2HKRA

Structures of the carbinolamine and schiff-base intermediates in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with p-methoxyphenylethylamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hkrA01
4L3HD 4CZVA 4CI1A 2P9PC 3EI1A 2PM9A 4PSWB 3SLED 4CY1A 5FLXg 2H6QA 1MG3A 2B4EA 2J55H 5FKQA 1PEVA 3UVOA 3JRPA 4GQ2P 5H1MA 1SHYB 1ERJA 4ERQA 4H5JA 1MG2A 4FHLA 5FA5B 2HESX 3KRWB 3UKRC 4ES0A 4ZOVA 2YNNA 1NEXB 3OKTA 4J8BA 3JZGA 4PBYA 3EI2A 4AOWA 1GG2B 2XL2A 2CN3A 3RN0D 3MZKA 4CY5A 5HE3B 2AQ5A 3V9FA 4JT5C 5C9ZB 4N14A 2MTAH 1FWXA 1PI6A 2AGYA 3DSMA 4QT8A 2OK6A 3EI4B 4X61B 2PM6B 4GQBB 1P22A 1OMWB 2IUPA 4J84A 5FKRA 4ZOZA 3VH0A 4J87A 2XL3A 4X3EA 3NVNA 3MMYA 3UVMA 3AL8B 4BUJC 3VA6A 5CXCB 5IC7A 5HQGA 3SCYA 3C75H 5EM2B 2CE9A 3JZHA 4K3JB 2H3XA 3VGZA 2J56H 4CY2A 3RFGA 3ULEC 4ERYA 3PSCB 3JZNA 5A2Qg 2GC7A 2AH1A 4JSXC 3AH8B 4ZOXA 4A08B 3DXKC 2H6NA 4R7AB 2XYIA 3L4MD 3SXTD 3NVQA 4J78A 4H5IA 4I79A 2UZXB 3N0EA 3EI4A 4J8GA 5I5MA 3GFCA 2OIZA 3SMRA 4PNKB 4GZ8A 4L3GD 4GM3A 3SWSD 3EMHA 4HDJA 4LG8A 3I7NA 5EMMB 2YNPA 4MK0B 5CXCA 1NR0A 5KDOB 4CI8A 2PM7B 5GSAA 5EM2A 3I7KA 2P9SC 3I8EA 3L4OD 3ORVD 3FGBA 3PE7A 2OVPB 3AFCA 3SJLD 5HYNB 2IUQA 1L0QA 3IIWA 2B5LA 3SVWD 3IIYA 4GM9A 2AGZA 5EAMA 1JJUB 4A08A 4JT6C 4J73A 2B5NA 4A09B 2AH0A 3FRXA 4XYIA 3KRXB 2AGXA 4Z8LA 3EI2B 5GMKn 3F3PA 4D6VA 2H9NA 4EWRA 3RRMC 3PVWB 2IAAA 3OTTA 1B9YA 4ERZA 4XEIC 5GXHA 3SN6B 4JD2C 2OVRB 2HJBA 4FA4D 4PC0A 1XKSA 4U1EI 4FA9D 2H9MA 4E54A 4J0WA 4PXWA 2J57G 1VYHC 2YBAA 3I8CA 2G9AA 4ESGA 3MXXA 4BL0A 5IT9g 2QC5A 5HE2B 2HYEA 4A09A 1R5MA 3RMZD 4QQEA 5JWZA 4X63B 2B5MA 2TRCB 3PXWD 3V5WB 1YFQA 3W15A 5FXYA 5CYKB 5AJAA 4NSXA 1S4UX 2H47A 1JMZB 4D0KA 4FAND 3PVUB 3I2NA 1B9XA 3I89A 3I7OA 4CZXA 3OKYB 2HKRA 5EMLB 1U2VC 4CI2A 5IJ8E 5HE1B 3RN1D 3DM0A 4PSXB 5H14A 1SQJA 4G56B 4FA5D 3J80g 4CI3A 3N0DA 3FM0A 4QL1A 2IURA 4GGCA 3UR4A 4JSNC 5CYKA 1GXRA 4KFMB 1A0RB 5CXBA 4L9OA 5H17A 1OLZA 4A0AB 3SBQA 2AGWA 4J82A 4PBZA 5IJ7E 4GGDA 2Q7QA 3I7HA 4FWWA 3OKYA 5IGOA 3RFHA 2CO0C 5FKSA 5TEEA 1SQ9A 4O3UB 3BG1A 2HXCA 2YNOA 5FKTA 3C9CA 4E54B 3I7LA 2H9PA 3UVLA 3JPXA 4IA9A 4A2MA 4A7JA 5C2VB 3PXTD 2G99A 3SHFA 3V7DB 3C5MA 4A2LA 4ZN4A 5AMSA 4OWRA 5EAPA 5I5IA 4K3ID 3CIKB 2IUVA 3MKSB 4A0AA 4E5ZA 2HKMA 3JAMg 3IJ0A 2P9IC 4LGNA 5K19A 2CN2A 1N6EA 5B4WA 2H6KA 4GMBA 4O1QD 5EMJB 3JB9L 3U4YA 4A0BB 3GREA 1TBGA 2P9KC 3HFQA 5EMKB 2Z2PA 3NVXA 4TZ4A 3I7PA 4CZYA 4BH6A 4FA1D 2QXVA 3SFZA 4OZUA 4J81A 5THAA 2H14A 4O9DA 4FB1D 2Z2OA 3ZWLB 3JROA 2CE8A 3BG0A 5FQDA 3OL2A 1TYQC 3K26A 2I0SA 3K27A 2OVQB 4CC9A 1GOTB 3IJ1A 2IWKA 2XU7A 1XHMA 5CXBB 4X60B 2GC4A 3MKQA 4O3TB 3IKOA 3C99A 4A0BA 2O9KA 1PBYB 2PBIB 2OJYA 1QNIA 2IWFA 3A0FA 5EALA 3RSEC 4FAVD 5AFU3 3PXSD 2UZYB 3IJCA 4GQ1A 1JOFA 4GM8A 5TF2A 3E0CA 1RI6A 3UVKA 4LG9A 5GXIA 4UI9R 2GNQA 3EI3B 5K1CC 4J0XA 2P9NC 3UVNA 4JXMA 4CY3A 2HJ4A 3CFSB 4L1QD 4J86A 1XIPA 3EU7A 2I0RA 4ZOYA 2EBSA 4A11B 1PGUA 2H13A 4E5ZB 4GGAA 3SBPA 5EARA 5HE0B 2W18A 3MZLA 3ODTA 4YVDA 5I5JA 4AEZA 1Q47A 1N6DA 2I3TA 3OW8A 2AGLA 4J79A 1JMXB 3J81g 2I0TA 4U7AA 5TEFA 2BBKH 3EG6A 4JSPC 3DXMC 3EWEA 4O45A 3UKUC 5SXMA 4QRJA 2I3SA 3PSLA 3P4FA 3EI3A 2OK4A 3EI1B 2PM9B 2BCJB 5TDHB 2Z2NA 3AL8A 4IMMA 1K8KC 3AL9A 3OL2B 3CFVA 4A11A 1U4CA 3DWLC 4Y7RA 3F3GA 2CNXA 3RLMD 2H9LA 1GP2B 1MDAH 2CO0A 5IGQA 3BWSA 2H68A 4Y5RD 4XYHA 1N6FA 2P9LC 2YMUA 3OKWA 4JSVC 2YB8B 2P9UC 3F3FA 3SBRA 1K32A 3B7FA 4J77A 5C2WB
chains in the Genus database with same CATH superfamily
4L3HD 4CZVA 4CI1A 1H2YA 4G1EA 2VDMA 4UM9A 2P9PC 3EI1A 3EQ8A 2PM9A 4JHPC 4AMZA 4PSWB 5M5VA 3SLED 4CY1A 5FLXg 2H6QA 1MG3A 2B4EA 2J55H 5FKQA 1VE7A 1PEVA 3UVOA 3IJEA 4AMYA 3JRPA 4GQ2P 5H1MA 4BP8A 1SHYB 1ERJA 3ZDZA 4ERQA 4H5JA 2VDLA 1MG2A 4FHLA 5FA5B 2HESX 3KRWB 3UKRC 4ES0A 3IVMA 4ZOVA 2YNNA 1NEXB 3OKTA 4J8BA 3JZGA 4PBYA 3EI2A 4AOWA 1GG2B 2XL2A 2CN3A 3GD1I 3RN0D 3MZKA 4Z7NA 4CY5A 5HE3B 2AQ5A 3V9FA 4JT5C 5C9ZB 2WQ8A 2MTAH 4N14A 1FWXA 1PI6A 2AGYA 3DSMA 3OF7A 1YR2A 4QT8A 2OK6A 3EI4B 4X61B 2PM6B 4GQBB 1P22A 2EIEA 1OMWB 2IUPA 4J84A 5FKRA 4ZOZA 3VH0A 4J87A 2XL3A 4X3EA 1UOOA 4Z7OA 3NVNA 3MMYA 3T3MA 3UVMA 3AL8B 5M61A 4BUJC 3VA6A 5CXCB 5IC7A 5HQGA 3SCYA 3C75H 5EM2B 2CE9A 3JZHA 1C9LA 4K3JB 3O4HA 2H3XA 3VGZA 2J56H 4CY2A 3RFGA 4O02A 3ULEC 4ERYA 3PSCB 3JZNA 5A2Qg 2GC7A 2AH1A 1A12A 4JSXC 3AH8B 4WK0A 4ZOXA 4A08B 1I2MB 2H6NA 3DXKC 4R7AB 2XYIA 3L4MD 3SXTD 2XZGA 3NVQA 4J78A 4H5IA 4I79A 2UZXB 3N0EA 2VZ3A 3EI4A 4O2WA 4WK2A 4J8GA 4DNUA 5I5MA 3GFCA 2OIZA 2EIDA 4PNKB 4GZ8A 3SMRA 4AX4A 3NIFA 4L3GD 3VI3A 4GM3A 3KCIA 3SWSD 3EMHA 4HDJA 4LG8A 3I7NA 5EMMB 1M1XA 2YNPA 4MK0B 5CXCA 1NR0A 5KDOB 4CI8A 2PM7B 5GSAA 5EM2A 3I7KA 1L5GA 2P9SC 4NAAA 3I8EA 3L4OD 3IUMA 3ORVD 3FGBA 3PE7A 2OVPB 1TYEA 5C92A 3IUJA 3AFCA 3SJLD 5HYNB 2IUQA 1L0QA 3IIWA 4MMZA 2B5LA 3SVWD 3IIYA 4GM9A 2AGZA 5EAMA 1JJUB 4A08A 4JT6C 4J73A 2B5NA 4A09B 2AH0A 4RE5A 3FRXA 4XYIA 5M5TA 3KRXB 2AGXA 4Z8LA 4AN0A 3EI2B 5GMKn 3F3PA 4D6VA 4BCBA 2H9NA 4EWRA 3RRMC 3PVWB 3NIDA 2VDQA 2IAAA 4WJKA 3OTTA 4NC4A 1B9YA 4BCDA 4ERZA 1O6GA 5C86A 4XEIC 5GXHA 3SN6B 4JD2C 2OVRB 2HJBA 4FA4D 4PC0A 1XKSA 3O4JA 4U1EI 3T3PA 4FA9D 2H9MA 4E54A 4J0WA 4PXWA 2VZ1A 2J57G 1VYHC 4JHNA 2YBAA 4L1MA 3I8CA 2G9AA 5E6RA 3MXXA 4ESGA 2VDPA 3ZE2A 4BL0A 1UOQA 2QZPA 2VDNA 5IT9g 2QC5A 5HE2B 2HYEA 3ZE0A 4A09A 1R5MA 1QFMA 3RMZD 4QQEA 5JWZA 4X63B 2B5MA 2TRCB 3PXWD 3V5WB 1YFQA 3W15A 3QHYB 5FXYA 5CYKB 5AJAA 4NSXA 1S4UX 2H47A 1JMZB 4D0KA 4FAND 3O4IA 3PVUB 3I2NA 4RE6A 1B9XA 3I89A 2BKLA 3I7OA 1E5TA 1VZ3A 3ZE1A 2EICA 4CZXA 3OKYB 2HKRA 5M5UA 3IUNA 5EMLB 1U2VC 4CI2A 5IJ8E 5HE1B 3RN1D 3MVDK 3DM0A 2VDRA 1E8NA 4PSXB 5H14A 1SQJA 4G56B 4FA5D 3J80g 4CI3A 3N0DA 1E8MA 3FM0A 2IURA 4QL1A 4GGCA 5FFGA 3UR4A 3V4PA 4JSNC 4BP9A 5CYKA 1GXRA 4KFMB 1A0RB 5CXBA 2HU7A 4L9OA 4G55A 5H17A 1OLZA 4A0AB 3SBQA 2AGWA 4J82A 4PBZA 5IJ7E 4GGDA 2Q7QA 3I7HA 4FWWA 3OKYA 5IGOA 3RFHA 2CO0C 2VDOA 5FKSA 5TEEA 1SQ9A 4O3UB 3BG1A 2HXCA 3IULA 2YNOA 5FKTA 3C9CA 4E54B 3I7LA 2H9PA 3ZDYA 3UVLA 3DDUA 5M5SA 1K3IA 2XE4A 3JPXA 4IA9A 4A2MA 4A7JA 1GOHA 5C2VB 3PXTD 2G99A 3SHFA 3V7DB 2VC2A 4Z7QA 3IURA 3C5MA 4A2LA 4ZN4A 5AMSA 4OWRA 5EAPA 5I5IA 4K3ID 3CIKB 2IUVA 3MKSB 4A0AA 1VZ2A 4E5ZA 4MMXA 2HKMA 1H2XA 2VDKA 3JAMg 3IJ0A 2HU8A 2P9IC 4LGNA 5K19A 1GOGA 3FCSA 2CN2A 1N6EA 3NIGA 5B4WA 2H6KA 4GMBA 1U8CA 4O1QD 5EMJB 5E6SA 4UM8A 3U4YA 4A0BB 1JTDB 3JB9L 3GREA 1TBGA 2P9KC 3HFQA 5EMKB 2Z2PA 3NVXA 4MMYA 4TZ4A 4DNVA 3I7PA 4NENA 4CZYA 4BH6A 2QR5A 4FA1D 2QXVA 3SFZA 4OZUA 4J81A 4G1MA 5THAA 2H14A 4O9DA 4FB1D 2Z2OA 3VI4A 3GC3B 3ZWLB 3JROA 2XDWA 2CE8A 1T2XA 3BG0A 5FQDA 3OL2A 1TYQC 3K26A 2I0SA 3K27A 2OVQB 4CC9A 1GOTB 3IJ1A 2IWKA 1C9IA 2JKXA 2XU7A 1XHMA 5CXBB 4X60B 2GC4A 2EIBA 3MKQA 4O3TB 3IKOA 3C99A 3ZDXA 4A0BA 3EQ9A 3IUQA 2O9KA 1PBYB 4DNWA 2PBIB 2OJYA 1QNIA 2IWFA 3A0FA 5EALA 4IRZA 3RSEC 4FAVD 5AFU3 1VE6A 3QI0A 3PXSD 2UZYB 3IJCA 4GQ1A 5M5RA 1JOFA 4GM8A 5TF2A 3E0CA 1RI6A 3UVKA 4LG9A 5GXIA 3EQ7A 4UI9R 5HDBA 2GNQA 3EI3B 5K1CC 4J0XA 5E6UA 1UTCA 2P9NC 3UVNA 4JXMA 4CY3A 2HJ4A 2HU5A 3CFSB 4L1QD 4NBMA 4J86A 1XIPA 3MUOA 3EU7A 2I0RA 4ZOYA 3V4VA 1O6FA 2EBSA 4A11B 1PGUA 2H13A 1H2ZA 4E5ZB 4GGAA 3SBPA 5EARA 5HE0B 2W18A 3MZLA 3ODTA 4YVDA 5I5JA 4AEZA 1Q47A 1N6DA 3MUNA 2I3TA 3OW8A 2AGLA 4J79A 1JMXB 4D9SA 4WK4A 3J81g 2I0TA 4U7AA 5TEFA 2BBKH 3EG6A 4JSPC 3DXMC 3EWEA 4O45A 3UKUC 5SXMA 1H2WA 3FCUA 4QRJA 1BPOA 2I3SA 3PSLA 3P4FA 3EI3A 1JV2A 2OK4A 3EI1B 2PM9B 2BCJB 1QFSA 5TDHB 2Z2NA 3AL8A 4IMMA 5FFOA 1K8KC 3AL9A 1GOFA 4AN1A 1UOPA 3OL2B 3K6SA 3CFVA 4A11A 1U4CA 3DWLC 3K72A 3F3GA 2CNXA 3O4GA 4Y7RA 2H9LA 3RLMD 1GP2B 1MDAH 2CO0A 5IGQA 3BWSA 2H68A 4Y5RD 4XYHA 1N6FA 2P9LC 2YMUA 4BCCA 3OKWA 4JSVC 2YB8B 2P9UC 3F3FA 3SBRA 1K32A 3K71A 3B7FA 4QAMA 4J77A 5C2WB
chains in the Genus database with same CATH topology
4L3HD 4CZVA 4CI1A 2P9PC 3EI1A 2PM9A 4PSWB 3SLED 4CY1A 5FLXg 2H6QA 1MG3A 2B4EA 2J55H 5FKQA 1PEVA 3UVOA 3JRPA 4GQ2P 5H1MA 1SHYB 1ERJA 4ERQA 4H5JA 1MG2A 4FHLA 5FA5B 2HESX 3KRWB 3UKRC 4ES0A 4ZOVA 2YNNA 1NEXB 3OKTA 4J8BA 3JZGA 4PBYA 3EI2A 4AOWA 1GG2B 2XL2A 2CN3A 3RN0D 3MZKA 4CY5A 5HE3B 2AQ5A 3V9FA 4JT5C 5C9ZB 4N14A 2MTAH 1FWXA 1PI6A 2AGYA 3DSMA 4QT8A 2OK6A 3EI4B 4X61B 2PM6B 4GQBB 1P22A 1OMWB 2IUPA 4J84A 5FKRA 4ZOZA 3VH0A 4J87A 2XL3A 4X3EA 3NVNA 3MMYA 3UVMA 3AL8B 4BUJC 3VA6A 5CXCB 5IC7A 5HQGA 3SCYA 3C75H 5EM2B 2CE9A 3JZHA 4K3JB 2H3XA 3VGZA 2J56H 4CY2A 3RFGA 3ULEC 4ERYA 3PSCB 3JZNA 5A2Qg 2GC7A 2AH1A 4JSXC 3AH8B 4ZOXA 4A08B 3DXKC 2H6NA 4R7AB 2XYIA 3L4MD 3SXTD 3NVQA 4J78A 4H5IA 4I79A 2UZXB 3N0EA 3EI4A 4J8GA 5I5MA 3GFCA 2OIZA 3SMRA 4PNKB 4GZ8A 4L3GD 4GM3A 3SWSD 3EMHA 4HDJA 4LG8A 3I7NA 5EMMB 2YNPA 4MK0B 5CXCA 1NR0A 5KDOB 4CI8A 2PM7B 5GSAA 5EM2A 3I7KA 2P9SC 3I8EA 3L4OD 3ORVD 3FGBA 3PE7A 2OVPB 3AFCA 3SJLD 5HYNB 2IUQA 1L0QA 3IIWA 2B5LA 3SVWD 3IIYA 4GM9A 2AGZA 5EAMA 1JJUB 4A08A 4JT6C 4J73A 2B5NA 4A09B 2AH0A 3FRXA 4XYIA 3KRXB 2AGXA 4Z8LA 3EI2B 5GMKn 3F3PA 4D6VA 2H9NA 4EWRA 3RRMC 3PVWB 2IAAA 3OTTA 1B9YA 4ERZA 4XEIC 5GXHA 3SN6B 4JD2C 2OVRB 2HJBA 4FA4D 4PC0A 1XKSA 4U1EI 4FA9D 2H9MA 4E54A 4J0WA 4PXWA 2J57G 1VYHC 2YBAA 3I8CA 2G9AA 4ESGA 3MXXA 4BL0A 5IT9g 2QC5A 5HE2B 2HYEA 4A09A 1R5MA 3RMZD 4QQEA 5JWZA 4X63B 2B5MA 2TRCB 3PXWD 3V5WB 1YFQA 3W15A 5FXYA 5CYKB 5AJAA 4NSXA 1S4UX 2H47A 1JMZB 4D0KA 4FAND 3PVUB 3I2NA 1B9XA 3I89A 3I7OA 4CZXA 3OKYB 2HKRA 5EMLB 1U2VC 4CI2A 5IJ8E 5HE1B 3RN1D 3DM0A 4PSXB 5H14A 1SQJA 4G56B 4FA5D 3J80g 4CI3A 3N0DA 3FM0A 4QL1A 2IURA 4GGCA 3UR4A 4JSNC 5CYKA 1GXRA 4KFMB 1A0RB 5CXBA 4L9OA 5H17A 1OLZA 4A0AB 3SBQA 2AGWA 4J82A 4PBZA 5IJ7E 4GGDA 2Q7QA 3I7HA 4FWWA 3OKYA 5IGOA 3RFHA 2CO0C 5FKSA 5TEEA 1SQ9A 4O3UB 3BG1A 2HXCA 2YNOA 5FKTA 3C9CA 4E54B 3I7LA 2H9PA 3UVLA 3JPXA 4IA9A 4A2MA 4A7JA 5C2VB 3PXTD 2G99A 3SHFA 3V7DB 3C5MA 4A2LA 4ZN4A 5AMSA 4OWRA 5EAPA 5I5IA 4K3ID 3CIKB 2IUVA 3MKSB 4A0AA 4E5ZA 2HKMA 3JAMg 3IJ0A 2P9IC 4LGNA 5K19A 2CN2A 1N6EA 5B4WA 2H6KA 4GMBA 4O1QD 5EMJB 3JB9L 3U4YA 4A0BB 3GREA 1TBGA 2P9KC 3HFQA 5EMKB 2Z2PA 3NVXA 4TZ4A 3I7PA 4CZYA 4BH6A 4FA1D 2QXVA 3SFZA 4OZUA 4J81A 5THAA 2H14A 4O9DA 4FB1D 2Z2OA 3ZWLB 3JROA 2CE8A 3BG0A 5FQDA 3OL2A 1TYQC 3K26A 2I0SA 3K27A 2OVQB 4CC9A 1GOTB 3IJ1A 2IWKA 2XU7A 1XHMA 5CXBB 4X60B 2GC4A 3MKQA 4O3TB 3IKOA 3C99A 4A0BA 2O9KA 1PBYB 2PBIB 2OJYA 1QNIA 2IWFA 3A0FA 5EALA 3RSEC 4FAVD 5AFU3 3PXSD 2UZYB 3IJCA 4GQ1A 1JOFA 4GM8A 5TF2A 3E0CA 1RI6A 3UVKA 4LG9A 5GXIA 4UI9R 2GNQA 3EI3B 5K1CC 4J0XA 2P9NC 3UVNA 4JXMA 4CY3A 2HJ4A 3CFSB 4L1QD 4J86A 1XIPA 3EU7A 2I0RA 4ZOYA 2EBSA 4A11B 1PGUA 2H13A 4E5ZB 4GGAA 3SBPA 5EARA 5HE0B 2W18A 3MZLA 3ODTA 4YVDA 5I5JA 4AEZA 1Q47A 1N6DA 2I3TA 3OW8A 2AGLA 4J79A 1JMXB 3J81g 2I0TA 4U7AA 5TEFA 2BBKH 3EG6A 4JSPC 3DXMC 3EWEA 4O45A 3UKUC 5SXMA 4QRJA 2I3SA 3PSLA 3P4FA 3EI3A 2OK4A 3EI1B 2PM9B 2BCJB 5TDHB 2Z2NA 3AL8A 4IMMA 1K8KC 3AL9A 3OL2B 3CFVA 4A11A 1U4CA 3DWLC 4Y7RA 3F3GA 2CNXA 3RLMD 2H9LA 1GP2B 1MDAH 2CO0A 5IGQA 3BWSA 2H68A 4Y5RD 4XYHA 1N6FA 2P9LC 2YMUA 3OKWA 4JSVC 2YB8B 2P9UC 3F3FA 3SBRA 1K32A 3B7FA 4J77A 5C2WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3H D;  4CZV A;  4CI1 A;  2P9P C;  3EI1 A;  2PM9 A;  4PSW B;  3SLE D;  4CY1 A;  5FLX g;  2H6Q A;  1MG3 A;  2B4E A;  2J55 H;  5FKQ A;  1PEV A;  3UVO A;  3JRP A;  4GQ2 P;  5H1M A;  1SHY B;  1ERJ A;  4ERQ A;  4H5J A;  1MG2 A;  4FHL A;  5FA5 B;  2HES X;  3KRW B;  3UKR C;  4ES0 A;  4ZOV A;  2YNN A;  1NEX B;  3OKT A;  4J8B A;  3JZG A;  4PBY A;  3EI2 A;  4AOW A;  1GG2 B;  2XL2 A;  2CN3 A;  3RN0 D;  3MZK A;  4CY5 A;  5HE3 B;  2AQ5 A;  3V9F A;  4JT5 C;  5C9Z B;  4N14 A;  2MTA H;  1FWX A;  1PI6 A;  2AGY A;  3DSM A;  4QT8 A;  2OK6 A;  3EI4 B;  4X61 B;  2PM6 B;  4GQB B;  1P22 A;  1OMW B;  2IUP A;  4J84 A;  5FKR A;  4ZOZ A;  3VH0 A;  4J87 A;  2XL3 A;  4X3E A;  3NVN A;  3MMY A;  3UVM A;  3AL8 B;  4BUJ C;  3VA6 A;  5CXC B;  5IC7 A;  5HQG A;  3SCY A;  3C75 H;  5EM2 B;  2CE9 A;  3JZH A;  4K3J B;  2H3X A;  3VGZ A;  2J56 H;  4CY2 A;  3RFG A;  3ULE C;  4ERY A;  3PSC B;  3JZN A;  5A2Q g;  2GC7 A;  2AH1 A;  4JSX C;  3AH8 B;  4ZOX A;  4A08 B;  3DXK C;  2H6N A;  4R7A B;  2XYI A;  3L4M D;  3SXT D;  3NVQ A;  4J78 A;  4H5I A;  4I79 A;  2UZX B;  3N0E A;  3EI4 A;  4J8G A;  5I5M A;  3GFC A;  2OIZ A;  3SMR A;  4PNK B;  4GZ8 A;  4L3G D;  4GM3 A;  3SWS D;  3EMH A;  4HDJ A;  4LG8 A;  3I7N A;  5EMM B;  2YNP A;  4MK0 B;  5CXC A;  1NR0 A;  5KDO B;  4CI8 A;  2PM7 B;  5GSA A;  5EM2 A;  3I7K A;  2P9S C;  3I8E A;  3L4O D;  3ORV D;  3FGB A;  3PE7 A;  2OVP B;  3AFC A;  3SJL D;  5HYN B;  2IUQ A;  1L0Q A;  3IIW A;  2B5L A;  3SVW D;  3IIY A;  4GM9 A;  2AGZ A;  5EAM A;  1JJU B;  4A08 A;  4JT6 C;  4J73 A;  2B5N A;  4A09 B;  2AH0 A;  3FRX A;  4XYI A;  3KRX B;  2AGX A;  4Z8L A;  3EI2 B;  5GMK n;  3F3P A;  4D6V A;  2H9N A;  4EWR A;  3RRM C;  3PVW B;  2IAA A;  3OTT A;  1B9Y A;  4ERZ A;  4XEI C;  5GXH A;  3SN6 B;  4JD2 C;  2OVR B;  2HJB A;  4FA4 D;  4PC0 A;  1XKS A;  4U1E I;  4FA9 D;  2H9M A;  4E54 A;  4J0W A;  4PXW A;  2J57 G;  1VYH C;  2YBA A;  3I8C A;  2G9A A;  4ESG A;  3MXX A;  4BL0 A;  5IT9 g;  2QC5 A;  5HE2 B;  2HYE A;  4A09 A;  1R5M A;  3RMZ D;  4QQE A;  5JWZ A;  4X63 B;  2B5M A;  2TRC B;  3PXW D;  3V5W B;  1YFQ A;  3W15 A;  5FXY A;  5CYK B;  5AJA A;  4NSX A;  1S4U X;  2H47 A;  1JMZ B;  4D0K A;  4FAN D;  3PVU B;  3I2N A;  1B9X A;  3I89 A;  3I7O A;  4CZX A;  3OKY B;  2HKR A;  5EML B;  1U2V C;  4CI2 A;  5IJ8 E;  5HE1 B;  3RN1 D;  3DM0 A;  4PSX B;  5H14 A;  1SQJ A;  4G56 B;  4FA5 D;  3J80 g;  4CI3 A;  3N0D A;  3FM0 A;  4QL1 A;  2IUR A;  4GGC A;  3UR4 A;  4JSN C;  5CYK A;  1GXR A;  4KFM B;  1A0R B;  5CXB A;  4L9O A;  5H17 A;  1OLZ A;  4A0A B;  3SBQ A;  2AGW A;  4J82 A;  4PBZ A;  5IJ7 E;  4GGD A;  2Q7Q A;  3I7H A;  4FWW A;  3OKY A;  5IGO A;  3RFH A;  2CO0 C;  5FKS A;  5TEE A;  1SQ9 A;  4O3U B;  3BG1 A;  2HXC A;  2YNO A;  5FKT A;  3C9C A;  4E54 B;  3I7L A;  2H9P A;  3UVL A;  3JPX A;  4IA9 A;  4A2M A;  4A7J A;  5C2V B;  3PXT D;  2G99 A;  3SHF A;  3V7D B;  3C5M A;  4A2L A;  4ZN4 A;  5AMS A;  4OWR A;  5EAP A;  5I5I A;  4K3I D;  3CIK B;  2IUV A;  3MKS B;  4A0A A;  4E5Z A;  2HKM A;  3JAM g;  3IJ0 A;  2P9I C;  4LGN A;  5K19 A;  2CN2 A;  1N6E A;  5B4W A;  2H6K A;  4GMB A;  4O1Q D;  5EMJ B;  3JB9 L;  3U4Y A;  4A0B B;  3GRE A;  1TBG A;  2P9K C;  3HFQ A;  5EMK B;  2Z2P A;  3NVX A;  4TZ4 A;  3I7P A;  4CZY A;  4BH6 A;  4FA1 D;  2QXV A;  3SFZ A;  4OZU A;  4J81 A;  5THA A;  2H14 A;  4O9D A;  4FB1 D;  2Z2O A;  3ZWL B;  3JRO A;  2CE8 A;  3BG0 A;  5FQD A;  3OL2 A;  1TYQ C;  3K26 A;  2I0S A;  3K27 A;  2OVQ B;  4CC9 A;  1GOT B;  3IJ1 A;  2IWK A;  2XU7 A;  1XHM A;  5CXB B;  4X60 B;  2GC4 A;  3MKQ A;  4O3T B;  3IKO A;  3C99 A;  4A0B A;  2O9K A;  1PBY B;  2PBI B;  2OJY A;  1QNI A;  2IWF A;  3A0F A;  5EAL A;  3RSE C;  4FAV D;  5AFU 3;  3PXS D;  2UZY B;  3IJC A;  4GQ1 A;  1JOF A;  4GM8 A;  5TF2 A;  3E0C A;  1RI6 A;  3UVK A;  4LG9 A;  5GXI A;  4UI9 R;  2GNQ A;  3EI3 B;  5K1C C;  4J0X A;  2P9N C;  3UVN A;  4JXM A;  4CY3 A;  2HJ4 A;  3CFS B;  4L1Q D;  4J86 A;  1XIP A;  3EU7 A;  2I0R A;  4ZOY A;  2EBS A;  4A11 B;  1PGU A;  2H13 A;  4E5Z B;  4GGA A;  3SBP A;  5EAR A;  5HE0 B;  2W18 A;  3MZL A;  3ODT A;  4YVD A;  5I5J A;  4AEZ A;  1Q47 A;  1N6D A;  2I3T A;  3OW8 A;  2AGL A;  4J79 A;  1JMX B;  3J81 g;  2I0T A;  4U7A A;  5TEF A;  2BBK H;  3EG6 A;  4JSP C;  3DXM C;  3EWE A;  4O45 A;  3UKU C;  5SXM A;  4QRJ A;  2I3S A;  3PSL A;  3P4F A;  3EI3 A;  2OK4 A;  3EI1 B;  2PM9 B;  2BCJ B;  5TDH B;  2Z2N A;  3AL8 A;  4IMM A;  1K8K C;  3AL9 A;  3OL2 B;  3CFV A;  4A11 A;  1U4C A;  3DWL C;  4Y7R A;  3F3G A;  2CNX A;  3RLM D;  2H9L A;  1GP2 B;  1MDA H;  2CO0 A;  5IGQ A;  3BWS A;  2H68 A;  4Y5R D;  4XYH A;  1N6F A;  2P9L C;  2YMU A;  3OKW A;  4JSV C;  2YB8 B;  2P9U C;  3F3F A;  3SBR A;  1K32 A;  3B7F A;  4J77 A;  5C2W B; 
#chains in the Genus database with same CATH topology
 4L3H D;  4CZV A;  4CI1 A;  1H2Y A;  4G1E A;  2VDM A;  4UM9 A;  2P9P C;  3EI1 A;  3EQ8 A;  2PM9 A;  4JHP C;  4AMZ A;  4PSW B;  5M5V A;  3SLE D;  4CY1 A;  5FLX g;  2H6Q A;  1MG3 A;  2B4E A;  2J55 H;  5FKQ A;  1VE7 A;  1PEV A;  3UVO A;  3IJE A;  4AMY A;  3JRP A;  4GQ2 P;  5H1M A;  4BP8 A;  1SHY B;  1ERJ A;  3ZDZ A;  4ERQ A;  4H5J A;  2VDL A;  1MG2 A;  4FHL A;  5FA5 B;  2HES X;  3KRW B;  3UKR C;  4ES0 A;  3IVM A;  4ZOV A;  2YNN A;  1NEX B;  3OKT A;  4J8B A;  3JZG A;  4PBY A;  3EI2 A;  4AOW A;  1GG2 B;  2XL2 A;  2CN3 A;  3GD1 I;  3RN0 D;  3MZK A;  4Z7N A;  4CY5 A;  5HE3 B;  2AQ5 A;  3V9F A;  4JT5 C;  5C9Z B;  2WQ8 A;  2MTA H;  4N14 A;  1FWX A;  1PI6 A;  2AGY A;  3DSM A;  3OF7 A;  1YR2 A;  4QT8 A;  2OK6 A;  3EI4 B;  4X61 B;  2PM6 B;  4GQB B;  1P22 A;  2EIE A;  1OMW B;  2IUP A;  4J84 A;  5FKR A;  4ZOZ A;  3VH0 A;  4J87 A;  2XL3 A;  4X3E A;  1UOO A;  4Z7O A;  3NVN A;  3MMY A;  3T3M A;  3UVM A;  3AL8 B;  5M61 A;  4BUJ C;  3VA6 A;  5CXC B;  5IC7 A;  5HQG A;  3SCY A;  3C75 H;  5EM2 B;  2CE9 A;  3JZH A;  1C9L A;  4K3J B;  3O4H A;  2H3X A;  3VGZ A;  2J56 H;  4CY2 A;  3RFG A;  4O02 A;  3ULE C;  4ERY A;  3PSC B;  3JZN A;  5A2Q g;  2GC7 A;  2AH1 A;  1A12 A;  4JSX C;  3AH8 B;  4WK0 A;  4ZOX A;  4A08 B;  1I2M B;  2H6N A;  3DXK C;  4R7A B;  2XYI A;  3L4M D;  3SXT D;  2XZG A;  3NVQ A;  4J78 A;  4H5I A;  4I79 A;  2UZX B;  3N0E A;  2VZ3 A;  3EI4 A;  4O2W A;  4WK2 A;  4J8G A;  4DNU A;  5I5M A;  3GFC A;  2OIZ A;  2EID A;  4PNK B;  4GZ8 A;  3SMR A;  4AX4 A;  3NIF A;  4L3G D;  3VI3 A;  4GM3 A;  3KCI A;  3SWS D;  3EMH A;  4HDJ A;  4LG8 A;  3I7N A;  5EMM B;  1M1X A;  2YNP A;  4MK0 B;  5CXC A;  1NR0 A;  5KDO B;  4CI8 A;  2PM7 B;  5GSA A;  5EM2 A;  3I7K A;  1L5G A;  2P9S C;  4NAA A;  3I8E A;  3L4O D;  3IUM A;  3ORV D;  3FGB A;  3PE7 A;  2OVP B;  1TYE A;  5C92 A;  3IUJ A;  3AFC A;  3SJL D;  5HYN B;  2IUQ A;  1L0Q A;  3IIW A;  4MMZ A;  2B5L A;  3SVW D;  3IIY A;  4GM9 A;  2AGZ A;  5EAM A;  1JJU B;  4A08 A;  4JT6 C;  4J73 A;  2B5N A;  4A09 B;  2AH0 A;  4RE5 A;  3FRX A;  4XYI A;  5M5T A;  3KRX B;  2AGX A;  4Z8L A;  4AN0 A;  3EI2 B;  5GMK n;  3F3P A;  4D6V A;  4BCB A;  2H9N A;  4EWR A;  3RRM C;  3PVW B;  3NID A;  2VDQ A;  2IAA A;  4WJK A;  3OTT A;  4NC4 A;  1B9Y A;  4BCD A;  4ERZ A;  1O6G A;  5C86 A;  4XEI C;  5GXH A;  3SN6 B;  4JD2 C;  2OVR B;  2HJB A;  4FA4 D;  4PC0 A;  1XKS A;  3O4J A;  4U1E I;  3T3P A;  4FA9 D;  2H9M A;  4E54 A;  4J0W A;  4PXW A;  2VZ1 A;  2J57 G;  1VYH C;  4JHN A;  2YBA A;  4L1M A;  3I8C A;  2G9A A;  5E6R A;  3MXX A;  4ESG A;  2VDP A;  3ZE2 A;  4BL0 A;  1UOQ A;  2QZP A;  2VDN A;  5IT9 g;  2QC5 A;  5HE2 B;  2HYE A;  3ZE0 A;  4A09 A;  1R5M A;  1QFM A;  3RMZ D;  4QQE A;  5JWZ A;  4X63 B;  2B5M A;  2TRC B;  3PXW D;  3V5W B;  1YFQ A;  3W15 A;  3QHY B;  5FXY A;  5CYK B;  5AJA A;  4NSX A;  1S4U X;  2H47 A;  1JMZ B;  4D0K A;  4FAN D;  3O4I A;  3PVU B;  3I2N A;  4RE6 A;  1B9X A;  3I89 A;  2BKL A;  3I7O A;  1E5T A;  1VZ3 A;  3ZE1 A;  2EIC A;  4CZX A;  3OKY B;  2HKR A;  5M5U A;  3IUN A;  5EML B;  1U2V C;  4CI2 A;  5IJ8 E;  5HE1 B;  3RN1 D;  3MVD K;  3DM0 A;  2VDR A;  1E8N A;  4PSX B;  5H14 A;  1SQJ A;  4G56 B;  4FA5 D;  3J80 g;  4CI3 A;  3N0D A;  1E8M A;  3FM0 A;  2IUR A;  4QL1 A;  4GGC A;  5FFG A;  3UR4 A;  3V4P A;  4JSN C;  4BP9 A;  5CYK A;  1GXR A;  4KFM B;  1A0R B;  5CXB A;  2HU7 A;  4L9O A;  4G55 A;  5H17 A;  1OLZ A;  4A0A B;  3SBQ A;  2AGW A;  4J82 A;  4PBZ A;  5IJ7 E;  4GGD A;  2Q7Q A;  3I7H A;  4FWW A;  3OKY A;  5IGO A;  3RFH A;  2CO0 C;  2VDO A;  5FKS A;  5TEE A;  1SQ9 A;  4O3U B;  3BG1 A;  2HXC A;  3IUL A;  2YNO A;  5FKT A;  3C9C A;  4E54 B;  3I7L A;  2H9P A;  3ZDY A;  3UVL A;  3DDU A;  5M5S A;  1K3I A;  2XE4 A;  3JPX A;  4IA9 A;  4A2M A;  4A7J A;  1GOH A;  5C2V B;  3PXT D;  2G99 A;  3SHF A;  3V7D B;  2VC2 A;  4Z7Q A;  3IUR A;  3C5M A;  4A2L A;  4ZN4 A;  5AMS A;  4OWR A;  5EAP A;  5I5I A;  4K3I D;  3CIK B;  2IUV A;  3MKS B;  4A0A A;  1VZ2 A;  4E5Z A;  4MMX A;  2HKM A;  1H2X A;  2VDK A;  3JAM g;  3IJ0 A;  2HU8 A;  2P9I C;  4LGN A;  5K19 A;  1GOG A;  3FCS A;  2CN2 A;  1N6E A;  3NIG A;  5B4W A;  2H6K A;  4GMB A;  1U8C A;  4O1Q D;  5EMJ B;  5E6S A;  4UM8 A;  3U4Y A;  4A0B B;  1JTD B;  3JB9 L;  3GRE A;  1TBG A;  2P9K C;  3HFQ A;  5EMK B;  2Z2P A;  3NVX A;  4MMY A;  4TZ4 A;  4DNV A;  3I7P A;  4NEN A;  4CZY A;  4BH6 A;  2QR5 A;  4FA1 D;  2QXV A;  3SFZ A;  4OZU A;  4J81 A;  4G1M A;  5THA A;  2H14 A;  4O9D A;  4FB1 D;  2Z2O A;  3VI4 A;  3GC3 B;  3ZWL B;  3JRO A;  2XDW A;  2CE8 A;  1T2X A;  3BG0 A;  5FQD A;  3OL2 A;  1TYQ C;  3K26 A;  2I0S A;  3K27 A;  2OVQ B;  4CC9 A;  1GOT B;  3IJ1 A;  2IWK A;  1C9I A;  2JKX A;  2XU7 A;  1XHM A;  5CXB B;  4X60 B;  2GC4 A;  2EIB A;  3MKQ A;  4O3T B;  3IKO A;  3C99 A;  3ZDX A;  4A0B A;  3EQ9 A;  3IUQ A;  2O9K A;  1PBY B;  4DNW A;  2PBI B;  2OJY A;  1QNI A;  2IWF A;  3A0F A;  5EAL A;  4IRZ A;  3RSE C;  4FAV D;  5AFU 3;  1VE6 A;  3QI0 A;  3PXS D;  2UZY B;  3IJC A;  4GQ1 A;  5M5R A;  1JOF A;  4GM8 A;  5TF2 A;  3E0C A;  1RI6 A;  3UVK A;  4LG9 A;  5GXI A;  3EQ7 A;  4UI9 R;  5HDB A;  2GNQ A;  3EI3 B;  5K1C C;  4J0X A;  5E6U A;  1UTC A;  2P9N C;  3UVN A;  4JXM A;  4CY3 A;  2HJ4 A;  2HU5 A;  3CFS B;  4L1Q D;  4NBM A;  4J86 A;  1XIP A;  3MUO A;  3EU7 A;  2I0R A;  4ZOY A;  3V4V A;  1O6F A;  2EBS A;  4A11 B;  1PGU A;  2H13 A;  1H2Z A;  4E5Z B;  4GGA A;  3SBP A;  5EAR A;  5HE0 B;  2W18 A;  3MZL A;  3ODT A;  4YVD A;  5I5J A;  4AEZ A;  1Q47 A;  1N6D A;  3MUN A;  2I3T A;  3OW8 A;  2AGL A;  4J79 A;  1JMX B;  4D9S A;  4WK4 A;  3J81 g;  2I0T A;  4U7A A;  5TEF A;  2BBK H;  3EG6 A;  4JSP C;  3DXM C;  3EWE A;  4O45 A;  3UKU C;  5SXM A;  1H2W A;  3FCU A;  4QRJ A;  1BPO A;  2I3S A;  3PSL A;  3P4F A;  3EI3 A;  1JV2 A;  2OK4 A;  3EI1 B;  2PM9 B;  2BCJ B;  1QFS A;  5TDH B;  2Z2N A;  3AL8 A;  4IMM A;  5FFO A;  1K8K C;  3AL9 A;  1GOF A;  4AN1 A;  1UOP A;  3OL2 B;  3K6S A;  3CFV A;  4A11 A;  1U4C A;  3DWL C;  3K72 A;  3F3G A;  2CNX A;  3O4G A;  4Y7R A;  2H9L A;  3RLM D;  1GP2 B;  1MDA H;  2CO0 A;  5IGQ A;  3BWS A;  2H68 A;  4Y5R D;  4XYH A;  1N6F A;  2P9L C;  2YMU A;  4BCC A;  3OKW A;  4JSV C;  2YB8 B;  2P9U C;  3F3F A;  3SBR A;  1K32 A;  3K71 A;  3B7F A;  4QAM A;  4J77 A;  5C2W B; 
#chains in the Genus database with same CATH homology
 4L3H D;  4CZV A;  4CI1 A;  2P9P C;  3EI1 A;  2PM9 A;  4PSW B;  3SLE D;  4CY1 A;  5FLX g;  2H6Q A;  1MG3 A;  2B4E A;  2J55 H;  5FKQ A;  1PEV A;  3UVO A;  3JRP A;  4GQ2 P;  5H1M A;  1SHY B;  1ERJ A;  4ERQ A;  4H5J A;  1MG2 A;  4FHL A;  5FA5 B;  2HES X;  3KRW B;  3UKR C;  4ES0 A;  4ZOV A;  2YNN A;  1NEX B;  3OKT A;  4J8B A;  3JZG A;  4PBY A;  3EI2 A;  4AOW A;  1GG2 B;  2XL2 A;  2CN3 A;  3RN0 D;  3MZK A;  4CY5 A;  5HE3 B;  2AQ5 A;  3V9F A;  4JT5 C;  5C9Z B;  4N14 A;  2MTA H;  1FWX A;  1PI6 A;  2AGY A;  3DSM A;  4QT8 A;  2OK6 A;  3EI4 B;  4X61 B;  2PM6 B;  4GQB B;  1P22 A;  1OMW B;  2IUP A;  4J84 A;  5FKR A;  4ZOZ A;  3VH0 A;  4J87 A;  2XL3 A;  4X3E A;  3NVN A;  3MMY A;  3UVM A;  3AL8 B;  4BUJ C;  3VA6 A;  5CXC B;  5IC7 A;  5HQG A;  3SCY A;  3C75 H;  5EM2 B;  2CE9 A;  3JZH A;  4K3J B;  2H3X A;  3VGZ A;  2J56 H;  4CY2 A;  3RFG A;  3ULE C;  4ERY A;  3PSC B;  3JZN A;  5A2Q g;  2GC7 A;  2AH1 A;  4JSX C;  3AH8 B;  4ZOX A;  4A08 B;  3DXK C;  2H6N A;  4R7A B;  2XYI A;  3L4M D;  3SXT D;  3NVQ A;  4J78 A;  4H5I A;  4I79 A;  2UZX B;  3N0E A;  3EI4 A;  4J8G A;  5I5M A;  3GFC A;  2OIZ A;  3SMR A;  4PNK B;  4GZ8 A;  4L3G D;  4GM3 A;  3SWS D;  3EMH A;  4HDJ A;  4LG8 A;  3I7N A;  5EMM B;  2YNP A;  4MK0 B;  5CXC A;  1NR0 A;  5KDO B;  4CI8 A;  2PM7 B;  5GSA A;  5EM2 A;  3I7K A;  2P9S C;  3I8E A;  3L4O D;  3ORV D;  3FGB A;  3PE7 A;  2OVP B;  3AFC A;  3SJL D;  5HYN B;  2IUQ A;  1L0Q A;  3IIW A;  2B5L A;  3SVW D;  3IIY A;  4GM9 A;  2AGZ A;  5EAM A;  1JJU B;  4A08 A;  4JT6 C;  4J73 A;  2B5N A;  4A09 B;  2AH0 A;  3FRX A;  4XYI A;  3KRX B;  2AGX A;  4Z8L A;  3EI2 B;  5GMK n;  3F3P A;  4D6V A;  2H9N A;  4EWR A;  3RRM C;  3PVW B;  2IAA A;  3OTT A;  1B9Y A;  4ERZ A;  4XEI C;  5GXH A;  3SN6 B;  4JD2 C;  2OVR B;  2HJB A;  4FA4 D;  4PC0 A;  1XKS A;  4U1E I;  4FA9 D;  2H9M A;  4E54 A;  4J0W A;  4PXW A;  2J57 G;  1VYH C;  2YBA A;  3I8C A;  2G9A A;  4ESG A;  3MXX A;  4BL0 A;  5IT9 g;  2QC5 A;  5HE2 B;  2HYE A;  4A09 A;  1R5M A;  3RMZ D;  4QQE A;  5JWZ A;  4X63 B;  2B5M A;  2TRC B;  3PXW D;  3V5W B;  1YFQ A;  3W15 A;  5FXY A;  5CYK B;  5AJA A;  4NSX A;  1S4U X;  2H47 A;  1JMZ B;  4D0K A;  4FAN D;  3PVU B;  3I2N A;  1B9X A;  3I89 A;  3I7O A;  4CZX A;  3OKY B;  2HKR A;  5EML B;  1U2V C;  4CI2 A;  5IJ8 E;  5HE1 B;  3RN1 D;  3DM0 A;  4PSX B;  5H14 A;  1SQJ A;  4G56 B;  4FA5 D;  3J80 g;  4CI3 A;  3N0D A;  3FM0 A;  4QL1 A;  2IUR A;  4GGC A;  3UR4 A;  4JSN C;  5CYK A;  1GXR A;  4KFM B;  1A0R B;  5CXB A;  4L9O A;  5H17 A;  1OLZ A;  4A0A B;  3SBQ A;  2AGW A;  4J82 A;  4PBZ A;  5IJ7 E;  4GGD A;  2Q7Q A;  3I7H A;  4FWW A;  3OKY A;  5IGO A;  3RFH A;  2CO0 C;  5FKS A;  5TEE A;  1SQ9 A;  4O3U B;  3BG1 A;  2HXC A;  2YNO A;  5FKT A;  3C9C A;  4E54 B;  3I7L A;  2H9P A;  3UVL A;  3JPX A;  4IA9 A;  4A2M A;  4A7J A;  5C2V B;  3PXT D;  2G99 A;  3SHF A;  3V7D B;  3C5M A;  4A2L A;  4ZN4 A;  5AMS A;  4OWR A;  5EAP A;  5I5I A;  4K3I D;  3CIK B;  2IUV A;  3MKS B;  4A0A A;  4E5Z A;  2HKM A;  3JAM g;  3IJ0 A;  2P9I C;  4LGN A;  5K19 A;  2CN2 A;  1N6E A;  5B4W A;  2H6K A;  4GMB A;  4O1Q D;  5EMJ B;  3JB9 L;  3U4Y A;  4A0B B;  3GRE A;  1TBG A;  2P9K C;  3HFQ A;  5EMK B;  2Z2P A;  3NVX A;  4TZ4 A;  3I7P A;  4CZY A;  4BH6 A;  4FA1 D;  2QXV A;  3SFZ A;  4OZU A;  4J81 A;  5THA A;  2H14 A;  4O9D A;  4FB1 D;  2Z2O A;  3ZWL B;  3JRO A;  2CE8 A;  3BG0 A;  5FQD A;  3OL2 A;  1TYQ C;  3K26 A;  2I0S A;  3K27 A;  2OVQ B;  4CC9 A;  1GOT B;  3IJ1 A;  2IWK A;  2XU7 A;  1XHM A;  5CXB B;  4X60 B;  2GC4 A;  3MKQ A;  4O3T B;  3IKO A;  3C99 A;  4A0B A;  2O9K A;  1PBY B;  2PBI B;  2OJY A;  1QNI A;  2IWF A;  3A0F A;  5EAL A;  3RSE C;  4FAV D;  5AFU 3;  3PXS D;  2UZY B;  3IJC A;  4GQ1 A;  1JOF A;  4GM8 A;  5TF2 A;  3E0C A;  1RI6 A;  3UVK A;  4LG9 A;  5GXI A;  4UI9 R;  2GNQ A;  3EI3 B;  5K1C C;  4J0X A;  2P9N C;  3UVN A;  4JXM A;  4CY3 A;  2HJ4 A;  3CFS B;  4L1Q D;  4J86 A;  1XIP A;  3EU7 A;  2I0R A;  4ZOY A;  2EBS A;  4A11 B;  1PGU A;  2H13 A;  4E5Z B;  4GGA A;  3SBP A;  5EAR A;  5HE0 B;  2W18 A;  3MZL A;  3ODT A;  4YVD A;  5I5J A;  4AEZ A;  1Q47 A;  1N6D A;  2I3T A;  3OW8 A;  2AGL A;  4J79 A;  1JMX B;  3J81 g;  2I0T A;  4U7A A;  5TEF A;  2BBK H;  3EG6 A;  4JSP C;  3DXM C;  3EWE A;  4O45 A;  3UKU C;  5SXM A;  4QRJ A;  2I3S A;  3PSL A;  3P4F A;  3EI3 A;  2OK4 A;  3EI1 B;  2PM9 B;  2BCJ B;  5TDH B;  2Z2N A;  3AL8 A;  4IMM A;  1K8K C;  3AL9 A;  3OL2 B;  3CFV A;  4A11 A;  1U4C A;  3DWL C;  4Y7R A;  3F3G A;  2CNX A;  3RLM D;  2H9L A;  1GP2 B;  1MDA H;  2CO0 A;  5IGQ A;  3BWS A;  2H68 A;  4Y5R D;  4XYH A;  1N6F A;  2P9L C;  2YMU A;  3OKW A;  4JSV C;  2YB8 B;  2P9U C;  3F3F A;  3SBR A;  1K32 A;  3B7F A;  4J77 A;  5C2W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...