 3S8WA 5E4EB 1NEZA 2HA1A 1GPOL 1A7RH 4R8WH 3ULUL 4JR9H 4Q9RH 4XC1H 4PV9A 3MRDA 2A0LC 4PY8J 4CW1B 2AJUL 1NMAL 3MXWL 4Z7UA 3PWUA 1QBLL 2FO1A 3L3IA 1UKTA 4HPOL 5GZOD 3R0NA 4OF3A 4JFFB 1YEKL 4W4NA 3OXSB 2EICA 5EPMB 3UTOA 3RUGF 1FNSH 1OP3H 3L5HA 3G9AB 3QIBD 1NGWA 4AIZA 4MJID 3O41A 1RUAL 4PJFA 3VXMA 4S1SH 5GGRA 3BP5A 5LQBH 3PGDA 5FA3B 3L3HB 1H3GA 4DAGL 3D18A 5EU5A 4NDMB 4G9FA 5B3NA 2DS4A 5E99L 1NCTA 3SGJA 4XVUD 5EZOL 5GRVL 3RVVC 1K85A 4FFYH 2YBRB 3VMOA 2JIXA 3HB3D 2GT9B 5SV3A 2XA8L 5ISZA 3OHXB 1ZT4B 4AH2B 5C1MB 4K9EL 4LHUB 4JE4B 3GHEH 4PJBE 1JWMA 4MJ6A 5HD8D 5D1XC 5HVHB 1MF2H 4IIQC 3T65B 4LEOB 3TGXA 1ES0A 2PYFB 3ZKNC 2R2BB 2DWDA 4ELKB 4OAWB 2YD4A 1NPUA 3P73A 2J2ZA 1Z9OA 2QQLL 4J7RA 2OLDA 1N8ZB 2VXQH 2YA0A 25C8H 1VGEH 3PWLB 2V7NA 5IV2A 3NFPB 4FA8A 4JPKH 1AQDA 5I1GL 3RWJA 4OJFH 1URLA 5IBUG 3GI8L 4JY5H 4I4WB 3U0PB 2J8UF 4PGEB 4J3TA 4JO4H 4AJ0A 2HT4D 4APQC 1FG2A 1T83C 3ARBB 1JWUA 1U3HD 2JCCB 3BOVA 4MB5A 5C08D 5HDQL 3EYUL 1CLZL 4LSVH 4I48A 4FZ8L 3RWFB 3FRPG 3WDIA 4CNIB 4N0FB 5EORH 3VFMB 3K1DA 4KXZI 4KKBC 2O93L 4Z7VB 1I7TB 3ES6A 4U3HA 1W8NA 2JJTA 3FQRA 5HSFA 4HXAL 4HUUB 15C8H 2Z35B 1LO0H 4A2MA 1UWXH 1BGXL 3GSXA 5IQ9A 4NJ9L 4LCWD 2CLVB 3RGHA 4FP8L 2Z31A 4MMZC 1RY7B 1R3LB 3IVKA 1E4WL 1KYOK 2E6PA 2A73A 2E7HA 1YA5A 1YEFH 4WWKC 3E3QE 3T0BA 1JNLH 4X5LA 1CU4H 2ICES 3G5ZA 4YHYC 3BWUC 1UJ3A 3UTPD 3QHTC 4WI2A 2CRMA 2HP4A 1LO3H 4E9LA 5HGDB 3OXSA 1F4HA 4TNWF 5CP7B 5EPMA 4U1LB 2PXYD 1LO4L 4GT7A 4NQTA 5I19H 3DX8B 3NCMA 3KJ4C 4WEBL 1IGFL 3WCYA 3CZFA 4P46C 3MLTA 1D5IH 4DUXA 2VQUA 5FA3A 4ZFFB 3L3HA 5JW3L 2R56H 5B3JF 1ZOXA 2AAVA 1ULVA 2BVPB 3D5OF 4NDMA 1HKLL 1ZLSH 1DL7L 1MI5B 3VWKB 2DOCA 4RAUB 3WMSA 2CMRH 1U2HA 4EKXA 1OARH 1KJ3L 2YBRA 1LMKA 1OT2A 2M26A 1RUMH 5D5ME 1NMBL 1JZ3A 4QHKJ 2DYPD 1YEEH 3ARFB 5A2JH 4XCYB 4J12A 3ZHDA 4ODBD 1OT1A 4LEOA 4OT1L 2LV4A 1B4JL 3TM6A 1BLNB 4QEGA 1O7SA 1WIUA 4F9PA 3PP3K 3DMMA 4ZOEA 1N8ZA 5F7KC 3WXWL 3VD3A 1IT9L 1UWGL 1O7VA 3LDBC 5A16B 3K3QA 5I8KH 2IF7A 4PJEA 4ODHL 4PRPD 4MB4A 3FZUD 4UIKL 3W9DB 4QTHB 4I4WA 3U0PA 3C2AH 4L8DA 3CU7A 2DQTH 5DRNB 3DV4B 5F9OL 2EIDA 3CVIH 1QSEB 4Y2OA 4H1LB 2GQHA 3L7FB 5DA0B 3VFMA 2VDRL 1GGIL 1I7TA 3QRGH 1PG7W 2AI0L 1CBVH 4NC1E 4M48H 4MHHG 4RWYL 2ZUQB 3MPCA 2E9IA 1CICD 2CLVA 1CK0H 1R3LA 1A5FH 3RWGB 5IMKB 3FB8B 3UBXI 1P7QD 3HLAB 4CDHA 1OP5K 3ZYOA 2R69L 2OP4H 3MREB 4YNYB 2YR3A 4BQ6A 1MEXL 3QDGB 4U0RC 4YFEA 2QHRH 1AR1D 5HGDA 2DQEH 5AWNH 1BAFL 5FB8B 5IQ7L 1PG7L 2RCSL 5J1AA 3ZTJG 2BHYA 2ZSVB 4FN0A 2GK0A 2HFTA 3SDCC 2PCPB 3RGVC 1XIWC 3NGBC 1EZVX 1G7PB 4D0CB 2AJSH 1OAYH 5C0GA 1S3KH 2BNUB 3T0XA 5IFHL 3IDJB 1IAKB 3VWKA 3T0ED 4UQ3B 5FGBA 4N90E 1CL7I 3BZEA 1RIHH 1OGAD 1F3DH 1Q94B 4JY4A 3U7WL 3BP4B 1EEYB 4ZO7A 3ARFA 3CSBA 4LGPB 2IAND 4FQXB 1ZHNA 3FO2B 5BVJA 3SGKC 3NABH 3C6SA 1RURH 4DQOL 1BLNA 3DARA 4U33A 1KB9J 4M7KL 3HG1A 4JFED 3OJVC 4HCRL 2H8PA 5JPMA 4X80L 5BRZE 3GEWB 1OTTD 5A16A 1DBAL 2H1PL 2VWEE 4FTVE 4KXZH 4Y5VB 3CH1B 1MFBL 2ZSWA 1N3NB 5ACLA 3QEHB 3W9DA 5ACZB 4QTHA 4WO4C 1LNUB 4D9LH 2FIRT 5AYUL 1U91B 4OZGA 5DRNA 5ACMA 3ZL4H 2JELL 3DV4A 2XY2A 1QSEA 1A6UL 3L5JA 1RJYA 4H1LA 5CINH 1IGIL 2ZG2A 3ZDYE 2P8MB 3Q2CA 5E4IA 4LLAA 4OQTH 2Y6SD 4GJTB 1WVZA 2R2EB 4PJIF 2PW2B 4AYFA 1QPPA 3IT8D 3MYZA 2G5RA 3QA3B 3RWGA 1RK0A 5IVXB 3VH8B 3A67H 5HHVH 5ADOL 3KPSD 5IW6B 3QISA 4ODXB 4XHQA 3EGSA 4ODWA 1QHOA 1JF1A 4LSSL 4LSQL 4OF8A 3UPRB 1IM9A 1X5GA 1CFBA 4HFUL 5MEQB 2GITB 3R8QA 1OLZA 1Z9MA 4OF6A 3WXVL 2ZCLL 4KHTH 2YPLE 4OCWL 3S96A 4HS6A 1NBZB 2Y36H 8CGTA 1BEYH 3HAEA 1YJDC 2ITDB 2R15A 1CXHA 2J12B 1G7PA 4D0CA 5MENE 1MLBB 1OWWA 2BNUA 4TN9A 3SPVA 4CN4A 3SN6N 3OF6A 3HNSH 1FCCA 4X8JB 1AE6H 5L88H 4J3UA 1FV1B 4CN1A 4YXKL 5EFIB 5D70H 4JFQA 3WUWB 3RAJH 5IMMA 1R24B 5EULV 1U2CA 3INUL 3OB0K 5T3XL 1F00I 2YMXH 5F72S 5GGTL 1BOYA 2ICCA 2ID5A 4F37F 2MOVA 1R3KB 1FYTB 1EEYA 3LD8C 1MFEL 1FQ9C 3UYRL 3QCUL 4ZOAA 3R1GL 5EU6E 3SGEI 3IKKA 5C6WH 4FQXA 3V5DB 3I2CL 4P0DA 3TWCL 4MXVE 3FO2A 1Q0XL 1JRHL 2YN5A 5JLZA 2QQQA 3TP4A 2DAVA 5ADPH 2APFA 2IPUK 4G6JL 3VFRA 1RZJL 4OZIF 3RL2B 1OSPH 1GC1L 2CQVA 2FBOJ 3D2UB 1X4ZA 4J8RB 3ZT6A 1NFDF 2BY1A 1U8PB 3CH1A 3WLBB 3B6SB 2R4RH 4LDEB 3BGAA 1WIPA 3QEHA 3RVVD 2B0SL 1LNUA 1JHLH 1X7QB 5AG8A 1U91A 3WHE0 1TCRB 3IDMA 2P1YA 2UWEA 1GGBH 3NCYS 3QXDA 2Y9RT 1X4YA 3N1FC 1J0JA 2NNAA 4M7ZB 3QI9D 5KOVC 1QVOB 5I8CB 4KK6C 4NN6C 1X6NA 1MFAL 1PLGL 3MLSH 5E2TH 1I3GL 3AXLA 5F8QC 1JNNL 3GIZH 5TE6H 1MJ8H 4HH9B 4EOWH 5CJQH 2AEIT 4CVUA 3MV7D 2PW2A 4H20L 5TQ0L 1M71A 1G7HB 1XF2B 1P2CA 4ODXA 3RVTC 5B21A 3F12B 1QP1A 3QHFL 1TQCC 4OGAC 3M1BB 2F54D 4P5TD 1QOKA 5TQ2L 4U4BA 3SCMC 5FYKU 1ZVHA 1J1PH 1O5DT 5J6GA 4TOYH 2D2OA 3DBXA 4OGYH 1CL7H 1NBZA 1GCFA 1FNHA 2H2SC 2F74A 4XWGL 5D93B 4DZ8B 3LKSA 1KV3A 1SHMA 4L5FH 2R23B 3V79C 4NN7C 5C9JA 3FTGB 1E6JH 5E8EB 2LAAA 1TETL 3RZCB 2VXVL 4Y7MA 5FO7B 3FQWB 2X4SB 1AY1H 1BM3L 4MD4A 4PLJD 3WUWA 4ZXBB 5E2UH 3S34H 4YWGL 4E5XB 5CEZL 1AJ7H 2XWTB 3NACL 4JZNA 4P2QD 1NC2D 1AO7B 1FYTA 1E28B 4KRPC 3F62A 1NCBH 1G7JB 3V5DA 1QYGL 2WAHA 5KSVB 1UCTA 2A6JB 3PUCA 4ACPA 1RAMA 3MQIA 1MHCB 2EH7H 4CUCA 1F42A 3AS0A 4E41D 2ERJC 4YX2L 2HFEB 4J8RA 4XP6L 4JRXD 4MNHB 3TA3D 4DKDC 3TZVB 1J1XH 2H2PC 3WLBA 4MDJA 4XNUH 4JJ5A 3D0LB 3UJTH 1X7QA 4RA0C 3FAWA 3TCXA 4LMQI 3BYTA 5DMKB 5KSUB 1ZAGA 1WZLA 4YIQB 3EJYC 2YC1A 4JHWL 4TUKL 5GIRA 4PJGA 1QVOA 5I8CA 2K7QA 3BD4A 3T4AB 4JFDE 2NY6B 3CX2A 4HH9A 3B9AA 1PG7X 5IB5A 1JFQL 1WTLA 2QQNH 2VIRB 1W72H 2FL5B 4EIZC 4PJBA 3HNVL 5DRZB 5JXEA 4GAYB 1S7TB 1XF2A 4MVBD 4LSRH 3F7YA 5TF0A 3F12A 2K3TA 3RVUC 3M1BA 4L4TE 5FM4A 1BVLB 4EI6B 1UXWB 1GOGA 1UKQA 1Q1JL 3T2NH 5TE4L 3UTTA 1PD6A 4OCYH 5I1KL 3QUMH 2NX5E 3UP1A 1VKXA 4ZG1A 1VADB 2YSSA 3DRQB 4XX1G 4DZ8A 2R23A 3SO5A 2IGFH 5CJ5A 4G7VL 4BUGA 3SGEH 5GXBB 3JVGC 3OKKB 1IGMH 3RZCA 5FO7A 4ZAKD 2QKIA 3FQWA 5A3ID 5D1ZB 3EUUA 1VCAA 2OSLA 3CC5B 1E27A 4ZXBA 1T5XA 2MPAL 4HBCL 4E5XA 2J7LA 5BV7L 1E28A 4IRJA 3N1PC 3P9WB 4KK5C 3WJJA 2EDBA 3WNLA 1T80A 1X5JA 2YD6A 1S9WB 4P9MH 2VR5A 2A6JA 3CCHA 4LRIC 3SDCD 1LGVA 5FYLE 5IB2B 4WUUD 1SM3L 1KLFA 2V5TA 4B5EA 1V7ML 2J6EA 1WFOA 3RBGA 1IC5H 3KDMA 4TPRL 4MNHA 4DOHE 5LCVL 3TZVA 1NMAH 3M45A 2OZ4A 1XCQB 3D0LA 2NXZB 4HPOH 4JFZL 1C16B 3NN8A 4O4YL 2HTLC 3VG9C 4PRDA 5KSUA 5I76B 3SQBA 3JWOC 1HINL 4YIQA 3RWIA 3D3VD 1CE6B 2PETA 2ESVD 1YQVL 1RUAH 2FB4L 4K7FB 4PYHA 4DAGH 3MRNB 2AERT 4PTTB 3T4AA 5AUMB 1I1AD 3DGGB 3T1WA 4Y19E 4I0KA 5D5MA 2VIRA 5EZOH 1PEWA 3EW3B 2FL5A 5D7JD 5I75B 5HHOB 3QJHA 4N1CA 5DRZA 3RBSA 4GAYA 1FSKB 1S7TA 1TPXC 3DO3A 4WO4D 1OVZA 5IBLC 4UOW0 2XA8H 1U8QB 1G6RL 2E8ZA 2Q3AA 1U8IB 1BVLA 3LPWA 3VGAC 3LVEA 1T6WA 5BRZB 3WS6A 1TZIB 1WAAF 4XBGB 2Q86A 1BFTA 4JCMA 4FTVB 2O5YH 1VADA 2DQJL 2RB8A 3VCLB 2QQLH 4HJGA 1NJ9B 4O2CB 1MNUL 4X99A 1I1FA 2GCYA 2BY0A 2QSVA 3VGFA 3MRIB 5DSCB 3SDYL 4HWNA 1H3PH 4J1UB 1JNJA 5I1GH 5EIQA 3OKKA 4U1SB 3GI8H 3C5ZC 1NGYA 2YD5A 4JN1L 3LIZL 2E7LA 3CC5A 1HWHB 2DL2A 4MD0A 4YBLC 4F7PB 1UQSA 1CLZH 4FZ8H 4TULL 3OGCA 3FT3A 3TEUA 4PD4K 4YDJB 4G8GD 5DQDL 4ZYKB 3QDAA 4HXAH 4OM0L 3BT2H 2P7TB 2DM3A 4DZBB 4I77L 1AC0A 3C6LD 5FOBA 1BGXH 3L9RB 5IB2A 4GG6A 4QOKE 1CGWA 2VLJE 4FP8H 5B38A 3NBNA 1S7XB 2R9HD 5BS0E 1E4WH 2HVKB 4YDLB 1FZJB 4NBZB 3QQ3B 4UIMA 1QLFB 1LP9E 4F7TB 2YD2A 2EYRB 3D0VB 3LRHA 5EBMA 5CD3A 5C6TL 5K33A 4N0UE 2NPLX 5HDBF 1REIA 2GI7A 4BZ1H 4CMMA 1WV7T 1LO4H 2R1YA 5I76A 2UV3A 3WLWD 1CE6A 5KVFL 2D7NA 2W0LA 1JI1A 4XP5L 4Z7WE 3TO2B 5GS0C 3MUHL 3HZMA 4PTTA 4X7FC 5AUMA 4WTZG 43C9A 2BVTA 3DGGA 3X12A 3CUPA 4JDVA 2BNRE 5D71H 3FFDB 2NZIA 3BGFC 2Q6WB 1XGRB 3WIIH 2EE6A 4PY8I 4YXLL 1BHGA 5F96L 3HN3A 2FZ3A 2X89D 2QSCL 1NMBH 2DQCL 4XI5C 4C4KO 3AB0C 5JIKA 1U8IA 3ARGB 1LEIB 3V8CA 4OT1H 5HI5D 2VDLH 5BRZA 2IH1B 2N7BA 1TZIA 4XBGA 3A6OA 5E5RB 4AT6A 3BN3B 2ICWA 4W4OC 4FTVA 3HC4L 2B4CH 3MBEB 3ARTA 3B9KB 3PDOA 4O2CA 4LEXL 1IT9H 3RU8L 3CDFA 4UI2A 3ARWA 4ZSOE 1T2XA 3MRIA 4ZTPL 1IGJB 2BSTA 4ODHH 4J1UA 4WY7H 3BRFA 2OJEB 3U7AA 4U1SA 3LMJH 2NXYC 3BX7C 4K8RD 5MI0B 3BD3A 4LVEA 1FC1A 3EDKA 4F7PA 4MLIA 2EIZB 4KJQC 1W0WB 5E8PA 3LQZB 3NPSB 5INCA 1GGIH 4PJ5D 4PLOB 3PWJB 4ZYKA 1HKFA 1FE8H 2P7TA 1MWAB 4DZBA 5FEBA 3BRDA 1D9KD 4QWWD 3U4EB 1F4AA 4LRNH 2HVKA 4HEPG 3VRLE 1FZJA 4JFXA 5C0JB 1J0IA 3QQ3A 1SJVA 4LHQB 1QLFA 1FN4B 2R69H 2WW8A 3GIVA 1UZ6E 1ZSDA 2YPLA 4ETYA 2EYRA 3BSZH 3D0VA 1KELL 4OFVA 4FQ1L 2GJZB 3KHQA 4X7CC 3KLHD 4F7EA 1FL3B 3O2WL 2LU4A 4LPWA 3SDXB 1RUQL 5CJ8A 1BAFH 2ZUWA 1I1RA 3T3PE 4PP1D 1PG7H 5IQ7H 2RCSH 5MENA 5E4EC 3BD5A 1AKJD 4NUGH 1GIGL 1E4XL 1NLBH 1YEHH 3QQ9C 2RFXB 4KMLB 4XB7A 3N1MC 5IFHH 1JPSL 3SKOB 1NDMB 2AK4D 4FFWD 1HE7A 1DQML 5ILTL 1FFRA 2D03H 5LJYH 5E5UB 3ZYZA 3FFDA 1FC2D 4K2UL 5EU6A 1M1SA 1IJ9A 5HGAA 4QHUB 5JO5A 2CR3A 4HFWA 4GXUM 4NUJB 5GS1B 1FL6B 2CXKA 3RIAF 1ZHLB 2YZ1A 1FPTL 1BVKB 2IH1A 4XMPL 4ZFZB 1S8DB 4MS8D 1ZTXH 3WD5L 1Q9KB 1L0QA 1N6QL 4LCIL 1JTPA 4H0IA 2DN7A 3JUYA 4YFLI 4L1HA 1EAPB 1DBAH 3QDHA 4PJ7B 2H1PH 1DCLA 5FHAL 1MFBH 1G84A 3TJEH 1IAIL 1UFUA 4KMQA 4QNPF 3NCEB 2JELH 1A6UH 4P59L 1MQ8A 4JFDB 1W0WA 3TPKA 3TO4B 5FGRA 1PKQB 1QPXA 4Q2ZB 4HXBL 5LG1A 1U8MB 3PWJA 1MRDH 4Y16C 3RY6A 1MWAA 3EO1B 3PV6B 2OXHA 3HUJF 4OD2B 2AEQH 3VXRD 1YY8A 3ARBC 5F7UA 4L4TB 5DXWA 1YMMD 4XP9L 1CS6A 3IB4A 4ODSL 4NKMB 1QQDB 4HWZB 2NX5B 3EDJA 5ENWB 1JZ4A 3EKCA 1Q8MA 4DWHA 2GJZA 1IBGL 2VN7A 5LGJB 2Z8SA 3OQ3B 4AK1A 1DLFL 1CDCA 3T3ME 2UY7A 9CGTA 4NBYB 1U3JA 5CZKA 3DX9B 2XQBH 3U36A 5F71A 2RFXA 3ULVC 4Y4FD 2MCPL 4HDIB 1MCDA 4MAUL 3A6CL 3V5HA 4PJAB 2J4WH 1XZ0A 4LGSB 3UPCA 2P45B 2HT2D 3PP4L 4F9LA 1C1EL 5IW1A 3INUH 1WEJL 5LBSL 5T3XH 5GSVB 1DVFB 1MFEH 4DGYL 3QCUH 5JIHA 1BQLL 4NUJA 4V1DE 1FL6A 3EAKA 4Z8FL 3I2CH 5HHPB 5HI3D 3TWCH 3DTXA 1ZHLA 1BVKA 2W9LA 4NWUH 2UY6A 4HS3B 1S8DA 4HKBB 4Y2DD 4UU9A 3V6FB 3WEXB 3VXUE 1Q9KA 1PQZB 1RZJH 1GC1H 4NO5B 3LS4L 4I18A 1JGVH 3GJFA 3MLZL 5I1HL 3DROA 3MYJA 3QPXH 1T20B 2GJ6D 3PJSB 2H32B 4KY1H 2OXGA 5D6CB 4M5YL 1A6PA 2IBZX 2B0SH 4HJJH 3QDMD 4Q7DA 5C0IB 5DMGD 1QRKA 3SE9L 4JFDA 3O4OB 3QEQA 3TO4A 4Y19B 1QRNE 1U8MA 4HUNB 2XQYG 3HRPA 1BIIB 1PLGH 3BKJL 3RVWD 2V5MA 4CVZB 1JNNH 5E6YA 5EUOA 3QT2A 4OD2A 1P5UA 3REWB 5E2WL 4MD5B 4XP4L 3AVEA 4H20H 2VABA 3SDAD 5J7CC 5BOZG 2P8PB 3QHFH 3EO0A 2P5EE 1QQDA 4HWZA 3RTQA 2NX5A 4YGAB 2VLRE 4P2YA 5DJZA 2ZUQC 3V4UL 3CSYB 4KH2A 5TQ2H 3BEVB 5LGJA 2N1KA 2KZ1B 1KCLA 1SVZA 3EOAB 4D0DA 3ZO0A 3DX9A 3U79A 5IJVB 3UXFA 5IEHB 1JHKL 4B0MM 1KPVB 4DKEH 5DJ8B 1P53A 4ZODA 1T66D 4Y8AA 1CFTA 2RQ8A 4LVOC 3BPLB 3C60B 2WUBL 3H3PH 1TIUA 4FFVC 5IBTL 2A9NL 2VXVH 4AEIH 2BZDA 1LE5A 4XVSL 4PJXE 5DJXB 5CEZH 4GAGH 1BFSA 5D2LE 4TYUA 1DVFA 1WBYB 4JKPL 5F9JA 5C8JB 5H94B 1EX0A 4QOKB 4CDGC 5TE7H 5L2KA 1FLTX 2XIDA 1XGYL 4K07A 4WHYH 3PP3H 1BQHB 1ND0B 5CILL 3GJEA 2J8OA 4HS3A 3GSNB 2RAMA 1D5BB 1RI8A 3MJ9A 3WEXA 2X2YA 1EV2E 4Z76A 3S3SA 4NO5A 1TQBC 4N0UB 5L8KB 5IKCB 1A1OB 4M93C 1GZPB 3PJSA 4UQ2B 2H32A 4R0LB 3ULSB 3PHSA 4M8VA 1X3DA 3QFDA 3RVXC 1D5ZB 1ZWIB 3BQUC 2WWMC 2VSCA 4HWEL 1YC7A 3MRFB 3QNZB 1TZHB 3VXMD 2GFBA 4XI5D 5JNYA 3MO1B 4Z7WB 3QDJE 4G9FD 4Y19A 4TUKH 1WCQA 4Y5VC 1P5VA 2BNRB 3DHMA 4X6EA 4CVZA 2JIXD 1JFQH 1ZVSB 4YPJA 3ZLQC 4WGWB 1PZUB 1XMWA 3OR6B 4M3JA 5ISZD 3LKRA 1J05B 2VDML 1P9MA 2VXTH 4GS7C 4CU8A 3I6LE 3QIUB 3CFCL 4PRIE 3ZKQD 2P8PA 1CDBA 4DGVL 4XGZB 5D2NE 2CDEA 3STLB 3TIEB 1G7MA 2G5BB 2V5YA 1I85C 3BEVA 5TE4H 2MTPA 1IAOB 4JFPA 1P7KB 1JMZA 5JQ6L 3HFMH 4ZSOB 1A7PH 3MRKA 2VDPH 4WI6A 4J2XA 5IJVA 3E0GA 2EEBA 2NY2D 1SEQH 3CPLB 5CGYD 1KPVA 4ZUVB 1KENH 4D9RE 3ELAT 3C60A 2N4IA 1M7IB 1YPZA 1T1YA 2B20A 4JO1H 4GBXB 4KQ4L 2BVUA 5E2JA 3LEVH 4YEEA 5DJXA 2MPAH 4YAQA 1L7IL 5GGVY 5BV7H 1P84J 1RIUH 1XF5A 4U1GB 1FNEA 1DANU 3QO0A 2AXFA 3MOBH 2IC2A 4KTDL 4QOKA 3MRQB 2Z31D 2VLJA 1QSFE 1YN7A 5BS0A 4Y5XC 1IC1A 1BQHA 1ND0A 2E9WA 4R96B 4LCCA 3R8BB 5EU3A 3EHBD 4O2EB 2VISA 4U31A 1D5BA 1LP9A 1WIOA 4RFOL 2EC8A 2QQKL 5E9DA 1NUGA 4N0UA 2FD6H 4TPRH 1P84K 1A1OA 3R06A 1AHWA 1GZPA 2COQA 3HE7B 1QBBA 4MXQD 2L7JA 3QG6B 2CK0L 1D5ZA 4JFZH 3C9NA 4O4YH 5TDPA 2ZKHL 3C08L 5A43C 3MO1A 4Z7WA 4Q6IA 1NEZG 1HINH 4LSUL 5D7IE 5EWIL 2CLZA 1CDHA 2FB4H 4X6FB 2OM5A 4MCYA 5IEKA 4K3JL 2BNRA 5F7NC 4RDQG 3JBG7 5GGRY 3VDAA 3OR6A 1QFPA 1U8NB 1E4XI 5DMJB 4BSJA 5F93C 4PJ8B 5FUCE 4M7ZC 2EZ0D 1XF4A 3V6OE 3Q6GH 4OZFH 2DLGA 3KGRA 1G6RH 4XGZA 3AAZA 1IEHA 4JGMA 2G5BA 3DMMD 4M5ZL 1K5NB 2AJXH 2Y4SA 4XNZB 1A9EA 1P7KA 1GAFL 3GO1L 3DJ9A 4ZSOA 5C0DA 2DQJH 1NGQH 3LQAC 4H25A 3NA4A 5CKAA 1XH3B 3CMOH 5JTWA 5I1EL 4WWID 2YD8A 1T7XA 2XKSA 4NIKB 3PHOA 4OD3L 3VI3F 3H9HA 1M7IA 3OAZK 4UBDC 1OGTB 2G2RB 3VWJA 1JZ2A 2YRZA 4YHML 2R29L 2D0GA 1J12A 2WUCL 3MC0A 2C26A 4TULH 2MMXA 4XVJL 3RDTB 3BH9B 4JZJC 3P4MA 1L9NA 1IAII 5LGHH 3MRQA 2CJUL 4I77H 4R96A 2V5RA 3G6JE 4O2EA 4ONFH 1BJMA 1HQRA 4UUJB 4PJCB 3IGAA 5I66A 5TPWH 3VGHA 2APBA 4MHHI 4WRLA 5J57B 2B2XH 1MRCL 2VLKE 3MOAL 1ITCA 3HE7A 3QG6A 4LKXB 2P24B 1JGEA 4QTIL 3W11D 4MDIA 4YDKL 3RKDC 2LU7A 4DUVA 4ONGH 1FYHB 3VWKD 3W39B 1MI5D 2WBKA 1KCKA 1FFQA 3MV8E 4X6FA 3X3GL 4JAMB 2Y5TB 1CGTA 3E6HB 4Z77B 3N06B 4G6AC 4Z7UF 4RDQF 3ARFD 1QHPA 1U8NA 1Z5LB 4V1DB 3IDYB 1KEGL 5HYJE 1VDGA 2CUMA 4DVRL 5F96H 3QHZH 1QFHA 3GB7B 5HGGS 2DQCH 1MSPA 4PGCB 2LVCA 4O51B 4PJFF 2NY6C 3VXUB 3O9WB 3NIDF 3HG1D 1K5NA 3JWOH 2AV7B 5CCKL 4R6UA 4X7EC 4U3XA 4TTDC 1MCCA 1MFNA 2O5ZL 2HT3C 3JSSA 4J3SA 4LEXH 1J8HE 4C56B 4ZTPH 1QSED 3KPMA 4IRSC 4ZO6A 5IT2L 5FHBL 1MY5A 2EC9U 3LY6A 4RA3A 4R2GB 1QRNB 5JORB 3ZKXC 3BVNB 3RDTA 4ZUUB 3U4AA 2HWZL 5IFJB 5DK2B 2YHGA 4QHMA 4Y88A 1EPFA 5GS3A 1AXTH 5DC4B 2VDOL 3IRZA 3A6BL 3SY0B 2PTVA 1JIBA 5D1ZC 3AREB 4XNXH 4NOBA 3BI9X 1CVRA 5EU4B 5DRXB 1KUMA 2P5EB 4UUJA 1TTUA 3LH2L 2VLRB 2VZ3A 4BUHA 4GRWF 2R8SL 4PLKD 3BZ4A 5IR1B 5IFAH 4XH2B 5I71C 2YUWA 3P0VL 2F9BT 1AC6A 1FZKA 5CWSB 1TDQA 2C1PB 1GHFL 1KELH 3FFCE 1A3LL 4JO3L 1CWVA 2EXYD 2X4NB 3O2WH 4NQUA 32C2B 4LU5H 4KDVA 4Z95L 1BECA 2BOBB 4S1RL 4N5EC 2FJHA 3W39A 3OF6D 4AMKL 1A7NH 4OUOA 4OUUB 5DVOA 3OJ2C 2OTWA 3GSRA 4JAMA 5MEOA 3E6HA 1JJUA 4PJXB 3D85B 3O3UN 3ZHLA 3SQOL 3KNBB 4M62H 5ILTH 1DQMH 4CBPA 5D2LB 5EN2A 5JDJA 3MLRL 3U0WH 2BSED 5CUSL 4K2UH 1Z5LA 1A6TB 4V1DA 3DV6B 4FQXD 5FUZL 3T08A 1VGKA 1EFQA 5T1LB 4GSDL 3KJ6L 3O9WA 4U6YB 4X6DE 4XMPH 1V3MA 3P4LA 4F2MB 3O45A 3WD5H 2H6PB 2XYCA 3QG7H 1I1YB 4LCIH 5CEYA 4MJ2A 4P2OB 2CD0A 3D87B 4Y5YB 1MJUL 5FK9B 3P4NB 1IAIH 4NZJA 3QDJB 5HHNB 3QFJB 3KLAB 4C4KT 5JORA 1QRNA 1GGYA 3UROR 3VA6A 3W9EA 5DD6A 3NIFE 2OI9B 5HYSB 3WJLC 1PZ5B 5IFJA 2HFGL 5FYJD 3VXQB 3O6FA 4QRPA 4I8DA 4TSAL 4HXBH 4QXTB 3UBXB 1XCTB 1UM5L 3DSNA 3QUXB 4HG4J 5JIPA 1H5BC 4G5ZL 4U1MB 4PJEF 3SY0A 3AREA 1A9BB 4NO0A 4I0PC 5EU4A 4F58L 2P5EA 1PY9A 5DUML 1NGXB 4FQIL 2VLRA 1HHHB 4JHAL 3ESVF 5C07B 4RISH 5IR1A 4BFGA 5BMFL 1XGUB 1N5YL 1U3ZA 3TBTB 4H0HB 2B5IB 5CWSA 3QJFB 1A3RH 2HLFC 4EBQL 5IJKA 1KXTB 1A7BA 2F8VA 5HJ3A 3M17B 3ZDXE 1IBGH 2X4NA 3DXAA 1OTSC 4PG2C 3ZTJH 4HG4K 2VITA 1KLGA 3D69A 2MCG1 3V0VA 1DFBH 1V3LA 4UTAL 3WHXB 4KJWC 2MCPH 4PJXA 4O00A 2D7TL 3SKJH 4JM2B 5D2LA 4YZFF 5DDHB 1VEPA 2HVJA 5D1QA 1FYTD 1UXSB 3PP4H 2GY5A 2X6MA 4GW1B 3C5JB 1C1EH 3ZT7A 1A6TA 3ARQA 5IGXH 1HWGB 4L9LA 3HAEG 3MRBA 1QSFB 1ZE3C 1WEJH 3U0TA 3U30B 2CGRL 1XR9B 4JRYE 4HJ0C 3KS0J 4WW2B 1BQLH 3GSQB 4G7YH 5T1LA 4Z7QE 2W91A 2D7MA 2GUOA 3MR9B 4K7PY 2ZUUA 2DF3A 4F2MA 5KVEL 1EJOH 3RFZC 1T0MB 4HV8B 1I1YA 2CKBH 4JZOB 2DTML 2AV1B 5CMAB 5I1AB 4RWHA 5I1HH 5FV2A 2D9QB 4P3DA 5T1KA 5FK9A 3P4NA 4FXGB 1SJEB 4M5YH 4M1CD 3QDJA 3KPLA 4R7NB 3K4AA 4MAYC 1RZ8B 2VZ1A 3MBEC 4JQVC 4L8SA 4D0BA 2KKQA 1AP2B 5HYSA 1UJTA 5DT1L 2HKHL 4MMXC 5DJDB 2IADA 3VXQA 2VDQL 1IL1A 4HIEB 3KPTA 3NH7H 4UB0L 4NM4H 4QXTA 3UBXA 3K2UH 5F7LB 1XCTA 2MHAB 5EA0H 4KWUA 5JXED 4LPUA 3Q1SL 5I0DA 1A9BA 4PRIA 1CXLA 4X4XA 3V7AG 5MI0C 4X8XA 4Y4HB 1NGXA 5E2WH 5D2NA 4OZGF 1W72B 1DTUA 3K7UA 2GTZA 1LO2L 1CF8L 4K8RL 3TBTA 3NPSC 2PTTB 1I9JL 4CJ0A 1NGPL 4KJPD 3QJFA 1DE4B 1QSVA 1RMFH 3V4UH 5I9QC 1J0HA 4KMTL 5FM8A 5C2BH 4M43L 3ETBF 2HMID 4OLXH 3FO0H 1HNFA 1B3JA 1JGDA 5DZNA 3LN4B 3RZCD 4K94L 5HY9A 2GEEA 3WHXA 3TT3L 4XCCL 4ZXBD 4FOMA 3TVMC 3VG0L 2WUBH 3ZDZE 4U3CA 2FLRT 5DTFB 1PAMA 4JM2A 3VFUB 5JXAH 5TH2B 5KSAB 1AFVL 1UXSA 4XVSH 3GRWL 4XPGL 1GL4B 2AABL 1C12A 3B4NA 4L29B 1QSFA 4XPFH 4DFIA 1XR9A 3SEPA 2DKUA 2J8HA 4JKPH 3VFGH 1U3HA 4O02H 3G6JB 3OGOE 3H0TB 5C0FB 3MR9A 2AS5M 4ISVA 4WV1B 2ATKB 1T04B 5DFVC 2RBLA 2FGWH 2B1AH 2VLKB 4AENB 3TZVD 2P43B 4JZOA 1UEYA 2DQDL 4M6NH 5CZXC 5ETUB 1SJHB 4FMKA 4UILL 4G6AD 2L7UA 3VFOB 2PO6B 4ELME 1N5AB 1DBKL 2NW3B 3TBYA 4YBQD 5GS1C 2A6KB 3T8XA 4BK4A 2WQRA 5KTEL 1OAZH 4WUKL 5E1AB 1SJEA 5BVPH 5FAAA 5D7IA 3I6KA 4QRTB 1OTUC 4GXVH 3PE9A 5DD5L 4P23A 3RNQB 4XPTH 4HWEH 3MV8B 3QPQC 3EFDL 3O2DL 1R5IB 4G43B 3FOMB 5FUOL 1F11B 2NY6D 3D25B 3OG6B 4OCNC 5DJDA 2ORBL 5IOPB 2HKFL 2D31B 4U1HB 4YHPA 1A6VH 5HYJB 2ADJB 2VLLB 3O4LE 4MNQB 2QADB 1FHGA 1YECH 4OBSA 4KROD 3GI9L 4Y4HA 3VD7A 3KPQB 5JW4M 3CFCH 3PNWB 2UWEF 4RAHA 4GO6B 3ROLB 3CFKB 2PTTA 4TVPE 4YHIA 5T3ZE 1BBJB 4DGVH 1YDPB 1MHHA 1PW3A 3WSQL 1DE4A 1MAKA 3BE1H 3GKWH 3MJ7B 4P4KB 4NT6B 3JXAA 4LF3B 5A1AA 4ZUTA 2AJYH 5FM5O 1JPGA 3UDWC 2IALB 3M8OL 3CH8A 3HC0B 5DI8B 4ORGB 5DTFA 3VFUA 1A3QA 5J11B 1FFNB 3RWDA 3DNKA 3S4SA 2BDNH 2EH8H 3JV4A 2G9HB 2HJLB 4AQOA 4A6YL 1OP3K 4JKLA 3WYRA 3VGEA 4XMKH 4RZCA 5IHLB 4KZEH 5IG7B 4TUOB 1LE9B 3H0TA 1AGFB 5C0FA 4JY6B 3CX5K 1SBSL 2ATKA 4OF7A 1HIML 2FSEB 1MCIA 2WINA 5J1TC 3WIFB 2Y5EA 2VLKA 4AENA 3LKOA 2E7BA 5ETUA 1SJHA 2QQKH 2EC9T 2NXZD 1EEQA 3SDDC 1CGSH 1L9MA 1D5XB 4POZC 4YR6A 4N8CL 2XKNB 3EJZC 4RSVA 4QRQA 4RQQA 3CFEB 4N90D 2ZKHH 3MV8A 3C08H 4ZPVA 1XGQB 1F4WH 3FOMA 4RIRA 1F11A 1MAML 4NQSB 1KFAL 3D25A 5EWIH 5BO1L 4LPVA 5IOPA 3BN9C 4JVPA 3MUGB 4MCZB 4UNUA 5KG9B 2BMKB 1DQQA 4U1HA 1P4LB 3MV01 2ADJA 2VLLA 5HYJA 5J13B 2FO4B 1TVHB 5IROC 3O8XB 1OW0A 3P4OB 5GGQL 1A6ZB 2FHBA 3O4OC 3KPQA 1A6AA 5B8CB 4X6DB 3CFKA 5BRZD 4PRAB 1MCKA 1BBJA 4BZ2L 4PJGF 3IJHB 4FTVD 1FNGA 4PY7B 5E5MA 3MJ7A 4ONHB 5GRXG 3TYGL 2LVEA 4OZHB 2ENSA 4NT6A 1MUJA 1J8HA 2ATPB 4O9HL 1DLHA 2VKXA 2JLLA 3GO1H 4RFNB 3LN5B 3TBSA 4XPAL 2O5XH 1UWXK 5L6YH 3LKNA 5E00B 1MCHA 2IALA 4KK8C 5I1EH 2KUTA 4PJBF 2FDBP 3EDFA 5DI8A 1C7SA 3BGMB 3VFPB 4PS4L 4FQCL 1BF2A 1FFNA 4U7MA 4YHMH 1K8IA 2R29H 4HC1L 4WJ5B 4R26L 2C1OB 1KJ2A 4N0YL 2G9HA 4JDTL 2J1KA 3VI4E 2WUCH 4M00A 3AY4C 1FO0A 1NAMH 4YDVB 4XVJH 1G1YA 1MELA 2F5BH 2CIIB 1ZLWH 4W68A 3JTSA 5CEXB 3LRGA 3CXDL 2DRUA 3BPLC 3BW9A 4IIQB 4PJHB 5GGVL 1LE9A 2VXSL 3AM8C 5GQBA 1K9TA 4JY6A 1RU9H 5ESAA 4FQHB 4QXGL 5EC1B 1RZGB 5CJOL 1A1NB 3BISA 2C3VB 2YPLD 3MRHB 3FFCA 1PJ9A 1LEKB 1RQ5A 3I02B 3VXTB 1RHHA 1WT5C 3BO8B 2OX5A 4K23L 3L3DA 1D5XA 4CVXB 3RQ3A 3MRPB 3IAPA 1RULH 5MEND 2XKNA 1XR8B 2OL3L 4BQ9A 5I1CL 3F7QA 1WTGT 2XWBA 1R5WB 1FORH 5DD1H 4APQB 3CFEA 3FMGH 5DRWA 4EUPA 1XGQA 2K7PA 3KPRE 4HJ0D 4WCYL 1T1ZB 4YDKH 5B38G 3H3BC 4QYOB 3RUGE 2NTSP 1SJXA 3BFOA 4MCZA 2BMKA 4X6CE 4R0LC 1KULA 3F8UB 5EU6D 5KBNC 1UVQA 2BOCB 2FO4A 1TJGL 1TVBB 2VMFA 4JRYB 2NY1C 4IMKC 3WO3B 3P4OA 1AXSA 1RZKL 1A6ZA 4DJMA 1CT8B 3ARVA 4WFEE 3ARGD 3QUYC 4WWKB 2IH3A 4GAJH 3BHBB 3UJJL 3W2DH 4NHCH 2YOCA 4PBVC 2FEDC 4YHYB 1KBGH 4PRAA 1F97A 5FKPB 4HKXA 4YEFA 1VENA 1ZA3A 3B9KD 5KN5B 4XC3L 5DO2C 3DGCR 4HPYL 2HG5B 2FATH 1HZHH 2CUHA 3U6RA 4IOIB 1Q0YL 5GGUB 5D5MF 2F5AL 4NC2B 3FB6A 3TPUA 5E00A 3QIUC 2A6DA 2X4PB 3MLUL 3BGMA 4KKLC 1A7OL 1NCNA 3VFPA 1CTOA 2Q7YA 3FCTA 1NDGB 2FX8L 5IT2H 1DEEB 2CLRA 5FHBH 1OB1B 5DEFB 1KTKE 1MCFA 4UNTA 4MA3B 4NZRL 4HIXH 4URTB 3B5TA 4OQ1A 1AR2A 4YDVA 1V5JA 4KZDL 1AD0B 5D1XA 5F88B 4IIQA 4EVNB 3PG2A 2VQ1B 2VDOH 4PJDB 3K46A 5MEPA 4OCLC 4S0SD 3IFPA 4FQHA 2JK5A 1NL0L 2ADIB 4GBXC 1ETZA 4LSTL 5EC1A 1RZGA 1DDHB 1A1NA 2YK1L 3OAYH 2C3VA 4QT5B 3PIQA 3LH2H 3MRHA 5EBGA 4XXCC 3I02A 3P0VH 4TRPL 2CDFB 5JMRA 2IPKB 1JK8A 4MJ5A 5INDB 4CVXA 5CFHA 4JM4L 1XR8A 4Y4KB 4JO3H 1HCFX 1R5WA 2MJWA 3VFNB 4OSUH 1DEDA 4L3EE 4APQA 4XBEH 1T83A 2QLVB 1J11A 4Z0BL 4KVCH 3S35H 4Z95H 3HI6L 1CDUA 4GG6F 4S1RH 1HILA 5JOPE 3WS3A 1CLYL 3RI5F 3Q3GA 4NBXB 4AL8L 2VDNH 3H9SB 1N59B 3SQOH 2FBJH 1EEZA 5JA9A 3QNXB 1TVBA 4JRYA 3F6LA 3MLRH 2R4SL 2KQMA 4GRLC 4WWKA 3VGGA 4G8IA 3DUSA 5DD0H 3MRJB 4HIJB 5GRJL 5FKPA 3QPQD 1EXUB 4G6FD 2YD9A 1B2WL 4L4VE 1EO8L 3IDXH 3OTTA 2I5YH 3IXAB 2LU3A 5JHDE 1VPOL 4LCUB 3P0GB 4N9GB 3P9MB 1KGCE 3TH3T 1XIWB 4G9DB 4PJ8C 4P46A 4WHTB 1P7HL 1AIFA 3NGBB 2PYEE 1NDGA 2BSRA 4JFDD 1DEEA 4NNYB 2P46B 1OB1A 2BHUA 3TO4D 4FS0A 1FLRH 4DKFL 3SE8H 3O3EB 3DHJA 5BZDB 2AKRB 4HIHA 5IK3B 3FB7B 1NUFA 4OIBA 1RVFL 3QWQB 3O4LB 5DQ9A 2M8XA 4JFOB 4YXHL 3BIAX 5I8EA 3KPPB 5KW9L 4EVNA 5IM7A 3DOSA 5TDOB 1UM5H 4L4TD 3B9VA 4Q6YA 3WO4B 1NAKL 3OL2A 5I17B 3FQNB 4PREB 4BK5A 2X10A 4OF0A 4F58H 5DUMH 3RTQD 2NX5D 4S1DD 3ZDYF 1N7ML 1MOEA 2YD1A 3MJ8B 4JHAH 3SE3C 3FQUA 1F5WA 1JNHA 3N9GH 1EUUA 2CDFA 4GMSL 1QO3B 2VL5B 5I16A 3WNPA 2C7UA 5JMOC 3VFNA 3GM8A 4HULB 5CSGA 3GBML 3PWVA 2OBGA 5DLML 4G3YL 4E42B 2ENYA 5E8NB 4WI3A 2HJFB 5KSBB 4UTAH 1S9XA 3G08A 1U92B 5ICXA 4NGHL 5JW4Q 1ZKAA 3L5WB 4KFZC 1N59A 1TITA 3WFEL 2Y1VA 1F2XK 4OCMC 3G5VA 3QNXA 1DVFD 3LKPB 4NQXB 3QQNA 3ZKSD 2ZOKA 4JVUA 5FYLD 2C4FT 2ZP0T 3PQYB 2EDHA 4HIJA 2PUQT 3OWEA 5FF6B 1INQA 1HH9A 1EXUA 2WANA 5EDXA 5F7EL 4OB5L 2AXHA 2P5WE 3B2UC 3KPNB 2YEZB 4LCUA 4DK6A 4ELMA 4MYWB 5KVEH 1JYVA 4N9GA 5DHVH 2WK2A 3P9MA 3SDCA 3RGVA 2HN7A 1XIWA 5FECA 4LQFH 3OAZH 4TSBH 4CVWA 5IB1B 4MXVF 3VRJA 1CR9L 2NY3B 4NNYA 2BCKB 3S88H 2MNUA 2VTFA 4Y19D 5GISL 4OFIA 2NY4D 2AKRA 5J9PB 3SHSA 2QR0A 3FB7A 1G9ML 4HWUA 1FIEA 5E8DH 2W0PA 3LD8B 5DT1H 3O4LA 4XCNB 2HKHH 4ZS6C 3KPPA 1YNTA 4QO1A 2E6JA 5TDOA 2EDFA 3SGKA 1A0QL 2XI9A 3FQNA 1NCUA 2V2WB 4R2GC 2NY0C 1ZGLM 1T2QH 5KVGL 4ZS7L 43CAA 2WBWB 2WSKA 4Z7NF 1LO2H 1CF8H 4K8RH 4CL7A 4GXUN 1UACH 3PL6B 1I9JH 1S5IH 1NGPH 1JN6A 4QHLB 2VL5A 2HTKD 5DEGA 4WO4A 3EYQD 2SEBA 3MNVB 3BPOB 4KMTH 3HA0A 2NTFB 4HBQA 3U46A 4E42A 3V0WH 1V8HA 5BJTB 3MLXL 5E8NA 3C60D 4KTEL 3ARDB 3HI1B 3RWCB 3K4DA 4AIXA 3WFHA 3ZTNL 1CGXA 5HI4D 2OK0L 1UH4A 3MXVH 3DUUA 3O6LL 1OM3L 2VB5A 4BH7B 3LKPA 1QZ1A 3NZHH 1MIML 4KI5C 4QOKD 2VLJD 4U1NB 5HBBA 5BS0D 4N68A 1TQCB 5BV7B 4NCC2 5BW7C 4BKLB 4RGNC 4NO2A 3SCMB 4BSWA 1A14L 1U8LB 2FJGB 2PR4H 5HGHB 3VD4A 3UO1L 2DDQL 5E8OB 2R0ZH 3KPNA 3EDDA 4ALAL 1MCWW 1N2RB 3VXNB 3TESA 4OGXH 1U42A 2DQDH 4K7PL 4IMLB 1A7QL 5MP6L 1XF3B 4UILH 4NN7B 2ICEB 4X98B 5DJ0A 1JZ5A 1YY9D 3IS1X 3KPRB 5KTEH 1TENA 3P77A 3RUGB 2GHWB 5DURB 2BCKA 5DD5H 3EO9H 2IMNA 4EI5B 2DJUA 3PHQB 4X6CB 2BNRD 4M61B 4JFFE 5FUOH 3NA9L 1EHLH 2P44B 4XCNA 1F90L 2ORBH 1X5LA 4P2OC 1R3IL 5DMYA 1P6FA 1G6VK 4Y5YC 5I15L 1EFXA 3LKQA 4JRWA 2XNAA 2E7CA 2AXGB 4ZUWA 4N0CD 1RFDH 3L3GB 1AH1A 2DTSA 3ROOA 1RUKH 1J7VR 4K71B 4JJHA 3N1QC 3U2SA 2ITCA 3IETB 4OI9A 4MA7L 4OZFB 3WSQH 1T0NB 3QUXC 1G6RB 5F1SA 3MNVA 2GAZB 2VL4A 1I8LA 3O6KH 4IJ3B 1TTGA 3JZ7A 2NTFA 5EUOF 2ICWJ 5BJTA 4EJ1C 3VXPB 1I8MB 3VWJD 3RWCA 2B5IC 1W0VA 3BUTA 4IRJC 1Q9LB 3D39B 2X5PA 2EYSA 2ADGB 3E8UL 4BH7A 1QLRB 3PWPE 4ODVL 1YEJH 1CZ8H 4H88L 1IE5A 2QJDA 2XZCL 1IZKA 3V95A 3MODL 3O3DA 4HGKC 3SKMA 4U1NA 3K1KC 3NIGE 2YD3A 4A6YH 1FDLL 3MV9E 2DBLH 2JCCE 1S78D 3JV6B 4BKLA 1EGJH 3B83A 1U8LA 3VFWA 4Z7VE 4BJLA 5HGHA 5GGSB 4P3CL 5E8OA 3TFKC 1HIMH 1UA6L 2V9TA 1A1MA 1DBML 1T3FB 1S9KC 3VXNA 3IFOB 3HRZB 1D6VL 2H3NA 3CGTA 3HE7D 4IMLA 4NO3B 4Q9QL 5TF1L 1XF3A 2V17L 1CN4A 5C0RH 2ICEA 4X7TB 2W59A 4L3EB 5BXFB 3IKCA 4WW2C 5C0NC 3GBNL 3KPRA 2P49B 5JR1L 3FONA 3RUGA 3ULVE 1BQHG 3BKML 2HFFA 1BOGA 3B9EA 3GRWA 3PHQA 2DB8A 1Z6JT 2YPVL 4X6CA 1QEWB 4FNLH 1TJIL 1MAMH 1J18A 1KFAH 1AI1L 4ZOBA 1I4FA 4JVWA 1IKFL 1BFVL 3OKNA 1IC7L 5DK0B 1I75A 4BYHA 4EN3B 5IVNA 4Z5RB 5F6HI 1CE1L 4YLQT 3LOWA 4RRPA 1JZ8A 1S7VA 4YDIL 5F1KC 1A4KB 4L4VB 5HPOA 1EVTC 4NJAL 4F3FB 4LASH 3BUYB 3MCG1 2WIMA 5JHDB 4GW5B 3IETA 4BZ2H 3HPLB 4OZFA 5ID0B 1T0NA 4W70A 3EYOB 3VG9B 5TDNB 1UB5B 3BRGC 5LWYH 4O9HH 2PYEB 4XPAH 1V3JA 3GNML 2BRRL 4JANB 2Z92A 2CRIA 1Q9LA 4PS4H 5DMIH 1EERB 4FQCH 4W81A 2ADGA 5IBUB 3MLVL 3RDTD 3CVHH 4FQ2L 1MAJA 1T5WB 5EOTA 3ZSSA 4R26H 4Z78B 3GSWA 4N0YH 4JDTH 1D6EB 3W81A 5D8JL 4BA8A 4PG9A 4RNRB 4B7IA 2J88L 3SJVB 3OZ9H 4P4RB 3FB5B 4QRSB 4IRZH 2D0HA 4JLRB 2VC2L 4E0RB 3JV6A 2DLEA 3LB6C 3GSUA 3PDGA 3GGWB 2ZPKL 5GGVH 4KDWA 2VXSH 2NW2A 5GGSA 4QXGH 4OCSL 3CMGA 5KSAC 3FOLB 3MRGB 1QFUH 1YPZF 2XKUA 3C8KB 2IQ9L 3KVQA 1J0KA 1MIEH 1OF2B 4NO3A 3MSPA 3KS0H 1H15B 4X7TA 1Q72L 4L3EA 5J0BA 3HI5H 4K23H 3JVGA 1BIHA 3CD4A 2YD7A 3C5ZB 3ZE2F 5I1CH 1G7IA 1IGYA 3F6IA 3CAFA 4WV1C 5E03A 3T0WA 1KACB 3QDGE 5DFWH 2C5DC 4C55A 1BX2A 4WCYH 1QEWA 5EZLB 3IDUA 1AQKH 1LP9F 4XXDB 4GAFB 3ULUC 4WI4A 2ZOLB 2OZ4L 3I9GL 4X4YB 1IARB 2P48B 2EDLA 4V1DD 4LRIA 2ARJQ 1FL5A 2EDXA 3QULB 1HEZB 2HLAB 4EIGB 3UYPA 1F4XL 1RZKH 1T21B 2OQJB 2ZCHL 3O9WD 3VXUD 1JTTA 5IVZB 1R5VB 2P5WB 3P11L 1ZT7B 4F3FA 3BUYA 4DCQB 2BFVL 4KUZL 4NKIL 1N64H 2KZWA 3HPLA 2UVFA 5ID0A 4MJIB 1CFSA 5TGBB 4XC3H 2HAZA 2QADC 1ZGLA 4ZFOA 2NR6D 1S9VA 2Z91B 4L4JA 2F5AH 1NH6A 2KH2B 2BK8A 2IAMC 4Z6AT 3MLUH 2E27L 3I3DA 1A7OH 1QRND 5E94A 3ARPA 4K9EC 2FX8H 4P4KC 3OJMB 1IZJA 4KRMB 5F7HA 3AS3A 4WU5B 4LFHD 2PNDA 3BGFB 3I84A 3O6FD 1TJHH 4Z78A 2O26U 3MZGB 1D6EA 4GQ9H 3RL1A 3FRPA 3UJIH 3AB0B 2OTUB 4C59B 1GGTA 3ARED 4NO0D 4BFIB 2Q8BL 2P5ED 4G42B 1QKZH 4P57B 4HX1B 5K9KB 2VLRD 3MGAA 4G6KL 1Z0NA 1F45A 5J11C 1E6OH 4GRWH 3UPAA 2Y7QA 3T2PA 2D4FA 2YK1H 3MGTA 5JW4R 1OF2A 1SEBB 3DXAD 2Y25A 3PDDA 5IVXE 3IYLW 5KZCB 2N7AA 2XTJE 5C08B 4BQBA 3B5GA 1HOCB 4GMTL 3C5ZA 4OZ4B 1I3UA 2NXYB 2Z0BA 1NGZB 1WBXB 3VRLF 5F1NB 4FG6C 2VZTA 1ZHKA 1BZ7A 1VFOA 4XXDA 4NQDE 5I1JH 2BC4B 1UZ6F 4EDWL 1CLYH 2ZOLA 5D1QD 1WFTA 4X4YA 1R3JA 4KK9D 4UV7L 3IF1A 5T5NG 3ARZA 4U6TA 3T3PF 3CLEL 3OKLB 2ZZUT 4BQCA 1NCAL 4M6ML 2HLAA 5CSZB 3FO9B 3REVA 4F15C 5T1LD 2APTA 1T21A 2AEPL 4LLMB 2D7PA 5J3HC 5IVZA 1R5VA 2P5WA 3EYSH 1ZT7A 4KKCC 2PXYB 1BJ8A 4DCQA 5F3HB 4HMCA 3UZEA 5LVEA 2FYYA 4G6MH 3BP7B 3AU1A 1KTLB 2MQ0A 5TGBA 4OZIB 3O8XC 1EUTA 4MNGE 3GMOB 3H9YA 5T1KD 2BVEA 1NFDB 3L7EB 3GMQA 1CIUA 2FX7H 5HVGB 4X9BA 5B8CC 2CKBB 3CNKA 3QXWA 3CFJB 1TTFA 3C8HA 1UCBL 3QDJD 5SWSE 7CGTA 2BVOA 2BX5A 4MZ2A 4U6VL 4M02A 1JPTH 1MFCH 1M05A 5SX5H 4NNXB 5FFLA 2EDEA 1HK6A 1QTYT 4RFNC 4DKFH 6FABL 2H9GB 3TBVA 1KCSH 3HZVA 3HPJB 4KJYB 4OF5A 1MH5B 2B4CC 3FN9A 1RVFH 3I6LD 4XCEB 3NTCL 2OTUA 1I9RL 4UDTB 2W92A 4PRID 2B7DT 3WFBL 4BFIA 4G42A 4J4PC 4HX1A 3X13B 2QV2A 3VFVB 4YHZH 1NAKH 3H7BA 4HHAB 4W4OA 3TBWB 5DK3A 2NY7L 1NCCL 1S5HB 4PRPB 4J23A 1FZOB 3HS0B 1N7MH 1BZ9B 1YEGL 4PBWD 3ZKMD 1Q9WB 4LFHG 4HMEA 4GMSH 2DQUH 4D9RD 2WLYA 1MCWM 4HZAA 2ADFH 4OZ4A 1EA9C 1CDGA 1NGZA 4P49A 3GBMH 5DLMH 4G3YH 1FBIL 3NFSL 4HS8L 4JM2D 3PWPB 4XHJC 5C6PB 4Y16B 3PXHA 4DK3A 4NGHH 1YYML 1G0DA 1ITBB 1P7QB 3LEXA 1QSFD 1ODAA 1HHIB 5BQ7B 1EEUA 1TNMA 3Q5OA 3QXAB 3MV9B 5T5NF 3QUKA 5CSZA 3TJHC 3FO9A 4OV5B 2JB5L 4KAQH 4LLMA 4TUJB 3S36L 1HYSD 1SYVA 5ABDE 4Y89A 5F3HA 2IWGA 2CDGA 1OWRM 1J86A 1AO7E 1KTLA 4K3HA 3BPNB 3GMOA 1FNLA 3B3IB 1DUZB 3L3KB 3T0EB 1G9NH 4JDZB 4C58B 2CKBA 3CFJA 4CW1A 3FQTB 5ID1B 1OGAB 4P23D 1PKOA 4M7JL 3OKOB 4JFFA 4UT6H 4XPHH 2W9DL 3HC3H 3FN0H 4ZQKB 5B4MD 2JE8A 1UM4H 3I50H 2CR6A 3I3EA 4UDTA 3S37X 2Y72A 3RPIB 2E8YA 4Y4HD 3X13A 1M4KA 1H8NA 3VFVA 5ITBH 2DL9A 2I26N 3TBWA 1NC4B 1FAIL 3QIWC 3BKCL 1FZOA 1NCWL 5KVGH 4ZS7H 2GT9A 5HYSG 5J56B 3NCFB 3NCJL 2HH0L 4XTRC 3OHXA 1ZT4A 4AH2A 4LHUA 5HYQB 1DN0B 4WHCA 5F7FA 1MWAL 3T65A 3GHBL 2PYFA 5D6DC 2PW1B 2FECL 3T4YB 2ZNXA 1IFHH 2R2BA 4QHNB 4ELKA 4OAWA 3Q48A 1MVUB 1UYWH 1WZ1L 3MLXH 2AK1H 3PWLA 3PWPA 3NFPA 1ZANL 4Y16A 1X5FA 1FVCB 1X5KA 3KPSB 4Y4KC 4TQEL 1LHZA 2OK0H 1QD0A 5ERWB 1OM3H 1WISA 4PGEA 5BQ7A 1HHIA 2EDYA 2XA3A 1UZ8B 3MV9A 3ARBA 2D9CA 2JCCA 3LHPH 4OV5A 4CNIA 3RWFA 3HAEH 1MIMH 4N0FA 3ZYJA 5JQHC 1MHPH 4TUJA 4Z7VA 1CIDA 4HUUA 4LOUD 3KYNB 3KYMB 1GJIA 2Z35A 2VLKD 4PGJA 2DJSA 1HQ4B 3STBA 5IHBA 1DBJL 1H3WM 2R0KH 2XPGB 4PJXF 2DDQH 5FYKL 1DSFL 1X5ZA 3LV3B 2PO6D 2L4OA 4ALAH 3WFCL 5D2LF 5E08L 1A7QH 5MP6H 3FQTA 5ID1A 4LVOB 35C8H 2NLJB 3MV8D 1CGYA 3UAJD 4R3SB 1SMAA 3HCVB 5CP7A 4KGJA 4ZD3H 1PSKH 4U1LA 2AGJH 5DA4A 1ZLVK 3DX8A 3TV3L 1KSRA 2X9YA 3O11B 3CFIC 3DIFB 1CD9B 2HJKB 3OJDB 1RZJC 2YA1A 5HYJD 1GC1C 5ALBL 4ZFFA 4G8FB 3OKMB 1R3IH 4U05A 2BVPA 3RPIA 3OX8B 1VFUA 1MI5A 3CLFL 5JDSB 1VSCA 5I15H 1FRGL 4RAUA 4BFEA 1CD1B 3QZWG 2ILLA 1C7TA 2XRAH 1NC4A 2GSIB 3DRTB 3MX0A 2W9EL 2OCFD 3NVQA 3TN0C 1TQBB 3UTQB 4BM7A 3QUZC 4KVNL 4M93B 3MGOB 5HHOE 4LLYB 1OSZB 4I3SH 4XCYA 1J8HD 1MFDH 4ORZC 5C0AE 2LAGB 5FYJH 2W0KA 3BQUB 4MQXC 3LS5L 4KKAC 1QR1B 3WO4C 4QHNA 1ORQB 2VH5L 3V52H 4Q9CA 2JJSC 5MERB 3K4ZA 2CUIA 5D7SH 3RWEB 4FQJH 4RFEB 5J12C 3SKNB 1XGPB 1X5HA 3MV7B 4XNMB 2B1HH 4CRPA 5E2VL 4ENEC 3CDYA 1JP5A 2ED9A 4J3WA 3E8UH 3DETC 4I2XE 2F54B 1B0GB 1KNOB 1QFWM 1KB9K 4GS7B 3X11B 3L7FA 3MODH 1FP5A 2X4QB 1BBDL 5DS8B 3TF7C 1T1WB 5AAWA 4LLUB 1NAMB 4R9HA 1YMHB 4JPWH 1SYSB 1U6AH 1P4IH 1LK3L 3FFCD 1F3JB 2A1WL 4XWOD 1INEL 2XPGA 3P40A 3LV3A 4PRBB 3V4VL 3S4SG 5IMKA 3FB8A 4JM2F 1DBMH 3VXSE 2XTJB 3HLAA 2R0LL 1L6ZA 3HE6C 4JN2B 1EH9A 4YNYA 1BQUA 3MREA 4Q9QH 5TF1H 4KHXH 5FYLL 1DQDL 3QDGA 3GBNH 4R3SA 1JCKA 2Q3ZA 4NQDB 4P2QB 1NC2B 5FB8A 3MJ9L 2M2DA 2GW5A 1OAQL 2BP3A 2ZSVA 4C83B 5DUPH 3ILQD 2GJJA 2PCPA 3O11A 1TJIH 2HJKA 3OJDA 1EMTH 1XF1A 4DTGL 2DD8H 4G8FA 3KXFE 3O8XD 3QCVL 5AZEL 3IDJA 1IAKA 3FO1B 4Y5XB 1IKFH 4UQ3A 4E41B 2NY3C 1IC7H 4XPBL 4DW2H 2YZ8A 3P30L 2VNCA 5LKNA 2A0LD 1Y6NR 1VEOA 1WFNA 5D7IF 1Q94A 5J89A 3GDBA 1I8KB 3UTQA 3L3JB 1FIGH 3Q6FB 3BP4A 2W07A 4TSCH 1VEMA 4LLYA 2X1XR 3V4PL 4MNGB 3FT4B 3U9UB 2YKLL 3BQUA 4M1DH 2MFNA 4F8TA 5GHWL 2IFFL 5F1OB 5SWSB 5I1IH 2Q76B 4GLRI 5MERA 3IU4L 3S36X 4RFEA 4NQEE 3BPCB 1Z9SA 3TT1L 3STZB 4Y5VA 1YEIH 4CGTA 3PL6C 5J06A 5HVWA 1N3NA 5ACZA 4OV6F 5EZIL 4NP4H 3BPOC 1FH5H 5GJTH 4TNWK 1Z9LA 3GMRB 4FQ2H 5D1XD 1KNOA 1NBVL 2X4QA 4LPTA 5DS8A 2P8MA 3E1F1 4K55A 3T0AA 3ARDC 2NZ9C 2MSPA 1T1WA 2R1WB 4Q0XL 3ZKND 8FABB 4ZNEE 4XNYL 4LLUA 3MNWB 1NAMA 5L8JB 1YMHA 3UTZB 1KTDB 1SYSA 2R2EA 2ZPKH 1I85A 5JZ7C 5GPRA 4ZTOL 3BJLA 3PV7A 2ICWI 1F3JA 3W0WE 5K59E 4JPIB 1DQLL 4OCSH 4YHNB 4PRBA 3QA3A 1FFPB 5IVXA 3VH8A 1IGCL 5EOQH 5IW6A 5JW4N 2F19L 2YXMA 5BV7C 4ZAKB 2DQGH 3U1SL 4HQQL 3UPRA 4APQD 2VUOA 5MEQA 1WWAX 3U9PL 4LVHC 4AEHH 4UT9L 2GITA 3S37H 1PFCA 4XCFH 5T5FL 2UZXB 4WDIB 5E7FA 4LIQE 4NQDA 4KKBD 4C83A 3ECBB 3OXRB 2J6EH 2ITDA 4JQXC 5I73B 3SDXE 1KCUH 4R8WL 4JZJB 4JR9L 4Q9RL 2V5SA 4LAQL 4XC1L 1GGCH 1MLBA 3ILPB 4JRYD 3MFGB 4WUUB 2OZ4H 2X9XA 1MCSA 3FO1A 1ACYH 4Y5XA 3I9GH 4NQVB 4X8JA 1FV1A 4WWKD 2Q7NA 1I7RB 3BZFB 5EFIA 1R24A 1FNSL 5DEZA 4EI5C 4EUPG 3T04D 1F4XH 1KJVB 3DX6B 3Q6FA 1R3KA 5C0BE 2ZCHH 1H8OA 1UG9A 2I60H 5FYKE 2XWJB 4S1SL 2BFVH 4MNGA 2VDKH 4KUZH 1BD2E 3F7VB 1ROWA 3D3VB 4QRRE 1DUYB 3O0RL 2DM7A 1SY6H 4P46D 5FO8B 4PLNC 2Q76A 3RL2A 2V2XB 3D2UA 1I1AB 3WIHA 5CD5C 3BMVA 3BPCA 4K71C 3WN5C 1KB5B 2ZUVA 4F7CB 4JB9L 4IBLT 1U8PA 4F7MB 3B6SA 4LLDB 4LLVB 4B7LA 4CAGA 2DMKA 1TVDA 3GHEL 5JUEL 4QXWA 2BY3A 4PJ7E 3MCKB 1TCRA 1DQJB 1N26A 4IJ3C 1EIBA 5EO0B 3GMRA 4HW6A 3U7YH 5DJAB 1P4BH 4P9HL 8FABA 2DQIH 1VGEL 3MNWA 4ZO9A 1X4XA 1A21A 4IOFC 1KG0B 3B2VL 2Q8BH 1UB6B 4ERSL 5C70A 1PKQE 3HUJB 4OJFL 1RZFH 2EXWC 2C3XA 4JO4L 1BJ1J 5I0ZA 1G7HA 4MZ3A 1FNAA 1WWWX 4LSVL 2VKWA 3WHE1 3DURB 3NFNB 4NCC1 1HSBB 4CKVX 1CCZA 1HHJB 3C87A 3SKUD 3KYOB 4IRSB 4WDIA 4F33B 2K1MA 1HH6B 2VXUL 4G8GB 3ZKXB 2W60B 4CMHB 3ECBA 3OXRA 4XVTH 5HHXH 4NN5C 4XRCB 1KCRH 3THMH 5CGMA 4JZJA 4EDWH 1CU4L 3FTGA 4IS6B 5E8EA 3OG4B 1B9ZA 4NQVA 2C9AA 4WTZA 1KPUB 4UV7H 2X4SA 1I7RA 1NCAH 1ZHBB 4M6MH 4PJAE 2XWTA 1MJ7H 2FX9L 1KJVA 5I19L 4K3EL 4Q74A 1C5DB 2BJML 1AO7A 5K93A 5I71B 1AGCB 3O3BB 2XWJA 1G7JA 4LGRB 3BYYA 1MCLA 3BDYH 2R56L 1VFAB 5JOEA 5KSVA 4N8PA 5DHXB 1DUYA 3RGVD 3OKDB 1XIWD 3X3FL 4EN3C 2YWZA 1A4JB 1L7TL 1MHCA 1IM3B 4GUPB 4L8CB 1GPOH 2WNGA 3JTTB 3H42L 3ULUH 2HFEA 4P2CG 1LO5B 2APVA 1KB5A 3K2MC 1UCBH 2AJUH 3MXWH 4LLDA 3QWOB 1QBLH 3DYPA 4RCAA 4U6VH 1YEKH 4R90L 5FDWB 3MCKA 3TIDB 4YK4B 3O4LD 5EO0A 5DMKA 3UYOD 4X0KB 1MPAL 5F7DB 5DJAA 4RMSA 3GSOB 5I8KL 3NTCH 1I9RH 4HAFA 2JJWA 3WE6B 4TVPD 1KG0A 4X4ZA 5T3ZD 5E99H 2DQFB 1NKRA 3PGCB 3C2AL 2DQTL 1NCCH 3HMXA 3CVIL 4TNVK 1AD9B 5DFTA 3FQXB 5C0AB 3TNNB 4RBPH 4F37K 3NFNA 1J0ZA 3ISWA 3RIFF 1HSBA 4K9EH 1IMHC 3QRGL 3SBWC 1U95B 1HHJA 4EI6A 3HHRB 3MRMB 1UXWA 1CBVL 4M48L 3GUTB 3KYOA 4IRSA 2LE9A 4F33A 2LTQB 3NOIA 2GK2A 1Y6KR 3GSVB 1CK0L 3DRQA 1A5FL 5EIIB 3MA7B 4XRCA 5J8OA 4FFZL 1D9KB 1FBIH 2OP4L 3ZDXF 4HD9A 2KBGA 2WBJC 4I2XB 4IS6A 3IDNB 1YYMH 1H5BB 2A2QT 3EZJB 5EUKB 4ODUB 5FKAB 1KPUA 3J8F7 5D1ZA 4EZMA 4I0PB 2DQEL 2XZAL 4UT7L 5AWNL 3RP1A 1ZHBA 2P42B 5HDQH 1A22B 3EYUH 2NY5L 5IESL 4FXKB 1RJZB 1T4KB 1AGCA 3S36H 4U7KA 3H6JA 2EDOA 2AJSL 4GW4B 1OAYL 1VFAA 1S3KL 3VXSB 1S9WA 4PGBB 3HKFA 4N1HB 3OKDA 3K0WA 4NJ9H 3L1OL 4LP4A 4M9PA 1UADC 1IM3A 1RIHL 4L8CA 2CXGA 5GZOC 1LO5A 1ZT1B 4YBHA 1UWEL 5LGKA 1XCQA 3QWOA 4PP2B 3QIBC 2FHFA 5CP3H 1C16A 5ITFB 3U48A 3VGDA 3NABL 5DJ2B 1RURL 1S7SB 1K2DB 3KXFB 4WEBH 2PN5A 1IGFH 4X0KA 5F7DA 1EFXD 3VXOB 4S0TD 1G0XA 4ZPTB 4WI5A 4U2ZA 4W6WB 3GSOA 2UZIL 4K7FA 3MRNA 4XVUC 4EDXB 5JW3H 2ARJB 4ZMAT 1FAKT 1HKLH 1DL7H 1HNGA 1K4DB 1CTNA 4NYLB 3HB3C 1IC4L 4D9LL 2X4UB 3QAZC 3OB8A 5HHOA 3ZL4L 2VAAB 5HD8C 1FAIH 1AD9A 1KJ3H 1II4E 3FQXA 1R3HB 5C0AA 2QEJA 4JG0L 5CINL 5EIVA 4ZUSB 1U8QA 3CFDB 3CZJA 4OKVB 5DC9B 5EBWB 4PJ9B 3IS0X 4R4BB 4X5XB 2FIKB 3GUTA 3RA7L 4NQEB 1JUFB 1B4JH 1U9KA 5F8RC 2K9UA 4KK6D 4MAYB 3VCLA 3GSVA 1NJ9A 2BVYA 3KWWB 3WXWH 3T77B 5EG6C 3WJLA 1UWGH 5EIIA 5CBAB 1WZ1H 2A74B 4HK3N 1RUPL 5DSCA 2VR9A 4LNRB 2JJVA 2HT4C 3GMLB 4OM1L 5FGSA 3VXRB 4I2XA 4MA1C 3IDNA 4UIKH 1H5BA 5DVLA 1JRHI 4FZEL 4ODUA 1YMMB 4TQEH 4U6XB 4UOW1 3RVTD 4I0PA 4OGAD 5F9OH 4PB9L 1VFBB 5E6IB 2Y36L 2X4OB 3S5LG 1WGOA 1JV5B 1BEYL 1T4KA 3SCMD 2VDRH 1TLKA 4NNPL 3W0WB 4P2RE 4YDJA 5IMLB 2AI0H 3AROA 4A6YB 3ZDZF 4M6OL 4RWYH 3FKUS 5I9QB 3VXSA 2H2SD 1HHKB 4P3WA 3HNSL 1OOAA 3L9RA 4PG2A 3WL9B 3P9LB 5L88L 4HWBA 1DSFH 3DLQR 1S7XA 2RR3A 3RAJL 5FCUL 3MMEB 3KPRD 4WI7A 3DVNB 4X9IA 4F7TA 5DURD 1ZT1A 2PXYC 3IDGB 1MEXH 4PP2A 3TVMB 5SX4I 1KT2B 1ORSB 4PUBL 4NPYB 3P0YL 5DHYB 1PBYA 4QCIB 2Z93B 4NKQB 4KRPD 3UCRA 1S7SA 1K2DA 3KXFA 3TV3H 4ZOCA 5ADPL 1Q9OB 4JO2L 4ELMF 3VXOA 4MA8L 3GJFH 4NFDA 4ZPTA 4Z9KB 1CXEA 4WFED 3TO2A 4UOJA 5B22A 1X6LA 3C5SB 5GSRB 1OL0A 2GTWB 1FRGH 4NYLA 5C0BB 1JHLL 1T7WA 2QSTA 1DZBA 1G1CA 1XFPA 2Q6WA 1XGRA 4PGZA 2VAAA 2H2PD 5LAXB 2W9EH 1R3HA 1BD2B 1EDQA 1JHTB 2Z8WC 4QRRB 3U7WH 3VJ6B 2IBBA 4OZGE 5DGRA 1OCWL 3ARGA 1LEIA 3MFFB 1OPGL 3MLSL 2AJZB 3EJYD 4NQEA 3GIZL 1JUFA 5TE6L 4EOWL 4DQOH 5CJQL 2VH5H 4M7KH 4MAYA 3MBEA 2D7OA 3B9KA 3KWWA 4JQVA 5HTSA 4HCRH 2ED7A 3FZUC 2YRPA 3KR3L 4X80H 1HSAB 2APXA 5CBAA 2A74A 1E4KC 1MHEB 3IAQA 2AVGA 3MJ6A 4LNRA 1IGJA 3ZE1F 2FHCA 2OJEA 3SDAB 1IKNC 1H3TA 2E5EA 5EH1A 5AYUH 4BH8B 2C4XA 1H8SA 4YHKL 1J1PL 3RVUD 2A83B 4ZNEA 1A47A 1VFBA 3CVHB 4OGYL 2EIZA 1IGIH 3GMMB 2X4OA 3LQZA 2DM2A 3IRPX 5JA8B 3W0WA 4L5FL 1CICC 4U0QB 2Z8RA 5HHME 3TYFB 1IEBB 1EGJA 3QEUB 3P9LA 3U4EA 3WUZA 5GS2H 2F58L 5L7XL 4L3ED 1EVUA 5C0JA 5ADOH 2R0LH 1AR1C 2ZUYA 1FN4A 4LSSH 5FYLH 3IDGA 4LSQH 4PJCE 4RX4D 1DQDH 5JOPD 4HFUH 3K74B 3TVMA 1NCBL 1KT2A 1FL3A 4PV8B 5DHYA 4QCIA 1UEMA 3WXVH 2ZCLH 1LD9B 3SDXA 3ARRA 3EYVB 2X1QA 3BPNC 2FCBA 4KK5D 4OCWH 1ZK9A 2KDGA 1Q9OA 1GXEA 1NEZB 3T0EC 5A2KH 3C5SA 3MRDB 3QCVH 5FYJU 5GSRA 1J1XL 1NDMA 1PGRB 2X9WA 3SKOA 4Z7UB 4XNUL 1CGUA 3PWUB 2I9LB 4YXKH 1UENA 3P30H 4LKCB 5LAXA 5JHDD 2JJUA 1BD2A 5GGTH 4AIZB 4QHUA 2EKJA 4QRRA 1KGCD 2YUZA 3O41B 4KQ3L 3SDDB 3UYRH 2HTLD 3R1GH 1U36A 1F6LL 5GS1A 2EIEA 5E6ZA 3V7AE 3BP5B 3V4PH 3PGDB 2EDDA 2BSSB 5IVOA 5EU5B 2YKLH 1ZLWK 1Q0XH 4G9FB 1JRHH 4QGTA 1OTTC 4OCXL 4ZFZA 5C0CE 2IFFH 5C0EB 1RV6X 1ONQB 1JVKA 3RPKA 4RRPG 4G6JH 4M4PA 5AAMA 1EAPA 3O2VL 4PJ7A 4DKAA 4LSRL 5JHLL 3C09B 1JWMB 1X5IA 5F6IC 5EZIH 4BH8A 4C56E 5IBLD 3G6AB 2A83A 4OCYL 4M7LL 5JIIA 2DWDB 1YZZA 1QNZL 3CVHA 2Y6SC 4ESKA 2W0FB 3GMMA 4U6HB 1PKQA 4Q2ZA 3MRCB 5B39B 4Q0XH 2VR4A 1HI6B 4XNYH 1ADQA 1CDIA 1MFAH 5TFSL 5I18L 2EECA 1I3GH 1IEBA 3EO1A 4ZTOH 3PV6A 5SX4H 3RWJB 1IGML 3BEWB 3DYOA 2NY2B 2RJMA 2IMMA 3VI4F 4L4TA 5TQ0H 3UDWA 3UC0L 1FG2B 5L0QC 4WNQB 5JOFB 1JWUB 1WWBX 2F19H 5GGSY 3C5ZD 2VZVA 4NKMA 5ENWA 3U9PH 4UT9H 5T5FH 1LD9A 2IPUG 5ANME 5H2BB 1RIVL 3RJQB 5I1LB 2XZZA 4RGMC 3IVKB 4XWGH 2A73B 1IC5L 1QBML 3NAAL 3ZHKA 1T89C 5DR5L 4LAQH 2EKSB 4HDIA 1VFMA 4KI5E 3G5ZB 4PJAA 1TETH 1UJ3B 1F6AB 2AQ1A 1NLDL 2I9LA 1BM3H 1ZA6B 3O3AB 4RGNE 1N0XL <