2HKPA

Sumo protease ulp1 with the catalytic cysteine oxidized to a sulfenic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
218
Chain Sequence
GSLVPELNEKDDDQVQKALASRTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-like-specific protease 1
publication title Molecular basis of the redox regulation of SUMO proteases: a protective mechanism of intermolecular disulfide linkage against irreversible sulfhydryl oxidation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 75
structure length 218
sequence length 221
ec nomenclature ec 3.4.22.68: Ulp1 peptidase.
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02902 Peptidase_C48 Ulp1 protease family, C-terminal catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.20 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2hkpA01
3.30.310.130 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Ubiquitin-related 2hkpA02
1EUVA 2HKPA 2HL9A 3EAYA 2HL8A
chains in the Genus database with same CATH superfamily
1FN7A 2NOFA 1LWWA 3N89A 3HORA 2YH5A 1M3HA 1M3QA 3OCIA 4IL8A 1RM1A 2JHJA 1R4XA 2Y8LA 1KYUA 5AN4A 4WX8A 3CWUA 4Q11A 1SH5A 3JALM 1VOKA 3HOPA 3ASMA 3CVSA 1AOAA 2EYNA 1DXXA 4EDMA 1UJOA 2LAEA 2R8UA 3CWTA 3PMGA 2QR1A 2IV8A 2NLVA 3PDKA 2D0BA 2DKAA 4DDPA 3KY9A 1EBMA 3FERA 3I6XA 1YTFA 3CWAA 2D85A 4TXIA 2NOBA 1BKRA 2G30A 5A37A 3JARM 4ROEB 5IYCP 5JN5A 1PCMX 1K2YX 1KY6A 3HS8A 3VN5A 3CW7A 2H5AX 3NA5A 1PXYA 1PCZA 2HZMA 5FMTA 1C4GA 5IYBP 2YRNA 4WXAA 1WYQA 3C04A 2DKDA 3SNSA 1MB8A 1QN9A 1V5SA 1LWYA 1T6AA 3RSMA 2R0OA 3TDHA 3JAKM 2QJZA 3DPTA 3CVTA 1KFQA 1VTLE 2I5WA 2K2RA 1PA7A 2QRDA 1PZDA 3OSEA 1HU0A 2HZSA 2RR8A 1WYMA 3DPUA 4Q58A 2QLVA 1UT7A 1KYDA 1WYRA 4EDNA 1YQMA 2VZDA 2IGPA 4EAKA 1LXTA 2XHIA 3UW2A 2EYIA 1QN4A 2V8QA 3OLPA 1QNBA 2NOLA 1NH2A 2DKCA 1C9BB 1QNEA 1J3MA 1W80A 1EUVA 3ENOC 5KL0A 5A4BA 4EAIA 2D0CA 5BMPA 2Y8QA 3OC3C 1JFIC 2FKFA 3OH9A 1WYPA 1RT8A 1LWVA 1WJOA 3H1ZA 3OSMA 2HL8A 4EDLA 4EAJA 2JPIA 2VZCA 1KYFA 2PWWA 1N39A 5HSHA 2VE7C 3ENCA 2EHBD 4C7PA 2NOHA 3RPJA 1TUOA 3F7PA 3D7QA 3D4VA 2FKMX 4Q57B 3VP7A 1P5DX 3I3WA 1C47A 1QNCA 1P2XA 1QN6A 4EJZA 2NVMA 2VE7A 2HKPA 4B0AA 5IYDP 1QN8A 2QRCA 3IH7A 2D86A 2F7LA 1VKAA 1N3AA 5JMVD 1E42A 4WZSD 2IV9A 5BMNA 4LVRA 2JV9A 3BKQX 2WE6A 3OSTA 5EPCA 1AISA 4EALA 1TJTA 1M5Q1 1QN5A 2HL9A 3OH6A 2FUVA 1V5KA 4TPSA 4ROCB 2JOIA 4TXKA 2V9JA 1P5GX 4HJHA 1K35A 1YQLA 3REPB 2WDTA 4D7QA 1SH6A 1YTBA 1P5SA 1WIXA 1BHDA 1UEGA 2JHNA 4BJUA 1MPGA 4PY5A 3KTUA 2O3OA 5F9CA 4Q59A 2EE7A 3ULXA 1KFIA 2Z0FA 1WYOA 5J8EA 1WYLA 4EJYA 3F0ZA 1VOLB 3CO1A 1DIZA 1AA2A 3KMUB 3T4NA 3HOCA 2NWVA 5L0OA 2MZ8A 5A36A 1JDYA 2YA3A 5BVRA 1WYNA 2D0AA 4D7RA 1WKUA 2D88A 2R5XA 1TBAB 2VZGB 3EAYA 2VZIB 1WJWA 1N3CA 1CDWA 1KO9A 2QJXA 2L3GA 2D87A 2OOXA 1VTOA 2K3SA 4LVPA 1H67A 2NOIA 2V92A 3CWSA 1WQAA 1TBPA 1NVPA 1MP9A 2QREA 1Q9UA 3F10A 1QTPA 4QG5A 2FGTA 4RODB 2VJ0A 2NOZA 1PVSA 2D89A 1TGHA 1VKLA 4EAGA 1YQKA 1UL7A 3KRMA 4DULA 1XSZA 1PCJX 2WA5A 2EQOA 1YQRA 4MRQA 2WA7A 4B7LA 2MJ7A 2OOYA 3OGDA 2NOEA 5A38A 3I0WA 1QTSA 2WFNA 2ZFDB 1B9KA 2H4LX 1QNAA 2WA6A 4CFFA 1UT4A 3I0XA 2E9KA 3EIKA 1QAGA 3KMWB 4I8OA 5FMUA 2DK9A 1QN7A 3HS9A 3TE5A 1D3UA 1NGMA 2Z8UA 1QN3A 1KY7A
chains in the Genus database with same CATH topology
1EUVA 3VP7A 2VE7A 2HKPA 2EQOA 2WE6A 2HL9A 5FMTA 5FMUA 2VE7C 2HL8A 3EAYA 2IGPA 4LVRA 4LVPA 4DDPA 2WDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUV A;  2HKP A;  2HL9 A;  3EAY A;  2HL8 A; 
#chains in the Genus database with same CATH topology
 1FN7 A;  2NOF A;  1LWW A;  3N89 A;  3HOR A;  2YH5 A;  1M3H A;  1M3Q A;  3OCI A;  4IL8 A;  1RM1 A;  2JHJ A;  1R4X A;  2Y8L A;  1KYU A;  5AN4 A;  4WX8 A;  3CWU A;  4Q11 A;  1SH5 A;  3JAL M;  1VOK A;  3HOP A;  3ASM A;  3CVS A;  1AOA A;  2EYN A;  1DXX A;  4EDM A;  1UJO A;  2LAE A;  2R8U A;  3CWT A;  3PMG A;  2QR1 A;  2IV8 A;  2NLV A;  3PDK A;  2D0B A;  2DKA A;  4DDP A;  3KY9 A;  1EBM A;  3FER A;  3I6X A;  1YTF A;  3CWA A;  2D85 A;  4TXI A;  2NOB A;  1BKR A;  2G30 A;  5A37 A;  3JAR M;  4ROE B;  5IYC P;  5JN5 A;  1PCM X;  1K2Y X;  1KY6 A;  3HS8 A;  3VN5 A;  3CW7 A;  2H5A X;  3NA5 A;  1PXY A;  1PCZ A;  2HZM A;  5FMT A;  1C4G A;  5IYB P;  2YRN A;  4WXA A;  1WYQ A;  3C04 A;  2DKD A;  3SNS A;  1MB8 A;  1QN9 A;  1V5S A;  1LWY A;  1T6A A;  3RSM A;  2R0O A;  3TDH A;  3JAK M;  2QJZ A;  3DPT A;  3CVT A;  1KFQ A;  1VTL E;  2I5W A;  2K2R A;  1PA7 A;  2QRD A;  1PZD A;  3OSE A;  1HU0 A;  2HZS A;  2RR8 A;  1WYM A;  3DPU A;  4Q58 A;  2QLV A;  1UT7 A;  1KYD A;  1WYR A;  4EDN A;  1YQM A;  2VZD A;  2IGP A;  4EAK A;  1LXT A;  2XHI A;  3UW2 A;  2EYI A;  1QN4 A;  2V8Q A;  3OLP A;  1QNB A;  2NOL A;  1NH2 A;  2DKC A;  1C9B B;  1QNE A;  1J3M A;  1W80 A;  1EUV A;  3ENO C;  5KL0 A;  5A4B A;  4EAI A;  2D0C A;  5BMP A;  2Y8Q A;  3OC3 C;  1JFI C;  2FKF A;  3OH9 A;  1WYP A;  1RT8 A;  1LWV A;  1WJO A;  3H1Z A;  3OSM A;  2HL8 A;  4EDL A;  4EAJ A;  2JPI A;  2VZC A;  1KYF A;  2PWW A;  1N39 A;  5HSH A;  2VE7 C;  3ENC A;  2EHB D;  4C7P A;  2NOH A;  3RPJ A;  1TUO A;  3F7P A;  3D7Q A;  3D4V A;  2FKM X;  4Q57 B;  3VP7 A;  1P5D X;  3I3W A;  1C47 A;  1QNC A;  1P2X A;  1QN6 A;  4EJZ A;  2NVM A;  2VE7 A;  2HKP A;  4B0A A;  5IYD P;  1QN8 A;  2QRC A;  3IH7 A;  2D86 A;  2F7L A;  1VKA A;  1N3A A;  5JMV D;  1E42 A;  4WZS D;  2IV9 A;  5BMN A;  4LVR A;  2JV9 A;  3BKQ X;  2WE6 A;  3OST A;  5EPC A;  1AIS A;  4EAL A;  1TJT A;  1M5Q 1;  1QN5 A;  2HL9 A;  3OH6 A;  2FUV A;  1V5K A;  4TPS A;  4ROC B;  2JOI A;  4TXK A;  2V9J A;  1P5G X;  4HJH A;  1K35 A;  1YQL A;  3REP B;  2WDT A;  4D7Q A;  1SH6 A;  1YTB A;  1P5S A;  1WIX A;  1BHD A;  1UEG A;  2JHN A;  4BJU A;  1MPG A;  4PY5 A;  3KTU A;  2O3O A;  5F9C A;  4Q59 A;  2EE7 A;  3ULX A;  1KFI A;  2Z0F A;  1WYO A;  5J8E A;  1WYL A;  4EJY A;  3F0Z A;  1VOL B;  3CO1 A;  1DIZ A;  1AA2 A;  3KMU B;  3T4N A;  3HOC A;  2NWV A;  5L0O A;  2MZ8 A;  5A36 A;  1JDY A;  2YA3 A;  5BVR A;  1WYN A;  2D0A A;  4D7R A;  1WKU A;  2D88 A;  2R5X A;  1TBA B;  2VZG B;  3EAY A;  2VZI B;  1WJW A;  1N3C A;  1CDW A;  1KO9 A;  2QJX A;  2L3G A;  2D87 A;  2OOX A;  1VTO A;  2K3S A;  4LVP A;  1H67 A;  2NOI A;  2V92 A;  3CWS A;  1WQA A;  1TBP A;  1NVP A;  1MP9 A;  2QRE A;  1Q9U A;  3F10 A;  1QTP A;  4QG5 A;  2FGT A;  4ROD B;  2VJ0 A;  2NOZ A;  1PVS A;  2D89 A;  1TGH A;  1VKL A;  4EAG A;  1YQK A;  1UL7 A;  3KRM A;  4DUL A;  1XSZ A;  1PCJ X;  2WA5 A;  2EQO A;  1YQR A;  4MRQ A;  2WA7 A;  4B7L A;  2MJ7 A;  2OOY A;  3OGD A;  2NOE A;  5A38 A;  3I0W A;  1QTS A;  2WFN A;  2ZFD B;  1B9K A;  2H4L X;  1QNA A;  2WA6 A;  4CFF A;  1UT4 A;  3I0X A;  2E9K A;  3EIK A;  1QAG A;  3KMW B;  4I8O A;  5FMU A;  2DK9 A;  1QN7 A;  3HS9 A;  3TE5 A;  1D3U A;  1NGM A;  2Z8U A;  1QN3 A;  1KY7 A; 
#chains in the Genus database with same CATH homology
 1EUV A;  3VP7 A;  2VE7 A;  2HKP A;  2EQO A;  2WE6 A;  2HL9 A;  5FMT A;  5FMU A;  2VE7 C;  2HL8 A;  3EAY A;  2IGP A;  4LVR A;  4LVP A;  4DDP A;  2WDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...