2HKRA

Structures of the carbinolamine and schiff-base intermediates in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with p-methoxyphenylethylamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hkrA01
2AGLA 2Z2PA 3PSCB 5AMSA 2H9PA 2OIZA 1U4CA 5SXMA 5EARA 3B7FA 2PM9A 5C2WB 2YB8B 4OZUA 1Q47A 4J79A 3PXSD 4L3HD 5EMJB 4PC0A 2QC5A 5HQGA 4O1QD 2GC7A 3BG1A 5KDOB 2I0TA 4AEZA 4U1EI 4A08B 3VGZA 3KRWB 5IJ8E 5GXHA 4YVDA 1VYHC 4J87A 3V7DB 3AH8B 2UZYB 3PVUB 3UKRC 4CZVA 3V9FA 1SQJA 3EMHA 1PBYB 2AH0A 4FAND 2IWKA 3VH0A 1JOFA 4XEIC 3DSMA 5FLXg 3JZNA 4BUJC 4ERZA 4ERQA 4CI1A 3J80g 2BCJB 2HJ4A 4ZOVA 4CZYA 4CC9A 5IGQA 3I2NA 2OK6A 4CI2A 4J77A 4JSVC 2IUPA 3NVXA 2PM7B 3RFGA 3UVNA 4A08A 5HE0B 3SFZA 4GGAA 4GM8A 4J8GA 3IJCA 3I8EA 3MZLA 4JT5C 3UVLA 2H47A 5EAPA 4X60B 3ORVD 2AQ5A 4EWRA 4FA1D 3PE7A 3CIKB 3CFSB 3SJLD 3OKWA 3RLMD 2I0SA 3PXTD 2G99A 3EI1B 2UZXB 2B5NA 3DXMC 4HDJA 2CE9A 4FA5D 4QQEA 2PM6B 3EWEA 2J57G 5FKTA 1XKSA 2H6KA 2P9NC 3ODTA 2P9IC 1PGUA 2AGXA 2I3TA 1XIPA 2Q7QA 3FRXA 2XYIA 4L3GD 3SBPA 1L0QA 3PXWD 4GMBA 4GQBB 4K3JB 3UVOA 3DWLC 3FM0A 4PBYA 2B5LA 3RN1D 3EI1A 3BWSA 4ESGA 5K1CC 4A11B 3I89A 3NVNA 5FKSA 3IJ0A 3IKOA 4FA9D 3JZGA 2H68A 2OK4A 1R5MA 2Z2NA 5FKRA 4A2MA 2B5MA 3MMYA 5GXIA 2P9KC 4GQ1A 4QRJA 3AFCA 3KRXB 5EM2B 3C9CA 3A0FA 1QNIA 3I7OA 4LG9A 4KFMB 4L1QD 3EI2B 4ZN4A 4CY1A 4JSNC 4N14A 5EAMA 3SMRA 2GC4A 4A11A 5EMLB 2AH1A 2G9AA 4J0WA 4J84A 2OVPB 3JROA 3L4OD 5H17A 4O45A 5HE3B 3SWSD 5TEEA 1A0RB 2H9LA 3OTTA 3MXXA 1PEVA 4ES0A 5GSAA 3SBRA 3GREA 4LG8A 3C99A 5EM2A 4NSXA 5I5MA 2XL2A 3JPXA 5AJAA 2H13A 5CXCB 4J78A 4O3UB 3W15A 2CO0C 3EI2A 3SLED 5C9ZB 4OWRA 3RFHA 4X63B 1GOTB 4A0AB 4J8BA 1MG2A 2AGYA 3PVWB 4G56B 5IC7A 3N0DA 4JXMA 2CO0A 1RI6A 4FHLA 2J55H 4H5JA 4CY5A 2P9LC 3RN0D 4FWWA 5I5IA 5B4WA 3UKUC 3JRPA 4A2LA 4E5ZB 1K8KC 3OKYB 1XHMA 2H6QA 4R7AB 2HKRA 4O9DA 1N6FA 3DM0A 5IJ7E 4CI3A 2J56H 2MTAH 1K32A 5IGOA 2YNPA 4BH6A 4A09B 5CXCA 2YNOA 2H14A 3IIYA 5EALA 4JD2C 4GQ2P 4H5IA 4A0AA 5H14A 2QXVA 4E54B 3I7KA 4J82A 1TYQC 3V5WB 3AL8B 2I3SA 2OVQB 3J81g 2IAAA 1S4UX 3DXKC 4E5ZA 2BBKH 4X3EA 3OKYA 4QT8A 4A0BB 5JWZA 1TBGA 2H9NA 3EU7A 3SXTD 2GNQA 1MDAH 3GFCA 3UR4A 2B4EA 3I7HA 4O3TB 3I7LA 4A09A 3P4FA 3MKSB 3IIWA 4PNKB 5HE1B 3SVWD 4J0XA 4PSXB 2P9UC 2XL3A 4E54A 4J86A 2P9SC 3E0CA 4ZOZA 3F3PA 5FQDA 1OLZA 3MZKA 3AL8A 5AFU3 3OKTA 4Z8LA 5THAA 5HYNB 3U4YA 1GG2B 4L9OA 1U2VC 4A0BA 4JSPC 5FXYA 5CXBB 2W18A 4U7AA 3IJ1A 4FA4D 3SCYA 5IT9g 3UVMA 2YBAA 4IMMA 3SBQA 4GGDA 3ULEC 4Y7RA 5CYKB 2CNXA 2IUQA 4IA9A 2CN2A 2H6NA 3EI3B 4A7JA 4BL0A 2EBSA 4X61B 4K3ID 4GGCA 1MG3A 3K26A 2AGZA 3MKQA 5I5JA 3PSLA 1ERJA 3F3GA 5A2Qg 3SN6B 5CXBA 3BG0A 3SHFA 2H3XA 4PSWB 4D0KA 3I8CA 1N6EA 3RSEC 1GXRA 4GM3A 1YFQA 2HKMA 4MK0B 2HESX 4XYIA 3VA6A 5CYKA 5C2VB 3JZHA 5GMKn 5K19A 2P9PC 3EI3A 3OW8A 4I79A 2YMUA 4ERYA 1P22A 4UI9R 3UVKA 5FA5B 3K27A 1B9XA 1OMWB 4ZOYA 4PBZA 3FGBA 2AGWA 1NR0A 2H9MA 2TRCB 4QL1A 2HXCA 2OJYA 3N0EA 4GZ8A 3EI4B 2HJBA 3EG6A 3AL9A 4J73A 4ZOXA 3RRMC 4FB1D 4TZ4A 1SQ9A 1SHYB 5FKQA 4JSXC 3I7PA 5TF2A 3C5MA 4CZXA 4GM9A 4XYHA 1JMXB 3C75H 3OL2B 4LGNA 2IURA 3JAMg 4AOWA 4J81A 2HYEA 1N6DA 3I7NA 3F3FA 2IUVA 2XU7A 3HFQA 1JJUB 5EMKB 5H1MA 5TEFA 4CY3A 3EI4A 1FWXA 1GP2B 1NEXB 2Z2OA 4JT6C 2PM9B 4PXWA 4CY2A 4D6VA 2IWFA 2YNNA 1JMZB 2CN3A 2O9KA 1B9YA 2CE8A 5TDHB 3RMZD 5EMMB 5HE2B 2I0RA 4CI8A 2OVRB 3L4MD 3NVQA 3ZWLB 1PI6A 4FAVD 3OL2A 3JB9L 2PBIB 3CFVA 4Y5RD
chains in the Genus database with same CATH superfamily
2AGLA 1VZ3A 2Z2PA 3PSCB 1L5GA 2H9PA 5AMSA 2OIZA 1U4CA 5SXMA 1UOOA 5EARA 3B7FA 3ZE0A 2PM9A 2VDLA 5C2WB 4NBMA 2YB8B 3IUQA 4OZUA 2XE4A 1Q47A 1U8CA 4J79A 3PXSD 5E6UA 1A12A 4L3HD 5EMJB 4PC0A 1E8MA 2QC5A 5HQGA 4O1QD 2GC7A 3BG1A 5KDOB 2I0TA 2QR5A 4AEZA 3VI3A 4U1EI 4A08B 3VGZA 3KRWB 5IJ8E 5GXHA 4YVDA 1O6FA 4NC4A 1VYHC 4J87A 3V7DB 3AH8B 2UZYB 3PVUB 2VDRA 3UKRC 4CZVA 3V9FA 1SQJA 3EMHA 1PBYB 2AH0A 4FAND 2IWKA 3VH0A 1JOFA 4XEIC 3DSMA 5FLXg 3ZE2A 1YR2A 3O4HA 3JZNA 5E6RA 4BUJC 4ERZA 2WQ8A 2HU5A 4ERQA 1GOGA 4CI1A 3J80g 2BCJB 2HJ4A 3GD1I 4ZOVA 3T3PA 4CZYA 4CC9A 4G1EA 5IGQA 2BKLA 3I2NA 2OK6A 4CI2A 4J77A 4JSVC 2IUPA 3NVXA 2PM7B 3RFGA 3UVNA 4A08A 5HE0B 3SFZA 4GGAA 4BCCA 4GM8A 4J8GA 3IJCA 1JTDB 2HU7A 3I8EA 3MZLA 4JT5C 3UVLA 2H47A 1C9LA 5EAPA 4AN0A 4O2WA 4X60B 3ORVD 2AQ5A 4EWRA 4FA1D 3PE7A 3O4GA 3K71A 4UM9A 4RE5A 4D9SA 3CIKB 3CFSB 3SJLD 3OKWA 3RLMD 2VDMA 2I0SA 3PXTD 3NIDA 3OF7A 2G99A 3EI1B 2UZXB 2B5NA 3DXMC 5M5RA 4HDJA 2CE9A 4FA5D 4QQEA 1UTCA 2PM6B 3EWEA 4IRZA 2J57G 3KCIA 5FKTA 5M61A 1XKSA 3MUNA 2H6KA 2P9NC 3DDUA 3ODTA 3IURA 2P9IC 1PGUA 2AGXA 2I3TA 3QHYB 1XIPA 2Q7QA 3FRXA 2XYIA 4L3GD 3SBPA 1L0QA 3PXWD 4UM8A 3ZE1A 3NIGA 2VZ3A 4GMBA 4GQBB 1E5TA 4K3JB 3UVOA 3DWLC 1GOHA 3FM0A 4PBYA 2B5LA 3RN1D 3EI1A 1M1XA 1K3IA 3BWSA 4ESGA 5K1CC 4A11B 3I89A 3NVNA 5FKSA 3IJ0A 3EQ7A 3IKOA 4FA9D 1H2ZA 3O4IA 4BP8A 3IUNA 3JZGA 2H68A 2OK4A 1R5MA 2Z2NA 1I2MB 5FKRA 4A2MA 2B5MA 3MMYA 3K72A 5GXIA 2P9KC 4GQ1A 4QRJA 3AFCA 3KRXB 5EM2B 3C9CA 3A0FA 1QNIA 3I7OA 4LG9A 4KFMB 4L1QD 3EI2B 4ZN4A 4AMZA 2EICA 4CY1A 4JSNC 4N14A 5EAMA 3SMRA 3EQ9A 2GC4A 2VC2A 4A11A 5EMLB 3FCUA 2AH1A 4MMYA 2VDOA 3IUMA 4Z7OA 2G9AA 4J0WA 4J84A 4DNWA 4AN1A 2OVPB 3JROA 3L4OD 5H17A 4O45A 5HE3B 3SWSD 5TEEA 1A0RB 2EIBA 2H9LA 3OTTA 3QI0A 5FFOA 3MXXA 1PEVA 1VZ2A 4ES0A 2VZ1A 5GSAA 3SBRA 3GREA 4LG8A 3C99A 5EM2A 4NSXA 5I5MA 2XL2A 3JPXA 5AJAA 1TYEA 1UOQA 2H13A 4J78A 5CXCB 4O3UB 3W15A 2CO0C 3EI2A 2EIDA 3SLED 4BCDA 5C9ZB 4OWRA 3RFHA 4X63B 1GOFA 1GOTB 3T3MA 4A0AB 1MG2A 2AGYA 3PVWB 4G56B 4J8BA 5IC7A 3IULA 3N0DA 3V4VA 4JXMA 2CO0A 1RI6A 3ZDYA 4FHLA 2J55H 4H5JA 3MUOA 4CY5A 2P9LC 3RN0D 4FWWA 4MMZA 5I5IA 5B4WA 3UKUC 3JRPA 5E6SA 4A2LA 4E5ZB 1K8KC 3OKYB 1XHMA 2H6QA 4R7AB 2HKRA 1N6FA 4O9DA 3DM0A 5IJ7E 4CI3A 2J56H 2MTAH 1K32A 5IGOA 2YNPA 4BH6A 2EIEA 4A09B 5CXCA 2YNOA 2H14A 3IIYA 5EALA 4JD2C 4NENA 4GQ2P 4H5IA 4A0AA 3GC3B 5H14A 2QXVA 4E54B 3I7KA 4J82A 1TYQC 4JHPC 4RE6A 3AL8B 3V5WB 2I3SA 2OVQB 3J81g 2IAAA 3O4JA 2VDPA 1S4UX 3VI4A 3MVDK 3DXKC 4E5ZA 5M5VA 2BBKH 4X3EA 3OKYA 4QT8A 4A0BB 5JWZA 1TBGA 4Z7NA 2H9NA 3EU7A 3SXTD 2GNQA 1MDAH 3GFCA 3UR4A 2B4EA 3I7HA 4O3TB 3I7LA 4A09A 1VE7A 5FFGA 3P4FA 3MKSB 4BCBA 3IIWA 4PNKB 5HE1B 3SVWD 4WK0A 4J0XA 4PSXB 2P9UC 2XL3A 4E54A 4J86A 2P9SC 3E0CA 4ZOZA 3F3PA 4L1MA 5FQDA 1OLZA 3MZKA 3AL8A 5AFU3 3OKTA 4Z8LA 5THAA 3EQ8A 4DNVA 5HYNB 3U4YA 1GG2B 4L9OA 1U2VC 4A0BA 4JSPC 5FXYA 5C92A 5CXBB 2W18A 4U7AA 3IJ1A 4FA4D 3SCYA 2XDWA 1QFSA 5IT9g 3UVMA 2YBAA 2HU8A 1H2XA 4IMMA 3SBQA 4GGDA 3ULEC 4Y7RA 5CYKB 4O02A 2CNXA 2IUQA 3K6SA 4IA9A 2CN2A 5M5SA 2H6NA 3EI3B 4A7JA 4BL0A 2EBSA 4X61B 4K3ID 1VE6A 4GGCA 3V4PA 1MG3A 3K26A 4DNUA 2AGZA 3MKQA 5I5JA 3PSLA 1ERJA 3F3GA 5A2Qg 3IVMA 3SN6B 5CXBA 3BG0A 3SHFA 2H3XA 4PSWB 4D0KA 1QFMA 3I8CA 1N6EA 1O6GA 3NIFA 3RSEC 1T2XA 1GXRA 3FCSA 4GM3A 1YFQA 1BPOA 2HKMA 4MK0B 3ZDZA 2HESX 4XYIA 3IUJA 3VA6A 5CYKA 5C2VB 3JZHA 5GMKn 5K19A 4G1MA 4QAMA 4BP9A 2P9PC 3EI3A 3OW8A 4I79A 2YMUA 5C86A 4ERYA 1P22A 4UI9R 3UVKA 5FA5B 3K27A 1B9XA 5HDBA 1OMWB 4ZOYA 4PBZA 3FGBA 4MMXA 2AGWA 1NR0A 2H9MA 2TRCB 3CFVA 4QL1A 2HXCA 2OJYA 3N0EA 4GZ8A 3EI4B 2HJBA 1E8NA 3EG6A 3AL9A 4J73A 4ZOXA 5M5UA 3RRMC 4FB1D 4TZ4A 4WJKA 1H2WA 1SQ9A 1SHYB 3ZDXA 4JHNA 4JSXC 5FKQA 4G55A 3I7PA 5TF2A 3C5MA 4CZXA 4Z7QA 1UOPA 4GM9A 4XYHA 1JMXB 3C75H 3OL2B 4LGNA 2IURA 3JAMg 4AOWA 2VDKA 4J81A 2HYEA 1N6DA 4WK2A 3I7NA 3F3FA 2IUVA 2XU7A 4WK4A 3HFQA 1JJUB 5EMKB 5H1MA 5TEFA 4CY3A 3EI4A 1FWXA 1GP2B 1NEXB 2Z2OA 2JKXA 4JT6C 1JV2A 2PM9B 4PXWA 4CY2A 4D6VA 2IWFA 4AX4A 2YNNA 1JMZB 2CN3A 2O9KA 1B9YA 2CE8A 5TDHB 1H2YA 3RMZD 4NAAA 5EMMB 5HE2B 2I0RA 2QZPA 4CI8A 2OVRB 3L4MD 3NVQA 3ZWLB 2VDQA 1PI6A 4FAVD 3OL2A 4AMYA 3JB9L 2VDNA 5M5TA 1C9IA 2XZGA 2PBIB 3IJEA 4Y5RD
chains in the Genus database with same CATH topology
2AGLA 2Z2PA 3PSCB 5AMSA 2H9PA 2OIZA 1U4CA 5SXMA 5EARA 3B7FA 2PM9A 5C2WB 2YB8B 4OZUA 1Q47A 4J79A 3PXSD 4L3HD 5EMJB 4PC0A 2QC5A 5HQGA 4O1QD 2GC7A 3BG1A 5KDOB 2I0TA 4AEZA 4U1EI 4A08B 3VGZA 3KRWB 5IJ8E 5GXHA 4YVDA 1VYHC 4J87A 3V7DB 3AH8B 2UZYB 3PVUB 3UKRC 4CZVA 3V9FA 1SQJA 3EMHA 1PBYB 2AH0A 4FAND 2IWKA 3VH0A 1JOFA 4XEIC 3DSMA 5FLXg 3JZNA 4BUJC 4ERZA 4ERQA 4CI1A 3J80g 2BCJB 2HJ4A 4ZOVA 4CZYA 4CC9A 5IGQA 3I2NA 2OK6A 4CI2A 4J77A 4JSVC 2IUPA 3NVXA 2PM7B 3RFGA 3UVNA 4A08A 5HE0B 3SFZA 4GGAA 4GM8A 4J8GA 3IJCA 3I8EA 3MZLA 4JT5C 3UVLA 2H47A 5EAPA 4X60B 3ORVD 2AQ5A 4EWRA 4FA1D 3PE7A 3CIKB 3CFSB 3SJLD 3OKWA 3RLMD 2I0SA 3PXTD 2G99A 3EI1B 2UZXB 2B5NA 3DXMC 4HDJA 2CE9A 4FA5D 4QQEA 2PM6B 3EWEA 2J57G 5FKTA 1XKSA 2H6KA 2P9NC 3ODTA 2P9IC 1PGUA 2AGXA 2I3TA 1XIPA 2Q7QA 3FRXA 2XYIA 4L3GD 3SBPA 1L0QA 3PXWD 4GMBA 4GQBB 4K3JB 3UVOA 3DWLC 3FM0A 4PBYA 2B5LA 3RN1D 3EI1A 3BWSA 4ESGA 5K1CC 4A11B 3I89A 3NVNA 5FKSA 3IJ0A 3IKOA 4FA9D 3JZGA 2H68A 2OK4A 1R5MA 2Z2NA 5FKRA 4A2MA 2B5MA 3MMYA 5GXIA 2P9KC 4GQ1A 4QRJA 3AFCA 3KRXB 5EM2B 3C9CA 3A0FA 1QNIA 3I7OA 4LG9A 4KFMB 4L1QD 3EI2B 4ZN4A 4CY1A 4JSNC 4N14A 5EAMA 3SMRA 2GC4A 4A11A 5EMLB 2AH1A 2G9AA 4J0WA 4J84A 2OVPB 3JROA 3L4OD 5H17A 4O45A 5HE3B 3SWSD 5TEEA 1A0RB 2H9LA 3OTTA 3MXXA 1PEVA 4ES0A 5GSAA 3SBRA 3GREA 4LG8A 3C99A 5EM2A 4NSXA 5I5MA 2XL2A 3JPXA 5AJAA 2H13A 5CXCB 4J78A 4O3UB 3W15A 2CO0C 3EI2A 3SLED 5C9ZB 4OWRA 3RFHA 4X63B 1GOTB 4A0AB 4J8BA 1MG2A 2AGYA 3PVWB 4G56B 5IC7A 3N0DA 4JXMA 2CO0A 1RI6A 4FHLA 2J55H 4H5JA 4CY5A 2P9LC 3RN0D 4FWWA 5I5IA 5B4WA 3UKUC 3JRPA 4A2LA 4E5ZB 1K8KC 3OKYB 1XHMA 2H6QA 4R7AB 2HKRA 4O9DA 1N6FA 3DM0A 5IJ7E 4CI3A 2J56H 2MTAH 1K32A 5IGOA 2YNPA 4BH6A 4A09B 5CXCA 2YNOA 2H14A 3IIYA 5EALA 4JD2C 4GQ2P 4H5IA 4A0AA 5H14A 2QXVA 4E54B 3I7KA 4J82A 1TYQC 3V5WB 3AL8B 2I3SA 2OVQB 3J81g 2IAAA 1S4UX 3DXKC 4E5ZA 2BBKH 4X3EA 3OKYA 4QT8A 4A0BB 5JWZA 1TBGA 2H9NA 3EU7A 3SXTD 2GNQA 1MDAH 3GFCA 3UR4A 2B4EA 3I7HA 4O3TB 3I7LA 4A09A 3P4FA 3MKSB 3IIWA 4PNKB 5HE1B 3SVWD 4J0XA 4PSXB 2P9UC 2XL3A 4E54A 4J86A 2P9SC 3E0CA 4ZOZA 3F3PA 5FQDA 1OLZA 3MZKA 3AL8A 5AFU3 3OKTA 4Z8LA 5THAA 5HYNB 3U4YA 1GG2B 4L9OA 1U2VC 4A0BA 4JSPC 5FXYA 5CXBB 2W18A 4U7AA 3IJ1A 4FA4D 3SCYA 5IT9g 3UVMA 2YBAA 4IMMA 3SBQA 4GGDA 3ULEC 4Y7RA 5CYKB 2CNXA 2IUQA 4IA9A 2CN2A 2H6NA 3EI3B 4A7JA 4BL0A 2EBSA 4X61B 4K3ID 4GGCA 1MG3A 3K26A 2AGZA 3MKQA 5I5JA 3PSLA 1ERJA 3F3GA 5A2Qg 3SN6B 5CXBA 3BG0A 3SHFA 2H3XA 4PSWB 4D0KA 3I8CA 1N6EA 3RSEC 1GXRA 4GM3A 1YFQA 2HKMA 4MK0B 2HESX 4XYIA 3VA6A 5CYKA 5C2VB 3JZHA 5GMKn 5K19A 2P9PC 3EI3A 3OW8A 4I79A 2YMUA 4ERYA 1P22A 4UI9R 3UVKA 5FA5B 3K27A 1B9XA 1OMWB 4ZOYA 4PBZA 3FGBA 2AGWA 1NR0A 2H9MA 2TRCB 4QL1A 2HXCA 2OJYA 3N0EA 4GZ8A 3EI4B 2HJBA 3EG6A 3AL9A 4J73A 4ZOXA 3RRMC 4FB1D 4TZ4A 1SQ9A 1SHYB 5FKQA 4JSXC 3I7PA 5TF2A 3C5MA 4CZXA 4GM9A 4XYHA 1JMXB 3C75H 3OL2B 4LGNA 2IURA 3JAMg 4AOWA 4J81A 2HYEA 1N6DA 3I7NA 3F3FA 2IUVA 2XU7A 3HFQA 1JJUB 5EMKB 5H1MA 5TEFA 4CY3A 3EI4A 1FWXA 1GP2B 1NEXB 2Z2OA 4JT6C 2PM9B 4PXWA 4CY2A 4D6VA 2IWFA 2YNNA 1JMZB 2CN3A 2O9KA 1B9YA 2CE8A 5TDHB 3RMZD 5EMMB 5HE2B 2I0RA 4CI8A 2OVRB 3L4MD 3NVQA 3ZWLB 1PI6A 4FAVD 3OL2A 3JB9L 2PBIB 3CFVA 4Y5RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGL A;  2Z2P A;  3PSC B;  5AMS A;  2H9P A;  2OIZ A;  1U4C A;  5SXM A;  5EAR A;  3B7F A;  2PM9 A;  5C2W B;  2YB8 B;  4OZU A;  1Q47 A;  4J79 A;  3PXS D;  4L3H D;  5EMJ B;  4PC0 A;  2QC5 A;  5HQG A;  4O1Q D;  2GC7 A;  3BG1 A;  5KDO B;  2I0T A;  4AEZ A;  4U1E I;  4A08 B;  3VGZ A;  3KRW B;  5IJ8 E;  5GXH A;  4YVD A;  1VYH C;  4J87 A;  3V7D B;  3AH8 B;  2UZY B;  3PVU B;  3UKR C;  4CZV A;  3V9F A;  1SQJ A;  3EMH A;  1PBY B;  2AH0 A;  4FAN D;  2IWK A;  3VH0 A;  1JOF A;  4XEI C;  3DSM A;  5FLX g;  3JZN A;  4BUJ C;  4ERZ A;  4ERQ A;  4CI1 A;  3J80 g;  2BCJ B;  2HJ4 A;  4ZOV A;  4CZY A;  4CC9 A;  5IGQ A;  3I2N A;  2OK6 A;  4CI2 A;  4J77 A;  4JSV C;  2IUP A;  3NVX A;  2PM7 B;  3RFG A;  3UVN A;  4A08 A;  5HE0 B;  3SFZ A;  4GGA A;  4GM8 A;  4J8G A;  3IJC A;  3I8E A;  3MZL A;  4JT5 C;  3UVL A;  2H47 A;  5EAP A;  4X60 B;  3ORV D;  2AQ5 A;  4EWR A;  4FA1 D;  3PE7 A;  3CIK B;  3CFS B;  3SJL D;  3OKW A;  3RLM D;  2I0S A;  3PXT D;  2G99 A;  3EI1 B;  2UZX B;  2B5N A;  3DXM C;  4HDJ A;  2CE9 A;  4FA5 D;  4QQE A;  2PM6 B;  3EWE A;  2J57 G;  5FKT A;  1XKS A;  2H6K A;  2P9N C;  3ODT A;  2P9I C;  1PGU A;  2AGX A;  2I3T A;  1XIP A;  2Q7Q A;  3FRX A;  2XYI A;  4L3G D;  3SBP A;  1L0Q A;  3PXW D;  4GMB A;  4GQB B;  4K3J B;  3UVO A;  3DWL C;  3FM0 A;  4PBY A;  2B5L A;  3RN1 D;  3EI1 A;  3BWS A;  4ESG A;  5K1C C;  4A11 B;  3I89 A;  3NVN A;  5FKS A;  3IJ0 A;  3IKO A;  4FA9 D;  3JZG A;  2H68 A;  2OK4 A;  1R5M A;  2Z2N A;  5FKR A;  4A2M A;  2B5M A;  3MMY A;  5GXI A;  2P9K C;  4GQ1 A;  4QRJ A;  3AFC A;  3KRX B;  5EM2 B;  3C9C A;  3A0F A;  1QNI A;  3I7O A;  4LG9 A;  4KFM B;  4L1Q D;  3EI2 B;  4ZN4 A;  4CY1 A;  4JSN C;  4N14 A;  5EAM A;  3SMR A;  2GC4 A;  4A11 A;  5EML B;  2AH1 A;  2G9A A;  4J0W A;  4J84 A;  2OVP B;  3JRO A;  3L4O D;  5H17 A;  4O45 A;  5HE3 B;  3SWS D;  5TEE A;  1A0R B;  2H9L A;  3OTT A;  3MXX A;  1PEV A;  4ES0 A;  5GSA A;  3SBR A;  3GRE A;  4LG8 A;  3C99 A;  5EM2 A;  4NSX A;  5I5M A;  2XL2 A;  3JPX A;  5AJA A;  2H13 A;  5CXC B;  4J78 A;  4O3U B;  3W15 A;  2CO0 C;  3EI2 A;  3SLE D;  5C9Z B;  4OWR A;  3RFH A;  4X63 B;  1GOT B;  4A0A B;  4J8B A;  1MG2 A;  2AGY A;  3PVW B;  4G56 B;  5IC7 A;  3N0D A;  4JXM A;  2CO0 A;  1RI6 A;  4FHL A;  2J55 H;  4H5J A;  4CY5 A;  2P9L C;  3RN0 D;  4FWW A;  5I5I A;  5B4W A;  3UKU C;  3JRP A;  4A2L A;  4E5Z B;  1K8K C;  3OKY B;  1XHM A;  2H6Q A;  4R7A B;  2HKR A;  4O9D A;  1N6F A;  3DM0 A;  5IJ7 E;  4CI3 A;  2J56 H;  2MTA H;  1K32 A;  5IGO A;  2YNP A;  4BH6 A;  4A09 B;  5CXC A;  2YNO A;  2H14 A;  3IIY A;  5EAL A;  4JD2 C;  4GQ2 P;  4H5I A;  4A0A A;  5H14 A;  2QXV A;  4E54 B;  3I7K A;  4J82 A;  1TYQ C;  3V5W B;  3AL8 B;  2I3S A;  2OVQ B;  3J81 g;  2IAA A;  1S4U X;  3DXK C;  4E5Z A;  2BBK H;  4X3E A;  3OKY A;  4QT8 A;  4A0B B;  5JWZ A;  1TBG A;  2H9N A;  3EU7 A;  3SXT D;  2GNQ A;  1MDA H;  3GFC A;  3UR4 A;  2B4E A;  3I7H A;  4O3T B;  3I7L A;  4A09 A;  3P4F A;  3MKS B;  3IIW A;  4PNK B;  5HE1 B;  3SVW D;  4J0X A;  4PSX B;  2P9U C;  2XL3 A;  4E54 A;  4J86 A;  2P9S C;  3E0C A;  4ZOZ A;  3F3P A;  5FQD A;  1OLZ A;  3MZK A;  3AL8 A;  5AFU 3;  3OKT A;  4Z8L A;  5THA A;  5HYN B;  3U4Y A;  1GG2 B;  4L9O A;  1U2V C;  4A0B A;  4JSP C;  5FXY A;  5CXB B;  2W18 A;  4U7A A;  3IJ1 A;  4FA4 D;  3SCY A;  5IT9 g;  3UVM A;  2YBA A;  4IMM A;  3SBQ A;  4GGD A;  3ULE C;  4Y7R A;  5CYK B;  2CNX A;  2IUQ A;  4IA9 A;  2CN2 A;  2H6N A;  3EI3 B;  4A7J A;  4BL0 A;  2EBS A;  4X61 B;  4K3I D;  4GGC A;  1MG3 A;  3K26 A;  2AGZ A;  3MKQ A;  5I5J A;  3PSL A;  1ERJ A;  3F3G A;  5A2Q g;  3SN6 B;  5CXB A;  3BG0 A;  3SHF A;  2H3X A;  4PSW B;  4D0K A;  3I8C A;  1N6E A;  3RSE C;  1GXR A;  4GM3 A;  1YFQ A;  2HKM A;  4MK0 B;  2HES X;  4XYI A;  3VA6 A;  5CYK A;  5C2V B;  3JZH A;  5GMK n;  5K19 A;  2P9P C;  3EI3 A;  3OW8 A;  4I79 A;  2YMU A;  4ERY A;  1P22 A;  4UI9 R;  3UVK A;  5FA5 B;  3K27 A;  1B9X A;  1OMW B;  4ZOY A;  4PBZ A;  3FGB A;  2AGW A;  1NR0 A;  2H9M A;  2TRC B;  4QL1 A;  2HXC A;  2OJY A;  3N0E A;  4GZ8 A;  3EI4 B;  2HJB A;  3EG6 A;  3AL9 A;  4J73 A;  4ZOX A;  3RRM C;  4FB1 D;  4TZ4 A;  1SQ9 A;  1SHY B;  5FKQ A;  4JSX C;  3I7P A;  5TF2 A;  3C5M A;  4CZX A;  4GM9 A;  4XYH A;  1JMX B;  3C75 H;  3OL2 B;  4LGN A;  2IUR A;  3JAM g;  4AOW A;  4J81 A;  2HYE A;  1N6D A;  3I7N A;  3F3F A;  2IUV A;  2XU7 A;  3HFQ A;  1JJU B;  5EMK B;  5H1M A;  5TEF A;  4CY3 A;  3EI4 A;  1FWX A;  1GP2 B;  1NEX B;  2Z2O A;  4JT6 C;  2PM9 B;  4PXW A;  4CY2 A;  4D6V A;  2IWF A;  2YNN A;  1JMZ B;  2CN3 A;  2O9K A;  1B9Y A;  2CE8 A;  5TDH B;  3RMZ D;  5EMM B;  5HE2 B;  2I0R A;  4CI8 A;  2OVR B;  3L4M D;  3NVQ A;  3ZWL B;  1PI6 A;  4FAV D;  3OL2 A;  3JB9 L;  2PBI B;  3CFV A;  4Y5R D; 
#chains in the Genus database with same CATH topology
 2AGL A;  1VZ3 A;  2Z2P A;  3PSC B;  1L5G A;  2H9P A;  5AMS A;  2OIZ A;  1U4C A;  5SXM A;  1UOO A;  5EAR A;  3B7F A;  3ZE0 A;  2PM9 A;  2VDL A;  5C2W B;  4NBM A;  2YB8 B;  3IUQ A;  4OZU A;  2XE4 A;  1Q47 A;  1U8C A;  4J79 A;  3PXS D;  5E6U A;  1A12 A;  4L3H D;  5EMJ B;  4PC0 A;  1E8M A;  2QC5 A;  5HQG A;  4O1Q D;  2GC7 A;  3BG1 A;  5KDO B;  2I0T A;  2QR5 A;  4AEZ A;  3VI3 A;  4U1E I;  4A08 B;  3VGZ A;  3KRW B;  5IJ8 E;  5GXH A;  4YVD A;  1O6F A;  4NC4 A;  1VYH C;  4J87 A;  3V7D B;  3AH8 B;  2UZY B;  3PVU B;  2VDR A;  3UKR C;  4CZV A;  3V9F A;  1SQJ A;  3EMH A;  1PBY B;  2AH0 A;  4FAN D;  2IWK A;  3VH0 A;  1JOF A;  4XEI C;  3DSM A;  5FLX g;  3ZE2 A;  1YR2 A;  3O4H A;  3JZN A;  5E6R A;  4BUJ C;  4ERZ A;  2WQ8 A;  2HU5 A;  4ERQ A;  1GOG A;  4CI1 A;  3J80 g;  2BCJ B;  2HJ4 A;  3GD1 I;  4ZOV A;  3T3P A;  4CZY A;  4CC9 A;  4G1E A;  5IGQ A;  2BKL A;  3I2N A;  2OK6 A;  4CI2 A;  4J77 A;  4JSV C;  2IUP A;  3NVX A;  2PM7 B;  3RFG A;  3UVN A;  4A08 A;  5HE0 B;  3SFZ A;  4GGA A;  4BCC A;  4GM8 A;  4J8G A;  3IJC A;  1JTD B;  2HU7 A;  3I8E A;  3MZL A;  4JT5 C;  3UVL A;  2H47 A;  1C9L A;  5EAP A;  4AN0 A;  4O2W A;  4X60 B;  3ORV D;  2AQ5 A;  4EWR A;  4FA1 D;  3PE7 A;  3O4G A;  3K71 A;  4UM9 A;  4RE5 A;  4D9S A;  3CIK B;  3CFS B;  3SJL D;  3OKW A;  3RLM D;  2VDM A;  2I0S A;  3PXT D;  3NID A;  3OF7 A;  2G99 A;  3EI1 B;  2UZX B;  2B5N A;  3DXM C;  5M5R A;  4HDJ A;  2CE9 A;  4FA5 D;  4QQE A;  1UTC A;  2PM6 B;  3EWE A;  4IRZ A;  2J57 G;  3KCI A;  5FKT A;  5M61 A;  1XKS A;  3MUN A;  2H6K A;  2P9N C;  3DDU A;  3ODT A;  3IUR A;  2P9I C;  1PGU A;  2AGX A;  2I3T A;  3QHY B;  1XIP A;  2Q7Q A;  3FRX A;  2XYI A;  4L3G D;  3SBP A;  1L0Q A;  3PXW D;  4UM8 A;  3ZE1 A;  3NIG A;  2VZ3 A;  4GMB A;  4GQB B;  1E5T A;  4K3J B;  3UVO A;  3DWL C;  1GOH A;  3FM0 A;  4PBY A;  2B5L A;  3RN1 D;  3EI1 A;  1M1X A;  1K3I A;  3BWS A;  4ESG A;  5K1C C;  4A11 B;  3I89 A;  3NVN A;  5FKS A;  3IJ0 A;  3EQ7 A;  3IKO A;  4FA9 D;  1H2Z A;  3O4I A;  4BP8 A;  3IUN A;  3JZG A;  2H68 A;  2OK4 A;  1R5M A;  2Z2N A;  1I2M B;  5FKR A;  4A2M A;  2B5M A;  3MMY A;  3K72 A;  5GXI A;  2P9K C;  4GQ1 A;  4QRJ A;  3AFC A;  3KRX B;  5EM2 B;  3C9C A;  3A0F A;  1QNI A;  3I7O A;  4LG9 A;  4KFM B;  4L1Q D;  3EI2 B;  4ZN4 A;  4AMZ A;  2EIC A;  4CY1 A;  4JSN C;  4N14 A;  5EAM A;  3SMR A;  3EQ9 A;  2GC4 A;  2VC2 A;  4A11 A;  5EML B;  3FCU A;  2AH1 A;  4MMY A;  2VDO A;  3IUM A;  4Z7O A;  2G9A A;  4J0W A;  4J84 A;  4DNW A;  4AN1 A;  2OVP B;  3JRO A;  3L4O D;  5H17 A;  4O45 A;  5HE3 B;  3SWS D;  5TEE A;  1A0R B;  2EIB A;  2H9L A;  3OTT A;  3QI0 A;  5FFO A;  3MXX A;  1PEV A;  1VZ2 A;  4ES0 A;  2VZ1 A;  5GSA A;  3SBR A;  3GRE A;  4LG8 A;  3C99 A;  5EM2 A;  4NSX A;  5I5M A;  2XL2 A;  3JPX A;  5AJA A;  1TYE A;  1UOQ A;  2H13 A;  4J78 A;  5CXC B;  4O3U B;  3W15 A;  2CO0 C;  3EI2 A;  2EID A;  3SLE D;  4BCD A;  5C9Z B;  4OWR A;  3RFH A;  4X63 B;  1GOF A;  1GOT B;  3T3M A;  4A0A B;  1MG2 A;  2AGY A;  3PVW B;  4G56 B;  4J8B A;  5IC7 A;  3IUL A;  3N0D A;  3V4V A;  4JXM A;  2CO0 A;  1RI6 A;  3ZDY A;  4FHL A;  2J55 H;  4H5J A;  3MUO A;  4CY5 A;  2P9L C;  3RN0 D;  4FWW A;  4MMZ A;  5I5I A;  5B4W A;  3UKU C;  3JRP A;  5E6S A;  4A2L A;  4E5Z B;  1K8K C;  3OKY B;  1XHM A;  2H6Q A;  4R7A B;  2HKR A;  1N6F A;  4O9D A;  3DM0 A;  5IJ7 E;  4CI3 A;  2J56 H;  2MTA H;  1K32 A;  5IGO A;  2YNP A;  4BH6 A;  2EIE A;  4A09 B;  5CXC A;  2YNO A;  2H14 A;  3IIY A;  5EAL A;  4JD2 C;  4NEN A;  4GQ2 P;  4H5I A;  4A0A A;  3GC3 B;  5H14 A;  2QXV A;  4E54 B;  3I7K A;  4J82 A;  1TYQ C;  4JHP C;  4RE6 A;  3AL8 B;  3V5W B;  2I3S A;  2OVQ B;  3J81 g;  2IAA A;  3O4J A;  2VDP A;  1S4U X;  3VI4 A;  3MVD K;  3DXK C;  4E5Z A;  5M5V A;  2BBK H;  4X3E A;  3OKY A;  4QT8 A;  4A0B B;  5JWZ A;  1TBG A;  4Z7N A;  2H9N A;  3EU7 A;  3SXT D;  2GNQ A;  1MDA H;  3GFC A;  3UR4 A;  2B4E A;  3I7H A;  4O3T B;  3I7L A;  4A09 A;  1VE7 A;  5FFG A;  3P4F A;  3MKS B;  4BCB A;  3IIW A;  4PNK B;  5HE1 B;  3SVW D;  4WK0 A;  4J0X A;  4PSX B;  2P9U C;  2XL3 A;  4E54 A;  4J86 A;  2P9S C;  3E0C A;  4ZOZ A;  3F3P A;  4L1M A;  5FQD A;  1OLZ A;  3MZK A;  3AL8 A;  5AFU 3;  3OKT A;  4Z8L A;  5THA A;  3EQ8 A;  4DNV A;  5HYN B;  3U4Y A;  1GG2 B;  4L9O A;  1U2V C;  4A0B A;  4JSP C;  5FXY A;  5C92 A;  5CXB B;  2W18 A;  4U7A A;  3IJ1 A;  4FA4 D;  3SCY A;  2XDW A;  1QFS A;  5IT9 g;  3UVM A;  2YBA A;  2HU8 A;  1H2X A;  4IMM A;  3SBQ A;  4GGD A;  3ULE C;  4Y7R A;  5CYK B;  4O02 A;  2CNX A;  2IUQ A;  3K6S A;  4IA9 A;  2CN2 A;  5M5S A;  2H6N A;  3EI3 B;  4A7J A;  4BL0 A;  2EBS A;  4X61 B;  4K3I D;  1VE6 A;  4GGC A;  3V4P A;  1MG3 A;  3K26 A;  4DNU A;  2AGZ A;  3MKQ A;  5I5J A;  3PSL A;  1ERJ A;  3F3G A;  5A2Q g;  3IVM A;  3SN6 B;  5CXB A;  3BG0 A;  3SHF A;  2H3X A;  4PSW B;  4D0K A;  1QFM A;  3I8C A;  1N6E A;  1O6G A;  3NIF A;  3RSE C;  1T2X A;  1GXR A;  3FCS A;  4GM3 A;  1YFQ A;  1BPO A;  2HKM A;  4MK0 B;  3ZDZ A;  2HES X;  4XYI A;  3IUJ A;  3VA6 A;  5CYK A;  5C2V B;  3JZH A;  5GMK n;  5K19 A;  4G1M A;  4QAM A;  4BP9 A;  2P9P C;  3EI3 A;  3OW8 A;  4I79 A;  2YMU A;  5C86 A;  4ERY A;  1P22 A;  4UI9 R;  3UVK A;  5FA5 B;  3K27 A;  1B9X A;  5HDB A;  1OMW B;  4ZOY A;  4PBZ A;  3FGB A;  4MMX A;  2AGW A;  1NR0 A;  2H9M A;  2TRC B;  3CFV A;  4QL1 A;  2HXC A;  2OJY A;  3N0E A;  4GZ8 A;  3EI4 B;  2HJB A;  1E8N A;  3EG6 A;  3AL9 A;  4J73 A;  4ZOX A;  5M5U A;  3RRM C;  4FB1 D;  4TZ4 A;  4WJK A;  1H2W A;  1SQ9 A;  1SHY B;  3ZDX A;  4JHN A;  4JSX C;  5FKQ A;  4G55 A;  3I7P A;  5TF2 A;  3C5M A;  4CZX A;  4Z7Q A;  1UOP A;  4GM9 A;  4XYH A;  1JMX B;  3C75 H;  3OL2 B;  4LGN A;  2IUR A;  3JAM g;  4AOW A;  2VDK A;  4J81 A;  2HYE A;  1N6D A;  4WK2 A;  3I7N A;  3F3F A;  2IUV A;  2XU7 A;  4WK4 A;  3HFQ A;  1JJU B;  5EMK B;  5H1M A;  5TEF A;  4CY3 A;  3EI4 A;  1FWX A;  1GP2 B;  1NEX B;  2Z2O A;  2JKX A;  4JT6 C;  1JV2 A;  2PM9 B;  4PXW A;  4CY2 A;  4D6V A;  2IWF A;  4AX4 A;  2YNN A;  1JMZ B;  2CN3 A;  2O9K A;  1B9Y A;  2CE8 A;  5TDH B;  1H2Y A;  3RMZ D;  4NAA A;  5EMM B;  5HE2 B;  2I0R A;  2QZP A;  4CI8 A;  2OVR B;  3L4M D;  3NVQ A;  3ZWL B;  2VDQ A;  1PI6 A;  4FAV D;  3OL2 A;  4AMY A;  3JB9 L;  2VDN A;  5M5T A;  1C9I A;  2XZG A;  2PBI B;  3IJE A;  4Y5R D; 
#chains in the Genus database with same CATH homology
 2AGL A;  2Z2P A;  3PSC B;  5AMS A;  2H9P A;  2OIZ A;  1U4C A;  5SXM A;  5EAR A;  3B7F A;  2PM9 A;  5C2W B;  2YB8 B;  4OZU A;  1Q47 A;  4J79 A;  3PXS D;  4L3H D;  5EMJ B;  4PC0 A;  2QC5 A;  5HQG A;  4O1Q D;  2GC7 A;  3BG1 A;  5KDO B;  2I0T A;  4AEZ A;  4U1E I;  4A08 B;  3VGZ A;  3KRW B;  5IJ8 E;  5GXH A;  4YVD A;  1VYH C;  4J87 A;  3V7D B;  3AH8 B;  2UZY B;  3PVU B;  3UKR C;  4CZV A;  3V9F A;  1SQJ A;  3EMH A;  1PBY B;  2AH0 A;  4FAN D;  2IWK A;  3VH0 A;  1JOF A;  4XEI C;  3DSM A;  5FLX g;  3JZN A;  4BUJ C;  4ERZ A;  4ERQ A;  4CI1 A;  3J80 g;  2BCJ B;  2HJ4 A;  4ZOV A;  4CZY A;  4CC9 A;  5IGQ A;  3I2N A;  2OK6 A;  4CI2 A;  4J77 A;  4JSV C;  2IUP A;  3NVX A;  2PM7 B;  3RFG A;  3UVN A;  4A08 A;  5HE0 B;  3SFZ A;  4GGA A;  4GM8 A;  4J8G A;  3IJC A;  3I8E A;  3MZL A;  4JT5 C;  3UVL A;  2H47 A;  5EAP A;  4X60 B;  3ORV D;  2AQ5 A;  4EWR A;  4FA1 D;  3PE7 A;  3CIK B;  3CFS B;  3SJL D;  3OKW A;  3RLM D;  2I0S A;  3PXT D;  2G99 A;  3EI1 B;  2UZX B;  2B5N A;  3DXM C;  4HDJ A;  2CE9 A;  4FA5 D;  4QQE A;  2PM6 B;  3EWE A;  2J57 G;  5FKT A;  1XKS A;  2H6K A;  2P9N C;  3ODT A;  2P9I C;  1PGU A;  2AGX A;  2I3T A;  1XIP A;  2Q7Q A;  3FRX A;  2XYI A;  4L3G D;  3SBP A;  1L0Q A;  3PXW D;  4GMB A;  4GQB B;  4K3J B;  3UVO A;  3DWL C;  3FM0 A;  4PBY A;  2B5L A;  3RN1 D;  3EI1 A;  3BWS A;  4ESG A;  5K1C C;  4A11 B;  3I89 A;  3NVN A;  5FKS A;  3IJ0 A;  3IKO A;  4FA9 D;  3JZG A;  2H68 A;  2OK4 A;  1R5M A;  2Z2N A;  5FKR A;  4A2M A;  2B5M A;  3MMY A;  5GXI A;  2P9K C;  4GQ1 A;  4QRJ A;  3AFC A;  3KRX B;  5EM2 B;  3C9C A;  3A0F A;  1QNI A;  3I7O A;  4LG9 A;  4KFM B;  4L1Q D;  3EI2 B;  4ZN4 A;  4CY1 A;  4JSN C;  4N14 A;  5EAM A;  3SMR A;  2GC4 A;  4A11 A;  5EML B;  2AH1 A;  2G9A A;  4J0W A;  4J84 A;  2OVP B;  3JRO A;  3L4O D;  5H17 A;  4O45 A;  5HE3 B;  3SWS D;  5TEE A;  1A0R B;  2H9L A;  3OTT A;  3MXX A;  1PEV A;  4ES0 A;  5GSA A;  3SBR A;  3GRE A;  4LG8 A;  3C99 A;  5EM2 A;  4NSX A;  5I5M A;  2XL2 A;  3JPX A;  5AJA A;  2H13 A;  5CXC B;  4J78 A;  4O3U B;  3W15 A;  2CO0 C;  3EI2 A;  3SLE D;  5C9Z B;  4OWR A;  3RFH A;  4X63 B;  1GOT B;  4A0A B;  4J8B A;  1MG2 A;  2AGY A;  3PVW B;  4G56 B;  5IC7 A;  3N0D A;  4JXM A;  2CO0 A;  1RI6 A;  4FHL A;  2J55 H;  4H5J A;  4CY5 A;  2P9L C;  3RN0 D;  4FWW A;  5I5I A;  5B4W A;  3UKU C;  3JRP A;  4A2L A;  4E5Z B;  1K8K C;  3OKY B;  1XHM A;  2H6Q A;  4R7A B;  2HKR A;  4O9D A;  1N6F A;  3DM0 A;  5IJ7 E;  4CI3 A;  2J56 H;  2MTA H;  1K32 A;  5IGO A;  2YNP A;  4BH6 A;  4A09 B;  5CXC A;  2YNO A;  2H14 A;  3IIY A;  5EAL A;  4JD2 C;  4GQ2 P;  4H5I A;  4A0A A;  5H14 A;  2QXV A;  4E54 B;  3I7K A;  4J82 A;  1TYQ C;  3V5W B;  3AL8 B;  2I3S A;  2OVQ B;  3J81 g;  2IAA A;  1S4U X;  3DXK C;  4E5Z A;  2BBK H;  4X3E A;  3OKY A;  4QT8 A;  4A0B B;  5JWZ A;  1TBG A;  2H9N A;  3EU7 A;  3SXT D;  2GNQ A;  1MDA H;  3GFC A;  3UR4 A;  2B4E A;  3I7H A;  4O3T B;  3I7L A;  4A09 A;  3P4F A;  3MKS B;  3IIW A;  4PNK B;  5HE1 B;  3SVW D;  4J0X A;  4PSX B;  2P9U C;  2XL3 A;  4E54 A;  4J86 A;  2P9S C;  3E0C A;  4ZOZ A;  3F3P A;  5FQD A;  1OLZ A;  3MZK A;  3AL8 A;  5AFU 3;  3OKT A;  4Z8L A;  5THA A;  5HYN B;  3U4Y A;  1GG2 B;  4L9O A;  1U2V C;  4A0B A;  4JSP C;  5FXY A;  5CXB B;  2W18 A;  4U7A A;  3IJ1 A;  4FA4 D;  3SCY A;  5IT9 g;  3UVM A;  2YBA A;  4IMM A;  3SBQ A;  4GGD A;  3ULE C;  4Y7R A;  5CYK B;  2CNX A;  2IUQ A;  4IA9 A;  2CN2 A;  2H6N A;  3EI3 B;  4A7J A;  4BL0 A;  2EBS A;  4X61 B;  4K3I D;  4GGC A;  1MG3 A;  3K26 A;  2AGZ A;  3MKQ A;  5I5J A;  3PSL A;  1ERJ A;  3F3G A;  5A2Q g;  3SN6 B;  5CXB A;  3BG0 A;  3SHF A;  2H3X A;  4PSW B;  4D0K A;  3I8C A;  1N6E A;  3RSE C;  1GXR A;  4GM3 A;  1YFQ A;  2HKM A;  4MK0 B;  2HES X;  4XYI A;  3VA6 A;  5CYK A;  5C2V B;  3JZH A;  5GMK n;  5K19 A;  2P9P C;  3EI3 A;  3OW8 A;  4I79 A;  2YMU A;  4ERY A;  1P22 A;  4UI9 R;  3UVK A;  5FA5 B;  3K27 A;  1B9X A;  1OMW B;  4ZOY A;  4PBZ A;  3FGB A;  2AGW A;  1NR0 A;  2H9M A;  2TRC B;  4QL1 A;  2HXC A;  2OJY A;  3N0E A;  4GZ8 A;  3EI4 B;  2HJB A;  3EG6 A;  3AL9 A;  4J73 A;  4ZOX A;  3RRM C;  4FB1 D;  4TZ4 A;  1SQ9 A;  1SHY B;  5FKQ A;  4JSX C;  3I7P A;  5TF2 A;  3C5M A;  4CZX A;  4GM9 A;  4XYH A;  1JMX B;  3C75 H;  3OL2 B;  4LGN A;  2IUR A;  3JAM g;  4AOW A;  4J81 A;  2HYE A;  1N6D A;  3I7N A;  3F3F A;  2IUV A;  2XU7 A;  3HFQ A;  1JJU B;  5EMK B;  5H1M A;  5TEF A;  4CY3 A;  3EI4 A;  1FWX A;  1GP2 B;  1NEX B;  2Z2O A;  4JT6 C;  2PM9 B;  4PXW A;  4CY2 A;  4D6V A;  2IWF A;  2YNN A;  1JMZ B;  2CN3 A;  2O9K A;  1B9Y A;  2CE8 A;  5TDH B;  3RMZ D;  5EMM B;  5HE2 B;  2I0R A;  4CI8 A;  2OVR B;  3L4M D;  3NVQ A;  3ZWL B;  1PI6 A;  4FAV D;  3OL2 A;  3JB9 L;  2PBI B;  3CFV A;  4Y5R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...