2HKRA

Structures of the carbinolamine and schiff-base intermediates in the reductive half-reaction of aromatic amine dehydrogenase (aadh) with p-methoxyphenylethylamine
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
360
structure length
360
Chain Sequence
b'EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title Structure-reactivity correlations and kinetic isotope effects in aromatic amine dehydrogenase
rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 98
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hkrA01
5FKSA 4O1QD 5H1MA 3SN6B 2XYIA 2GC4A 4JT6C 1SHYB 2HKMA 3K27A 4Y7RA 4ZOVA 5EAMA 3SBQA 3JZGA 4FB1D 4J79A 3W15A 3OKWA 3RLMD 4A0AA 2HXCA 2AGXA 4O45A 2H13A 4K3ID 2HYEA 4ESGA 4FA1D 4Y5RD 4GM8A 3DWLC 4QL1A 4G56B 1A0RB 3J80g 1MG2A 3BG1A 5CXCB 5K1CC 2GNQA 2PM9A 4A09B 3JAMg 3PXSD 1GOTB 1VYHC 3I89A 4CY5A 4XYIA 1YFQA 2G9AA 2H6QA 2HESX 1JMXB 2YB8B 2YBAA 2AH0A 4L3HD 5H17A 1PGUA 3C99A 4CY3A 3EU7A 4A08B 2YMUA 3PXWD 3OTTA 3BG0A 2QC5A 4FHLA 3NVQA 2P9KC 5CXCA 3JZHA 1OMWB 1JMZB 4CZVA 4L9OA 2AGZA 5FQDA 1JJUB 2B5MA 5I5JA 3SCYA 4CY1A 2OVPB 4PBYA 4OWRA 3SHFA 3ULEC 5EMLB 4E54B 4XYHA 4ZOZA 3I7HA 3I7OA 2TRCB 5GXHA 2AGYA 3OL2A 1XKSA 3B7FA 2B5LA 3UVNA 3IJCA 3U4YA 1GXRA 5HE2B 4ZOXA 5GSAA 5EMMB 3GFCA 5HE0B 3I7LA 4CY2A 2CO0C 3N0DA 3EMHA 2I3TA 1PI6A 3IKOA 3NVXA 3J81g 1PBYB 3I2NA 3AL8B 3E0CA 3I7PA 4PC0A 1NR0A 2G99A 2W18A 4PNKB 4JSPC 5H14A 1L0QA 2H6KA 3IIYA 3MXXA 1Q47A 3EI2A 3SBRA 1GP2B 3CIKB 3MMYA 3V5WB 5IC7A 4K3JB 4J8GA 5C9ZB 4CI2A 4UI9R 4NSXA 2B4EA 4A2MA 3ORVD 4AOWA 4GZ8A 4KFMB 4PSXB 4A0BB 2I0TA 3PE7A 5CXBA 1B9YA 3MZKA 2H68A 2OVQB 3SJLD 5IGOA 1GG2B 2CNXA 1RI6A 1N6EA 3AL9A 1B9XA 4ERZA 3UVLA 2I3SA 4GQ1A 4GQBB 4J0WA 3OKYB 4FA5D 3RMZD 5AMSA 1TBGA 2AGWA 3CFVA 1U4CA 2H9NA 1NEXB 1K32A 2H3XA 2P9UC 4J73A 4U1EI 2H9LA 2HJ4A 2PM7B 4BUJC 3RSEC 4Z8LA 4O9DA 1PEVA 3UR4A 3PVWB 3UVKA 3PXTD 4X61B 2IWKA 3C9CA 2BCJB 4X3EA 3JB9L 2O9KA 4J0XA 4MK0B 2J55H 5TEFA 1S4UX 2H47A 4D0KA 3I8CA 3AH8B 2CN3A 5HYNB 3CFSB 4IMMA 3V9FA 3F3PA 3DM0A 3EI1B 4A09A 2CE9A 1U2VC 5TEEA 3N0EA 5THAA 1XIPA 4O3TB 3JRPA 2CO0A 2PBIB 4IA9A 1ERJA 4J8BA 5I5MA 3EI4B 3VGZA 3SLED 5EAPA 4A08A 4FA4D 1QNIA 3JZNA 2YNOA 4O3UB 3AFCA 1P22A 4GGCA 3PSLA 4A11B 1MDAH 1N6DA 1OLZA 4GM3A 4CI8A 2P9SC 3EI1A 3EWEA 3C75H 3RN1D 2QXVA 3GREA 3OKTA 3VH0A 4ERQA 3JROA 3OW8A 4ES0A 3DSMA 3ODTA 3IJ0A 3DXKC 4PXWA 3ZWLB 2H9MA 2P9IC 4R7AB 2XL2A 4E54A 3EI4A 1R5MA 4GM9A 5AJAA 5C2VB 3I8EA 4X63B 4ZN4A 2J56H 3F3FA 3RFHA 3SXTD 5GXIA 3SFZA 3UKUC 1JOFA 4FWWA 1FWXA 2B5NA 3FRXA 2AGLA 2IURA 4L1QD 2CE8A 3L4OD 4LG8A 4A0AB 4XEIC 5FXYA 3AL8A 2XL3A 4FAND 2H6NA 4FAVD 3FGBA 5FLXg 1SQ9A 2IAAA 4CZYA 3PSCB 5EMKB 3SMRA 3C5MA 5FKQA 3I7NA 5HE1B 4U7AA 2Q7QA 4CC9A 4JD2C 2PM9B 2P9PC 5AFU3 2AQ5A 2Z2OA 4CZXA 3P4FA 2GC7A 3I7KA 3RRMC 4J82A 5EALA 2P9NC 2P9LC 4H5IA 3RN0D 3UKRC 5IGQA 4J81A 3KRWB 3UVOA 4A0BA 3F3GA 1MG3A 2Z2NA 2Z2PA 2OVRB 4J78A 2J57G 2PM6B 2UZXB 3SVWD 3EG6A 5B4WA 5A2Qg 3RFGA 2IUPA 4PSWB 4J86A 4CI3A 5I5IA 5TF2A 3MKQA 5CYKB 3NVNA 4YVDA 4D6VA 4GGAA 4OZUA 3VA6A 2I0SA 5TDHB 4QRJA 4ERYA 2IWFA 3MKSB 3OKYA 3FM0A 4BL0A 2EBSA 4JSVC 4QT8A 4GMBA 4J87A 3BWSA 2YNPA 3DXMC 4N14A 4HDJA 4JSNC 3HFQA 5KDOB 2IUQA 2BBKH 5CYKA 4FA9D 5FA5B 2H9PA 5K19A 4LGNA 2H14A 5HQGA 3OL2B 4BH6A 4J77A 5IT9g 3UVMA 2OIZA 3A0FA 4L3GD 3K26A 3EI3B 4JSXC 3PVUB 2OK6A 5JWZA 5C2WB 5SXMA 5FKRA 3L4MD 4PBZA 2YNNA 2IUVA 1N6FA 4AEZA 4GQ2P 5EM2B 2HKRA 4QQEA 5GMKn 4E5ZB 5EARA 3SWSD 5IJ7E 5EMJB 3EI2B 2AH1A 3EI3A 3IIWA 4LG9A 4A7JA 5FKTA 4A11A 3KRXB 2OJYA 1XHMA 3IJ1A 4I79A 2HJBA 3V7DB 5CXBB 4ZOYA 4GGDA 5HE3B 3SBPA 2CN2A 4A2LA 5EM2A 3MZLA 4E5ZA 4X60B 1TYQC 2I0RA 3JPXA 1K8KC 4JXMA 4H5JA 4EWRA 5IJ8E 4CI1A 2XU7A 4TZ4A 2OK4A 4JT5C 2MTAH 2UZYB 1SQJA 4J84A
chains in the Genus database with same CATH superfamily
5FKSA 4O1QD 5H1MA 3SN6B 2XYIA 2GC4A 4JT6C 1SHYB 2HKMA 3K27A 4Y7RA 2HU5A 4ZOVA 4Z7OA 5EAMA 5E6SA 3JZGA 1E5TA 1E8MA 3O4GA 3SBQA 4FB1D 4J79A 3W15A 3OKWA 4MMYA 3RLMD 4A0AA 2HXCA 2AGXA 4O45A 3O4IA 2H13A 4K3ID 2HYEA 4ESGA 1H2ZA 4FA1D 4Y5RD 1I2MB 3V4VA 3GD1I 4GM8A 1GOGA 3DWLC 4QL1A 4G56B 4UM9A 1A0RB 3J80g 1MG2A 3BG1A 5CXCB 5K1CC 2GNQA 2PM9A 3DDUA 5FFGA 4A09B 3JAMg 3PXSD 1GOTB 1VYHC 3I89A 3T3MA 4CY5A 4XYIA 1YFQA 4BCDA 2G9AA 2H6QA 2HESX 2VDQA 3T3PA 1JMXB 2VDMA 2YB8B 2YBAA 2AH0A 4L3HD 4BP9A 5H17A 1PGUA 2HU8A 3K6SA 3C99A 3K71A 4CY3A 3EU7A 4A08B 2YMUA 3PXWD 3OTTA 3ZE1A 3BG0A 2QC5A 5E6RA 4FHLA 3NVQA 2P9KC 5CXCA 3JZHA 4G1EA 1OMWB 1JMZB 1VE6A 4CZVA 4L9OA 2AGZA 5FQDA 1JJUB 2B5MA 1GOFA 2EIDA 5I5JA 3SCYA 4CY1A 1L5GA 2OVPB 4PBYA 5M5VA 1QFMA 3IUMA 4OWRA 3MVDK 3SHFA 3ULEC 5EMLB 4E54B 3MUNA 4XYHA 4ZOZA 3I7HA 3KCIA 3I7OA 4JHNA 2JKXA 2TRCB 5GXHA 2AGYA 3OL2A 4G1MA 1XKSA 2VZ1A 3B7FA 1A12A 2B5LA 3UVNA 3IJCA 1C9IA 4DNWA 3U4YA 1GXRA 5HE2B 4ZOXA 3ZDYA 4MMXA 5EMMB 5GSAA 3GFCA 5M5SA 5HE0B 3I7LA 4CY2A 4BP8A 2CO0C 3N0DA 3EMHA 2I3TA 2QZPA 4MMZA 1PI6A 3IKOA 2VDLA 3NVXA 3J81g 1PBYB 3I2NA 3AL8B 3E0CA 3I7PA 4PC0A 5M61A 1NR0A 2G99A 3IUNA 3VI3A 3MUOA 5HDBA 2W18A 2EIBA 4D9SA 4PNKB 4JSPC 5H14A 4G55A 1L0QA 2H6KA 3IIYA 3MXXA 1Q47A 3EI2A 3SBRA 1GP2B 3CIKB 3MMYA 3V5WB 5IC7A 4K3JB 4J8GA 5C9ZB 4CI2A 4UI9R 4NSXA 4NAAA 2B4EA 3ZDZA 4A2MA 3ORVD 4AOWA 4GZ8A 4KFMB 4PSXB 4A0BB 2I0TA 3PE7A 2BKLA 5CXBA 1B9YA 1UTCA 3MZKA 4NBMA 5M5TA 2H68A 2OVQB 2EIEA 3IUJA 3SJLD 5IGOA 1GG2B 2CNXA 1RI6A 1N6EA 3AL9A 1B9XA 4ERZA 3VI4A 3UVLA 2I3SA 4GQ1A 4GQBB 3FCSA 4J0WA 3IJEA 3OKYB 4FA5D 3RMZD 5AMSA 1TBGA 2AGWA 4AMYA 1JV2A 3CFVA 1U4CA 2H9NA 1UOPA 4BCBA 1NEXB 1K32A 2H3XA 2P9UC 4J73A 3QHYB 4U1EI 2H9LA 2HJ4A 2PM7B 4BUJC 3RSEC 4Z8LA 4O9DA 1PEVA 3UR4A 3PVWB 3UVKA 3PXTD 4X61B 2IWKA 3C9CA 1M1XA 2BCJB 4X3EA 1H2WA 3JB9L 4JHPC 2O9KA 4J0XA 1GOHA 4MK0B 2J55H 5TEFA 1S4UX 3EQ7A 2H47A 4D0KA 3I8CA 3AH8B 2CN3A 5HYNB 1UOOA 3CFSB 4IMMA 4NC4A 3V9FA 3F3PA 1O6GA 2XZGA 3DM0A 3EI1B 4A09A 2HU7A 4QAMA 4AX4A 4Z7QA 2CE9A 1U2VC 2VDNA 5TEEA 3N0EA 5THAA 3OF7A 1XIPA 4NENA 4O3TB 3JRPA 2CO0A 2PBIB 4IA9A 1ERJA 4J8BA 5I5MA 3ZE0A 3EI4B 3VGZA 3SLED 5EAPA 1QFSA 4A08A 4DNVA 4FA4D 2VDPA 1QNIA 3JZNA 2YNOA 4O3UB 4AN0A 3AFCA 2VDRA 1P22A 4GGCA 3PSLA 4A11B 1MDAH 1N6DA 1OLZA 4GM3A 4CI8A 2P9SC 3EI1A 3FCUA 3EWEA 3C75H 5E6UA 3RN1D 2QXVA 3EQ9A 3GREA 3IVMA 3OKTA 3VH0A 4ERQA 3JROA 3OW8A 4ES0A 3DSMA 1VZ2A 3ODTA 3IJ0A 3DXKC 4PXWA 3ZWLB 2H9MA 2P9IC 4R7AB 2XL2A 4E54A 3EI4A 3IULA 1R5MA 4GM9A 3ZE2A 5M5UA 1C9LA 5C92A 4RE5A 5AJAA 5C2VB 3I8EA 4X63B 4ZN4A 2J56H 3F3FA 3RFHA 3SXTD 5GXIA 3SFZA 3UKUC 1JOFA 4FWWA 1FWXA 2B5NA 3FRXA 2AGLA 2IURA 4L1QD 2CE8A 3L4OD 4LG8A 1YR2A 4A0AB 4XEIC 5FXYA 3AL8A 2XL3A 4FAND 2H6NA 4FAVD 3FGBA 3QI0A 4AN1A 5FLXg 1TYEA 1SQ9A 2WQ8A 2IAAA 4CZYA 3PSCB 5EMKB 4BCCA 3SMRA 3C5MA 5FKQA 1H2XA 3K72A 3I7NA 5HE1B 3IURA 4U7AA 2Q7QA 4CC9A 4JD2C 2PM9B 2P9PC 5AFU3 2AQ5A 2VC2A 2XDWA 2Z2OA 4CZXA 3P4FA 2GC7A 2QR5A 3I7KA 3RRMC 4J82A 5EALA 3IUQA 2P9NC 2P9LC 4H5IA 3RN0D 3UKRC 3O4JA 5IGQA 4J81A 3KRWB 3UVOA 4A0BA 3F3GA 4RE6A 1MG3A 2Z2NA 2Z2PA 2OVRB 4J78A 2J57G 2PM6B 2UZXB 3SVWD 3EG6A 5B4WA 5A2Qg 1VE7A 3NIDA 3RFGA 2IUPA 4PSWB 1JTDB 3NIGA 4J86A 2VZ3A 4CI3A 5I5IA 5TF2A 3MKQA 5CYKB 3NVNA 4YVDA 4D6VA 4GGAA 4OZUA 3VA6A 1T2XA 2I0SA 5TDHB 4QRJA 4ERYA 2IWFA 3MKSB 3OKYA 3FM0A 2XE4A 4BL0A 3GC3B 1O6FA 4WK4A 2EBSA 4JSVC 3NIFA 4QT8A 4GMBA 4J87A 3BWSA 3V4PA 2YNPA 3DXMC 5M5RA 4N14A 4HDJA 3EQ8A 4JSNC 3HFQA 3ZDXA 5KDOB 1UOQA 2IUQA 1E8NA 2VDKA 2BBKH 5CYKA 4FA9D 5FA5B 2H9PA 5K19A 4LGNA 1VZ3A 2H14A 5HQGA 3OL2B 4BH6A 4J77A 5IT9g 4IRZA 3UVMA 2OIZA 3A0FA 4L3GD 3K26A 3EI3B 1U8CA 5C86A 3O4HA 4JSXC 3PVUB 2OK6A 5JWZA 5C2WB 5SXMA 5FKRA 3L4MD 4PBZA 2YNNA 2IUVA 5FFOA 1N6FA 4AEZA 4GQ2P 5EM2B 2HKRA 4QQEA 5GMKn 1K3IA 4E5ZB 4DNUA 2EICA 4O02A 5EARA 3SWSD 5IJ7E 5EMJB 3EI2B 1BPOA 2AH1A 4O2WA 3EI3A 3IIWA 2VDOA 4LG9A 4A7JA 5FKTA 4A11A 3KRXB 4L1MA 2OJYA 1XHMA 3IJ1A 4I79A 1H2YA 2HJBA 3V7DB 4WK0A 4Z7NA 4UM8A 4WJKA 4WK2A 5CXBB 4ZOYA 4GGDA 5HE3B 3SBPA 2CN2A 4A2LA 5EM2A 3MZLA 4AMZA 4E5ZA 4X60B 1TYQC 2I0RA 3JPXA 1K8KC 4JXMA 4H5JA 4EWRA 5IJ8E 4CI1A 2XU7A 4TZ4A 2OK4A 4JT5C 2MTAH 2UZYB 1SQJA 4J84A
chains in the Genus database with same CATH topology
5FKSA 4O1QD 5H1MA 3SN6B 2XYIA 2GC4A 4JT6C 1SHYB 2HKMA 3K27A 4Y7RA 4ZOVA 5EAMA 3SBQA 3JZGA 4FB1D 4J79A 3W15A 3OKWA 3RLMD 4A0AA 2HXCA 2AGXA 4O45A 2H13A 4K3ID 2HYEA 4ESGA 4FA1D 4Y5RD 4GM8A 3DWLC 4QL1A 4G56B 1A0RB 3J80g 1MG2A 3BG1A 5CXCB 5K1CC 2GNQA 2PM9A 4A09B 3JAMg 3PXSD 1GOTB 1VYHC 3I89A 4CY5A 4XYIA 1YFQA 2G9AA 2H6QA 2HESX 1JMXB 2YB8B 2YBAA 2AH0A 4L3HD 5H17A 1PGUA 3C99A 4CY3A 3EU7A 4A08B 2YMUA 3PXWD 3OTTA 3BG0A 2QC5A 4FHLA 3NVQA 2P9KC 5CXCA 3JZHA 1OMWB 1JMZB 4CZVA 4L9OA 2AGZA 5FQDA 1JJUB 2B5MA 5I5JA 3SCYA 4CY1A 2OVPB 4PBYA 4OWRA 3SHFA 3ULEC 5EMLB 4E54B 4XYHA 4ZOZA 3I7HA 3I7OA 2TRCB 5GXHA 2AGYA 3OL2A 1XKSA 3B7FA 2B5LA 3UVNA 3IJCA 3U4YA 1GXRA 5HE2B 4ZOXA 5GSAA 5EMMB 3GFCA 5HE0B 3I7LA 4CY2A 2CO0C 3N0DA 3EMHA 2I3TA 1PI6A 3IKOA 3NVXA 3J81g 1PBYB 3I2NA 3AL8B 3E0CA 3I7PA 4PC0A 1NR0A 2G99A 2W18A 4PNKB 4JSPC 5H14A 1L0QA 2H6KA 3IIYA 3MXXA 1Q47A 3EI2A 3SBRA 1GP2B 3CIKB 3MMYA 3V5WB 5IC7A 4K3JB 4J8GA 5C9ZB 4CI2A 4UI9R 4NSXA 2B4EA 4A2MA 3ORVD 4AOWA 4GZ8A 4KFMB 4PSXB 4A0BB 2I0TA 3PE7A 5CXBA 1B9YA 3MZKA 2H68A 2OVQB 3SJLD 5IGOA 1GG2B 2CNXA 1RI6A 1N6EA 3AL9A 1B9XA 4ERZA 3UVLA 2I3SA 4GQ1A 4GQBB 4J0WA 3OKYB 4FA5D 3RMZD 5AMSA 1TBGA 2AGWA 3CFVA 1U4CA 2H9NA 1NEXB 1K32A 2H3XA 2P9UC 4J73A 4U1EI 2H9LA 2HJ4A 2PM7B 4BUJC 3RSEC 4Z8LA 4O9DA 1PEVA 3UR4A 3PVWB 3UVKA 3PXTD 4X61B 2IWKA 3C9CA 2BCJB 4X3EA 3JB9L 2O9KA 4J0XA 4MK0B 2J55H 5TEFA 1S4UX 2H47A 4D0KA 3I8CA 3AH8B 2CN3A 5HYNB 3CFSB 4IMMA 3V9FA 3F3PA 3DM0A 3EI1B 4A09A 2CE9A 1U2VC 5TEEA 3N0EA 5THAA 1XIPA 4O3TB 3JRPA 2CO0A 2PBIB 4IA9A 1ERJA 4J8BA 5I5MA 3EI4B 3VGZA 3SLED 5EAPA 4A08A 4FA4D 1QNIA 3JZNA 2YNOA 4O3UB 3AFCA 1P22A 4GGCA 3PSLA 4A11B 1MDAH 1N6DA 1OLZA 4GM3A 4CI8A 2P9SC 3EI1A 3EWEA 3C75H 3RN1D 2QXVA 3GREA 3OKTA 3VH0A 4ERQA 3JROA 3OW8A 4ES0A 3DSMA 3ODTA 3IJ0A 3DXKC 4PXWA 3ZWLB 2H9MA 2P9IC 4R7AB 2XL2A 4E54A 3EI4A 1R5MA 4GM9A 5AJAA 5C2VB 3I8EA 4X63B 4ZN4A 2J56H 3F3FA 3RFHA 3SXTD 5GXIA 3SFZA 3UKUC 1JOFA 4FWWA 1FWXA 2B5NA 3FRXA 2AGLA 2IURA 4L1QD 2CE8A 3L4OD 4LG8A 4A0AB 4XEIC 5FXYA 3AL8A 2XL3A 4FAND 2H6NA 4FAVD 3FGBA 5FLXg 1SQ9A 2IAAA 4CZYA 3PSCB 5EMKB 3SMRA 3C5MA 5FKQA 3I7NA 5HE1B 4U7AA 2Q7QA 4CC9A 4JD2C 2PM9B 2P9PC 5AFU3 2AQ5A 2Z2OA 4CZXA 3P4FA 2GC7A 3I7KA 3RRMC 4J82A 5EALA 2P9NC 2P9LC 4H5IA 3RN0D 3UKRC 5IGQA 4J81A 3KRWB 3UVOA 4A0BA 3F3GA 1MG3A 2Z2NA 2Z2PA 2OVRB 4J78A 2J57G 2PM6B 2UZXB 3SVWD 3EG6A 5B4WA 5A2Qg 3RFGA 2IUPA 4PSWB 4J86A 4CI3A 5I5IA 5TF2A 3MKQA 5CYKB 3NVNA 4YVDA 4D6VA 4GGAA 4OZUA 3VA6A 2I0SA 5TDHB 4QRJA 4ERYA 2IWFA 3MKSB 3OKYA 3FM0A 4BL0A 2EBSA 4JSVC 4QT8A 4GMBA 4J87A 3BWSA 2YNPA 3DXMC 4N14A 4HDJA 4JSNC 3HFQA 5KDOB 2IUQA 2BBKH 5CYKA 4FA9D 5FA5B 2H9PA 5K19A 4LGNA 2H14A 5HQGA 3OL2B 4BH6A 4J77A 5IT9g 3UVMA 2OIZA 3A0FA 4L3GD 3K26A 3EI3B 4JSXC 3PVUB 2OK6A 5JWZA 5C2WB 5SXMA 5FKRA 3L4MD 4PBZA 2YNNA 2IUVA 1N6FA 4AEZA 4GQ2P 5EM2B 2HKRA 4QQEA 5GMKn 4E5ZB 5EARA 3SWSD 5IJ7E 5EMJB 3EI2B 2AH1A 3EI3A 3IIWA 4LG9A 4A7JA 5FKTA 4A11A 3KRXB 2OJYA 1XHMA 3IJ1A 4I79A 2HJBA 3V7DB 5CXBB 4ZOYA 4GGDA 5HE3B 3SBPA 2CN2A 4A2LA 5EM2A 3MZLA 4E5ZA 4X60B 1TYQC 2I0RA 3JPXA 1K8KC 4JXMA 4H5JA 4EWRA 5IJ8E 4CI1A 2XU7A 4TZ4A 2OK4A 4JT5C 2MTAH 2UZYB 1SQJA 4J84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKS A;  4O1Q D;  5H1M A;  3SN6 B;  2XYI A;  2GC4 A;  4JT6 C;  1SHY B;  2HKM A;  3K27 A;  4Y7R A;  4ZOV A;  5EAM A;  3SBQ A;  3JZG A;  4FB1 D;  4J79 A;  3W15 A;  3OKW A;  3RLM D;  4A0A A;  2HXC A;  2AGX A;  4O45 A;  2H13 A;  4K3I D;  2HYE A;  4ESG A;  4FA1 D;  4Y5R D;  4GM8 A;  3DWL C;  4QL1 A;  4G56 B;  1A0R B;  3J80 g;  1MG2 A;  3BG1 A;  5CXC B;  5K1C C;  2GNQ A;  2PM9 A;  4A09 B;  3JAM g;  3PXS D;  1GOT B;  1VYH C;  3I89 A;  4CY5 A;  4XYI A;  1YFQ A;  2G9A A;  2H6Q A;  2HES X;  1JMX B;  2YB8 B;  2YBA A;  2AH0 A;  4L3H D;  5H17 A;  1PGU A;  3C99 A;  4CY3 A;  3EU7 A;  4A08 B;  2YMU A;  3PXW D;  3OTT A;  3BG0 A;  2QC5 A;  4FHL A;  3NVQ A;  2P9K C;  5CXC A;  3JZH A;  1OMW B;  1JMZ B;  4CZV A;  4L9O A;  2AGZ A;  5FQD A;  1JJU B;  2B5M A;  5I5J A;  3SCY A;  4CY1 A;  2OVP B;  4PBY A;  4OWR A;  3SHF A;  3ULE C;  5EML B;  4E54 B;  4XYH A;  4ZOZ A;  3I7H A;  3I7O A;  2TRC B;  5GXH A;  2AGY A;  3OL2 A;  1XKS A;  3B7F A;  2B5L A;  3UVN A;  3IJC A;  3U4Y A;  1GXR A;  5HE2 B;  4ZOX A;  5GSA A;  5EMM B;  3GFC A;  5HE0 B;  3I7L A;  4CY2 A;  2CO0 C;  3N0D A;  3EMH A;  2I3T A;  1PI6 A;  3IKO A;  3NVX A;  3J81 g;  1PBY B;  3I2N A;  3AL8 B;  3E0C A;  3I7P A;  4PC0 A;  1NR0 A;  2G99 A;  2W18 A;  4PNK B;  4JSP C;  5H14 A;  1L0Q A;  2H6K A;  3IIY A;  3MXX A;  1Q47 A;  3EI2 A;  3SBR A;  1GP2 B;  3CIK B;  3MMY A;  3V5W B;  5IC7 A;  4K3J B;  4J8G A;  5C9Z B;  4CI2 A;  4UI9 R;  4NSX A;  2B4E A;  4A2M A;  3ORV D;  4AOW A;  4GZ8 A;  4KFM B;  4PSX B;  4A0B B;  2I0T A;  3PE7 A;  5CXB A;  1B9Y A;  3MZK A;  2H68 A;  2OVQ B;  3SJL D;  5IGO A;  1GG2 B;  2CNX A;  1RI6 A;  1N6E A;  3AL9 A;  1B9X A;  4ERZ A;  3UVL A;  2I3S A;  4GQ1 A;  4GQB B;  4J0W A;  3OKY B;  4FA5 D;  3RMZ D;  5AMS A;  1TBG A;  2AGW A;  3CFV A;  1U4C A;  2H9N A;  1NEX B;  1K32 A;  2H3X A;  2P9U C;  4J73 A;  4U1E I;  2H9L A;  2HJ4 A;  2PM7 B;  4BUJ C;  3RSE C;  4Z8L A;  4O9D A;  1PEV A;  3UR4 A;  3PVW B;  3UVK A;  3PXT D;  4X61 B;  2IWK A;  3C9C A;  2BCJ B;  4X3E A;  3JB9 L;  2O9K A;  4J0X A;  4MK0 B;  2J55 H;  5TEF A;  1S4U X;  2H47 A;  4D0K A;  3I8C A;  3AH8 B;  2CN3 A;  5HYN B;  3CFS B;  4IMM A;  3V9F A;  3F3P A;  3DM0 A;  3EI1 B;  4A09 A;  2CE9 A;  1U2V C;  5TEE A;  3N0E A;  5THA A;  1XIP A;  4O3T B;  3JRP A;  2CO0 A;  2PBI B;  4IA9 A;  1ERJ A;  4J8B A;  5I5M A;  3EI4 B;  3VGZ A;  3SLE D;  5EAP A;  4A08 A;  4FA4 D;  1QNI A;  3JZN A;  2YNO A;  4O3U B;  3AFC A;  1P22 A;  4GGC A;  3PSL A;  4A11 B;  1MDA H;  1N6D A;  1OLZ A;  4GM3 A;  4CI8 A;  2P9S C;  3EI1 A;  3EWE A;  3C75 H;  3RN1 D;  2QXV A;  3GRE A;  3OKT A;  3VH0 A;  4ERQ A;  3JRO A;  3OW8 A;  4ES0 A;  3DSM A;  3ODT A;  3IJ0 A;  3DXK C;  4PXW A;  3ZWL B;  2H9M A;  2P9I C;  4R7A B;  2XL2 A;  4E54 A;  3EI4 A;  1R5M A;  4GM9 A;  5AJA A;  5C2V B;  3I8E A;  4X63 B;  4ZN4 A;  2J56 H;  3F3F A;  3RFH A;  3SXT D;  5GXI A;  3SFZ A;  3UKU C;  1JOF A;  4FWW A;  1FWX A;  2B5N A;  3FRX A;  2AGL A;  2IUR A;  4L1Q D;  2CE8 A;  3L4O D;  4LG8 A;  4A0A B;  4XEI C;  5FXY A;  3AL8 A;  2XL3 A;  4FAN D;  2H6N A;  4FAV D;  3FGB A;  5FLX g;  1SQ9 A;  2IAA A;  4CZY A;  3PSC B;  5EMK B;  3SMR A;  3C5M A;  5FKQ A;  3I7N A;  5HE1 B;  4U7A A;  2Q7Q A;  4CC9 A;  4JD2 C;  2PM9 B;  2P9P C;  5AFU 3;  2AQ5 A;  2Z2O A;  4CZX A;  3P4F A;  2GC7 A;  3I7K A;  3RRM C;  4J82 A;  5EAL A;  2P9N C;  2P9L C;  4H5I A;  3RN0 D;  3UKR C;  5IGQ A;  4J81 A;  3KRW B;  3UVO A;  4A0B A;  3F3G A;  1MG3 A;  2Z2N A;  2Z2P A;  2OVR B;  4J78 A;  2J57 G;  2PM6 B;  2UZX B;  3SVW D;  3EG6 A;  5B4W A;  5A2Q g;  3RFG A;  2IUP A;  4PSW B;  4J86 A;  4CI3 A;  5I5I A;  5TF2 A;  3MKQ A;  5CYK B;  3NVN A;  4YVD A;  4D6V A;  4GGA A;  4OZU A;  3VA6 A;  2I0S A;  5TDH B;  4QRJ A;  4ERY A;  2IWF A;  3MKS B;  3OKY A;  3FM0 A;  4BL0 A;  2EBS A;  4JSV C;  4QT8 A;  4GMB A;  4J87 A;  3BWS A;  2YNP A;  3DXM C;  4N14 A;  4HDJ A;  4JSN C;  3HFQ A;  5KDO B;  2IUQ A;  2BBK H;  5CYK A;  4FA9 D;  5FA5 B;  2H9P A;  5K19 A;  4LGN A;  2H14 A;  5HQG A;  3OL2 B;  4BH6 A;  4J77 A;  5IT9 g;  3UVM A;  2OIZ A;  3A0F A;  4L3G D;  3K26 A;  3EI3 B;  4JSX C;  3PVU B;  2OK6 A;  5JWZ A;  5C2W B;  5SXM A;  5FKR A;  3L4M D;  4PBZ A;  2YNN A;  2IUV A;  1N6F A;  4AEZ A;  4GQ2 P;  5EM2 B;  2HKR A;  4QQE A;  5GMK n;  4E5Z B;  5EAR A;  3SWS D;  5IJ7 E;  5EMJ B;  3EI2 B;  2AH1 A;  3EI3 A;  3IIW A;  4LG9 A;  4A7J A;  5FKT A;  4A11 A;  3KRX B;  2OJY A;  1XHM A;  3IJ1 A;  4I79 A;  2HJB A;  3V7D B;  5CXB B;  4ZOY A;  4GGD A;  5HE3 B;  3SBP A;  2CN2 A;  4A2L A;  5EM2 A;  3MZL A;  4E5Z A;  4X60 B;  1TYQ C;  2I0R A;  3JPX A;  1K8K C;  4JXM A;  4H5J A;  4EWR A;  5IJ8 E;  4CI1 A;  2XU7 A;  4TZ4 A;  2OK4 A;  4JT5 C;  2MTA H;  2UZY B;  1SQJ A;  4J84 A; 
#chains in the Genus database with same CATH topology
 5FKS A;  4O1Q D;  5H1M A;  3SN6 B;  2XYI A;  2GC4 A;  4JT6 C;  1SHY B;  2HKM A;  3K27 A;  4Y7R A;  2HU5 A;  4ZOV A;  4Z7O A;  5EAM A;  5E6S A;  3JZG A;  1E5T A;  1E8M A;  3O4G A;  3SBQ A;  4FB1 D;  4J79 A;  3W15 A;  3OKW A;  4MMY A;  3RLM D;  4A0A A;  2HXC A;  2AGX A;  4O45 A;  3O4I A;  2H13 A;  4K3I D;  2HYE A;  4ESG A;  1H2Z A;  4FA1 D;  4Y5R D;  1I2M B;  3V4V A;  3GD1 I;  4GM8 A;  1GOG A;  3DWL C;  4QL1 A;  4G56 B;  4UM9 A;  1A0R B;  3J80 g;  1MG2 A;  3BG1 A;  5CXC B;  5K1C C;  2GNQ A;  2PM9 A;  3DDU A;  5FFG A;  4A09 B;  3JAM g;  3PXS D;  1GOT B;  1VYH C;  3I89 A;  3T3M A;  4CY5 A;  4XYI A;  1YFQ A;  4BCD A;  2G9A A;  2H6Q A;  2HES X;  2VDQ A;  3T3P A;  1JMX B;  2VDM A;  2YB8 B;  2YBA A;  2AH0 A;  4L3H D;  4BP9 A;  5H17 A;  1PGU A;  2HU8 A;  3K6S A;  3C99 A;  3K71 A;  4CY3 A;  3EU7 A;  4A08 B;  2YMU A;  3PXW D;  3OTT A;  3ZE1 A;  3BG0 A;  2QC5 A;  5E6R A;  4FHL A;  3NVQ A;  2P9K C;  5CXC A;  3JZH A;  4G1E A;  1OMW B;  1JMZ B;  1VE6 A;  4CZV A;  4L9O A;  2AGZ A;  5FQD A;  1JJU B;  2B5M A;  1GOF A;  2EID A;  5I5J A;  3SCY A;  4CY1 A;  1L5G A;  2OVP B;  4PBY A;  5M5V A;  1QFM A;  3IUM A;  4OWR A;  3MVD K;  3SHF A;  3ULE C;  5EML B;  4E54 B;  3MUN A;  4XYH A;  4ZOZ A;  3I7H A;  3KCI A;  3I7O A;  4JHN A;  2JKX A;  2TRC B;  5GXH A;  2AGY A;  3OL2 A;  4G1M A;  1XKS A;  2VZ1 A;  3B7F A;  1A12 A;  2B5L A;  3UVN A;  3IJC A;  1C9I A;  4DNW A;  3U4Y A;  1GXR A;  5HE2 B;  4ZOX A;  3ZDY A;  4MMX A;  5EMM B;  5GSA A;  3GFC A;  5M5S A;  5HE0 B;  3I7L A;  4CY2 A;  4BP8 A;  2CO0 C;  3N0D A;  3EMH A;  2I3T A;  2QZP A;  4MMZ A;  1PI6 A;  3IKO A;  2VDL A;  3NVX A;  3J81 g;  1PBY B;  3I2N A;  3AL8 B;  3E0C A;  3I7P A;  4PC0 A;  5M61 A;  1NR0 A;  2G99 A;  3IUN A;  3VI3 A;  3MUO A;  5HDB A;  2W18 A;  2EIB A;  4D9S A;  4PNK B;  4JSP C;  5H14 A;  4G55 A;  1L0Q A;  2H6K A;  3IIY A;  3MXX A;  1Q47 A;  3EI2 A;  3SBR A;  1GP2 B;  3CIK B;  3MMY A;  3V5W B;  5IC7 A;  4K3J B;  4J8G A;  5C9Z B;  4CI2 A;  4UI9 R;  4NSX A;  4NAA A;  2B4E A;  3ZDZ A;  4A2M A;  3ORV D;  4AOW A;  4GZ8 A;  4KFM B;  4PSX B;  4A0B B;  2I0T A;  3PE7 A;  2BKL A;  5CXB A;  1B9Y A;  1UTC A;  3MZK A;  4NBM A;  5M5T A;  2H68 A;  2OVQ B;  2EIE A;  3IUJ A;  3SJL D;  5IGO A;  1GG2 B;  2CNX A;  1RI6 A;  1N6E A;  3AL9 A;  1B9X A;  4ERZ A;  3VI4 A;  3UVL A;  2I3S A;  4GQ1 A;  4GQB B;  3FCS A;  4J0W A;  3IJE A;  3OKY B;  4FA5 D;  3RMZ D;  5AMS A;  1TBG A;  2AGW A;  4AMY A;  1JV2 A;  3CFV A;  1U4C A;  2H9N A;  1UOP A;  4BCB A;  1NEX B;  1K32 A;  2H3X A;  2P9U C;  4J73 A;  3QHY B;  4U1E I;  2H9L A;  2HJ4 A;  2PM7 B;  4BUJ C;  3RSE C;  4Z8L A;  4O9D A;  1PEV A;  3UR4 A;  3PVW B;  3UVK A;  3PXT D;  4X61 B;  2IWK A;  3C9C A;  1M1X A;  2BCJ B;  4X3E A;  1H2W A;  3JB9 L;  4JHP C;  2O9K A;  4J0X A;  1GOH A;  4MK0 B;  2J55 H;  5TEF A;  1S4U X;  3EQ7 A;  2H47 A;  4D0K A;  3I8C A;  3AH8 B;  2CN3 A;  5HYN B;  1UOO A;  3CFS B;  4IMM A;  4NC4 A;  3V9F A;  3F3P A;  1O6G A;  2XZG A;  3DM0 A;  3EI1 B;  4A09 A;  2HU7 A;  4QAM A;  4AX4 A;  4Z7Q A;  2CE9 A;  1U2V C;  2VDN A;  5TEE A;  3N0E A;  5THA A;  3OF7 A;  1XIP A;  4NEN A;  4O3T B;  3JRP A;  2CO0 A;  2PBI B;  4IA9 A;  1ERJ A;  4J8B A;  5I5M A;  3ZE0 A;  3EI4 B;  3VGZ A;  3SLE D;  5EAP A;  1QFS A;  4A08 A;  4DNV A;  4FA4 D;  2VDP A;  1QNI A;  3JZN A;  2YNO A;  4O3U B;  4AN0 A;  3AFC A;  2VDR A;  1P22 A;  4GGC A;  3PSL A;  4A11 B;  1MDA H;  1N6D A;  1OLZ A;  4GM3 A;  4CI8 A;  2P9S C;  3EI1 A;  3FCU A;  3EWE A;  3C75 H;  5E6U A;  3RN1 D;  2QXV A;  3EQ9 A;  3GRE A;  3IVM A;  3OKT A;  3VH0 A;  4ERQ A;  3JRO A;  3OW8 A;  4ES0 A;  3DSM A;  1VZ2 A;  3ODT A;  3IJ0 A;  3DXK C;  4PXW A;  3ZWL B;  2H9M A;  2P9I C;  4R7A B;  2XL2 A;  4E54 A;  3EI4 A;  3IUL A;  1R5M A;  4GM9 A;  3ZE2 A;  5M5U A;  1C9L A;  5C92 A;  4RE5 A;  5AJA A;  5C2V B;  3I8E A;  4X63 B;  4ZN4 A;  2J56 H;  3F3F A;  3RFH A;  3SXT D;  5GXI A;  3SFZ A;  3UKU C;  1JOF A;  4FWW A;  1FWX A;  2B5N A;  3FRX A;  2AGL A;  2IUR A;  4L1Q D;  2CE8 A;  3L4O D;  4LG8 A;  1YR2 A;  4A0A B;  4XEI C;  5FXY A;  3AL8 A;  2XL3 A;  4FAN D;  2H6N A;  4FAV D;  3FGB A;  3QI0 A;  4AN1 A;  5FLX g;  1TYE A;  1SQ9 A;  2WQ8 A;  2IAA A;  4CZY A;  3PSC B;  5EMK B;  4BCC A;  3SMR A;  3C5M A;  5FKQ A;  1H2X A;  3K72 A;  3I7N A;  5HE1 B;  3IUR A;  4U7A A;  2Q7Q A;  4CC9 A;  4JD2 C;  2PM9 B;  2P9P C;  5AFU 3;  2AQ5 A;  2VC2 A;  2XDW A;  2Z2O A;  4CZX A;  3P4F A;  2GC7 A;  2QR5 A;  3I7K A;  3RRM C;  4J82 A;  5EAL A;  3IUQ A;  2P9N C;  2P9L C;  4H5I A;  3RN0 D;  3UKR C;  3O4J A;  5IGQ A;  4J81 A;  3KRW B;  3UVO A;  4A0B A;  3F3G A;  4RE6 A;  1MG3 A;  2Z2N A;  2Z2P A;  2OVR B;  4J78 A;  2J57 G;  2PM6 B;  2UZX B;  3SVW D;  3EG6 A;  5B4W A;  5A2Q g;  1VE7 A;  3NID A;  3RFG A;  2IUP A;  4PSW B;  1JTD B;  3NIG A;  4J86 A;  2VZ3 A;  4CI3 A;  5I5I A;  5TF2 A;  3MKQ A;  5CYK B;  3NVN A;  4YVD A;  4D6V A;  4GGA A;  4OZU A;  3VA6 A;  1T2X A;  2I0S A;  5TDH B;  4QRJ A;  4ERY A;  2IWF A;  3MKS B;  3OKY A;  3FM0 A;  2XE4 A;  4BL0 A;  3GC3 B;  1O6F A;  4WK4 A;  2EBS A;  4JSV C;  3NIF A;  4QT8 A;  4GMB A;  4J87 A;  3BWS A;  3V4P A;  2YNP A;  3DXM C;  5M5R A;  4N14 A;  4HDJ A;  3EQ8 A;  4JSN C;  3HFQ A;  3ZDX A;  5KDO B;  1UOQ A;  2IUQ A;  1E8N A;  2VDK A;  2BBK H;  5CYK A;  4FA9 D;  5FA5 B;  2H9P A;  5K19 A;  4LGN A;  1VZ3 A;  2H14 A;  5HQG A;  3OL2 B;  4BH6 A;  4J77 A;  5IT9 g;  4IRZ A;  3UVM A;  2OIZ A;  3A0F A;  4L3G D;  3K26 A;  3EI3 B;  1U8C A;  5C86 A;  3O4H A;  4JSX C;  3PVU B;  2OK6 A;  5JWZ A;  5C2W B;  5SXM A;  5FKR A;  3L4M D;  4PBZ A;  2YNN A;  2IUV A;  5FFO A;  1N6F A;  4AEZ A;  4GQ2 P;  5EM2 B;  2HKR A;  4QQE A;  5GMK n;  1K3I A;  4E5Z B;  4DNU A;  2EIC A;  4O02 A;  5EAR A;  3SWS D;  5IJ7 E;  5EMJ B;  3EI2 B;  1BPO A;  2AH1 A;  4O2W A;  3EI3 A;  3IIW A;  2VDO A;  4LG9 A;  4A7J A;  5FKT A;  4A11 A;  3KRX B;  4L1M A;  2OJY A;  1XHM A;  3IJ1 A;  4I79 A;  1H2Y A;  2HJB A;  3V7D B;  4WK0 A;  4Z7N A;  4UM8 A;  4WJK A;  4WK2 A;  5CXB B;  4ZOY A;  4GGD A;  5HE3 B;  3SBP A;  2CN2 A;  4A2L A;  5EM2 A;  3MZL A;  4AMZ A;  4E5Z A;  4X60 B;  1TYQ C;  2I0R A;  3JPX A;  1K8K C;  4JXM A;  4H5J A;  4EWR A;  5IJ8 E;  4CI1 A;  2XU7 A;  4TZ4 A;  2OK4 A;  4JT5 C;  2MTA H;  2UZY B;  1SQJ A;  4J84 A; 
#chains in the Genus database with same CATH homology
 5FKS A;  4O1Q D;  5H1M A;  3SN6 B;  2XYI A;  2GC4 A;  4JT6 C;  1SHY B;  2HKM A;  3K27 A;  4Y7R A;  4ZOV A;  5EAM A;  3SBQ A;  3JZG A;  4FB1 D;  4J79 A;  3W15 A;  3OKW A;  3RLM D;  4A0A A;  2HXC A;  2AGX A;  4O45 A;  2H13 A;  4K3I D;  2HYE A;  4ESG A;  4FA1 D;  4Y5R D;  4GM8 A;  3DWL C;  4QL1 A;  4G56 B;  1A0R B;  3J80 g;  1MG2 A;  3BG1 A;  5CXC B;  5K1C C;  2GNQ A;  2PM9 A;  4A09 B;  3JAM g;  3PXS D;  1GOT B;  1VYH C;  3I89 A;  4CY5 A;  4XYI A;  1YFQ A;  2G9A A;  2H6Q A;  2HES X;  1JMX B;  2YB8 B;  2YBA A;  2AH0 A;  4L3H D;  5H17 A;  1PGU A;  3C99 A;  4CY3 A;  3EU7 A;  4A08 B;  2YMU A;  3PXW D;  3OTT A;  3BG0 A;  2QC5 A;  4FHL A;  3NVQ A;  2P9K C;  5CXC A;  3JZH A;  1OMW B;  1JMZ B;  4CZV A;  4L9O A;  2AGZ A;  5FQD A;  1JJU B;  2B5M A;  5I5J A;  3SCY A;  4CY1 A;  2OVP B;  4PBY A;  4OWR A;  3SHF A;  3ULE C;  5EML B;  4E54 B;  4XYH A;  4ZOZ A;  3I7H A;  3I7O A;  2TRC B;  5GXH A;  2AGY A;  3OL2 A;  1XKS A;  3B7F A;  2B5L A;  3UVN A;  3IJC A;  3U4Y A;  1GXR A;  5HE2 B;  4ZOX A;  5GSA A;  5EMM B;  3GFC A;  5HE0 B;  3I7L A;  4CY2 A;  2CO0 C;  3N0D A;  3EMH A;  2I3T A;  1PI6 A;  3IKO A;  3NVX A;  3J81 g;  1PBY B;  3I2N A;  3AL8 B;  3E0C A;  3I7P A;  4PC0 A;  1NR0 A;  2G99 A;  2W18 A;  4PNK B;  4JSP C;  5H14 A;  1L0Q A;  2H6K A;  3IIY A;  3MXX A;  1Q47 A;  3EI2 A;  3SBR A;  1GP2 B;  3CIK B;  3MMY A;  3V5W B;  5IC7 A;  4K3J B;  4J8G A;  5C9Z B;  4CI2 A;  4UI9 R;  4NSX A;  2B4E A;  4A2M A;  3ORV D;  4AOW A;  4GZ8 A;  4KFM B;  4PSX B;  4A0B B;  2I0T A;  3PE7 A;  5CXB A;  1B9Y A;  3MZK A;  2H68 A;  2OVQ B;  3SJL D;  5IGO A;  1GG2 B;  2CNX A;  1RI6 A;  1N6E A;  3AL9 A;  1B9X A;  4ERZ A;  3UVL A;  2I3S A;  4GQ1 A;  4GQB B;  4J0W A;  3OKY B;  4FA5 D;  3RMZ D;  5AMS A;  1TBG A;  2AGW A;  3CFV A;  1U4C A;  2H9N A;  1NEX B;  1K32 A;  2H3X A;  2P9U C;  4J73 A;  4U1E I;  2H9L A;  2HJ4 A;  2PM7 B;  4BUJ C;  3RSE C;  4Z8L A;  4O9D A;  1PEV A;  3UR4 A;  3PVW B;  3UVK A;  3PXT D;  4X61 B;  2IWK A;  3C9C A;  2BCJ B;  4X3E A;  3JB9 L;  2O9K A;  4J0X A;  4MK0 B;  2J55 H;  5TEF A;  1S4U X;  2H47 A;  4D0K A;  3I8C A;  3AH8 B;  2CN3 A;  5HYN B;  3CFS B;  4IMM A;  3V9F A;  3F3P A;  3DM0 A;  3EI1 B;  4A09 A;  2CE9 A;  1U2V C;  5TEE A;  3N0E A;  5THA A;  1XIP A;  4O3T B;  3JRP A;  2CO0 A;  2PBI B;  4IA9 A;  1ERJ A;  4J8B A;  5I5M A;  3EI4 B;  3VGZ A;  3SLE D;  5EAP A;  4A08 A;  4FA4 D;  1QNI A;  3JZN A;  2YNO A;  4O3U B;  3AFC A;  1P22 A;  4GGC A;  3PSL A;  4A11 B;  1MDA H;  1N6D A;  1OLZ A;  4GM3 A;  4CI8 A;  2P9S C;  3EI1 A;  3EWE A;  3C75 H;  3RN1 D;  2QXV A;  3GRE A;  3OKT A;  3VH0 A;  4ERQ A;  3JRO A;  3OW8 A;  4ES0 A;  3DSM A;  3ODT A;  3IJ0 A;  3DXK C;  4PXW A;  3ZWL B;  2H9M A;  2P9I C;  4R7A B;  2XL2 A;  4E54 A;  3EI4 A;  1R5M A;  4GM9 A;  5AJA A;  5C2V B;  3I8E A;  4X63 B;  4ZN4 A;  2J56 H;  3F3F A;  3RFH A;  3SXT D;  5GXI A;  3SFZ A;  3UKU C;  1JOF A;  4FWW A;  1FWX A;  2B5N A;  3FRX A;  2AGL A;  2IUR A;  4L1Q D;  2CE8 A;  3L4O D;  4LG8 A;  4A0A B;  4XEI C;  5FXY A;  3AL8 A;  2XL3 A;  4FAN D;  2H6N A;  4FAV D;  3FGB A;  5FLX g;  1SQ9 A;  2IAA A;  4CZY A;  3PSC B;  5EMK B;  3SMR A;  3C5M A;  5FKQ A;  3I7N A;  5HE1 B;  4U7A A;  2Q7Q A;  4CC9 A;  4JD2 C;  2PM9 B;  2P9P C;  5AFU 3;  2AQ5 A;  2Z2O A;  4CZX A;  3P4F A;  2GC7 A;  3I7K A;  3RRM C;  4J82 A;  5EAL A;  2P9N C;  2P9L C;  4H5I A;  3RN0 D;  3UKR C;  5IGQ A;  4J81 A;  3KRW B;  3UVO A;  4A0B A;  3F3G A;  1MG3 A;  2Z2N A;  2Z2P A;  2OVR B;  4J78 A;  2J57 G;  2PM6 B;  2UZX B;  3SVW D;  3EG6 A;  5B4W A;  5A2Q g;  3RFG A;  2IUP A;  4PSW B;  4J86 A;  4CI3 A;  5I5I A;  5TF2 A;  3MKQ A;  5CYK B;  3NVN A;  4YVD A;  4D6V A;  4GGA A;  4OZU A;  3VA6 A;  2I0S A;  5TDH B;  4QRJ A;  4ERY A;  2IWF A;  3MKS B;  3OKY A;  3FM0 A;  4BL0 A;  2EBS A;  4JSV C;  4QT8 A;  4GMB A;  4J87 A;  3BWS A;  2YNP A;  3DXM C;  4N14 A;  4HDJ A;  4JSN C;  3HFQ A;  5KDO B;  2IUQ A;  2BBK H;  5CYK A;  4FA9 D;  5FA5 B;  2H9P A;  5K19 A;  4LGN A;  2H14 A;  5HQG A;  3OL2 B;  4BH6 A;  4J77 A;  5IT9 g;  3UVM A;  2OIZ A;  3A0F A;  4L3G D;  3K26 A;  3EI3 B;  4JSX C;  3PVU B;  2OK6 A;  5JWZ A;  5C2W B;  5SXM A;  5FKR A;  3L4M D;  4PBZ A;  2YNN A;  2IUV A;  1N6F A;  4AEZ A;  4GQ2 P;  5EM2 B;  2HKR A;  4QQE A;  5GMK n;  4E5Z B;  5EAR A;  3SWS D;  5IJ7 E;  5EMJ B;  3EI2 B;  2AH1 A;  3EI3 A;  3IIW A;  4LG9 A;  4A7J A;  5FKT A;  4A11 A;  3KRX B;  2OJY A;  1XHM A;  3IJ1 A;  4I79 A;  2HJB A;  3V7D B;  5CXB B;  4ZOY A;  4GGD A;  5HE3 B;  3SBP A;  2CN2 A;  4A2L A;  5EM2 A;  3MZL A;  4E5Z A;  4X60 B;  1TYQ C;  2I0R A;  3JPX A;  1K8K C;  4JXM A;  4H5J A;  4EWR A;  5IJ8 E;  4CI1 A;  2XU7 A;  4TZ4 A;  2OK4 A;  4JT5 C;  2MTA H;  2UZY B;  1SQJ A;  4J84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...