2HKRA

Structures of the carbinolamine and schiff-base intermediates in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with p-methoxyphenylethylamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase, small subunit
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hkrA01
4OZUA 2XL2A 3OL2B 2HESX 2GC7A 4ERYA 4CC9A 5EARA 3ODTA 2H9LA 4L1QD 3C5MA 4Z8LA 5GMKn 4Y5RD 2G99A 3PXSD 2XL3A 4J84A 3C9CA 3C75H 3IKOA 3PVWB 5I5JA 4CI8A 3BG1A 3I7KA 3BWSA 2IWFA 1YFQA 3EI2A 2I3TA 3CFSB 2CNXA 1N6DA 2P9LC 5HE1B 2H6NA 3VA6A 2H14A 4GM3A 2YNNA 2OVQB 4PXWA 2H6QA 3VGZA 4A11B 4PC0A 2IUPA 3I7LA 5FQDA 4ES0A 3AL9A 2PBIB 4LG9A 1SHYB 2IUQA 3HFQA 2OVPB 3PXTD 4I79A 2Z2PA 5AJAA 2B5NA 4AOWA 4FA5D 4JT6C 3A0FA 1RI6A 3SBRA 3IJ1A 2I0RA 2GC4A 3GREA 1SQ9A 4A08A 4GQBB 2O9KA 4XYHA 5H14A 4CY3A 3SVWD 4PNKB 5CXCB 3SMRA 3OL2A 2AH0A 1ERJA 2MTAH 5CYKB 3E0CA 4CZVA 1JOFA 2YB8B 4YVDA 3SLED 3V5WB 3W15A 3I89A 4K3JB 5IT9g 4QRJA 2I0TA 5CXCA 5EMKB 4JSPC 3IIWA 4ZOXA 3RFGA 4JSNC 3IIYA 4A2MA 4FHLA 4J87A 2YNPA 3EI1B 4A0AA 4J81A 4FWWA 3JROA 4UI9R 4U1EI 1U2VC 2H9PA 2H47A 4QT8A 2AGXA 4QQEA 1MDAH 5I5IA 4X3EA 2H9MA 5IC7A 3I8EA 3J80g 5B4WA 4CI2A 5K1CC 3AFCA 2P9IC 3F3FA 4J8GA 2YNOA 3MKSB 1MG3A 4O3UB 3OKWA 4JT5C 3K26A 2P9NC 3RN1D 2B5LA 4E54A 3OKTA 3RFHA 5EM2B 3U4YA 2Z2OA 3V9FA 3I7PA 3JPXA 4E5ZA 1QNIA 1U4CA 4CY1A 1JJUB 4A09B 3PSLA 3JZNA 5EALA 4BH6A 3L4OD 4A0BA 3AH8B 4PBYA 2HYEA 4ZOZA 2QC5A 2IUVA 1PEVA 3UVMA 2H68A 2J57G 2TRCB 3UVNA 3ORVD 2AGYA 3F3GA 5FKQA 3MZLA 3AL8A 4J78A 4H5JA 1OMWB 5CXBB 3EI4B 3CFVA 2IWKA 1FWXA 4XEIC 1B9YA 4N14A 3I7OA 3I2NA 2H13A 4A2LA 3SFZA 1S4UX 3JZHA 4XYIA 5IGQA 3PXWD 3FGBA 4A7JA 4LG8A 2EBSA 4X60B 4FA9D 5C2VB 3DWLC 3ZWLB 1PI6A 2CO0C 4MK0B 4A0BB 5FLXg 4GZ8A 2PM7B 3V7DB 4O3TB 5HE2B 2HJBA 2CE9A 2AGWA 3RRMC 1PBYB 2CN2A 4GQ1A 2AGLA 3RMZD 3RLMD 4CZXA 3EI3A 5HYNB 4JXMA 3EI2B 5C2WB 4IA9A 4G56B 3SN6B 4L3GD 5EMLB 2B4EA 3EWEA 3PSCB 1JMZB 2XYIA 2Z2NA 3MZKA 4BUJC 1XIPA 4J8BA 5EAMA 5K19A 3OKYA 4IMMA 3SXTD 5FA5B 3OKYB 1L0QA 3N0EA 3BG0A 4O1QD 5HE0B 4CY2A 4GM8A 1SQJA 5SXMA 2Q7QA 4R7AB 5FXYA 2P9PC 1OLZA 2W18A 4J0XA 3PVUB 4ERZA 4Y7RA 5H17A 2IAAA 1TBGA 3GFCA 3DM0A 5AMSA 2BBKH 1R5MA 3FRXA 2HJ4A 5GSAA 2UZYB 5JWZA 4X61B 2PM9B 4J77A 4J86A 4KFMB 5KDOB 2HKMA 2IURA 4U7AA 4CI3A 5GXHA 3P4FA 3OTTA 2J55H 4J0WA 3L4MD 5HE3B 3MKQA 4J73A 1JMXB 4GGDA 2BCJB 3KRWB 3J81g 2UZXB 4E54B 2OK4A 4CY5A 2OJYA 3UVKA 5HQGA 3UVLA 4GQ2P 4J82A 3NVXA 1PGUA 2J56H 2PM9A 3DXKC 4LGNA 4OWRA 5EMMB 2P9KC 1TYQC 2CO0A 4H5IA 5FKTA 5FKSA 4FAND 1A0RB 4JSXC 4ZOYA 2G9AA 3JZGA 5IJ7E 5TDHB 4FB1D 3OW8A 2HKRA 3SBPA 2AH1A 4X63B 2I3SA 3I8CA 3I7NA 3FM0A 3RN0D 4ERQA 4HDJA 4ESGA 1MG2A 4NSXA 3JB9L 5TEFA 3UVOA 2H6KA 3EI1A 4A0AB 4PSWB 1N6EA 3SHFA 1NR0A 2H9NA 5GXIA 3B7FA 2OIZA 5H1MA 2XU7A 5THAA 3SCYA 1GXRA 3JRPA 2CE8A 4TZ4A 4QL1A 2I0SA 3EI3B 3JAMg 4D6VA 1XKSA 4E5ZB 1K8KC 3DXMC 3SWSD 4EWRA 4FA4D 5TEEA 1GG2B 3UKUC 2OVRB 2P9UC 3N0DA 1VYHC 3IJ0A 5TF2A 4J79A 4CZYA 4JSVC 5EMJB 3CIKB 4GGCA 5IJ8E 2OK6A 3F3PA 1XHMA 5FKRA 3NVQA 1P22A 2AGZA 5AFU3 2YBAA 4A08B 4GMBA 3EG6A 2H3XA 5CXBA 3EMHA 3MXXA 3K27A 3NVNA 1Q47A 3DSMA 3SBQA 2P9SC 3EU7A 3KRXB 1K32A 3UKRC 5CYKA 5EM2A 1NEXB 2YMUA 5C9ZB 5A2Qg 1GOTB 4L3HD 5IGOA 3I7HA 4K3ID 4O9DA 4BL0A 3PE7A 4AEZA 4L9OA 4PBZA 4A09A 2PM6B 3IJCA 4A11A 1GP2B 2B5MA 1N6FA 5EAPA 3AL8B 4JD2C 3UR4A 3VH0A 3RSEC 3C99A 4FAVD 2CN3A 4ZN4A 2HXCA 4GM9A 3MMYA 4FA1D 2AQ5A 4D0KA 4O45A 4GGAA 1B9XA 4ZOVA 3ULEC 5I5MA 4PSXB 2GNQA 2QXVA 4CI1A 3EI4A 3SJLD
chains in the Genus database with same CATH superfamily
4OZUA 2XL2A 3OL2B 2VZ3A 3FCSA 3GC3B 2HESX 2GC7A 4ERYA 4CC9A 5EARA 3ODTA 2H9LA 4L1QD 3C5MA 4Z8LA 5GMKn 4Y5RD 2G99A 3PXSD 2XL3A 4J84A 4MMYA 3C9CA 3C75H 1GOGA 3KCIA 3IKOA 3PVWB 5I5JA 4CI8A 3BG1A 3I7KA 4BCBA 3BWSA 2IWFA 4BP9A 1YFQA 3EI2A 2I3TA 3FCUA 3CFSB 2CNXA 1N6DA 2P9LC 5HE1B 3EQ8A 2H6NA 3VA6A 2H14A 2VDQA 4GM3A 2YNNA 2OVQB 4PXWA 2H6QA 3VGZA 2XDWA 4A11B 4DNVA 4PC0A 1H2ZA 2IUPA 3I7LA 4BCDA 5C86A 5FQDA 1JTDB 4ES0A 3AL9A 2PBIB 4LG9A 1SHYB 2IUQA 3HFQA 5C92A 2OVPB 3PXTD 3DDUA 1VE6A 4I79A 2Z2PA 5AJAA 2B5NA 4AOWA 4FA5D 4JT6C 3IVMA 3A0FA 1RI6A 3SBRA 3IJ1A 5M61A 2I0RA 2GC4A 3GREA 2EIEA 1SQ9A 1UTCA 4A08A 4GQBB 2O9KA 3IUNA 4XYHA 5H14A 4CY3A 3ZDXA 2VZ1A 3EQ7A 3SVWD 2VDPA 3VI4A 4PNKB 5CXCB 3SMRA 3OL2A 2AH0A 1ERJA 2EIBA 1QFSA 2MTAH 5CYKB 3E0CA 4CZVA 1JOFA 2YB8B 3IURA 4YVDA 3ZDZA 3ZE2A 3SLED 3V5WB 1GOFA 3W15A 3I89A 4K3JB 5IT9g 3EQ9A 4QRJA 2I0TA 5CXCA 5EMKB 3O4IA 2QZPA 4JSPC 3IIWA 4ZOXA 3T3MA 3RFGA 4JSNC 3IIYA 4A2MA 4FHLA 3ZE0A 4J87A 5M5SA 2YNPA 1C9IA 1A12A 3EI1B 4A0AA 4J81A 4FWWA 3JROA 4NC4A 4UI9R 4U1EI 1U2VC 2H9PA 2H47A 3O4JA 4QT8A 2AGXA 4QQEA 1MDAH 5I5IA 4X3EA 2H9MA 5IC7A 3I8EA 4IRZA 3J80g 5B4WA 4CI2A 5K1CC 3AFCA 1C9LA 2P9IC 3F3FA 4J8GA 2YNOA 3MKSB 3IUMA 1MG3A 1JV2A 4O3UB 3OKWA 4JT5C 3K26A 2P9NC 3RN1D 2B5LA 4E54A 3OKTA 3RFHA 5EM2B 3V4VA 3U4YA 2Z2OA 3IUQA 3I7PA 3V9FA 2VDLA 3JPXA 4E5ZA 1QNIA 5FFGA 1U4CA 4CY1A 1JJUB 4A09B 3PSLA 3JZNA 5EALA 4BH6A 3L4OD 4A0BA 3AH8B 3NIGA 4PBYA 3NIDA 2VC2A 4Z7QA 2HYEA 2VDKA 4ZOZA 2QC5A 2IUVA 1PEVA 2BKLA 3UVMA 2H68A 2J57G 2TRCB 3UVNA 3ORVD 2AGYA 3F3GA 1U8CA 4MMXA 3MZLA 5E6SA 5FKQA 3AL8A 4J78A 4H5JA 1OMWB 5CXBB 3EI4B 3CFVA 2IWKA 1FWXA 4XEIC 1B9YA 4N14A 1E8MA 3I7OA 3OF7A 3I2NA 2H13A 1E5TA 4A2LA 4JHPC 3VI3A 3SFZA 4D9SA 1TYEA 1S4UX 3JZHA 4XYIA 5IGQA 3K71A 3PXWD 3FGBA 4A7JA 4LG8A 2EBSA 4X60B 3QHYB 4FA9D 5C2VB 3DWLC 3ZWLB 1PI6A 2CO0C 4RE5A 4MK0B 1H2WA 3O4HA 4A0BB 5FLXg 1E8NA 2QR5A 4O02A 4GZ8A 2PM7B 2HU8A 3V7DB 4O3TB 5HE2B 2HJBA 1L5GA 2CE9A 2AGWA 3RRMC 1PBYB 2CN2A 4GQ1A 2AGLA 1H2YA 4WK4A 3RMZD 4AN1A 3RLMD 4CZXA 3EI3A 5HYNB 4JXMA 3EI2B 5C2WB 4IA9A 4G56B 3SN6B 1VZ3A 4L3GD 5EMLB 2B4EA 2XZGA 3EWEA 3PSCB 1JMZB 2XYIA 2Z2NA 3MZKA 5E6UA 4BUJC 1XIPA 4J8BA 4BCCA 5EAMA 4NAAA 5K19A 2EIDA 3OKYA 4IMMA 3SXTD 1GOHA 4AMZA 5FA5B 3OKYB 4L1MA 1L0QA 3N0EA 3BG0A 4O1QD 5HE0B 4CY2A 4GM8A 1SQJA 1BPOA 5SXMA 5E6RA 2Q7QA 4R7AB 5FXYA 3T3PA 2P9PC 2VDRA 1OLZA 2W18A 4J0XA 3PVUB 4ERZA 4G1MA 4Y7RA 5H17A 2IAAA 4DNUA 1TBGA 3GFCA 3DM0A 5AMSA 2BBKH 1R5MA 3FRXA 3NIFA 2HJ4A 5GSAA 2UZYB 5JWZA 4G55A 2PM9B 4X61B 4J77A 4J86A 4KFMB 4QAMA 2HKMA 5KDOB 2IURA 4U7AA 4CI3A 5GXHA 3P4FA 3OTTA 2J55H 4J0WA 4WK2A 3L4MD 5HE3B 3K72A 4Z7OA 1YR2A 5M5TA 3MKQA 4J73A 1JMXB 4GGDA 2BCJB 3KRWB 3J81g 2UZXB 4E54B 2OK4A 4Z7NA 4CY5A 2OJYA 3UVKA 5HQGA 3UVLA 2HU5A 4GQ2P 4J82A 3MUNA 3NVXA 1PGUA 2J56H 2PM9A 3DXKC 3IUJA 4LGNA 4OWRA 5EMMB 2P9KC 5M5UA 1TYQC 2CO0A 4BP8A 4H5IA 5FKTA 5FKSA 4FAND 1A0RB 4JSXC 4ZOYA 2G9AA 3JZGA 5IJ7E 5TDHB 4FB1D 3OW8A 1O6GA 2HKRA 4WK0A 3SBPA 1T2XA 2AH1A 4X63B 2I3SA 3I8CA 3I7NA 3O4GA 3FM0A 3RN0D 4ERQA 4HDJA 4ESGA 3MUOA 1MG2A 5M5RA 4NSXA 3JB9L 5TEFA 3UVOA 2H6KA 4UM9A 3EI1A 4A0AB 4PSWB 1N6EA 3SHFA 1NR0A 2H9NA 5GXIA 3B7FA 2OIZA 5H1MA 2XU7A 3MVDK 5THAA 5FFOA 3SCYA 2VDMA 1GXRA 1UOQA 3JRPA 4MMZA 2CE8A 4TZ4A 4QL1A 2I0SA 3EI3B 3JAMg 1O6FA 4D6VA 1XKSA 4E5ZB 1K8KC 3DXMC 3SWSD 4EWRA 1UOPA 4FA4D 1QFMA 5TEEA 1GG2B 3K6SA 1UOOA 4WJKA 3UKUC 2OVRB 2P9UC 3N0DA 1VYHC 3IJ0A 2WQ8A 4NBMA 5TF2A 1I2MB 4J79A 4CZYA 4JSVC 5EMJB 3CIKB 3IULA 4GGCA 3GD1I 5HDBA 5IJ8E 2OK6A 3F3PA 1K3IA 1H2XA 1XHMA 5FKRA 3NVQA 1P22A 2VDNA 2AGZA 5AFU3 2YBAA 4A08B 4GMBA 3EG6A 2H3XA 4JHNA 2JKXA 5CXBA 3EMHA 3MXXA 3K27A 3NVNA 1Q47A 3DSMA 3SBQA 2P9SC 4O2WA 3EU7A 3KRXB 1K32A 2XE4A 3UKRC 5CYKA 4AN0A 5EM2A 1NEXB 2YMUA 5C9ZB 5A2Qg 1GOTB 3ZDYA 4L3HD 3QI0A 3I7HA 5IGOA 4K3ID 4O9DA 4BL0A 3PE7A 4AEZA 4L9OA 4PBZA 1VZ2A 4A09A 2PM6B 4NENA 3IJCA 2EICA 4A11A 1GP2B 2B5MA 1N6FA 2HU7A 5EAPA 3AL8B 1VE7A 4JD2C 3UR4A 4DNWA 3RSEC 3VH0A 3C99A 4FAVD 2CN3A 4UM8A 2VDOA 4ZN4A 3IJEA 2HXCA 4GM9A 4RE6A 3ZE1A 5M5VA 1M1XA 3MMYA 4FA1D 2AQ5A 4D0KA 4O45A 4AMYA 4GGAA 1B9XA 4ZOVA 4G1EA 3ULEC 5I5MA 3V4PA 4PSXB 2GNQA 2QXVA 4CI1A 3EI4A 4AX4A 3SJLD
chains in the Genus database with same CATH topology
4OZUA 2XL2A 3OL2B 2HESX 2GC7A 4ERYA 4CC9A 5EARA 3ODTA 2H9LA 4L1QD 3C5MA 4Z8LA 5GMKn 4Y5RD 2G99A 3PXSD 2XL3A 4J84A 3C9CA 3C75H 3IKOA 3PVWB 5I5JA 4CI8A 3BG1A 3I7KA 3BWSA 2IWFA 1YFQA 3EI2A 2I3TA 3CFSB 2CNXA 1N6DA 2P9LC 5HE1B 2H6NA 3VA6A 2H14A 4GM3A 2YNNA 2OVQB 4PXWA 2H6QA 3VGZA 4A11B 4PC0A 2IUPA 3I7LA 5FQDA 4ES0A 3AL9A 2PBIB 4LG9A 1SHYB 2IUQA 3HFQA 2OVPB 3PXTD 4I79A 2Z2PA 5AJAA 2B5NA 4AOWA 4FA5D 4JT6C 3A0FA 1RI6A 3SBRA 3IJ1A 2I0RA 2GC4A 3GREA 1SQ9A 4A08A 4GQBB 2O9KA 4XYHA 5H14A 4CY3A 3SVWD 4PNKB 5CXCB 3SMRA 3OL2A 2AH0A 1ERJA 2MTAH 5CYKB 3E0CA 4CZVA 1JOFA 2YB8B 4YVDA 3SLED 3V5WB 3W15A 3I89A 4K3JB 5IT9g 4QRJA 2I0TA 5CXCA 5EMKB 4JSPC 3IIWA 4ZOXA 3RFGA 4JSNC 3IIYA 4A2MA 4FHLA 4J87A 2YNPA 3EI1B 4A0AA 4J81A 4FWWA 3JROA 4UI9R 4U1EI 1U2VC 2H9PA 2H47A 4QT8A 2AGXA 4QQEA 1MDAH 5I5IA 4X3EA 2H9MA 5IC7A 3I8EA 3J80g 5B4WA 4CI2A 5K1CC 3AFCA 2P9IC 3F3FA 4J8GA 2YNOA 3MKSB 1MG3A 4O3UB 3OKWA 4JT5C 3K26A 2P9NC 3RN1D 2B5LA 4E54A 3OKTA 3RFHA 5EM2B 3U4YA 2Z2OA 3V9FA 3I7PA 3JPXA 4E5ZA 1QNIA 1U4CA 4CY1A 1JJUB 4A09B 3PSLA 3JZNA 5EALA 4BH6A 3L4OD 4A0BA 3AH8B 4PBYA 2HYEA 4ZOZA 2QC5A 2IUVA 1PEVA 3UVMA 2H68A 2J57G 2TRCB 3UVNA 3ORVD 2AGYA 3F3GA 5FKQA 3MZLA 3AL8A 4J78A 4H5JA 1OMWB 5CXBB 3EI4B 3CFVA 2IWKA 1FWXA 4XEIC 1B9YA 4N14A 3I7OA 3I2NA 2H13A 4A2LA 3SFZA 1S4UX 3JZHA 4XYIA 5IGQA 3PXWD 3FGBA 4A7JA 4LG8A 2EBSA 4X60B 4FA9D 5C2VB 3DWLC 3ZWLB 1PI6A 2CO0C 4MK0B 4A0BB 5FLXg 4GZ8A 2PM7B 3V7DB 4O3TB 5HE2B 2HJBA 2CE9A 2AGWA 3RRMC 1PBYB 2CN2A 4GQ1A 2AGLA 3RMZD 3RLMD 4CZXA 3EI3A 5HYNB 4JXMA 3EI2B 5C2WB 4IA9A 4G56B 3SN6B 4L3GD 5EMLB 2B4EA 3EWEA 3PSCB 1JMZB 2XYIA 2Z2NA 3MZKA 4BUJC 1XIPA 4J8BA 5EAMA 5K19A 3OKYA 4IMMA 3SXTD 5FA5B 3OKYB 1L0QA 3N0EA 3BG0A 4O1QD 5HE0B 4CY2A 4GM8A 1SQJA 5SXMA 2Q7QA 4R7AB 5FXYA 2P9PC 1OLZA 2W18A 4J0XA 3PVUB 4ERZA 4Y7RA 5H17A 2IAAA 1TBGA 3GFCA 3DM0A 5AMSA 2BBKH 1R5MA 3FRXA 2HJ4A 5GSAA 2UZYB 5JWZA 4X61B 2PM9B 4J77A 4J86A 4KFMB 5KDOB 2HKMA 2IURA 4U7AA 4CI3A 5GXHA 3P4FA 3OTTA 2J55H 4J0WA 3L4MD 5HE3B 3MKQA 4J73A 1JMXB 4GGDA 2BCJB 3KRWB 3J81g 2UZXB 4E54B 2OK4A 4CY5A 2OJYA 3UVKA 5HQGA 3UVLA 4GQ2P 4J82A 3NVXA 1PGUA 2J56H 2PM9A 3DXKC 4LGNA 4OWRA 5EMMB 2P9KC 1TYQC 2CO0A 4H5IA 5FKTA 5FKSA 4FAND 1A0RB 4JSXC 4ZOYA 2G9AA 3JZGA 5IJ7E 5TDHB 4FB1D 3OW8A 2HKRA 3SBPA 2AH1A 4X63B 2I3SA 3I8CA 3I7NA 3FM0A 3RN0D 4ERQA 4HDJA 4ESGA 1MG2A 4NSXA 3JB9L 5TEFA 3UVOA 2H6KA 3EI1A 4A0AB 4PSWB 1N6EA 3SHFA 1NR0A 2H9NA 5GXIA 3B7FA 2OIZA 5H1MA 2XU7A 5THAA 3SCYA 1GXRA 3JRPA 2CE8A 4TZ4A 4QL1A 2I0SA 3EI3B 3JAMg 4D6VA 1XKSA 4E5ZB 1K8KC 3DXMC 3SWSD 4EWRA 4FA4D 5TEEA 1GG2B 3UKUC 2OVRB 2P9UC 3N0DA 1VYHC 3IJ0A 5TF2A 4J79A 4CZYA 4JSVC 5EMJB 3CIKB 4GGCA 5IJ8E 2OK6A 3F3PA 1XHMA 5FKRA 3NVQA 1P22A 2AGZA 5AFU3 2YBAA 4A08B 4GMBA 3EG6A 2H3XA 5CXBA 3EMHA 3MXXA 3K27A 3NVNA 1Q47A 3DSMA 3SBQA 2P9SC 3EU7A 3KRXB 1K32A 3UKRC 5CYKA 5EM2A 1NEXB 2YMUA 5C9ZB 5A2Qg 1GOTB 4L3HD 5IGOA 3I7HA 4K3ID 4O9DA 4BL0A 3PE7A 4AEZA 4L9OA 4PBZA 4A09A 2PM6B 3IJCA 4A11A 1GP2B 2B5MA 1N6FA 5EAPA 3AL8B 4JD2C 3UR4A 3VH0A 3RSEC 3C99A 4FAVD 2CN3A 4ZN4A 2HXCA 4GM9A 3MMYA 4FA1D 2AQ5A 4D0KA 4O45A 4GGAA 1B9XA 4ZOVA 3ULEC 5I5MA 4PSXB 2GNQA 2QXVA 4CI1A 3EI4A 3SJLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZU A;  2XL2 A;  3OL2 B;  2HES X;  2GC7 A;  4ERY A;  4CC9 A;  5EAR A;  3ODT A;  2H9L A;  4L1Q D;  3C5M A;  4Z8L A;  5GMK n;  4Y5R D;  2G99 A;  3PXS D;  2XL3 A;  4J84 A;  3C9C A;  3C75 H;  3IKO A;  3PVW B;  5I5J A;  4CI8 A;  3BG1 A;  3I7K A;  3BWS A;  2IWF A;  1YFQ A;  3EI2 A;  2I3T A;  3CFS B;  2CNX A;  1N6D A;  2P9L C;  5HE1 B;  2H6N A;  3VA6 A;  2H14 A;  4GM3 A;  2YNN A;  2OVQ B;  4PXW A;  2H6Q A;  3VGZ A;  4A11 B;  4PC0 A;  2IUP A;  3I7L A;  5FQD A;  4ES0 A;  3AL9 A;  2PBI B;  4LG9 A;  1SHY B;  2IUQ A;  3HFQ A;  2OVP B;  3PXT D;  4I79 A;  2Z2P A;  5AJA A;  2B5N A;  4AOW A;  4FA5 D;  4JT6 C;  3A0F A;  1RI6 A;  3SBR A;  3IJ1 A;  2I0R A;  2GC4 A;  3GRE A;  1SQ9 A;  4A08 A;  4GQB B;  2O9K A;  4XYH A;  5H14 A;  4CY3 A;  3SVW D;  4PNK B;  5CXC B;  3SMR A;  3OL2 A;  2AH0 A;  1ERJ A;  2MTA H;  5CYK B;  3E0C A;  4CZV A;  1JOF A;  2YB8 B;  4YVD A;  3SLE D;  3V5W B;  3W15 A;  3I89 A;  4K3J B;  5IT9 g;  4QRJ A;  2I0T A;  5CXC A;  5EMK B;  4JSP C;  3IIW A;  4ZOX A;  3RFG A;  4JSN C;  3IIY A;  4A2M A;  4FHL A;  4J87 A;  2YNP A;  3EI1 B;  4A0A A;  4J81 A;  4FWW A;  3JRO A;  4UI9 R;  4U1E I;  1U2V C;  2H9P A;  2H47 A;  4QT8 A;  2AGX A;  4QQE A;  1MDA H;  5I5I A;  4X3E A;  2H9M A;  5IC7 A;  3I8E A;  3J80 g;  5B4W A;  4CI2 A;  5K1C C;  3AFC A;  2P9I C;  3F3F A;  4J8G A;  2YNO A;  3MKS B;  1MG3 A;  4O3U B;  3OKW A;  4JT5 C;  3K26 A;  2P9N C;  3RN1 D;  2B5L A;  4E54 A;  3OKT A;  3RFH A;  5EM2 B;  3U4Y A;  2Z2O A;  3V9F A;  3I7P A;  3JPX A;  4E5Z A;  1QNI A;  1U4C A;  4CY1 A;  1JJU B;  4A09 B;  3PSL A;  3JZN A;  5EAL A;  4BH6 A;  3L4O D;  4A0B A;  3AH8 B;  4PBY A;  2HYE A;  4ZOZ A;  2QC5 A;  2IUV A;  1PEV A;  3UVM A;  2H68 A;  2J57 G;  2TRC B;  3UVN A;  3ORV D;  2AGY A;  3F3G A;  5FKQ A;  3MZL A;  3AL8 A;  4J78 A;  4H5J A;  1OMW B;  5CXB B;  3EI4 B;  3CFV A;  2IWK A;  1FWX A;  4XEI C;  1B9Y A;  4N14 A;  3I7O A;  3I2N A;  2H13 A;  4A2L A;  3SFZ A;  1S4U X;  3JZH A;  4XYI A;  5IGQ A;  3PXW D;  3FGB A;  4A7J A;  4LG8 A;  2EBS A;  4X60 B;  4FA9 D;  5C2V B;  3DWL C;  3ZWL B;  1PI6 A;  2CO0 C;  4MK0 B;  4A0B B;  5FLX g;  4GZ8 A;  2PM7 B;  3V7D B;  4O3T B;  5HE2 B;  2HJB A;  2CE9 A;  2AGW A;  3RRM C;  1PBY B;  2CN2 A;  4GQ1 A;  2AGL A;  3RMZ D;  3RLM D;  4CZX A;  3EI3 A;  5HYN B;  4JXM A;  3EI2 B;  5C2W B;  4IA9 A;  4G56 B;  3SN6 B;  4L3G D;  5EML B;  2B4E A;  3EWE A;  3PSC B;  1JMZ B;  2XYI A;  2Z2N A;  3MZK A;  4BUJ C;  1XIP A;  4J8B A;  5EAM A;  5K19 A;  3OKY A;  4IMM A;  3SXT D;  5FA5 B;  3OKY B;  1L0Q A;  3N0E A;  3BG0 A;  4O1Q D;  5HE0 B;  4CY2 A;  4GM8 A;  1SQJ A;  5SXM A;  2Q7Q A;  4R7A B;  5FXY A;  2P9P C;  1OLZ A;  2W18 A;  4J0X A;  3PVU B;  4ERZ A;  4Y7R A;  5H17 A;  2IAA A;  1TBG A;  3GFC A;  3DM0 A;  5AMS A;  2BBK H;  1R5M A;  3FRX A;  2HJ4 A;  5GSA A;  2UZY B;  5JWZ A;  4X61 B;  2PM9 B;  4J77 A;  4J86 A;  4KFM B;  5KDO B;  2HKM A;  2IUR A;  4U7A A;  4CI3 A;  5GXH A;  3P4F A;  3OTT A;  2J55 H;  4J0W A;  3L4M D;  5HE3 B;  3MKQ A;  4J73 A;  1JMX B;  4GGD A;  2BCJ B;  3KRW B;  3J81 g;  2UZX B;  4E54 B;  2OK4 A;  4CY5 A;  2OJY A;  3UVK A;  5HQG A;  3UVL A;  4GQ2 P;  4J82 A;  3NVX A;  1PGU A;  2J56 H;  2PM9 A;  3DXK C;  4LGN A;  4OWR A;  5EMM B;  2P9K C;  1TYQ C;  2CO0 A;  4H5I A;  5FKT A;  5FKS A;  4FAN D;  1A0R B;  4JSX C;  4ZOY A;  2G9A A;  3JZG A;  5IJ7 E;  5TDH B;  4FB1 D;  3OW8 A;  2HKR A;  3SBP A;  2AH1 A;  4X63 B;  2I3S A;  3I8C A;  3I7N A;  3FM0 A;  3RN0 D;  4ERQ A;  4HDJ A;  4ESG A;  1MG2 A;  4NSX A;  3JB9 L;  5TEF A;  3UVO A;  2H6K A;  3EI1 A;  4A0A B;  4PSW B;  1N6E A;  3SHF A;  1NR0 A;  2H9N A;  5GXI A;  3B7F A;  2OIZ A;  5H1M A;  2XU7 A;  5THA A;  3SCY A;  1GXR A;  3JRP A;  2CE8 A;  4TZ4 A;  4QL1 A;  2I0S A;  3EI3 B;  3JAM g;  4D6V A;  1XKS A;  4E5Z B;  1K8K C;  3DXM C;  3SWS D;  4EWR A;  4FA4 D;  5TEE A;  1GG2 B;  3UKU C;  2OVR B;  2P9U C;  3N0D A;  1VYH C;  3IJ0 A;  5TF2 A;  4J79 A;  4CZY A;  4JSV C;  5EMJ B;  3CIK B;  4GGC A;  5IJ8 E;  2OK6 A;  3F3P A;  1XHM A;  5FKR A;  3NVQ A;  1P22 A;  2AGZ A;  5AFU 3;  2YBA A;  4A08 B;  4GMB A;  3EG6 A;  2H3X A;  5CXB A;  3EMH A;  3MXX A;  3K27 A;  3NVN A;  1Q47 A;  3DSM A;  3SBQ A;  2P9S C;  3EU7 A;  3KRX B;  1K32 A;  3UKR C;  5CYK A;  5EM2 A;  1NEX B;  2YMU A;  5C9Z B;  5A2Q g;  1GOT B;  4L3H D;  5IGO A;  3I7H A;  4K3I D;  4O9D A;  4BL0 A;  3PE7 A;  4AEZ A;  4L9O A;  4PBZ A;  4A09 A;  2PM6 B;  3IJC A;  4A11 A;  1GP2 B;  2B5M A;  1N6F A;  5EAP A;  3AL8 B;  4JD2 C;  3UR4 A;  3VH0 A;  3RSE C;  3C99 A;  4FAV D;  2CN3 A;  4ZN4 A;  2HXC A;  4GM9 A;  3MMY A;  4FA1 D;  2AQ5 A;  4D0K A;  4O45 A;  4GGA A;  1B9X A;  4ZOV A;  3ULE C;  5I5M A;  4PSX B;  2GNQ A;  2QXV A;  4CI1 A;  3EI4 A;  3SJL D; 
#chains in the Genus database with same CATH topology
 4OZU A;  2XL2 A;  3OL2 B;  2VZ3 A;  3FCS A;  3GC3 B;  2HES X;  2GC7 A;  4ERY A;  4CC9 A;  5EAR A;  3ODT A;  2H9L A;  4L1Q D;  3C5M A;  4Z8L A;  5GMK n;  4Y5R D;  2G99 A;  3PXS D;  2XL3 A;  4J84 A;  4MMY A;  3C9C A;  3C75 H;  1GOG A;  3KCI A;  3IKO A;  3PVW B;  5I5J A;  4CI8 A;  3BG1 A;  3I7K A;  4BCB A;  3BWS A;  2IWF A;  4BP9 A;  1YFQ A;  3EI2 A;  2I3T A;  3FCU A;  3CFS B;  2CNX A;  1N6D A;  2P9L C;  5HE1 B;  3EQ8 A;  2H6N A;  3VA6 A;  2H14 A;  2VDQ A;  4GM3 A;  2YNN A;  2OVQ B;  4PXW A;  2H6Q A;  3VGZ A;  2XDW A;  4A11 B;  4DNV A;  4PC0 A;  1H2Z A;  2IUP A;  3I7L A;  4BCD A;  5C86 A;  5FQD A;  1JTD B;  4ES0 A;  3AL9 A;  2PBI B;  4LG9 A;  1SHY B;  2IUQ A;  3HFQ A;  5C92 A;  2OVP B;  3PXT D;  3DDU A;  1VE6 A;  4I79 A;  2Z2P A;  5AJA A;  2B5N A;  4AOW A;  4FA5 D;  4JT6 C;  3IVM A;  3A0F A;  1RI6 A;  3SBR A;  3IJ1 A;  5M61 A;  2I0R A;  2GC4 A;  3GRE A;  2EIE A;  1SQ9 A;  1UTC A;  4A08 A;  4GQB B;  2O9K A;  3IUN A;  4XYH A;  5H14 A;  4CY3 A;  3ZDX A;  2VZ1 A;  3EQ7 A;  3SVW D;  2VDP A;  3VI4 A;  4PNK B;  5CXC B;  3SMR A;  3OL2 A;  2AH0 A;  1ERJ A;  2EIB A;  1QFS A;  2MTA H;  5CYK B;  3E0C A;  4CZV A;  1JOF A;  2YB8 B;  3IUR A;  4YVD A;  3ZDZ A;  3ZE2 A;  3SLE D;  3V5W B;  1GOF A;  3W15 A;  3I89 A;  4K3J B;  5IT9 g;  3EQ9 A;  4QRJ A;  2I0T A;  5CXC A;  5EMK B;  3O4I A;  2QZP A;  4JSP C;  3IIW A;  4ZOX A;  3T3M A;  3RFG A;  4JSN C;  3IIY A;  4A2M A;  4FHL A;  3ZE0 A;  4J87 A;  5M5S A;  2YNP A;  1C9I A;  1A12 A;  3EI1 B;  4A0A A;  4J81 A;  4FWW A;  3JRO A;  4NC4 A;  4UI9 R;  4U1E I;  1U2V C;  2H9P A;  2H47 A;  3O4J A;  4QT8 A;  2AGX A;  4QQE A;  1MDA H;  5I5I A;  4X3E A;  2H9M A;  5IC7 A;  3I8E A;  4IRZ A;  3J80 g;  5B4W A;  4CI2 A;  5K1C C;  3AFC A;  1C9L A;  2P9I C;  3F3F A;  4J8G A;  2YNO A;  3MKS B;  3IUM A;  1MG3 A;  1JV2 A;  4O3U B;  3OKW A;  4JT5 C;  3K26 A;  2P9N C;  3RN1 D;  2B5L A;  4E54 A;  3OKT A;  3RFH A;  5EM2 B;  3V4V A;  3U4Y A;  2Z2O A;  3IUQ A;  3I7P A;  3V9F A;  2VDL A;  3JPX A;  4E5Z A;  1QNI A;  5FFG A;  1U4C A;  4CY1 A;  1JJU B;  4A09 B;  3PSL A;  3JZN A;  5EAL A;  4BH6 A;  3L4O D;  4A0B A;  3AH8 B;  3NIG A;  4PBY A;  3NID A;  2VC2 A;  4Z7Q A;  2HYE A;  2VDK A;  4ZOZ A;  2QC5 A;  2IUV A;  1PEV A;  2BKL A;  3UVM A;  2H68 A;  2J57 G;  2TRC B;  3UVN A;  3ORV D;  2AGY A;  3F3G A;  1U8C A;  4MMX A;  3MZL A;  5E6S A;  5FKQ A;  3AL8 A;  4J78 A;  4H5J A;  1OMW B;  5CXB B;  3EI4 B;  3CFV A;  2IWK A;  1FWX A;  4XEI C;  1B9Y A;  4N14 A;  1E8M A;  3I7O A;  3OF7 A;  3I2N A;  2H13 A;  1E5T A;  4A2L A;  4JHP C;  3VI3 A;  3SFZ A;  4D9S A;  1TYE A;  1S4U X;  3JZH A;  4XYI A;  5IGQ A;  3K71 A;  3PXW D;  3FGB A;  4A7J A;  4LG8 A;  2EBS A;  4X60 B;  3QHY B;  4FA9 D;  5C2V B;  3DWL C;  3ZWL B;  1PI6 A;  2CO0 C;  4RE5 A;  4MK0 B;  1H2W A;  3O4H A;  4A0B B;  5FLX g;  1E8N A;  2QR5 A;  4O02 A;  4GZ8 A;  2PM7 B;  2HU8 A;  3V7D B;  4O3T B;  5HE2 B;  2HJB A;  1L5G A;  2CE9 A;  2AGW A;  3RRM C;  1PBY B;  2CN2 A;  4GQ1 A;  2AGL A;  1H2Y A;  4WK4 A;  3RMZ D;  4AN1 A;  3RLM D;  4CZX A;  3EI3 A;  5HYN B;  4JXM A;  3EI2 B;  5C2W B;  4IA9 A;  4G56 B;  3SN6 B;  1VZ3 A;  4L3G D;  5EML B;  2B4E A;  2XZG A;  3EWE A;  3PSC B;  1JMZ B;  2XYI A;  2Z2N A;  3MZK A;  5E6U A;  4BUJ C;  1XIP A;  4J8B A;  4BCC A;  5EAM A;  4NAA A;  5K19 A;  2EID A;  3OKY A;  4IMM A;  3SXT D;  1GOH A;  4AMZ A;  5FA5 B;  3OKY B;  4L1M A;  1L0Q A;  3N0E A;  3BG0 A;  4O1Q D;  5HE0 B;  4CY2 A;  4GM8 A;  1SQJ A;  1BPO A;  5SXM A;  5E6R A;  2Q7Q A;  4R7A B;  5FXY A;  3T3P A;  2P9P C;  2VDR A;  1OLZ A;  2W18 A;  4J0X A;  3PVU B;  4ERZ A;  4G1M A;  4Y7R A;  5H17 A;  2IAA A;  4DNU A;  1TBG A;  3GFC A;  3DM0 A;  5AMS A;  2BBK H;  1R5M A;  3FRX A;  3NIF A;  2HJ4 A;  5GSA A;  2UZY B;  5JWZ A;  4G55 A;  2PM9 B;  4X61 B;  4J77 A;  4J86 A;  4KFM B;  4QAM A;  2HKM A;  5KDO B;  2IUR A;  4U7A A;  4CI3 A;  5GXH A;  3P4F A;  3OTT A;  2J55 H;  4J0W A;  4WK2 A;  3L4M D;  5HE3 B;  3K72 A;  4Z7O A;  1YR2 A;  5M5T A;  3MKQ A;  4J73 A;  1JMX B;  4GGD A;  2BCJ B;  3KRW B;  3J81 g;  2UZX B;  4E54 B;  2OK4 A;  4Z7N A;  4CY5 A;  2OJY A;  3UVK A;  5HQG A;  3UVL A;  2HU5 A;  4GQ2 P;  4J82 A;  3MUN A;  3NVX A;  1PGU A;  2J56 H;  2PM9 A;  3DXK C;  3IUJ A;  4LGN A;  4OWR A;  5EMM B;  2P9K C;  5M5U A;  1TYQ C;  2CO0 A;  4BP8 A;  4H5I A;  5FKT A;  5FKS A;  4FAN D;  1A0R B;  4JSX C;  4ZOY A;  2G9A A;  3JZG A;  5IJ7 E;  5TDH B;  4FB1 D;  3OW8 A;  1O6G A;  2HKR A;  4WK0 A;  3SBP A;  1T2X A;  2AH1 A;  4X63 B;  2I3S A;  3I8C A;  3I7N A;  3O4G A;  3FM0 A;  3RN0 D;  4ERQ A;  4HDJ A;  4ESG A;  3MUO A;  1MG2 A;  5M5R A;  4NSX A;  3JB9 L;  5TEF A;  3UVO A;  2H6K A;  4UM9 A;  3EI1 A;  4A0A B;  4PSW B;  1N6E A;  3SHF A;  1NR0 A;  2H9N A;  5GXI A;  3B7F A;  2OIZ A;  5H1M A;  2XU7 A;  3MVD K;  5THA A;  5FFO A;  3SCY A;  2VDM A;  1GXR A;  1UOQ A;  3JRP A;  4MMZ A;  2CE8 A;  4TZ4 A;  4QL1 A;  2I0S A;  3EI3 B;  3JAM g;  1O6F A;  4D6V A;  1XKS A;  4E5Z B;  1K8K C;  3DXM C;  3SWS D;  4EWR A;  1UOP A;  4FA4 D;  1QFM A;  5TEE A;  1GG2 B;  3K6S A;  1UOO A;  4WJK A;  3UKU C;  2OVR B;  2P9U C;  3N0D A;  1VYH C;  3IJ0 A;  2WQ8 A;  4NBM A;  5TF2 A;  1I2M B;  4J79 A;  4CZY A;  4JSV C;  5EMJ B;  3CIK B;  3IUL A;  4GGC A;  3GD1 I;  5HDB A;  5IJ8 E;  2OK6 A;  3F3P A;  1K3I A;  1H2X A;  1XHM A;  5FKR A;  3NVQ A;  1P22 A;  2VDN A;  2AGZ A;  5AFU 3;  2YBA A;  4A08 B;  4GMB A;  3EG6 A;  2H3X A;  4JHN A;  2JKX A;  5CXB A;  3EMH A;  3MXX A;  3K27 A;  3NVN A;  1Q47 A;  3DSM A;  3SBQ A;  2P9S C;  4O2W A;  3EU7 A;  3KRX B;  1K32 A;  2XE4 A;  3UKR C;  5CYK A;  4AN0 A;  5EM2 A;  1NEX B;  2YMU A;  5C9Z B;  5A2Q g;  1GOT B;  3ZDY A;  4L3H D;  3QI0 A;  3I7H A;  5IGO A;  4K3I D;  4O9D A;  4BL0 A;  3PE7 A;  4AEZ A;  4L9O A;  4PBZ A;  1VZ2 A;  4A09 A;  2PM6 B;  4NEN A;  3IJC A;  2EIC A;  4A11 A;  1GP2 B;  2B5M A;  1N6F A;  2HU7 A;  5EAP A;  3AL8 B;  1VE7 A;  4JD2 C;  3UR4 A;  4DNW A;  3RSE C;  3VH0 A;  3C99 A;  4FAV D;  2CN3 A;  4UM8 A;  2VDO A;  4ZN4 A;  3IJE A;  2HXC A;  4GM9 A;  4RE6 A;  3ZE1 A;  5M5V A;  1M1X A;  3MMY A;  4FA1 D;  2AQ5 A;  4D0K A;  4O45 A;  4AMY A;  4GGA A;  1B9X A;  4ZOV A;  4G1E A;  3ULE C;  5I5M A;  3V4P A;  4PSX B;  2GNQ A;  2QXV A;  4CI1 A;  3EI4 A;  4AX4 A;  3SJL D; 
#chains in the Genus database with same CATH homology
 4OZU A;  2XL2 A;  3OL2 B;  2HES X;  2GC7 A;  4ERY A;  4CC9 A;  5EAR A;  3ODT A;  2H9L A;  4L1Q D;  3C5M A;  4Z8L A;  5GMK n;  4Y5R D;  2G99 A;  3PXS D;  2XL3 A;  4J84 A;  3C9C A;  3C75 H;  3IKO A;  3PVW B;  5I5J A;  4CI8 A;  3BG1 A;  3I7K A;  3BWS A;  2IWF A;  1YFQ A;  3EI2 A;  2I3T A;  3CFS B;  2CNX A;  1N6D A;  2P9L C;  5HE1 B;  2H6N A;  3VA6 A;  2H14 A;  4GM3 A;  2YNN A;  2OVQ B;  4PXW A;  2H6Q A;  3VGZ A;  4A11 B;  4PC0 A;  2IUP A;  3I7L A;  5FQD A;  4ES0 A;  3AL9 A;  2PBI B;  4LG9 A;  1SHY B;  2IUQ A;  3HFQ A;  2OVP B;  3PXT D;  4I79 A;  2Z2P A;  5AJA A;  2B5N A;  4AOW A;  4FA5 D;  4JT6 C;  3A0F A;  1RI6 A;  3SBR A;  3IJ1 A;  2I0R A;  2GC4 A;  3GRE A;  1SQ9 A;  4A08 A;  4GQB B;  2O9K A;  4XYH A;  5H14 A;  4CY3 A;  3SVW D;  4PNK B;  5CXC B;  3SMR A;  3OL2 A;  2AH0 A;  1ERJ A;  2MTA H;  5CYK B;  3E0C A;  4CZV A;  1JOF A;  2YB8 B;  4YVD A;  3SLE D;  3V5W B;  3W15 A;  3I89 A;  4K3J B;  5IT9 g;  4QRJ A;  2I0T A;  5CXC A;  5EMK B;  4JSP C;  3IIW A;  4ZOX A;  3RFG A;  4JSN C;  3IIY A;  4A2M A;  4FHL A;  4J87 A;  2YNP A;  3EI1 B;  4A0A A;  4J81 A;  4FWW A;  3JRO A;  4UI9 R;  4U1E I;  1U2V C;  2H9P A;  2H47 A;  4QT8 A;  2AGX A;  4QQE A;  1MDA H;  5I5I A;  4X3E A;  2H9M A;  5IC7 A;  3I8E A;  3J80 g;  5B4W A;  4CI2 A;  5K1C C;  3AFC A;  2P9I C;  3F3F A;  4J8G A;  2YNO A;  3MKS B;  1MG3 A;  4O3U B;  3OKW A;  4JT5 C;  3K26 A;  2P9N C;  3RN1 D;  2B5L A;  4E54 A;  3OKT A;  3RFH A;  5EM2 B;  3U4Y A;  2Z2O A;  3V9F A;  3I7P A;  3JPX A;  4E5Z A;  1QNI A;  1U4C A;  4CY1 A;  1JJU B;  4A09 B;  3PSL A;  3JZN A;  5EAL A;  4BH6 A;  3L4O D;  4A0B A;  3AH8 B;  4PBY A;  2HYE A;  4ZOZ A;  2QC5 A;  2IUV A;  1PEV A;  3UVM A;  2H68 A;  2J57 G;  2TRC B;  3UVN A;  3ORV D;  2AGY A;  3F3G A;  5FKQ A;  3MZL A;  3AL8 A;  4J78 A;  4H5J A;  1OMW B;  5CXB B;  3EI4 B;  3CFV A;  2IWK A;  1FWX A;  4XEI C;  1B9Y A;  4N14 A;  3I7O A;  3I2N A;  2H13 A;  4A2L A;  3SFZ A;  1S4U X;  3JZH A;  4XYI A;  5IGQ A;  3PXW D;  3FGB A;  4A7J A;  4LG8 A;  2EBS A;  4X60 B;  4FA9 D;  5C2V B;  3DWL C;  3ZWL B;  1PI6 A;  2CO0 C;  4MK0 B;  4A0B B;  5FLX g;  4GZ8 A;  2PM7 B;  3V7D B;  4O3T B;  5HE2 B;  2HJB A;  2CE9 A;  2AGW A;  3RRM C;  1PBY B;  2CN2 A;  4GQ1 A;  2AGL A;  3RMZ D;  3RLM D;  4CZX A;  3EI3 A;  5HYN B;  4JXM A;  3EI2 B;  5C2W B;  4IA9 A;  4G56 B;  3SN6 B;  4L3G D;  5EML B;  2B4E A;  3EWE A;  3PSC B;  1JMZ B;  2XYI A;  2Z2N A;  3MZK A;  4BUJ C;  1XIP A;  4J8B A;  5EAM A;  5K19 A;  3OKY A;  4IMM A;  3SXT D;  5FA5 B;  3OKY B;  1L0Q A;  3N0E A;  3BG0 A;  4O1Q D;  5HE0 B;  4CY2 A;  4GM8 A;  1SQJ A;  5SXM A;  2Q7Q A;  4R7A B;  5FXY A;  2P9P C;  1OLZ A;  2W18 A;  4J0X A;  3PVU B;  4ERZ A;  4Y7R A;  5H17 A;  2IAA A;  1TBG A;  3GFC A;  3DM0 A;  5AMS A;  2BBK H;  1R5M A;  3FRX A;  2HJ4 A;  5GSA A;  2UZY B;  5JWZ A;  4X61 B;  2PM9 B;  4J77 A;  4J86 A;  4KFM B;  5KDO B;  2HKM A;  2IUR A;  4U7A A;  4CI3 A;  5GXH A;  3P4F A;  3OTT A;  2J55 H;  4J0W A;  3L4M D;  5HE3 B;  3MKQ A;  4J73 A;  1JMX B;  4GGD A;  2BCJ B;  3KRW B;  3J81 g;  2UZX B;  4E54 B;  2OK4 A;  4CY5 A;  2OJY A;  3UVK A;  5HQG A;  3UVL A;  4GQ2 P;  4J82 A;  3NVX A;  1PGU A;  2J56 H;  2PM9 A;  3DXK C;  4LGN A;  4OWR A;  5EMM B;  2P9K C;  1TYQ C;  2CO0 A;  4H5I A;  5FKT A;  5FKS A;  4FAN D;  1A0R B;  4JSX C;  4ZOY A;  2G9A A;  3JZG A;  5IJ7 E;  5TDH B;  4FB1 D;  3OW8 A;  2HKR A;  3SBP A;  2AH1 A;  4X63 B;  2I3S A;  3I8C A;  3I7N A;  3FM0 A;  3RN0 D;  4ERQ A;  4HDJ A;  4ESG A;  1MG2 A;  4NSX A;  3JB9 L;  5TEF A;  3UVO A;  2H6K A;  3EI1 A;  4A0A B;  4PSW B;  1N6E A;  3SHF A;  1NR0 A;  2H9N A;  5GXI A;  3B7F A;  2OIZ A;  5H1M A;  2XU7 A;  5THA A;  3SCY A;  1GXR A;  3JRP A;  2CE8 A;  4TZ4 A;  4QL1 A;  2I0S A;  3EI3 B;  3JAM g;  4D6V A;  1XKS A;  4E5Z B;  1K8K C;  3DXM C;  3SWS D;  4EWR A;  4FA4 D;  5TEE A;  1GG2 B;  3UKU C;  2OVR B;  2P9U C;  3N0D A;  1VYH C;  3IJ0 A;  5TF2 A;  4J79 A;  4CZY A;  4JSV C;  5EMJ B;  3CIK B;  4GGC A;  5IJ8 E;  2OK6 A;  3F3P A;  1XHM A;  5FKR A;  3NVQ A;  1P22 A;  2AGZ A;  5AFU 3;  2YBA A;  4A08 B;  4GMB A;  3EG6 A;  2H3X A;  5CXB A;  3EMH A;  3MXX A;  3K27 A;  3NVN A;  1Q47 A;  3DSM A;  3SBQ A;  2P9S C;  3EU7 A;  3KRX B;  1K32 A;  3UKR C;  5CYK A;  5EM2 A;  1NEX B;  2YMU A;  5C9Z B;  5A2Q g;  1GOT B;  4L3H D;  5IGO A;  3I7H A;  4K3I D;  4O9D A;  4BL0 A;  3PE7 A;  4AEZ A;  4L9O A;  4PBZ A;  4A09 A;  2PM6 B;  3IJC A;  4A11 A;  1GP2 B;  2B5M A;  1N6F A;  5EAP A;  3AL8 B;  4JD2 C;  3UR4 A;  3VH0 A;  3RSE C;  3C99 A;  4FAV D;  2CN3 A;  4ZN4 A;  2HXC A;  4GM9 A;  3MMY A;  4FA1 D;  2AQ5 A;  4D0K A;  4O45 A;  4GGA A;  1B9X A;  4ZOV A;  3ULE C;  5I5M A;  4PSX B;  2GNQ A;  2QXV A;  4CI1 A;  3EI4 A;  3SJL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...