2HKFL

Crystal structure of the complex fab m75- peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
219
structure length
219
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPNLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin Light chain Fab fragment
molecule tags Immune system
publication title Stabilization of antibody structure upon association to a human carbonic anhydrase IX epitope studied by X-ray crystallography, microcalorimetry, and molecular dynamics simulations.
pubmed doi rcsb
total genus 55
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2006-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hkfL01
1NGXB 1RJLB 4EI5A 3O11A 4LCCA 2X09A 2BJMH 5FYKL 1FYTA 3KXFA 4FFZH 4ODTH 5LVEA 5HYQB 2BDNH 2VXTH 3HMWH 4X83A 5K9JL 3U2SB 2ZUQB 3IXTB 5DK0A 3VG9B 1YEFL 3DSFL 3PV6A 1N59A 4YIQA 2NLJB 3DUHA 5BZWA 3OX8B 2ITCA 1GGCH 4FTVA 1YMHB 4M7JH 3UJJH 1T04A 1WBZA 4O00A 1JTOA 5IJVA 1JWUA 2P46B 1DEDA 2KKQA 1IL1B 3BSZL 3V8CA 4Z8FL 3ZLQC 1EEZA 3BJ91 5ESQB 1MRFH 5IM7B 4Z7NE 3PGFH 3H9HB 4NNPL 3T2NH 3HPLA 4GSDL 2G75A 2JB6A 3BRDA 5FKPB 4GRWB 4YDKL 1EFXD 1VA9A 3QFDA 4E5XA 3GHEH 4M5ZH 5J1SC 4PS4H 1MCKA 3CVHA 3MYZA 3HI1B 1GAFL 3QEGL 4J2XA 5IB3B 3SQOH 2AXFA 4OGXL 3QUXC 3T8XB 4M7ZC 3I6LD 3BGMB 3O6FD 4DW2L 4JFDA 1OLLA 1VFAB 5DRWA 3TF7C 4XMLH 1FIGL 4U1SA 5KANI 4JR9H 5I1HH 4CMMB 1T21A 3VFUB 1OAQL 1YMHA 2DYPD 3NTCH 3P4OB 2ITCB 1A6TB 1JGVH 3I9GL 2CO7B 4IOFD 2ADIB 1I9RL 4OD2A 4Z7OE 4M43L 2NX5E 1R24A 4GAYB 4YGAB 5K9QI 4G3YH 2DQJH 3P0YL 5FOBA 4D8PA 3MR9A 3LRSA 3QNYA 3GSQB 2EYRB 3P11H 1BBDL 5HGGS 4P2CG 2OZ4L 2K7QA 2NNAA 1WZ1H 4RMVA 3AU1A 1C5CH 2FX7H 4QRUB 2FWOB 3ULVH 2LE9A 4A6YH 5GS0L 5F3BB 2HT2D 3QIUB 1JNJA 3QIWA 1E4JA 4NQVA 1MFCH 1FGVL 4TSCL 4D0BB 4F57H 4CW1B 1D5BA 5HDQH 3QUYD 1CGXA 4NO0B 1JGUH 3JTSA 3V5KB 3JWDL 3WHE0 3LKPB 4X5XA 1FJ1A 3NH7L 5EU6B 4ENED 1U8QB 5KANG 2VB5A 1FE8H 4OCSL 3MJ9L 1ORQB 2KZ1B 4F33A 1MJ7L 3VFGH 3L9RB 4XPFL 5JPMA 4MXWH 2BZDA 4JFOA 5E2TL 2MHAB 3GSOA 2APTA 3MJ7B 4OI7A 1J1OH 1Y6MR 4FQIH 1S9YA 5KOVC 1R3IL 4WUUB 3T04D 1W72L 3TCLA 4GXUM 3KJ6H 4MCZA 4WV1B 4HUUA 3FB5A 1BX2A 1MI5D 1ZVSA 5FHBH 4W68A 3TO2A 4K3EL 4F15C 5SX5K 1YEKL 4HJJH 4E41E 1OPGL 4HBCH 1XGPB 4RA3A 5L88H 2OZ4H 2FATL 1SMAA 5C0IA 2X5PA 4Y5YC 3TZVD 1YPZB 2ZWLT 1D5ZB 4QTIL 1G9NC 4LSRH 1K5NB 1F3JA 3OXSB 4M8VA 2XA3A 4R0LC 1MCWW 4M48H 9CGTA 4LCIL 4UTBH 4RGNE 3E6FB 2X4SA 3WFHB 1P4LB 1EMTH 2HVKB 1MPAL 3GI9H 2VZ1A 3O6FC 2GJZB 4NZTH 5E8NB 5GSRA 1F4XL 2EDBA 2KH2B 2VLJB 4U6HA 4YBLB 4MS8C 1UYWL 1WUNT 1JTPA 3ULUF 2I26N 5B4MC 1A6AB 5I30L 2H2SC 4XAWL 4XMPH 4XPHL 1V3KA 3F5WA 4L4TE 4R7DA 4YR6B 1XGUB 4APQC 1NH6A 4N0FB 2VC2L 3W82A 2HJKB 3WMSA 1YEHL 3BMWA 1ZS8A 2BVQA 4R97B 1IZKA 5IWLC 5EIIA 2I25N 3IT8D 4PJHB 4RQQB 4PS4L 1IARB 4ONGH 4G6FB 2E9WA 3PP4H 5FAAA 2QV2A 5I1LB 4JZJA 4BQ9A 3TPUB 4N90E 1BQHA 1FH5H 4ZUSB 1C8PA 4AM0B 2VITB 4QXTA 4NZDA 1AGBA 2X4UB 4WY7H 4F7PB 4TQEH 2Z31B 3MV01 25C8L 2XV6B 1TZHA 1QBML 1P2CB 5K93A 5E5MA 4I4WB 5E08H 4ISVB 2WIIB 1MCWM 1OD9A 3G5XB 5DUBB 3LDBC 1J05A 5ICXA 1FZOA 4HPOL 4M1CC 4I2XE 3MBEB 1T03H 3QULA 4P2RA 2N7BA 5KSBF 5F7EL 1K4CA 3RQ3A 4NRXB 4HKBB 4QT5B 4HLZH 2JJSC 2NY4D 2EDFA 2GJ6B 3IDIB 3KPRE 1KCSL 3P0VL 4DKDC 5C0AE 5LGJA 1TNMA 4PR5A 5E1AA 3IJYA 4WHTA 3QQ3A 1FNEB 3DXAB 2CXKA 3A6BL 2ZNXA 4N0UB 2E9JA 2KQMA 3L3GA 5DS8B 1P7QD 4WNQA 2R1WB 1U3JA 4AENB 3PWUA 3RJDA 4L29B 2HP4A 2W60A 5CEXA 3LKSA 1XH3A 3HZYB 1P9MA 3KPRA 2WUBH 3T77B 2VDKL 4GFTB 4DVRL 4IMKC 4JZJB 1QBBA 5I1LA 1F4HA 4Z5RA 1MWAL 3HR5A 3VFMB 3LHPH 5DWUL 3DRTA 3VFPA 1OGTB 2VLLA 2XWTA 5EU6D 2BVQB 4I2XA 4JM2C 3V52H 2JELH 5C0GB 1MOEA 4CJ1A 2JJTA 1JPGA 4ZUUA 1KG0B 2VISB 3OKNA 4HUXB 3SDDD 3J8F7 3MUGB 4HT1L 4G6FD 4Q9CA 3NCEB 3NZHH 3W39B 5MP6L 1RZ8A 5EBGA 1MWAB 2H2SD 4JPIB 1NMBL 4CAGA 1U93B 1A7PL 4KPHH 4K8RL 2X40A 2D7QA 3DURB 2G60L 4ETQB 3PWNB 1YPZF 3RY6C 5B3JE 3BUYA 2EH8L 1FVEA 3MREB 4AK1A 1ZEAL 4RMTA 2ATPA 5KSUB 1LHZA 2ZJSH 3O81A 4NZRH 1CBVL 3SO3B 3B3IB 4OIIH 5GGRA 1RZKC 1T22B 3VGHA 2X9YA 2QSCH 4YNYA 3THML 4MB5A 3DLQR 3CU7A 2EE3A 4YHZH 2A6DB 4X98B 3IJSA 1QFUH 2VL5B 3EHBC 4MHHI 4OF0A 1TLKA 5AAMA 3ILPA 2BMKA 3KLSA 4GAGL 1ZLSH 5IWLA 4O51A 3C08L 3OBAA 4M93B 1UA6H 3PDOB 4ONGL 4XNUH 3RWHB 5DMKB 3BP5B 4KKNA 3BWAA 1DQML 3MRKB 3WD5L 2F74A 3GBMH 4I5BB 2MKLC 1N64H 3TA3D 4JY4B 2Q8BL 4TVPE 1LO3L 1T0MB 7FABL 2XG5A 3G5VB 3BXNB 4P2YA 1KJ2L 1QKZL 1UZ6F 1A02N 1T0MA 1NSNH 5D70H 1HE7A 4GRLD 4Z7VB 3UJIL 4I8DA 4KKCD 2A9NH 3OKDB 3HZMA 1K9TA 3RWDB 4XVUD 3T0VA 1R5WA 1AXTH 3DVIA 4KQ4H 5GS0D 3ARXA 1YJDL 2J6EA 4O51B 3TJEL 3BN9C 5DHVH 1ORSB 3CFJA 1BJ1H 2NY2C 3IB4A 5DHYB 1MH5A 5FK9B 5GS2D 3LIZL 5HPMA 4L3EE 5KVFL 3GSXB 3ILQD 3VD4A 1RZ7H 3O41A 3WN5A 1PSKH 2I5YH 5CSGA 4JQXC 5I1KL 4O2CA 3LSOB 1AE6L 3RL1B 4RGND 12E8H 4LLQA 5C0CA 3X3GH 1ZANH 2HLFC 4O58H 4PJ8D 3WIFA 1D9KD 4QTIH 3SE8L 1H3PH 1A0QL 4C4KO 2AJZB 3RWGB 3TBTB 1FNGB 5DD3L 1K8DB 1YEKH 4RMSA 1EHAA 3U0WL 1NFDE 5FA4A 5DD6B 3BKCH 1EIBA 3C5JB 4KFZC 1ONQA 4LGPB 5KVDL 3PP3H 3P73A 4G5ZL 2R56L 4ZO7A 3T2QA 3C60D 4W6YB 1S7WB 3UC0H 5D1QA 4JFXB 2RBLA 5F93C 2B4CC 2FYYA 4N9GB 5EWIL 4RMRA 2DQIL 1U8NB 3UAJD 5ALBH 4HIJB 4QRQB 5C2BH 4IJ3C 5C7XH 1QFHA 1HQ4A 3WLBB 3UTZB 2DIAA 3VGAC 3MLXH 2BXYA 3BGMA 3BP4B 4UNUA 2CQVA 2BMKB 5C6TL 5EU6E 1I1FB 5FYJH 4HKZB 4L4VA 3QJFB 4KK5C 5EA0H 3FO1B 3S9DB 1ZWIA 1RFDH 1NCCL 4HUNB 1BQLH 3WUWB 3ARDC 3I02A 4XAKE 2E5EA 3B2VL 3MV8B 3I50L 1T0NB 4C58B 2VUOA 4B0MM 5DJYA 2NYYD 5C8JA 2R1WA 2QLVB 3GKWH 4BFIA 3GBNH 2ZSWA 1AY1H 3TNMA 5C0RL 3CSBA 1A1OB 5I0DA 2CDFA 4N0UA 4XP5L 1Z9LA 1V7NH 5JQHC 2HAZA 1LP9A 5IB2B 4F9PA 4QHKI 5FYLH 4JFDE 4ONHB 4ODUA 4X7SH 3TT3H 2QADC 3EZJB 3UTSD 2VWEC 3KPSB 2AKRA 4RGMB 3MA7B 1UCBH 4O4YL 2NMSA 4HMEA 1FFNA 5I19H 4QTHB 4HPYL 3CXDL 4HW6A 1Z0MA 4FQ2L 2DWEB 2P44B 2VZOA 4AIXA 4XWGH 1DANT 3C8KA 2JJUA 2VN7A 1CE6A 5FCUH 4M02A 5C0GA 3B9DA 3JUYA 3EOTL 4YGVB 4JO2H 5K59F 5A2LH 3EGSA 4X6DB 1DVFA 2WWKT 2EDHA 4HWBA 5I2IB 1MJUH 1T2XA 3LQZB 5J12C 3TNMB 1C7TA 3S36H 4YXHH 4ZYKB 4KRNA 3EYSL 3UROR 4P57B 4OJFL 3FTGA 5I1AB 5IFAH 5DEGA 2VLRA 5CEXB 4Y19E 2D7NA 4PB0H 2XTLA 5ERWB 1ZWIB 1ZE3C 2BCKA 1DBMH 2Y07H 5IEHB 1FNAA 3SN6N 1R5VA 1FNEA 4FZEH 1HHJB 5CUSL 2NY7H 3JV5A 4TSAH 1AXSB 4U1MB 4YEEA 5CAYB 5FCSH 5A40E 1F2QA 4NT6B 4P2OA 1UZ8A 5TPWH 2ICWI 4MD5B 5DUPH 4MJIB 1G9NH 3ES6B 2R69L 3B6SA 4E41A 2YD1A 2H32A 4XNQA 2YUXA 1XR8B 1MY7A 4NCC1 4XCYA 5T5FL 3MBEA 4JY5H 1FZOB 5C86A 5CCKH 3E2HB 4MA7L 1WSST 4J3OC 3QNZA 3VFWA 4DVBB 1I7UA 2OR9H 3IXAA 4KH2A 2B4CL 5I17B 3R1GL 2GUOB 2JF1A 4NNXB 4Y7MA 5MEOA 3RUGB 2KQNA 3UPCA 3D39A 1KT2B 1BZ7A 2IF7A 1HHKA 1UVQB 5HYSA 3WDJA 4YHOL 4QXTB 4GRMB 4Y5XA 3O2WH 1PKOA 2Q6WA 4LIQE 5D7KD 2UZIH 3E6HB 4JO3L 4FFVD 2R9HC 1ADQL 3EYQC 1U8LB 3GM0A 4R2GC 3INUH 3ESVF 4LHUB 3TO2B 4XWOC 3MBXL 3HNSL 4NN7B 3CFJB 3ZYIA 3VFTB 2CDEB 1F2XK 4NM4H 2FB4H 2I24N 3KPPA 4RMQA 3HG1E 4P5MA 1FG2B 2RFXA 5ALCH 3ULVD 4IRSC 4K23L 4U1NA 4WJ5B 2WBWB 3C6SB 1F11A 1OWWA 1DLFL 4X6BB 4NN5C 3LMJL 3QDJB 3KNBB 3RBSA 1UQSA 1PW3A 3GMMB 3D25B 1OGAE 4XPGL 1NCWL 3U9UB 1TQBC 1CLCA 3TVMD 3H3BC 4O9HH 3LN5A 4D0DB 5GRZA 1HI6B 4KK5D 5F70A 4ONFH 5JIKA 3P4NA 1ODAA 3BHBA 4IDJH 3C9NB 1AGCA 1NGZA 4Y1AD 5D1QD 1IC7L 2GITB 6FABH 4JN1L 1IC7H 3ZKMC 5L2KD 1KN4H 2IAMC 1DQMH 1I4FB 3PABB 3P0GB 1J7VR 4ZOAA 3DV4B 4LSPL 2X4RA 1I9JL 2Z8WC 3QIWC 4EUPB 4WUKH 1OGAB 4MJID 3JUZA 5E56A 5SV3A 3FRUB 3GMOA 3KR3H 1KBGL 1G9ML 2Z91A 3D48R 4PJEA 1LK2B 1U8OB 2XTJD 2YD8A 2F15A 3BZDA 1T21B 4C56E 1A1MB 4O5LL 3MUGA 2GSIB 3BPNC 3P4MB 1FAIH 1INEH 4PJ9D 3W2DL 3FQTA 5I73B 4YBHA 5CJ8A 1JF1B 1H8SA 3GIVA 5CGMA 1C12B 4P9MH 4OLYH 1ZEAH 3QHTC 2AABH 2AXFB 2V7NA 1QTYT 4W81A 5F89B 3MBEC 3L5WB 1UB5B 2FWOA 3HI1A 3H3PL 3EYVB 2OLDA 4WCYH 3PQYD 2K7PA 1A7PH 2ZKHH 3GJEA 3PL6A 3AU1B 3ARTA 4PJFF 2R0KH 3D0VA 5FO7B 2AGJL 4F7TB 1MFBH 4XC1H 1U6AH 2MCPL 4Z78B 1U92B 2ZUYA 2DM2A 1T7WA 2XI9A 3FO9A 3OJ2C 2YD7A 3RVWD 2BRRH 4GAYA 1DJSA 4AEHH 1H3GA 4PJDB 3IJYB 4OBRA 5EU7E 1WITA 1CL7L 4IRJC 3FT3A 1WIUA 2CGRH 3KLAB 1NEUA 1UACL 3LEXA 3L7EA 3HN3A 1FBIH 1ZA6A 1RK1B 2NZ9C 1BOGB 4HAGA 2NY4B 1ZSDA 2YD2A 5LGHH 3BPNB 1NC4D 4XX1E 3I3DA 1FCGA 4MWFB 2FX8H 4XHJC 1GPOH 4NGHL 3G5XA 5DUBA 2EO1A 5ITFA 2AP2A 4UDUA 2QHRH 1FYTB 3A6BH 4H1LH 1EZVX 1QFWH 4UQ3B 1G7MB 4XXDA 1P6FA 1H3UA 5IR1A 5JHLL 2WP3O 4AIOA 2WUCH 5HYJD 1F4YL 1AGBB 3QPXH 1OM3L 2IPTH 2J88L 3M1BB 3LH2H 2Z31D 1GL4B 4QO1A 5L7XL 3IDNB 3MJ6A 3ZKSD 4MAYA 1UB6B 3KDMA 3HA0A 3L7EB 3OAYK 1UENA 2VDML 3KLAA 1K3IA 5I71B 1F90L 1P4BL 2Z4QA 3T4AA 1FO0A 5F9AC 5IVXA 4P2QA 5HJ3B 5HGDB 3DYPA 2P5WA 1KIRB 4U1GC 2DLFL 4PJFE 2MPAL 3C8HA 5EFIB 5DRZB 2FLRT 3DX9A 3MFFA 4QXWA 3UZQA 4X7CC 3V6OE 4LSUH 2CUMA 3U7WL 3D0VB 1UM5L 1EEYB 4PJXF 4UAOC 3V4VH 5D7LD 3PV6B 1UJ3C 5CINH 5JXEA 4HGWA 1ZHLB 5I8OL 3AXLA 2FO4B 4YDLB 1JV5B 5D7IB 3VXRD 1VSCA 3F7VB 5MERB 1OB1B 3SJVD 4GMSL 2BHYA 3VXUE 1I1RA 2APXA 5DFTA 5D1XD 1F3JB 3OXSA 4D0CA 3KYKH 4DAGH 4TVPH 3SGEI 4FG6C 2VE6B 3VXSE 5JW5A 3V5DB 1EZVY 4Q9RL 4ZFZB 4YUEL 1A1MA 1K6QH 3D85B 2X4OA 4ZUVA 2H1PH 3R0NA 2NTSP 3S7GA 2QQLL 1ZHNA 1Z9SA 2MOVA 3MUY1 1E6JH 4JGUA 5HHOE 5FM5O 4CDGC 3QHFH 3FRUA 3JVGC 5HGHB 1RD6A 3CAFA 1ADQA 3LV3A 4KGJA 4YLQT 3GJFK 2IAND 4EUPA 1KIRA 2CIIB 4PG9A 5B3NA 3ZE1E 2HLAA 1QSVA 2F58L 5KVGL 1GGBH 1ITCA 3PWPD 4EOWL 5J11C 3V79C 4WFFE 4L8DA 4K9EH 3MODH 1L0YA 2OJEB 5E94A 4RSVA 3VWJC 2V9TA 5I76B 3WFCL 5EU6A 3PWLB 2ED7A 5E99L 4PJ5B 1MVUB 4I13B 4QHNB 4PGEB 2KPNA 3X3FH 1JN6A 5C9KA 2X4PB 1M71B 1TVBB 2QKIB 5A1AA 2IQAB 3MV9D 3TV3H 3TYFA 4U2ZA 2AS5M 4XTRD 4QRUA 4KK9C 5IOPB 1E4KA 4OD1L 1IAII 4ZPVA 5GISL 3HNVL 3L6FA 1ZGLB 1QO3B 2Y5EA 5DC9B 1LO5A 4NSKB 4OZHA 3RL2B 4OCSH 3CFBB 3G04A 3NA4A 1KJMB 1KTLA 3ARED 2Y5TA 4OFYA 2X2YA 2QSTA 2Y7QA 5T1MA 2NW2B 1EEQA 5FO8B 1S7QA 5CINL 1TJHH 5ETUB 5IESL 3SDDB 1SYVB 1I1AB 2LFGA 1JPTL 5B39G 4RRPG 2VH5H 1IT9L 1S5IH 2CDEA 5BMFL 3VFVA 4RNRA 3MUJA 5DYOB 3IVKA 1NGPH 5SWSA 1J0KA 3RIFK 1G6RB 1JWSB 1OAKH 3D0LA 3TYFB 2EDXA 4GRWH 3B2UC 5EUOF 4OV5B 5FDWB 5AAWA 3C5SA 4GMSH 1KPUA 1RUPL 5A2JH 4JDTL 1JN6B 5J1AB 1BJMA 4XNUL 3IAGC 1HKLH 3MMEA 5CLWA 5MI0C 2FDBP 4PGCB 1OY3B 4WI9A 2H8PA 2CK0L 4OGYL 2Z31C 1MVUA 5CFHA 5I0ZA 2AEPL 1MCOH 4LVOC 2EKJA 3MRBA 2V7NB 3FN0L 1YMMD 4XNZC 3ZYJA 5JHLH 4XPAH 1A64A 2FHBA 3ARSA 4M6OL 1B0WA 3GHBL 2JB5H 3VXOB 4H25A 1MLCB 4LLDB 3SCMD 3TO4C 2JB6B 4JR9L 5I1HL 4XCYB 1CLZL 3SE4A 2QADB 4RA0C 1N6VA 3MRCB 5I15H 4MD4B 5C08A 5JHDB 4Z0XA 3UBXA 3CVHL 3RKPA 3RHWF 2IH1A 1JZ6A 1IGML 1D3CA 3CZFB 3GEWB 2IG2H 5BZDA 2XZAL 5MENA 4PJ8B 2VZSA 4PJ7B 5CKGA 4F37F 1QRNB 1S7VA 3TVMB 4X99A 4KKAC 2R0WH 3ZE1F 1PZ5A 3PABA 4KRPD 3K81A 4QYOB 5CKAA 2V2XA 3H9SB 2HFEA 3NZHL 3EFFB 3ZKXB 3Q6FB 4AQOA 4Y2DA 3G08B 4HIIA 4R7NB 4ZO9A 1G1CA 1TVHB 1P84J 5IKCB 1KYOK 5FYLL 4R4NC 2YK1H 4LSVL 3UTQB 3DI2B 4HK0A 1NPUA 3LKRA 3EGSB 3D2UA 1JF6A 1OB1A 2BVUA 5C0BD 4CGTA 2VDOL 1X5KA 5MHSD 5TGBB 3WO4C 1FBIL 3P40A 1S9VA 3QFJE 5IG7B 3QCVH 1X5AA 3C8KB 2CLRA 5ELIA 5ID1A 4ETYA 1BD2D 4QCIB 4ZO6A 1IC5H 3LB6C 3MO1A 5DJ6B 2EE9A 1WWCA 5HD8D 3KNBA 3TJHC 1OTSD 3ZSTA 3RNQB 3BD3A 4Y4KA 2NCMA 2BNRB 3BRFA 1UEYA 1QRKA 3RUGF 1A6UH 1RZJC 3Q2CA 4PJ8C 5EC1B 4MDIB 3C6LA 5JOPD 3S4SG 3S3JA 1NLBL 1U9KA 4LEXH 5IV2B 1YUHB 1P1ZB 3TO4A 2HKFL 3WIHH 1TZIA 4EUPG 3R0MA 1ES0B 3IU4L 8FABA 3VG0L 3WS3B 5F7DB 1NCBL 1JYXA 1KNOB 1NFIB 4YHNA 1TJIL 5H94B 3PJSA 1ACYH 1ERNA 4YDIH 4ORZC 3RNKA 3SEPA 1IJ9A 2Q3AA 5KVDH 4XRCA 1J8HD 4IIQC 4X6DF 1CI5A 4JQIH 1VGEH 1X5IA 2J8UE 1MHCB 4G7YH 4EN3A 5DJDA 5TE7L 1A21A 2F8OA 1KT2A 3MSPA 5CEYB 3BVNB 4NN5B 4MAYD 5CIPB 5EU4A 1T1YA 1DTUA 4TQEL 1ZSDB 3O3BB 3RVVC 1HQ4B 2V5MA 2XICA 1Y18A 3OHXA 4P48A 4YHLL 4JFED 1U8NA 3SDYL 1MI5B 1CLYL 3MLWL 2FEEL 3MRFA 3VI3E 1EFXB 2PXYC 1NFDF 1WLHA 4CVWA 4JM2F 3VFRB 5ABDE 1FVDB 3DETD 2YRLA 2Y6SD 3KYAA 5ICZA 2H45A 5DD6A 3GSRB 1YNTB 1YEHH 3NZ8A 3LD8C 3VH8G 1K6QL 3C60A 4WENB 3CFBA 1WJ3A 5KSBA 4H1LG 3TC9A 1A4KA 4UQ2B 3T4YA 1F4WH 1DE4A 1U8KA 3BT2H 1X6LA 1A7OH 2VR5A 4G9FB 4IS6A 4P46A 4Y4HC 1TIUA 4G9FE 2VLKA 5IMLB 5C0CD 4U1LA 3RGVA 5EB9A 3MRQA 1RUKH 1YQVL 4P46D 4B41A 2OR7A 4S1SH 5HHNB 3BRGC 3QUZD 2VQUA 5DMIL 4F80A 1EJOL 3RWDA 1K3ZA 1N8ZA 5FV2A 4ZOBA 1BBJB 5IW1B 1A4KB 1J1XL 1C7SA 4NO5A 1JFQH 1U3HA 3QDMA 4JFFB 4Q6YA 5KSBE 1HQRB 5SWSE 1RUML 3EYUH 3I6KA 3DI3B 4KJYA 4K3EH 5T5NF 5C70A 5JLZB 4GKNA 1FFNB 2GTWB 2QTEA 5E70A 4PJAB 3MA7A 1DUYA 3RWHA 5C0ND 5J56B 5T33L 1U3HD 3S5LA 1UH3A 4R26L 4ZSOE 1H8NA 1MNUH 1FO0H 4Z9KB 4R90H 1W72H 2J4WH 2ORBL 1J1OL 1HEZA 1HHGB 4I18B 4QKXB 5ICYA 3K1KC 4JHWH 5SWQA 4E42A 4YHOH 2FH6A 2QSQA 5E4EB 5ACZA 4GMTH 4BFIB 4DK3A 5LGKA 1XIWC 2WWKO 4MD0B 5D1XB 1YDPA 2R0WL 1D5XB 1DR9A 4DZ8B 3BIAX 2C3HA 1O7VA 2J8UA 4PB0L 3LEYH 2VXSH 1T20A 1FNSH 5D7JA 5HHVL 4NIKB 2XZAH 2V7HA 5T5FH 1EK3A 5TDNB 4H8WL 4R97C 2ZCKH 3U4EA 5F96L 4K94H 1VEMA 4PRPA 1Q0YH 4P23B 1G9NL 3ARWA 4HWUA 1MCHA 4NWUL 4MAYC 2YBRB 3MFFB 3WHXA 1DN2A 4LAQL 5J1TC 3BESR 3HZKB 2BRRL 3QDHA 1MRCL 3KPLA 1C08A 3W9DB 2FYYB 5M7QA 3S35X 4PB9L 3V5HA 3QG7H 1CFBA 1FO0B 2X4QA 5FYKU 4S1QH 1AR1C 3Q5OA 2VXVL 3AS3A 5FUZH 5GRYA 2YHGA 2I9LB 1LO4H 2DM7A 1I7RB 2FL5A 1F8TL 3FKUS 4PRDA 5BOZG 2AI0H 2J8UB 4FXGB 1AR2A 2HFGL 3BKMH 3CK0H 5IB5B 3AM8C 3T1FB 2L0DA 4P2RE 4L29A 5D1XA 2A77L 4L8SB 3AM8A 2IFGA 3HR6A 4PRPE 5I6XB 5I17A 1M7IA 1KENL 3MLUL 4LSQH 3HAEH 3HCVA 4HX1B 4M8QA 3GSXA 3LS4H 1I7ZB 4NYLB 3GSNB 3UDWA 1QSEA 2DQDL 3GSNH 1CE1H 1M1SA 1H5BB 3E2HC 3WIIH 2PXYD 2DQUH 4ODHH 4Y0GA 3TT3L 2D7PA 4FQLH 3MRDA 5EZOH 1CT8B 3A0OA 4OGYH 3G5ZA 1NBYA 1FG9C 2E9BA 4MZ2A 4L3EA 5GGTH 3V6OA 1ED3B 3X12B 5ICXB 5C7XL 3LPGA 4ZAKA 4PY7A 5D1ZC 1N5YH 1XGQA 1AFVH 3MRKA 4NBZB 3EHBD 4I4WA 3BP5A 2FRGP 1JHTB 5HHOB 2FZ3B 4C55A 1TTGA 2N56A 2X1WL 2D9CA 2V6HA 3WFEH 3AB0B 4HJGB 4PV8A 4ZUWA 3O3UN 4OFPA 4NQEA 1A3RL 4JO4L 5L8KB 1XGRB 3TFKC 4JLRB 1NAKL 1IT9H 1UXSA 5EULV 1H8OA 1IC4L 4G8EB 4PGCA 4V1DB 5D93B 5HGAB 4UIKH 4ODTL 2Y36L 2XQBL 1U91A 3L7FA 5TE4L 2R39A 2YD5A 2XN9E 1NCWH 4BK5A 2XTJC 4XPGH 4LCYB 3IDUA 2DQIH 1F4AA 4KZDH 2X4TA 1ZT7A 4WI4A 4CJ0A 1MCPH 4XC3H 3IVKB 2ATKA 4ZMAT 3U9PH 3FFCB 2B20A 5DMJB 2H3NB 3OV6A 4ETQA 2H1PL 1IGYB 1DQTA 2OMBA 4MQXD 4ZFOL 4JB9L 3L3KA 2GI7A 2FB4L 2Z91B 4DN4L 4MAUH 5IHLB 4H8WC 4JB9H 4TVPD 1G7IB 5JO5A 3CFCL 3BEVA 2KL6A 1QRND 4I77L 1FZJB 2XACC 3MROA 5FO8A 3S88H 4B53A 2VISA 2J8UF 3U6RB 3W5NA 4DKFL 4LSDA 3WXVH 5GZND 5C0EA 2DTML 1T66C 2HH0L 4XBGA 4JZOA 1HOCB 4NN6B 5EO1B 3D3VB 5JW4R 4ZNEE 2WINA 2V17H 2VQTA 1RSFA 3AB0C 1CDYA 5ANMB 4PJXB 4AT6A 4U1IB 3VXQB 4AT6B 4PJIE 4JRWA 1KPVA 1Q72L 4YDVB 5DJDB 3O3AB 1I1FA 4KK9D 4H1LA 3WS3A 4M6ML 4PD4J 1RZKH 2VDNL 5INCB 3NIFE 4DN3H 4KQ3H 5BVJA 1YUHA 5C9JB 2JCCA 1KCLA 3HZVB 2OI9C 3RX8A 4AG4H 2OJEA 3HE7A 1KUMA 4LRNL 1S9YB 3MOQA 1HIML 2E9IA 3N0PB 3QDGD 3SDDC 4MVBC 5EU5A 4X6BA 5CGTA 3C6SA 4OZFG 1WFUA 2B2XH 4FQJH 2VNCA 2GYSA 2H32H 4TSAL 3MNVA 4X8JB 3I3BA 4FQHB 1BFVH 4FQXD 3NA9L 1JF5A 3QULB 1CQKA 1JK8B 2WUCL 3CCHB 2VQ1B 1CLYH 5C0AA 3FB6B 4U33A 2QL1A 1NCDL 3F7QA 2SEBB 2OK0L 3U7WH 4JE4B 3KPOB 4JFYA 1TZHB 2F53D 3VXSA 1TVHA 4LARH 4MVBD 2I9TA 1KTDA 1RZIA 1IGCH 1FFOB 4MMZC 2RR3A 5ANME 3PQYA 1I7TA 2EH8H 1DZBA 2D31A 2GSGA 2XZQH 5GGSB 3BD5A 2D4DA 4N8CH 2WUBL 1L9NA 3LRSB 4PJDF 5FOBB 1RHFA 1X7QA 3VG0H 4JM2A 3U4AA 2NR6D 4JRXB 4PJ8A 1D5IL 1MCRA 2MJWA 2AV7A 4YR6A 5EC2A 3QPXL 2J5LC 2OQJB 4PYGA 3SOBH 4YZFF 3BIBX 4XNQB 3MRDB 4YDKH 3Q1SL 3B6SB 3N1MC 4KC3B 1U0QA 4CVUA 1JHLH 1RJYA 4WWKB 3GIZH 4F2MA 4M7LH 3G5ZB 4WEBL 1WFNA 5GPRA 3ARZA 4ORGB 5CP7B 1BREA 4L3CA 4LBEA 1C16A 2FJGA 4WW2B 3P9LA 4BZYA 4R6UA 2P5EE 2AXHA 1PVHA 4LNRB 3T0EB 1JRHH 3NIGE 3T1FA 5FYJL 5HDBE 5DFVD 4P57A 5DSCA 2NPLX 5EUOB 1GZPA 3H42H 2P8MB 5IW3A 5SX4H 3CDYA 3H0TA 2BHZA 4IBLT 1FIEA 3VI3F 1DVFB 3SGDI 1LDSA 4UUJB 1I3RA 3HRZB 3G5YB 1NGQH 1NLDL 2CMRH 3RVVD 1ZVSB 2AGJH 3QUYB 5DVNA 5CD3B 4NQDA 1ZT4B 5KS9B 4HF5H 4HKXB 3X14A 4FP8L 3SDCB 1DBKH 4X6CE 1QQDA 2RCSH 4FTVB 1RURL 1H0DB 4NWTH 1C5BL 4P2QD 2O5ZH 4RAVA 3MXWH 2HTLC 1YN7B 4ZFGH 2V5TA 5DD3H 2BSRA 1PD6A 3WKNA 1NAMA 5CGYC 5EPMB 5DR5H 2O61A 4NKIL 1T5WB 1YEEL 5ETUA 4WFGE 3HG1B 3DARA 4WTWA 1S5HB 4TUKH 3X3GL 3QH3A 3QUMA 3LVEA 3T0XA 5GZOD 2X10A 4UV4L 2FR4A 1KXTB 5DJYB 3L6FB 4U6XB 3ZE0E 2AEPH 2HT2C 2OXHA 4K71C 4TUJA 4PGEA 1DBBL 5F7LB 1Q9WB 3ZYOA 4YFEA 5F72S 3PE9A 1DLFH 1JNHB 2PW2B 4JDTH 2BY2A 2BFVL 3CMOH 3NN8A 3O4LB 2A73A 5TF1H 1HIMH 4PLNC 5CJQL 2P24B 1T80A 4XBGB 3TBVA 3GO1H 5HI5D 3GGWB 2F19H 2GCYB 5EBMB 3O6FA 4HS8L 2R4SH 4GG6B 1HYSD 2PO6A 4KI5E 2PCPB 4DN3L 4WTZG 4KK6D 1Q9KA 3H6JA 4ZUTA 3IDMA 2LAAA 5JLZA 4YPJA 1BIIB 1EVUA 5D1QC 4IDJL 1S5IL 4LPTA 3CVIL 3S35L 4ELMA 2BVPB 2P8LA 2X6MA 1L9MA 3L3KB 1I8LA 3O6MH 4ZAKD 2IALA 3S37X 2H26B 3D18A 3GRWH 5IW1A 3VD9A 1NJ9B 3HS0A 4XP4L 3WJJC 3SCMC 3TBVB 3QPQC 3IFPA 2X4TB 4LPWA 4EBQL 5DQ9B 2F54D 4YHIA 2ZCHH 4D0CB 4KXZI 5C92A 1UH2A 2DQHH 3ZT6A 5E6IB 5JW5B 4Q2ZA 1PKQE 1E4WL 4V1DA 2R1YA 5CWSA 5IFHH 4OV6F 3LZFL 4H88L 3LS5H 1XCQB 1RY7B 3ZDZF 1UKTA 1ZHLA 4JVWA 3BKYH 5H8DA 2IC2A 4HH9B 2AQ2A 4D0DA 1L7IH 1RV6X 1ZS8B 3VWJB 3MRIA 4CBPA 4NC1C 5J6GB 4PGDA 1SJHA 2DJSA 4L4VE 1S5HA 5TPWL 3D5OF 4BZ1L 1A6VH 3NZ8B 4RDQG 1BD2A 3AS0A 1LK3L 1NLBH 1RIUH 5I74C 3WNMA 4ZS6C 5JQ6L 1D6EA 3TBWA 1P4IL 2XFXB 5IROC 5KSAC 3S6CA 1L0QA 3C60B 1ED3A 3X12A 1B3JA 1M4KA 3QWQB 3GRWL 4YDJA 1RZJH 1KCRH 2AXGB 2DTMH 4OGAD 1WT5C 3CVIH 5F7WC 3S35H 3IFLL 4PJDE 5IVXB 5D7LA 2HTLD 4PIRF 3G5YA 1LEKA 4JO1H 3WNOA 3MA9H 3SDAC 4MAUL 4M8QB 3HAEA 4RGOL 3RTQB 3ZZ1A 2PYFB 1BVKB 2IADB 5GS3A 2F19L 4Z7VF 3SDXE 2R8SL 5GZOC 1XGPA 2DI7A 4WUUD 3U9PL 5MEND 3V7MA 1HYRC 3F7YA 4LNRA 3T0EA 2FX9H 1KSRA 3UTPD 2EC8A 4LVOB 4R4FH 2M1KA 3U1SL 3P9LB 4G6AD 3MV11 1KCKA 3MXVL 5I8CA 1G7MA 1I75A 2FSEB 5JMRA 1A6WL 2VWEE 3TWCL 4ORGA 5CP7A 4DVBA 4JGJA 5D2LF 3VXRE 1IKNC 3ARGC 3I9GH 5EC1A 5I1JH 1CU4L 2UZYB 1NAKH 4GRLA 3PGFL 4L1DA 5DLML 5JPMB 5A2FA 1TZIB 1FYTD 1HZHL 5F1IA 5DJCB 4E41B 3GUTB 1SBBA 3MO1B 5DJ6A 4PJAE 2E7CA 1FL3A 1BQLL 1SY6H 5H2BB 2GY5A 5EUKA 5JXAH 3RIAK 4U31A 3OR6A 5HDBF 3SE4C 3GDBA 4QXUL 3GHEL 1OQOA 5GGTL 1F6FB 2NY1B 5ID1B 1CICD 3HMXH 1ZV5A 5SWZA 4F7EB 1D9KA 2DS4A 4GG6F 2C7UB 2NNAB 4MXQD 5CBEA 3EO0B 1IM3A 4U6YB 5IMMB 4HUVA 5GGQL 2BVOA 1UB5A 1YC8A 4OKDA 3VXUD 2APFA 1RUQL 3ULUD 4DGIL 1D6VL 3DWTA 2R8SH 3AREB 1AY1L 5D6DC 3VFOB 4QHLA 5JOEA 2VQ1A 1GC1L 5GRWA 2C5DC 5SX5H 5BO1H 1HH6A 1DUZA 4GBXD 4LEOA 4X99B 1Q1JL 3IF1A 3T3MF 1QRNA 4HK3N 3RZCA 3TESA 5AEAA 4PRNB 2W9LA 3QNXA 4NC1E 3HNTH 1PGRB 2DD8H 4YWGH 2XXCB 1KCRL 5HXMA 1AE6H 1IVLA 3IDMB 3CZFA 3SY0B 5CZVL 4JZJC 1GVIA 1MF2H 4ISVA 2NX5B 3OTTA 4BUGA 2PO6B 5C9JA 2LU7A 2VO5A 3O6FB 4M1GL 1U36A 3MV9E 4MLIA 5AWNL 4DKEL 3S36X 5FHAH 4YXLH 5CBEB 1OSPL 4K8RC 4RFNC 3V0VB 3VXMD 1CXHA 3CC5A 2EXWC 3CSPA 4NQCD 5C07A 3LN5B 1RMFH 5I1EH 2WNGA 2G75B 4PJGB 3IFLH 1SEQL 1KJ2H 3DXAD 4MJ6B 3MV7A 4LRIA 1T7ZA 5EO1A 3LS5L 1KPUB 3NPSB 4RWYH 3GBML 5CJBA 1A5FH 3QH3B 3QUMB 4FQPA 3ZMRA 3VXRB 1ACZA 3NFNB 5FGBA 5EORH 5J7CC 4HFWA 5HVGB 1H15B 1MCDA 3L3HB 4GKOA 5KSAB 1KULA 1U8JA 5IP4A 1LK3H 4MJ4A 4HGMA 5I1KH 2ICWB 1F3RB 3BISA 2NY3C 1MEXL 3AS1A 3U46A 2ZOLA 1QO3A 4Q9BA 3UAJC 1FO0L 4XB7A 2YC1B 1K8IB 5GQBA 3GK8H 1QYGH 2G5RA 4C83A 2Y7QB 4PYHA 1CVSC 2Q7YA 5CD3A 1YY8A 5ENWA 1FYHB 1U8HB 5IVXF 3MV7B 1NSNL 5D70L 1HHKB 3F58L 2NY5C 2DQEH 3NAAH 1BM3H 4CN1A 2YD3A 4NZJA 1IBGL 3D2UD 3IFOB 1JUFA 1EUUA 3VRJB 1QPXA 2PYFA 1AQKL 2LABA 3TH2T 3CC5B 2C1OB 2A6IB 1X6NA 3P2TA 5DJZB 4HZLA 4AMKL 1RUKL 3W0WD 4XBPB 1DBBH 4OFVA 4DEPB 4L3CB 3GMRB 3JWOL 3E0GA 3M45A 4FA8A 1WWWX 3EKCA 4Y4HB 3UPRA 4AL8H 1T1XB 3T0ED 4Y4KD 3G5VA 1MWAH 2CR6A 5TQ2L 1CGVA 3WS6A 5HVFB 4IHOB 1I3VA 3MRPB 4C57C 2V9RA 3EOAA 3SPVA 2VDMH 3PHQA 1TQBB 4QRRE 2XWBA 4GRWE 3B9EA 5J6GA 2L7UA 5EOCJ 4DKEH 3INUL 4I0PD 4OSUH 5KTEH 5CS7A 1NMAL 1AC0A 1HHJA 4K3DH 1I7ZA 1R5VB 1FFQA 1KYOJ 4GKZA 1UM4L 3RVUC 1KELL 3B9KD 5ITBL 1MHPH 3O2VH 5F9OL 5K9KA 4F58L 4HJ0D 4JPKL 2BNQB 1IM3B 3HNTL 3QSKB 1AP2B 1J11A 2YEZB 3BAEL 4PGJA 4PJFA 1D9KB 1CGSL 3BEWB 1LEIB 3O45A 2AJSH 3QNYB 3LN4A 3TBYA 2CDGA 1U8IB 3QCVL 3OR6B 2Y9RT 5EUOE 3DVNB 2ZSVA 1ZLWH 5DQDH 4X9BA 5DEZA 3WLWD 1PLGH 1ND0B 3RIFF 1JK8A 5ESAA 1BVZA 1MWAA 1IMHC 4X6FA 5D2NA 2BHUA 1VFOA 2VJXA 3IS0X 3OKNB 3ZHKA 1T0PB 4B7IA 5K9JH 1IGJB 1IEHA 4FMFA 1JHLL 1SYSB 5FYKH 3MUZ1 1QLFA 2CRYA 1WV7T 3I02B 4LCCC 1CN4A 3OAZK 3MRBB 2JCCB 3AC0A 4L8SC 5IHBA 1Q9WA 1T0NA 4H1LB 3EYSH 3G6JE 1DVFC 1IGMH 1KIQA 3MFGB 1EHXA 4MWFA 4WEBH 4XPHH 3HB3D 3UTZA 5D1ZB 5I8EB 3MLRL 4E42B 2BNUA 5SWQB 1NCAL 5IM7A 2R0ZH 3VD5A 1INEL 5FGRA 1TXKA 1NDGB 2DQCH 5ITFB 5HDOA 1MJ8L 2YK1L 4JZOB 4LSVH 1JL8A 1ITBB 5TDOB 4MNQE 3ZKQD 4JFXA 4NZTL 1JWUB 3T1WA 4XP6L 5FFLA 1N3NA 2P4AB 4HPYH 3FJTA 3QQ9D 4HLJA 2XNAA 4HKBA 4MX7B 1WBZB 1JBJA 3BW9A 1BFOA 2HKHL 4RBPH 1EX0A 4Q6IB 4X80H 3QG7L 4M4PA 5F88A 3SDAA 4X7SL 3SDCA 2X1QA 1PG7H 2DBLH 1XF4A 4Y16A 4F7TA 1YY9D 2DKSA 1S78D 4IRZL 3GMQA 1YC7A 4JJ5A 5E8OB 4NM8H 2WIIA 5F7FA 4UUJA 1OPGH 1A7BA 3GB7B 4ZPVB 2A6KB 1BD2B 4U49A 1QLRB 4UV7L 4IOIA 4X4XA 5ESVB 5AUMB 4LCCB 5HHNA 3HI5H 4PGDB 3H0TB 5FHBL 3O41B 1VGKA 3IFNL 3DX8A 4YZFE 5IEKB 4MQSB 5IMLA 2VLKB 2EC9U 3AMLA 2P5ED 5FK9A 2K3TA 4UOW1 4I9WD 3QCTL 2PKDA 3RGVC 5B4MD 5CMAB 4WW2A 3J7HA 5J3HD 2ZG2A 5E6IA 1W8NA 2O5XH 3HE7C 3HUJF 4JVPA 5EOTA 1BLNB 1KB5B 3ZYZA 4KRPB 3BD4A 1S7UA 3VRIA 1JF1A 3RFZC 4YFLF 1QSED 4UDTA 1P7QB 5CJ5A 2GSIA 4K23H 1F3DJ 1T1WA 3JV0A 4XNYH 4DKFH 4CADB 3ZHLA 4L8BB 4RRPA 3ULVL 3P3YA 1I9IL 5ID0A 5JPNB 2CLZA 3CZJA 3SCMA 1E4WH 3SKNA 3HPJA 5FM8A 3CD4A 4OCMC 4M6MH 3ROOA 4G8GA 4GKSB 1ZT1A 1A0QH 3B9VA 4GG6A 2DWDA 2X4SB 3TCXA 2VE6A 4BYHA 4H0GA 4V2BA 5I74B 1GH7A 3DUSB 3U7YL 4PLOB 1X3DA 2P49B 2VN4A 5DGRA 4DUWA 5D9SA 4OZFA 4XPFH 1HXMA 1KEGH 4QRPA 5CZVH 1JNHA 2OMNA 5FF6B 5T3XH 5H94A 4Y1AB 3VGAB 1HCVA 1KNOA 3MCKB 3BUYB 2ZUVA 4TUJB 4U2YA 4DFIA 3UBXI 4LP4A 3S98A 4MA3A 4WGVB 2A74A 2NXZB 4YUEH 5LKNA 5KSUA 3O9WC 4WJ5A 4MCZB 3K46A 5IQ7H 1CXEA 3C60C 4MDIA 1QR1B 1QRNE 4A6YL 1FG2A 2RFXB 4HUXA 4LCUA 3G6AA 5E99H 2VLRD 3RDTA 2DIBA 1BF2A 3VFTA 2YXFA 4ODXA 4QEGA 5DDHB 1NDMA 1NUNB 5BW7C 4QCIA 2F5BL 5DT1H 3VFNB 2WLYA 3JTSB 2XPGA 4OAWB 4Y88A 4ZNEA 4YHLH 5LCVH 2HKHH 4RGMC 1S7XB 4XGZB 3UTTB 1P5UA 2DQUL 4ODHL 4W4NA 4POZC 2XOTA 1Z0NA 1BZ7B 5E03A 3X13B 1S3KH 3GMLB 1WZKA 2YOCA 3BSZH 1UXWB 1OAQH 3U48A 1GZPB 4JRYD 2FHFA 4Z7UF 1NCAH 2FJHA 2WINB 1KENH 1FIGH 3QUMH 3BKJL 4QYOA 1I9EA 3BO8A 1OLZA 1PEZA 3LPFA 1HZHH 2XKSA 3PWVA 2MQ3A 1AGEA 5F88B 3RAJH 1BOYA 1XR8A 5DD5H 4OB5H 1O5DT 2XZZA 3WYRA 5BZDB 4OZGE 3ZDXE 5A43C 1VESA 1AXSA 4U1MA 5FUZL 1OW0C 1S9XB 4X4MA 1T89A 3EO1A 4U6VH 1MHHA 1QNZL 2IBBA 4P9HH 4Y8AA 2FX9L 4N9OB 4D9RE 2D2OA 1CDIA 3P9MB 5IHUL 1MJJA 2W1NA 4GXVH 3QDMB 4ODWB 1AHWB 4GW5B 2A77H 2FJHB 5L0QB 4JM4H 1MREH 3VD3A 5L2KA 1WZMA 3ALPA 4LVNB 5HGAA 3EYVA 5GJSL 3CVHB 3GMLA 5LQBH 3MMEB 1FN4B 4F7PA 4RQQA 7CGTA 2GFBA 4M5YL 1FFOA 4PUBL 2DJ4A 3LEYL 1U3YA 2J88H 2VIRB 4WEUD 3TVMC 4Y4FC 4YBQC 3KYMB 2HVJA 4C56A 5I16A 2BDNL 2VXTL 3MRNA 5D7JD 4IEFB 4KMTL 1CTNA 2D9QB 5IVZA 4JFZH 3IU3B 1IL1A 4Q74A 4F58H 2QR0B 3OR7B 4HSQA 4HKJB 1HKFA 1JGLL 1ND0A 3WXWL 4XCEB 4PJEB 2YKLL 5C0NC 4HC1A 4FQ1H 5T1LB 3UC0L 32C2A 3OL2A 1A7QH 4JVUA 3UO1L 5EO0A 5EOCH 5FDYA 1HHIA 1OTUD 3MJ8A 2OTPA 3NPSC 4PJCF 2NW3B 1ZGLA 4M6AA 1RI8A 1WT5A 5DA0B 3PDDA 3MCG1 3L95B 1MFDL 2DQHL 3OKYA 3HCVB 4HX1A 5DI8A 43C9A 4TSBH 3W0WE 2Y06L 1RK0B 3FN0H 5CLTA 4P2RD 4UNVA 1K5NA 4JFFE 4XXCA 1RULL 3L3OA 3VCLA 4JQXA 2FJFA 4WI7A 3LKOB 3MLYL 1UWXH 3KYNB 4LIQH 4MHHG 4OF8A 1S9WA 5FUCE 4G8GB 3PHQB 3WFDL 5DD1L 4BSVB 1Z2KA 2I27N 2EYTB 4LRNH 5ILTH 3V5HB 4F37K 1BM3L 1XF2A 2YMXH 4FTVD 5D93C 4LSSH 5EZLB 3T65A 2NY5L 5K9OA 1HSAA 4ELKA 1IILE 2HT4C 4UB0L 2VH5L 1IAOA 3HC0B 3PXJA 5AG9A 4F33B 2XT1B 1FV1A 1WTGT 3HFMH 4S1SL 2YUVA 1UA6L 4IJ3B 4D0BA 4Y2DD 1NQBA 2ARJA 4OLWL 4X5LA 1MEXH 4JKKA 2R29L 4PJBE 2NY6B 4MNGA 1ZLVH 5B21A 1BF8A 1G7PB 5D7JB 1INQA 4TNVF 2YD9A 1H3WM 4YBLC 2ZOKB 1S9VB 3FFCD 3SDYH 2PR4H 2OXGA 5F7KC 2AJ3A 3DGGA 3AROA 1P7KB 2EIBA 4KTDL 1U91B 3L7FB 4NKIH 5ENWB 2FATH 1OAUL 4MD0A 4RWYL 4G8EA 4HHAB 4KDTA 3CSYA 3UTOA 5EDXA 3IXAB 3VFWB 3OKDA 3SJVB 5EOCL 1O7SA 1C5BH 2RCSL 1X5FA 4QHUA 5DHYA 3E1F1 1MCPL 1ETZB 3RGVD 1NCBH 4K8RH 2UZIL 3MJGX 1R3KB 3MOBH 1BFOB 3OB0H 4BA8A 1CFQB 5C0DA 2OP4L 5HHQB 2HKFH 5DMKA 3RWEB 3AS2A 1A6PA 4NT6A 4HXBL 1NBVL 1F58H 5F9DC 1T1ZB 1PY9A 1CG9B 1CT8A 2JELL 4TUOB 4ERSH 3DSNA 1OP3H 1QSFD 5AZEH 2BNUB 2WQRA 4I3SL 4GG6E 1A47A 5DWUH 3NVQA 4M1CD 3NCFB 2Q1EA 3ARGB 4P59H 2YR3A 3T2OA 1ACYL 1FHGA 3T8XA 2YN3A 2HWZH 2EDNA 1TQCB 5DRNA 2MSPA 5DEGB 1UM6L 5FKPA 5EN2A 3WNLA 5BV7L 1QEWB 1E28A 3F12B 4HQQL 4GXVL 1C5CL 4HWBH 3RY4A 4NFDA 3LKNB 1KJ2B 3QFDB 4E5XB 4UQ2A 4XCNA 5KW9H 2DQTL 4GUPB 3NFSH 1A6UL 4H20H 3HPLB 2BSSB 4Y16B 1MFEL 2IPUK 1W8OA 4EN3D 1UT9A 1OTSC 2X41A 2X9XA 5IHZA 3IF1B 1J86A 5DEFA 3L3JB 5LAXB 3MLUH 4LSQL 4Z7QF 3ZE2F 2PNDA 2NLJA 3VFOA 4BSJA 2JCCF 1LP9E 2E6JA 2QR0A 3OR7A 1SYVA 3QRGH 1WCQA 4LLVB 1HDMA 1SM3L 3OAUL 3QZWB 3BH8B 4X4ZA 1A1NA 5JW4M 4OM1H 1U92A 3BKML 5GRVL 1LEIA 5FUOH 5SV4A 4PGZA 5DVLA 4PJFB 5I9QB 3SGJA 3GJEB 5EIQA 3R06A 2YEZA 4R3SA 5C09A 5BJTB 2OK0H 4Q97A 2VXVH 1BVLA 2H9GA 4S1QL 4XZUA 1LWRA 2JB5L 2IPTL 3WDIA 3G6JA 3MOAL 4JDVB 1NFIA 2XRAH 4YHNB 4GKZB 1NEZG 1F45A 3NA9H 1PYWA 2XA8L 3FL7A 3GIVB 1HINL 1NEZB 4LU5H 3FQTB 1KOAA 1QLFB 4XNMB 3REVA 5I76A 2FHCA 5E1HB 4TRPL 4RWHA 3RVUD 5BRZB 3QO1A 4OT1H 3DXAA 4P3CL 1QPPA 1J1PH 1T83C 3QXTA 4APQA 1LD9A 1KCVL 2X70B 4G7VL 4J3WA 4BZ2L 3OAUH 5C07D 2LTQB 3IGAA 3GMOB 4MQTB 4KQ3L 4K7FB 4MA1C 1G7LB 5ISZA 4JJHA 2ZSVB 3DVNA 5IK3A 4D9LH 1MQKL 1TCMA 1XF5A 4L5FL 3O9WA 3OKEA 2YPVL 3C5ZD 1MCOL 5MEQB 3FONB 4NN7C 5HI5C 1FNGA 3QAZC 4GMTL 1MLBA 3UCRA 4NO5B 4HUWA 1E4XL 2BY1A 4NZUL 1J0IA 3ZTNH 2JK5B 2X1PA 4KKBD 5JQ6H 1AD9A 2EIDA 5J11B 1B4JH 5D2LA 3W81A 4KROB 4Z7UE 1HH9A 1XCTB 2WW8A 5DJAB 4XP5H 1B4RA 3PUCA 1XIWA 4TTDD 35C8H 4P46B 5FA3B 5B38B 3SKUD 2APBA 3H9SD 1WVZA 4JY6B 1I9IH 4M93C 3U9UA 3VFNA 4QRRD 3DIFB 4OLYL 2FO4A 5IF0B 3ARYA 3HZMB 3D69B 3QDJA 1NDMB 5HYSG 4O2EB 2NTFA 1A7NH 3KLHC 1J1XH 1QP1A 2Y4SA 5C3LD 4MGXA 5EA0L 2HJKA 3BXNA 4MNQD 2YA2A 3CLFL 1XGYL 1OAXH 5DMGD 2AV1A 3CH8A 3MLXL 1AGDB 1QR1A 2F58H 5KVGH 1BP3B 3LIZH 1B6UA 2Y36H 5HJ3A 3C87A 4NRZA 5TE4H 4BQ6A 3BQUB 1I1YA 1G6RH 4R9HA 2EECA 4WUKL 3C09B 3MCLL 3PWPA 4N8VG 1MI5A 5HDQL 3QAZB 1A22B 1GRWA 1U8LA 4D94A 5C0FA 2OL3H 3E6HA 4WU5B 2PTTB 1J8HA 2DMBA 3OJDA 3V8OA 1T22A 1WZLA 5JORB 2X9WA 2Z35B 4NDMB 4R4BA 7FABH 1JHKH 4P3WA 2R2HB 5D2LB 2XQYK 3U83A 3D39B 4OGZA 4XTRC 3QUKA 1OAUH 2YPKB 4FFVC 4KK8C 4OLUL 4KTDH 4ZXBB 2F5AH 3VDAA 3NPZB 2X1XR 5TDPA 3U82B 3HRPA 3O6KL 3U46B 4X80L 3SBWC 1R0AL 1BZ9B 5E6IC 4LDLB 1BX2B 1NKOA 4QGTA 1OAXL 5CSBA 3HC3L 3LEXB 5DK2A 1CBVH 2PXYA 1FJ1B 5D7IF 3WV0A 1OP5H 1FSKB 4ZD3L 3I75A 1E6OL 4HUKB 4DEPC 4FN0A 4UTAL 5E2VL 4W70A 2R2CA 3T2PA 5F3BA 3ECBB 3LQAH 3G6JB 1CLOH 2PW2A 5ERWA 2BVOB 5EBLA 1XIWD 4HV8B 4H5SA 1FLRH 1CK0L 5DFVC 2IQAA 3ARBA 4Y89A 4MNQA 1XH3B 3EIFA 3OF6D 1WQVT 3ARDB 3QG6B 2LU3A 4HFUL 2L4OA 3GNMH 4FP8H 4DUXA 3D2UB 1WICA 3LKRB 4LAJH 1MFAL 4QHNA 3S37H 3GFUA 2Z93A 1YJDC 2OX5A 1CVRA 4LPVA 4JM2D 4N0CC 3RA7H 3I85A 5D6DA 4XHJD 3IAPA 4BFGA 2RIKA 4POUB 5EU7C 1AI1H 2B1AH 1MCSA 4OCRH 1UG9A 4JFPA 1XF4B 4Q9QL 4DVRH 3MR9B 3O2DA 1U8MB 5EG6C 5DJCA 2IQ9H 5ECJE 5DVOA 4HDIA 1SJXA 4H0IA 3ULUL 4GG8A 1JI2A 5I1IL 1J05B 1CDHA 1QSFA 3HRZA 4WWKD 4GH7B 2G60H 2BSED 4Z7WE 4ZXBD 4NQSA 4ZS7H 4U1SB 1JGLH 2XA8H 2BJML 2E6QA 5HHXH 3RI5F 1IEAB 3QUZA 3TN0A 1W0WB 4PTTA 4OZFH 2ADJA 3DMMA 4JDZA 5CJOH 2ADFH 4AM0A 1SJEA 2QQNH 2FIKA 3BIKB 43CAB 2UUDK 4P4KA 4YE4L 1RHHB 4WW1B 4PRHD 5BS0E 2AJXL 1JCKA 1EEZB 2IJ0C 4QRRB 1T1ZA 5T1KB 2GTZA 1LEKB 4U1JB 3BQUA 3UBXG 3FFCE 2DQGH 1QZ1A 4KJPC 5HI4D 2V5YA 3WLWC 2VYRE 5E2VH 3KLHD 4AYFA 2IANE 1QSFE 1BWWA 1A4JB 2OQJA 4LHQB 1KLFA 3VRLE 2G9HA 1IM9A 1FYTE 1ZVYA 2AJUH 1FAIL 5A3IC 4MQXC 2YS4A 5T1LD 4XC1L 2C4FT 4O2EA 3NIFF 2NZ9D 3RPKA 4P5MB 4LVEA 4LASL 2DDQH 5CD5D 1YECH 3HE6D 4HHAA 4MAYB 1AQKH 3IDNA 3GSVB 3GMNB 1AC6A 2F8XC 4M6NH 5TE6H 4NQXB 2AEQL 1CLOL 3DMMB 4JDZB 1I9JH 3U2SA 5HYQA 2XYCA 3DO3A 3FO0L 3OGCA 4YXKH 1F42A 2CO6B 3CIQA 5DJXA 1CD9B 3RL1A 2R1YB 5CWSB 4GBXA 1B0GB 1RIVH 5F6HI 1E6OH 1N5AB 2FEEI 1S7TA 5E08L 1QYGL 3HAEB 3MGOA 2PUQT 4LOUC 1T2QL 1SEBB 3RVTC 4HCRL 1KCUL 4WFFD 3N85H 3LQMA 3LQAC 1MCJA 5C0AB 1FC2D 4QLRA 3PG2A 3PP3K 3STLA 4FNLL 1EMTL 4CL7A 2AK1L 4ZO8A 2AXGA 1G6RL 3TJHD 3FOMA 3QWRD 1Q9OA 2IBZX 1J5OL 1LEGA 4BH8A 3WN5C 5HYJB 3DROA 3R4DA 4ZDHB 4I48A 5C2BL 4BM7A 4D3CH 1D6EB 4PGBB 2DRUA 2HH0H 2E27H 5IQ9A 5KS9F 3PGCB 5JR1H 1JHKL 4CNIA 2I60H 1G6VK 1H5BC 2DBJA 3ET9F 3KYNA 4KDTC 2R56H 3V7AG 4Z0BL 1B0RB 3L3OB 5I1CL 4OLXL 1N4XL 5EOQL 4P5TD 3QIWB 2HMID 4J3VA 4H5SB 4YNYB 5ISZD 1KIUA 2FGZA 5GGRB 1FZMA 3KJ4B 3L95A 1BFSA 1NFDB 4N5ED 3EDJA 2EDJA 3B2UD 3MV7E 1X4ZA 2ZUSA 3FMGH 3W9EB 5D72H 2GK0B 3AY4C 5I73C 4NOFA 1KV3A 4YGVA 2EXYD 2OBGA 1EO8H 1IEBB 4RDQF 3HFML 5JO5B 1DQDL 1KJVA 2B0SL 3CUPA 4MA8L 3WUZA 1J10A 4WW2C 3RZCD 1EEYA 2CKBL 1WF5A 3VH8A 4Q9RH 1EERB 2AK4D 4RX4A 1A3RH 4JO4H 5BV7C 1GC1H 3ETBF 3WO3B 1NMCC 4QTHA 1JWMA 4YXKL 3FO0H 3KAAA 3IKCA 1YN6B 2F53A 2VDLL 3WFZA 2EEBA 1LE5A 1IKFH 3EJYC 3GGWA 5EBMA 3QDJE 2E27L 3VXUA 1I3RB 3IDYB 4U1JA 2R2BB 2DDQL 2E7LA 4K8RD 3MRNB 4F7MA 3MLYH 4LIQL 3SE3A 4P23D 2W9EH 4JPVL 1J8HB 3OJDB 2NY7L 3MGTB 4QRSB 5EUOA 1GSMA 2QQKH 2ZUWA 4ZSOB 3EOBB 5D2LE 1Y0LB 3ZL4H 4M7KL 4WHYH 4L5FH 1AHWA 3WIIL 15C8L 2F54E 3FZUC 4UILH 5T1DH 4OQ1A 3QCTH 4UQ3A 4KJPD 4EQ3A 5F1KC 1T7YA 3CFKB 3HG1A 1S9XA 4ODSH 3S3SA 5CEZL 3CU1A 4OLEA 4FMKA 1X4YA 3UYRH 1KC5L 3RWEA 2ID5A 2WIMA 3VXNB 4XVSH 3UTTE 2ARJQ 1ZHKB 2ESVA 3OKOB 2HFGH 3CK0L 1KB9J 3NIDE 5CP3A 5D5ME 5BV7B 4M5ZL 1JZ2A 2Y07L 1ETZA 1G84A 4FHBD 4P3DB 1S7RB 4TYUA 3CXDH 3K4DA 3AREA 3S34H 3IDJA 2UYLA 4NKDB 5DK0B 3RTQC 4PJBF 3D3VE 4N0CD 5H35A 1M05A 3PL6D 1ZLUK 2AJUL 4H26A 3O11B 3NFSL 4A6YB 1B2WL 5FUOL 2VDQL 3DGGB 4HWBL 1RZIB 4HQQH 2W9DL 1RUAH 3QRGL 5CIPH 3BOVA 2CUHA 1TCRB 4ODSL 5CEZH 5EBLB 4F9PC 4X6CA 4C56D 3P30L 3UTTA 3BGAA 4P59L 4FFZL 5J12B 1AIFA 3KS0J 1Q0XL 1L0XA 4JRYA 5D72L 4M7KH 2LTQC 2W65B 3QEHA 5KZCB 4FQHA 1DN0B 5K9OB 3OKOA 1PY4A 2R0LH 3V9FA 3EDEA 3FT2A 3VI4E 5HGBA 1FCCA 5HYEA 5KSVB 1NUGA 5LWYH 3QISA 5AZ2L 1AQDA 4JFDD 3GSWA 4ESKA 4LLWB 2E3VA 2ORBH 2DM4A 1MNUL 4P5TB 3BKYL 5FYJE 3ZKND 4GO6B 3DV4A 1R3HA 2IQ9L 2BY3A 2FJFB 1FDLH 4EJ1C 2XWJA 3ZHDA 2H41A 5DUML 1UH4A 3O3EA 4R0LA 5JORA 1D5ZA 4U1IA 1FVCA 3V95A 5J9PA 3RDTC 1KJ3H 1CGSH 3QEUB 1X5LA 1MSPA 3C9NA 5ACZB 2RAMA 3TEUA 4YO0B 1FVCB 4PJXA 5ANMA 3TFKD 1IGTA 2G2RB 5FOJA 4O58L 4FXLA 4QXGH 2OP4H 2OSLA 1NFKA 4JPKH 3QIBA 3VJ6A 5BW7A 4FABL 5GXBB 3DHMA 2YZ8A 5FYLE 4UOW0 5C07E 4LQ1A 4Z7UB 1CIDA 1G7JB 1S7SB 1F3DH 3BWUC 2V2WB 3HHRB 1NMAH 3FN3A 4OM0L 4S0TD 4WFEE 2VDRL 5DJ2A 5T1LA 1HQRA 5KSAD 4Z77A 4HKJA 4JKMA 1RIVL 2DICA 1U42A 2GIYA 3HI6L 3GO1L 5IW6A 4XMPL 5IVZB 1OP9A 4TVPL 3WL9B 4RMWA 4L3AA 3MNWB 3BDYH 3ORJA 5FECB 3WJLA 1P7QA 1FL6B 4GQ9H 1KFAL 1T66D 1PX3A 1EJ6A 4X6DE 2E7BA 4JY6A 1LO3H 4NO0A 3SDCD 1W72B 4RFNB 4YHPB 5F1SA 2P5WE 5DRNB 1F97A 1WBXA 1CD1B 2R29H 4FS0A 3LMJH 4DGVL 1R3LA 5T3XD 4F3FA 1J5OH 3HMXA 4FABH 3P9WB 4M48L 4L8CB 1KIPA 3QWOB 1KFAH 2EDDA 4GQ9L 4NQEB 4P4RA 1N26A 2ARWA 1UVQA 1CFVH 2OTWA 1KJ3L 4G8GD 2HG5A 5F7MC 5HY9A 4X4XB 4IOIB 4NFCA 3TLRA 4OZIA 1T2QH 4I3GA 4LKXB 4MLSA 5D5MB 4G8IB 3H9YA 2VDRH 4U7SA 4EKXA 1FNLA 5GIRB 5HD8C 5E1AB 4OZGA 4JAMB 5DD0L 4FTVE 1T6WA 3QXUA 3TNNA 1H3VA 1QUNA 3U36A 3F7PC 3PIQA 4KKBC 2DI9A 4L3EB 4Q58C 4RISH 4YHML 4JO3H 1OF2A 3DVGB 1IGYA 1NDGA 2QQNL 3SKOA 3MZGB 4NO2B 1NGQL 2CMRL 2IGFL 3ARUA 5E95B 1ZHKA 2YKLH 1VERA 1QFUL 1UJ3A 4OKVA 1OTTC 2DKMA 4RZCA 1SHMA 3KPTA 1Z3GL 1BPVA 4X7DC 2MWCA 4KJWC 5CILH 1SEBA 1XF3B 1FL5A 2IFFH 3WIFB 3KXFD 4PP1D 4P5KA 3JWDH 5IB3A 4OFIA 3OWEA 3QWOA 2G5BB 1N7ML 4Y16C 4Z76B 4ZPTB 4JG0L 5D1ZA 5I8EA 4XH2B 4ZAKC 1CR9L 2BP3A 4XZUB 3LSOA 1JVKA 2XN9A 5C1MB 4IDLA 4PJCA 5F6HJ 4G7VH 5F7DA 1I8KA 1J1PL 1SEQH 3VWKD 4PRBA 3LKQA 4TN9A 1KTRL 2AEIT 3DBXA 4WEMB 5C0BB 2W0FA 3ULVF 2DLTA 5J6HA 1P1ZA 3TO4B 4PRDB 3VXTB 5JDSB 1BQHG 4X6DA 1FORH 5D7IE 3UDWC 1C5DA 4UI2A 1NMBH 3Q6GH 1G0XA 5D4QA 1P6AB 3SDXA 4DOHE 4TTGA 1CFTA 4IMKA 2P5EA 1BJ8A 2IBGA 3C6LD 4NC0B 3UTSE 4NZUH 4LL9A 3P0YH 4RAVB 2DOCA 1MFAH 3BZ4A 4HC1H 5BS0A 4KTEH 4GS7B 4M5YH 1MIEL 3GI8L 2OCFD 5FV1L 4JREB 1A8JH 4MA3B 2DQCL 5IBUB 1XR9A 4PP2A 1JP5A 1LP9B 4WTXA 1SM3H 3KPNB 3ULSA 3LEVH 5C0JA 3LKNA 3HKFA 4BZ2H 1KCVH 3QDAA 2A6DA 4X98A 3UXFA 3FQUA 4DK6A 3VE0B 3ARRA 4EI5C 3CVHH 1X5JA 1J0JA 3CH1A 1A2YA 1EDQA 3ZTJH 1N7MH 3O3EB 1RUQH 1OARL 4O2FA 1N2RB 5J0BA 4KXZH 3QEGH 2XWJB 1S3KL 4F8TA 1WGOA 1A6ZA 4MA1B 2YD4A 4NUGH 4YJZL 3FO1A 2FL5B 2I9LA 4PJ7A 3SKNB 1CIUA 1CDUA 2H2PC 4IHOA 1NGWB 3KPRD 3BP6B 3ZT5A 2EE6A 5BV7H 3SHSA 1U8MA 1DN0A 1KTKE 1C5DB 3QUML 3IRPX 5GGSY 4M3JA 4UDTB 3RI5K 3I6KB 4RFEA 1IQDB 4JRYB 1FFPB 3L9RA 3LQAL 3Q5YA 5E8EB 3ISWA 25C8H 2C1OA 1CFNB 3OXRA 4Y4FB 4GOSA 4UILL 5T1DL 3VA2C 1LDPH 1BBJA 1RZGA 4NCC2 4ZD3H 5HI3D 1UYWH 3GMRA 3STLB 2EDKA 3HB3C 3MCLH 3WCYA 4JQVA 2B0SH 2A6IA 3T77A 1F4XH 3MZTA 3ARDA 1JMZA 3QG6A 4K7PH 4MB3A 3OF6A 3BDBA 4MB4A 5HVWA 5BS0D 5C0CB 5B38G 4H20L 2NXYB 3IFOA 3N1GC 4WNQB 4Y5VC 1U8KB 1INQB 2HT3C 4H26B 4JKWA 4LK4A 4R4FL 5ESVA 3CFDB 5AUMA 4YDLC 4NO0D 5KVEH 1NC4A 2X44D 5ICYB 4XT1C 2UYLB 4NKDA 1AH1A 4I77H 3UPAA 2DN7A 4P3DA 3O2DL 1IAOB 3HC0A 2PXYB 1WFTA 3SDAB 4NNYA 4D8PB 3VMPA 4OLXH 2CKBB 1LMKA 3D39E 1P7HL 3MNVB 4MX7A 4X8JA 1S8DA 5D5MA 4OZIB 5ADPH 3KJ6L 4GW1B 4PRHB 4ZTPH 5J06A 3FMGL 3TNNB 4ERSL 2OTWB 1R3IH 1VCAA 2A9ML 2J1KA 1GGIL 4D3CL 4P4RB 3O2WL 5J89A 4J8RA 3LY6A 4EOWH 4LRIC 2E8ZA 1GGBL 5KVFH 1MJ7H 3DX7B 3QUKB 3PDOA 1A9BA 5HPOA 5CEYA 3VCLB 4QOKB 2AK1H 2X4NB 4MJ6A 2P5WD 3CFEB 4V2CB 4U1LB 3RGVB 1OT1A 2VITA 3EOBA 2PYEE 5F6IB 3N85L 4HEPG 4F3FB 5C07B 1BMGA 2COQA 1AO7D 1WBXB 4M9PA 2WV3A 1DFBH 2EXYC 4S11A 5JR1L 3QIBC 5JHDE 3TBSA 4YK4C 4C59B 3N1FC 4BSWB 1SYSA 1N5YL 2BERA 1QD0A 4Y19A 5J13C 5KJRL 1O0VA 2JKXA 3FT4B 2D7MA 3O8XD 2AV1B 3C08H 1HINH 4LU5L 4X6FB 5DK3A 1BBDH 4G6KH 5HHMB 1DUZB 4LEOB 5AYUH 2NY1C 4IOFC 5ESAB 5IJVB 1CXLA 3TZVC 2R1XA 2AK4B 5JW3L 5F9WC 1T83A 3W11C 3X17A 2IAMB 3DO7B 3FCTB 2Y1VA 5JOFA 5JNYA 3NFPA 4LHUD 2ATKB 4MDJA 5I16B 3OX8A 2HTKC 3W9EA 4YO0A 2F54B 5GZNC 2AAVA 1MQKH 3HI5L 4FOMA 5TGBA 3TGXA 2ZJSL 2WBJC 1XZ0B 3VJ6B 2QHLA 3UO1H 3CLEH 3VFPB 1L7TL 2P7TA 2BOCB 5C3TA 1FQ9C 3K7UA 1YNKH 2NY3B 3QEUA 2VRAA 1V7ML 1HXYB 3JXAA 2D3VA 4HIIB 2LVEA 4FQCH 1GIGL 1LO0L 1P69B 3WUWG 4E0RB 3X11B 4F7EA 4HEME 1U8PA 1JNNH 3E8UL 5D7SH 3HC4L 2VKXA 3BYTA 1SVCP 3JV6B 4YHKH 2ZUTA 5DRZA 4HLZG 5IK3B 1KEML 2YUZA 3BPLB 2XQYG 4AY0A 4JANA 3I75B 3GSWB 4DCQA 4Y4KB 1MQ8A 3MC0A 2GJ6A 1MFDH 1MAML 5HGBB 1WBYA 5GJSH 4NP4L 3BYYA 5F1OB 1FGNL 1Q1JH 1LNUB 3FB8B 4XBEH 4GRWF 3W0WB 3F65A 4AEIH 2BX5A 3AREC 2A0LC 1BZ9A 4RIRB 2CH8A 4J6RH 5DQDL 2IPUG 3DUUB 4NWTL 1NCCH 4M7JL 1BAFH 1J18A 2P42B 4JG0H 1OHQA 1EO5A 3MGOB 1IAIH 5IEKA 1HYSC 3ARFD 2OM5A 2Q87A 3ARVA 2BOCA 1B0GA 4GBXB 4HXBH 1BVLB 2CRIA 3P0VH 3MPCA 1GC1C 4Y2OA 5DJXB 3X13A 3ULVC 5H35B 3UYOD 2X4UA 5LBSH 1XZ0A 3F7YB 3O8XA 4DTGH 3GZKA 4L1HA 4JFEA 3Q6FA 5DD5L 1HWGB 5GJTL 1S7RA 3BGFC 1QFPA 1QFWI 4JFQA 4RISL 4PBVC 4YHMH 5LG1A 2FIRT 4Q7DA 3RTQA 3I3EA 2VDLH 4PJHA 3GSUA 5E7BA 1AHWC 3UJJL 1WISA 3L5HA 3UTTD 2X4QB 1MAJA 1UM6H 4AQ1B 3KPSD 1QBMH 2NY1D 3CFIC 3L3HA 5IROA 4U1HB 5KSAA 1JGEA 3PWJA 4TOYL 5DO2C 4M7LL 2APWA 5I18H 3NCMA 3DV6B 1VENA 3FO9B 4CMMA 4UT6L 3KPSE 4Z78A 2A83A 4ZTOH 5T3ZE 1TTUA 5CHNA 1KPRA 3TBSB 3TO4D 3SOBL 5C0CE 3GNML 3IJHB 1XMWA 2WBJD 4MCYB 1RHHA 2BRQA 3WKMH 3VRLF 3H3KA 3WFHA 3O6KH 3TJEH 3AVEA 3CGTA 5I1DB 4OCYH 4S1DC 4QOKA 3BDYL 5DQ9A 1YNKL 1T2JA 1A9BB 4NJAL 3T3ME 1LQSR 1YPZA 3BKJH 4Z0BH 4Q2ZB 5IQ7L 4ZQKA 3TPKA 3MA9L 3ZT7A 5JOPE 5A2IH 2XXMB 2LAGB 4LP5A 3WFBH 1CG9A 4OF3A 4X9FA 4YHIB 4KDWA 5FYKE 2PTVA 2P8PB 1BZQK 3S5LB 1BIIA 3RWCB 1YZZA 3B8SA 4WO4C 4PRNA 1AJ7H 5IVNA 2HN7A 3O0RL 4PJAA 2PR4L 5IFJB 1GGTA 1JWMB 2D7TL 2YPLE 3GSOB 3MJ7A 2Y5TB 4APQB 3EW3B 3BEWA 3OZ9H 5IIEB 2EKSA 4NSKA 1LO5B 3RL2A 3VWJD 3WNKA 1BLNA 1KB5A 2WAHA 3AY4A 3NN8B 4F9LA 4FQJL 2B2XL 1TITA 4KI5D 1DBJL 2VZTA 2Z93B 3OAYH 2NY6D 4WIQA 2P43B 5I1GL 4JKLA 1CQYA 5I1DA 1IE5A 4MNQB 4E9LA 5SWZB 4V1DD 2YMXL 1G0DA 1ZVHA 3QDJD 4MCYA 3S8WA 4CNIB 5DRXB 3AXLB 5E94B 1OSPH 3B9AA 2PO6C 4J7RA 4K2UH 1VKXA 1W0VA 2BOBA 2PW1B 1CGTA 5T3ZD 2NY6C 4I48B 3ZTNL 1IZJA 2PN5A 3KVQA 2MFNA 4FXKB 4GT7A 2BVTA 5I71C 3DX6B 4RAUA 3PGCA 2Y06H 2XNAB 1X5XA 3TH3T 2YPVH 1DQJA 5J3HC 5TQ0H 1EGJA 4U6TA 3IYLW 3B5GA 4G6MH 1CFSB 4BH8B 5IHZB 5E9DE 5I1EL 2PO6D 1M7DA 1MREL 5E9DB 3B5TA 4I3RL 2AJXH 1ZT4A 4NQDB 5I8CB 2QADD 1B2WH 5DZNA 4JPWH 4M1GH 4NQCE 4Y5VA 3ELAT 1SJVA 1OVZA 2VXUH 3VXME 5E5RB 4P4KC 3DETC 2NXYC 1VEOA 2P45B 3V6OC 3OB8A 1YY8B 4IMLA 1XAUA 3G6JF 1F02I 2JJTC 3VWKC 3MRRB 4M9OA 3RPIA 3MOAH 1MJ8H 2ZOLB 4UIKL 5D7LE 1KB5H 1G0YR 1KPRB 3HAEG 4XNZB 2VTFA 5HSFA 3PWPE 2ENYA 3N50A 1OCWH 2EDTA 1Z6JT 5EO0B 2IG2L 1AGDA 3T09A 1A4JA 5HHME 3ES6A 32C2B 4BELD 1DP0A 4MD5A 1JIBA 3SQOL 4HAFA 4OQTL 1CDCA 1CDBA 4Q9QH 5HHQA 3QBTB 1ZTXL 2MQ0A 2MQCA 5T1KA 3ROLA 4JCMA 3JV4A 4CVZB 2UZXB 3F8UB 3EJYD 1VPOL 4XVTL 4YEFA 1FH5L 3LKQB 3HE6A 4KY1L 5K33A 1I8KB 5IBTL 4XB8A 3CSYB 3TN0B 5E8DH 3VXSB 2BNQA 1L6ZA 4HJ0C 1JPFA 1FLRL 1IKFL 2D31B 4NQSB 2E7MA 2NQCA 2R15A 4QHKJ 2EDLA 2I9TB 1IEAA 2WK2A 4KZEH 1R3JA 4OCWL 4L4TA 1CF8L 4LDEB 4JRXE 2JE8A 3FCTA 1BOGA 2AQ3A 1OAYH 5HHMD 5I9QC 3HC3H 1FV1B 2YWZA 4OFKA 3V6ZB 3Q3GA 1MHEB 3EBAA 4IRSB 4WI3A 1VEPA 4HDIB 1NL0H 1ZOXA 3MRGB 5CZXC 5E2JA 3K4ZA 4XVUC 4YAQB 4ELKB 2LQRA 2WBJA 1JNLH 4QNPF 1Q9KB 4G8IA 5KW9L 4MQ7A 2E7LC 3DXAE 4UT7L 4MD4A 3QO0A 1WTLA 3FAXA 1HNGA 4JHAH 5DURB 1JE6A 5DJZA 3QEQD 5L88L 1KPVB 4YDVA 2J6EL 1AD0A 3CDCA 4U0RB 4RGNC 3TZVA 3L3DB 1XFPA 5BVJB 2VDPL 1G7HB 1R3LB 1ULVA 1LP9F 2FNBA 1DQQB 4YFDB 3M17B 2IH3A 2XN9D 3FAWA 3V4UH 4IIQB 5FXCH 1MCEA 3LRHA 5C09E 1RZJL 4FQIL 3JWOH 4LPYA 3K2UH 3C5ZC 2IPKB 3QIBD 2IMNA 3RKDC 3ECBA 1OT2A 4FZ8H 1L4IA 2O61B 2IAMA 2BSRB 5T3XL 5FKAA 5F7YC 3RDTB 1KELH 3G6AB 2IGFH 4W6WB 2GK2A 4LCUB 2JIXB 1L7IL 1RQ5A 4M7LT 5DFWH 1PQZA 3NIGF 4NNYB 5IB1B 2ICWJ 3GMPB 1NBZB 2NXZC 2AJZA 4OZ4A 2FSEA 4H88H 3MRLB 4HWEL 2X7LA 4AIZA 2W0LA 4GUPA 4XCNB 1XGTA 4H0HB 4PY8I 4U1KA 4HS8H 4AJ0A 4S2SA 3OGOE 4XNYL 1E28B 3F12A 3BHBB 2Q6WB 1EH9A 4R0LB 4GRMA 4P4KD 2ZZUT 1HHHB 2JJVA 3SKMB 4G42A 4KDVA 4HJGA 1EJOH 5IBUG 1MH5B 3PWPB 3H9ZA 5B3JF 1H3XA 3MYJB 1Q94A 1UXSB 5T3XE 4NRZB 3IDGA 3TH4T 3V6BR 2I07A 2RQ8A 1I8IB 3CDFA 4N1HB 1EBAA 4J8RB 1SVZA 4B5EA 3WXVL 2FLBT 1MUJA 4LSSL 2ICEB 4L9LC 4WWKA 2XFXA 4XMLL 4U1NB 3MV9A 2C26A 1VFUA 3BZFB 4PG9B 3ZSSA 2EYSB 3EO1B 2Z92B 3KJ4C 5GGTA 1ROWA 3BWAB 4LVNC 3BI9X 1A14L 2AV7B 3GK8L 2NY4C 1T7XA 2B5IC 1BWMA 5JA8B 4ZXBC 2ED9A 4XC3L 4LHUA 3REWA 4HXAH 4WO4D 3IJSB 5K59E 5MENE 3WXWH 4PJGF 3ESUF 3MTRA 1QLEL 4WI5A 1NLDH 1LVEA 4NYLA 4QXGL 1P7KA 3K74B 2PETA 1A2YB 1AXIB 1II4E 2AJ3B 4J3SA 2C7UA 4L9DA 5D1XC 1B9ZA 4LLYA 3QQ9C 4NRYB 1CD8A 3ZTJG 2JIXD 3G9AB 4PRPD 2GJJA 4XPTH 1TPXC 4YH6A 5I2IA 5DXWA 1M05B 1I7RA 4X9GA 3KLDA 2HFTA 3IDYC 1NUDA 4QNPE 1DBKL 5E8EA 5D6CB 2EDWA 1LO2H 2Q86A 2Z9TA 4D9RD 4WO4B 1TMCB 4KVCH 2DI8A 4P23C 1BQSA 4WI8A 5HI3C 2H32B 1XF5B 3BW9B 1TDQA 5AWNH 3RU8L 1G7LA 5ISZB 3KWWA 3SGJC 4X5WB 1JPGB 3IGAB 4P23A 3BP7B 4Q6IC 4G6AC 1V5JA 1F13A 3RZWA 1JZ3A 3KG5A 4JANB 4HUMB 3TIEA 4QY8B 2JCCE 2V7HB 4X9IA 2BCKB 4NQDE 1XEDA 4NKOA 4J4PA 5EBWB 5GGVH 4BUHA 4Y8DC 1DQLH 5GSVA 3H3PH 2VLMD 3T08A 4PRBB 3RVWC 4U0RC 1DANU 1IC5L 1CF8H 3EDDA 3IS1X 4WTZA 3O4LE 5F8QC 1RK0A 3VXQA 2XN9B 4U05A 2HWZL 5CEZE 1IFHH 3L3GB 3OPZL 5CEZD 3IETB 4OZFB 1KXQE 1CDGA 2G5BA 5D2NE 4Z6AT 3D9AH 3U0TB 4WVRA 3MRHA 3O4LD 1FL5B 4Z7NF 4HG4K 1CCZA 3VXUB 4AL8L 4XPTL 3BP4A 4RZCB 3RUGE 3SKJL 4XI5D 1RU9L 1WCBB 5IBTH 2J8OA 5BVPL 3IKCB 4AMKH 2YXMA 4NQUA 1KBGH 1IQWH 3EYFB 1HEZB 1HHGA 4N8VA 4LLVA 3U1SH 5D7JC 3ARDD 3MOBL 5ITBH 5DQJB 2F5AL 5DEFB 4PJDA 1KJVB 3A67H 5MEPA 4K3DL 1L7TH 5HHPA 1JPSH 1N8ZB 1P53A 3VXTA 1A14H 4KRPC 3KYMA 4LARL 4WHYG 4JFFA 3QB7C 5DF0A 4BSWA 2DL9A 3ILQC 4GW4B 1OCWL 4PPTA 4XMKL 3V7AE 3BZEB 3NMEA 3I2CH 2F53E 3OKKA 2H6PA 4R4ND 2C3XA 5F7HA 4O02H 3VWKB 2IAMD 1Q72H 5AYUL 1XF3A 4NUJA 5D5MF 4S10A 2EO9A 4YBQD 3IFPB 2HTKD 4PREB 5KJRH 1RJYB 1RUPH 2A6KA 5DZOA 1P84K 3CXHK 1XGQB 1J88A 4JG1L 4HIJA 4QRQA 3BN3B 3BZFA 4OF5A 1PKQB 4X0KA 5FM4A 3PIQB 4HJJL 2ITDB 1I3GL 4QHUB 2VXQL 3FQNB 5B8CC 4XNXH 3P73B 5I75B 4Y4HA 1OGAA 2I07B 5ACMA 1R3KA 4LKXA 1G7JA 2B5IB 3CX5J 1H5BA 1QSEE 5HY9B 1B4JL 5DJ0B 5FGBC 3RWGA 3ILPB 1DQDH 1RJCA 2C4XA 1UADC 2DIJA 3V2AR 3QJHA 4N0YH 3O6LL 2VL5A 4EQ2A 2A73B 3EZ8A 2QQQA 3O6LH 5IVXE 1KB9K 4EN3C 3HUJA 3V4PL 1I1CA 5F44A 4YWGL 4HIXL 4WI2A 1HCFX 4BJLA 1X5YA 3RJQB 2ESVD 2FO1A 4CMHC 4U6XA 3U0PB 4WFHE 4YX2L 4YHPA 1WEJL 4AZ8A 1FPTL 5F9WB 1GZQA 1BEYL 4P5TA 4POZD 5EU3A 3SGKA 4OLZL 1M7XA 4YC2B 5IW6B 2WSKA 4DGIH 1RMFL 2V2TA 4HCRA 4WU7B 3CMOL 1IM9B 5F6IC 1IGJA 4LQFL 1Q38A 1AFVL 2EYTA 4P2OD 3LAFA 3OZ9L 4ODBD 4PBXA 3P11L 4NKMB 2R4RH 2HRPL 1S9WB 3RWFA 2CLRB 4O02L 2OI9B 1XT5A 2XIDA 1MVFA 1NC2D 2K9UA 1KLUB 5BVPH 3O3AA 4GQPH 1LDPL 4Z5RB 2DLIA 4Y1AA 4X7FC 3L3DA 5EZIL 1N6UA 4TNWK 5IG7A 5DI8B 43C9B 1OWRM 1K2DB 4POYA 3G08A 4G7YL 5C09D 5DSCB 1XF1A 3BPLC 4O2FB 3S97C 5E24E 4F8QA 2HFEB 2V9QA 4HK0B 3LOWA 4KZEL 3DUSA 3BQUC 5C0EB 5L6YH 4I0CC 4LSTH 3TVMA 2KZWA 4FFWC 4KTYA 4MQ7B 4ZOCA 2LV4A 2WBJB 4I18A 4NC2B 4LLWA 3EFFA 2ADIA 4BH7B 3QEQE 2NW3A 3QA3B 3WIHL 2CLZB 4PTUB 1YECL 3QP3A 5HI4C 4EIZC