2HKXA

Structure of cooa mutant (n127l/s128l) from carboxydothermus hydrogenoformans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKLLLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based hypothesis on the activation of the CO-sensing transcription factor CooA.
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Transcription regulator
molecule keywords Carbon monoxide oxidation system transcription regulator Coo
total genus 62
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hkxA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hkxA01
1FP2A 2NNNA 3B73A 4M73A 4S05A 1B6AA 2XKOA 1X7NA 4MV2A 3PLQA 2QQ9A 1NHAA 1S8NA 2KIMA 4IXAA 4N9IA 1J5YA 4FX0A 3M3IA 2HYGD 2GWRA 3HYIA 1REPC 4BHCA 5D8KB 2EA2A 1WKMA 5D4SA 2PFBA 3E6MA 1ZZ6A 2L3DA 1ZLKA 4YYOA 2ET7A 3RTRA 1J2XA 2A61A 1HW5A 3DEUA 4KIFA 4Q29A 3FMSA 2PQ8A 5ICEA 4KL1A 3ZMZA 3H3UA 3ETQA 5K8SA 1WQ2A 1TNSA 1ZN2A 5HDKA 1UIJA 1SFUA 2QLZA 2A68F 3CUQB 4QX5A 1GXQA 3HOSA 4M6XA 3HQXA 2E1CA 4UXAA 2P5VA 4HBNA 3F8NA 1IN6A 1OYYA 2OQGA 2Q0OA 2MLGA 4YFKF 1XB4A 4UUVA 2MHFA 4L11A 1BI2A 5D5UB 2RN7A 2GXBA 4IHSA 2VN2A 4AVCA 3IDBB 2ISYA 4JQFA 3D0JA 3V8JA 3NVCA 4LGWA 2XV4S 1DZTA 2CGPA 2DQRA 2EFPA 3LFKA 4A6DA 3NW4A 2VE8A 4J1WA 4ZU7A 1P92A 3HRTA 5LEKA 2L4MA 2VQAA 4IEPA 3OD0A 4EMSA 4B8XA 3LWCA 2O1QA 1XGOA 2R7FA 1Q5OA 4FX4A 1ZRRA 3ES4A 3WU1B 2GC1A 1XD7A 4AXOA 4HBLA 4HAMA 1USSA 3TDUC 5EZWA 3LSTA 4QWQA 4BHBA 3EQLF 4LLOA 2WC2A 1LDJA 1EPZA 3FX3A 1P6RA 3CLOA 2PBIA 4I98B 4IESA 4U0VA 4WCGA 5FLXK 3WW4A 2HKOA 2VBZA 1OMIA 2DW4A 3DXJF 2CYYA 2ZFWA 1T0FA 4O3MA 2R3SA 3T8TA 5AIQA 2D40A 2VONA 1IW7F 1QWRA 5CVIA 2B0LA 2IXCA 3KZZA 2D5FA 1ON1A 2LNBA 4O6JA 1KU3A 2CWEA 3RYKA 2ACJA 3EO6A 2QDRA 4CZZA 4KIBA 4EM0B 1CF7A 3H1MA 5D5XB 1R1UA 2XASA 1J3PA 2VBWA 1XCVA 4WXHA 4EJOA 4LK0F 3E6DA 1H9TA 5A2QZ 2FMYA 2UXNA 1W5SA 1KQ8A 2PAKA 1TTYA 5IT9Z 3H9AA 3IKTA 4HN0A 5L3DA 2EWNA 3VFZA 5HI0A 4WVZA 5T3NA 1DP7P 1YWKA 1YTYA 3T8RA 1XE8A 4YIIA 1FT9A 4L9TA 1QO0D 2LKPA 4ESFA 1FNNA 2GA2A 4RAYA 3HT1A 2W57A 3GFMA 2H6CA 1DZRA 2PTMA 3WE2A 1W5TA 1O5LA 3GW2A 3GFLA 3BALA 5AVPA 4KN4X 1W4MA 2HOEA 4KWKA 4XBFA 3M9AA 3KGLA 3H8UA 5ED4A 2FSWA 1OYWA 1RGSA 2N7GA 1CGPA 1RNLA 4M9SA 1YS6A 2X0LA 3LZZA 3KE2A 3H50A 4NVPA 3LAGA 3KP6A 3L00A 3GFJA 4IEUA 2IA2A 4YIFA 4X6RB 1LB2A 3RIRA 4IEOA 4LK1F 1CF7B 4KICA 4I2OA 4MGZE 1I27A 3R4KA 4EV0A 1ODDA 1YG2A 2STWA 4QM9A 2ZJ2A 3VOEA 1FXZA 5E1ZB 2VC0A 4XSXF 1W7PB 3ECHA 4LLLA 3QRFF 2ESNA 3EHKA 3KMHA 4UHTA 1FI2A 5L3FA 2OZJA 2A6EF 4PCQA 4ZU4A 4RB3C 4QGLA 1X8EA 1I5ZA 4LG0A 5FFZA 1GQGA 2KJBA 3KP3A 2IA0A 3L2CA 3N97A 2GIVA 2LF7A 1NXMA 3GZ6A 2ZNYA 1R1VA 2GQQA 3I5UA 3COAC 2A07F 1XSXA 3H7YA 5HLHA 2DLLA 4ZZDA 2EVXA 2HR3A 2STTA 4ESBA 5D1IA 5E1XA 4D7SA 1KU9A 3LA2A 2E7WA 1YW8A 1LDKB 1HXDA 4XSZF 5HLGA 1BC7C 6PAXA 2CW0F 5CVRA 2DK8A 3NRVA 1CAVA 1BOAA 5H20A 1FOKA 3V7CA 3O6BB 1ZH5A 1ZGJA 4CDGA 2NRAC 3OOPA 5HS9A 2L4AA 3FHZA 2XAHA 4J1XA 1NYWA 1ZARA 1ZRCA 1A04A 3FWEA 3SCFA 3HRUA 2MH9A 2IT0A 5BPDA 2W25A 5FQ0A 2UWMA 2Z9OA 4KA4A 3RYPA 2HJIA 3IHUA 4IRIA 3CUOA 3FXUA 3E5UA 2JPBA 4RGXA 5LGTA 4YARA 4M9XA 2E1NA 3GO5A 2PAEA 2CFXA 4HQEA 4OU0A 2EFQA 4I0AA 1SAXA 3W6KB 2O0YA 4WBBA 1I1SA 4IERA 1KYWA 2UXXA 4L18B 2P7CB 1H1MA 4ZYDA 3IWZA 1O7LA 2XKPA 3MCZA 1ZAOA 3TO7A 3TQNA 1UHWA 3WTYC 2BNOA 3C7JA 3WW2A 3UKNA 1Y3TA 2QYOA 3F8CA 2H0VA 3V8KA 1XN7A 2P7VB 3E5QA 2JRTA 4ASNA 2Z99A 2EFNA 4RAZA 2EAAA 5DCFA 2L01A 1SD7A 1FYMA 5KK1A 2V1XA 4OMYA 3GFIA 3OTFA 3Q5FA 2K27A 1XGSA 1O3TA 1U2WA 3K2ZA 4HVOA 1H9GA 2VBYA 5KHIA 3WTZA 5JR3A 4GO1A 3SHFA 5JHUA 1FSEA 1YUDA 1YHFA 1EH6A 2IA1A 1NZCA 2HTJA 1CAXB 3BZ6A 4QM8A 5LGNA 2DI3A 1JGSA 2J5OA 5I8TA 3WTUC 2F5DA 2HS5A 3CUQA 1HBXG 3RKWA 4DNCA 4GXOA 3E6BA 3NL1A 3ELNA 3PNAA 1ZREA 5L3CA 4PIXA 3IIAA 2F5EA 1MJ9A 3QPHA 5E8IA 2IXLA 2FMLA 1YFXA 1IXSB 1SD4A 1U8RA 5ILSA 1JE8A 2GC2A 3KZYA 3H7JA 3GX4X 2K4BA 1LEAA 4CGZA 4AWXB 5F1RA 4M72A 3ERED 1QBJA 2D1VA 4LULA 4P9FA 1SD5A 2PYTA 1SFXA 2QENA 4P96A 5KBFA 4N0BA 4P9GA 2HEOA 1T39A 1ZGAA 1R58A 3OCPA 4KT5C 1S7AA 4EWAA 4HF2A 5KHJA 1FYKA 4Q48A 1IRGA 4XFGA 3RKXA 1Y0UA 3FFQA 2RDPA 5J3UA 1IN7A 4OIQF 4EJUA 3LOIA 1R7JA 4GGGA 2PJPA 1WWXA 2J5PA 1IF1A 1BI1A 4WX9A 2DO7A 5I0RA 4GCVA 3IRQA 2NS0A 4DQ2A 3F22A 2W24A 1HSTA 1ULYA 5KHGA 4L0YB 1AWCA 2GC0A 5J7MA 1R22A 4IPAA 4XEZA 3F8MA 1YQAA 2QBYB 3QAHA 2A69F 3L7WA 2XUBA 2XLFA 4EROA 1YO5C 5HS7A 1XSDA 3ABUA 4KU8A 4YG2F 1V70A 4UBHA 1VP6A 2M1BA 3DN7A 3B02A 2B8MA 4HX4A 2VOOA 1OKRA 3I0TA 4IEYA 1O3SA 1FC3A 1CAWA 4L9JA 1Z6TA 1MDMA 5LHGA 1KYZA 4BNCA 3ABTA 1H1IA 5IT9K 2FA5A 2JSCA 2Q8KA 3FJSA 4P9UA 3KLNA 1OI6A 5KHHA 3F8FA 3QP6A 4LD5A 4HN1A 1OYIA 2PLYA 4KFCA 4K2EA 2FBIA 4PGGA 4KMFA 1J58A 5ILUA 1TW3A 2YPRA 3U2RA 1O4TA 4MGYE 1E2XA 4Q0VA 2KJCA 4XF9A 1ZZ9A 4HSJA 2UY8A 3ECOA 1MGTA 3KSCA 5F64A 4MTDA 5FPXA 4Q4ZF 2K0GA 3J80K 3BDDA 4A6EA 4G7HF 5DUKA 1P4WA 5E1WA 3IBMA 3TDZC 4U7DA 3WG9A 2GC3A 1S29A 4XFCA 3IKVA 4HX7A 4U7BA 4HX8A 4A5MA 1XDUA 1XRUA 4JTOA 3BU7A 5ILVA 5K5RA 1ZHFA 1SD6A 1LVAA 5E8GA 2Q2EA 2ZKZA 4YFXF 1O57A 3RI4A 3SZTA 5FGMA 5IT3A 2UY9A 3WGIA 1XCBA 4XFFA 1IN5A 1ZG5A 2AS5F 4WWCA 1GQHA 3RJPA 1PP8F 1UHMA 1Z1DA 3PQKA 1MDMB 1IN8A 3JTHA 2MLKA 3WW3A 3GWZA 2Z5UA 1T98A 3ZN0A 3E5XA 4GYGA 5FB2A 3C3VA 3MDPA 4LEJA 5LGUA 4H7LA 2KRFA 3FZVA 4IF4A 3H3ZA 1ZNPA 4HA8A 5JFRA 2KXLA 3MFKA 1HSJA 2TDXA 4FAHA 4S04A 2L02A 2FE3A 3PVBB 4RB0A 2FEZA 4I09A 1FBUA 2FNAA 4ETSA 5D8LB 2VT2A 5JSPA 4IRGA 3SHRA 3LA3A 3ST7A 1FP1D 4JK1X 2G7HA 4U88A 2Q30A 2RGVA 2K4JA 4WF2A 2PHLA 5CYVA 1EY2A 2ESHA 1NE4A 2OZUA 1IXCA 5E18F 3HOTA 3E6CC 3I59B 2UZKA 1K78A 1UCRA 4Q5SF 1V4RA 4YSFA 4NHJA 5CLSA 1QPMA 3I53A 3T0YA 1PUEE 2DT5A 2IW5A 2M5WA 2XROA 1JUHA 4CICA 4B09A 3HRSA 4ORFA 4XF4A 2EV6A 1K79A 5E20A 3MYXA 4BYYA 2OQRA 4ENNA 3EYYA 2O8QA 3CF6E 4G9YA 4Z82A 1DPUA 5FLIA 1IXRC 2A5YB 4OLLA 3USSA 4PDKA 1ZZBA 2FBHA 2FXAA 3GLXA 1ON2A 5E16A 5HDNA 2FBKA 5CVJA 1YIOA 2P5KA 4HF0A 1B9NA 3BWGA 3HSRA 2JT1A 3D0SA 5JSOA 4MUVA 2MC3A 5JAXA 2IXJA 2FNPA 4A0ZA 4RS8A 1XE7A 1B4AA 4MGKE 1NE6A 3DPTA 1RIOH 4HV5A 2MD5A 1E17A 4GYIA 4UV9A 1BI3A 2F2EA 4EJWA 1ZRFA 4TV7A 1UCXA 1LJ9A 2P5LC 3U1DA 2XAGA 5ERIA 1STZA 5LHIA 2QWWA 1DDNA 1TLHB 4LG0B 3K1MA 3ZQ7A 2QQAA 3KEQA 2PMHA 2W84A 4Q47A 4O5VA 1SEFA 1IZ1A 1XGMA 2VPVA 1KU2A 3HUGA 4LJZF 4CO8A 4IEXA 3F6OA 1Q3EA 3O2PE 1LEBA 4ZYEA 2IXHA 4IEVA 3L2HA 2FF4A 3WTXC 1LRHA 3GYHX 4KWJA 1D8KA 5I91A 4YNIA 3AAFA 1R23A 4UBGA 1O7FA 3WE3A 2DU9A 2W85A 2V6CA 3K9TA 3WODF 4YRDA 4HDUA 2EB7A 3J81K 3RPUA 3WTWC 2KIFA 1IUYA 1W7PD 4U0WA 5CVUA 2QJVA 1SFNA 2CV6A 1PMIA 1TW2A 3ZP5A 1HKQA 1EV7A 1HKSA 4MEXF 1WI9A 5JI6A 5LLQA 1QZZA 2G9WA 3SFZA 2CQKA 2GXGA 3T5XA 3HT2A 4PIZA 5LRSA 3QU6A 3V4GA 3OF1A 2CG4A 5AIPA 5L3EA 3ULQB 3KP4A 4Q0UA 2ZO4A 3V7RA 3CEWA 1XSVA 2XAFA 4RD7A 1BN5A 1UFMA 2ATFA 4BHPA 4LTAA 1F5TA 3KGZA 4HOBA 3V7SA 1ZLJA 3ZMTA 2M45A 3M8EA 2VECA 3TKYA 5EEHA 5CADA 4RB2C 5CJ9A 1YFUA 3WU0A 2IJLA 2Y48A 3O14A 4ZZLA 4XF0A 5HLIA 2IXIA 1B9MA 3HIFA 2HQNA 1D3YA 1SQ4A 1P4AA 1UIKA 1IRFA 2HKXA 3KLOA 1K7AA 4MQVA 5FLXZ 3I4PA 1LQ1A 4R8HA 3TNQA 2RVCA 3LWFA 3GYDA 5FD5A 3GZ5A 2OD5A 3I71A 2QZ8A 1HW2A 4EWDA 1X8MA 3FXRA 2ZKLA 2PMUA 3BP8A 5D4RA 4LB5A 2H27A 2BGCA 4LMYA 2Q1ZB 4EVIA 2HZTA 2ETEA 3ELKA 4EQQA 2Y0OA 1KU7A 3H92A 4EGYA 1F4KA 3PQJA 4JBAA 2FOKA 3LA7A 4QLCU 4MX3A 1XMKA 1MKMA 2JTVA 3H1YA 2DPDA 2VOPA 3OGJA 5A2QK 4E2GA 2O8XA 1UPIA 3SXWA 2B5HA 2GA1A 4IETA 4M6YA 3ZMDA 1VTNC 2QVSB 2D1HA 1GVJA 1G4DA 1WRJA 4GULA 1CAVB 2D93A 3MEXA 3SZPA 4CXFA 4XFAA 5DUIA 3BCWA 3GUDA 3MQ0A 1J3RA 2MPFA 3RPQA 2LSOA 1TQIA 3EETA 5FO5A 3C3WA 2FRHA 4META 2BEOA 1UD1A 1R00A 3DP7A 3LAPA 2D45A 4Q0PA 2OU2A 3U10A 1D8JA 2VODA 4IRHA 2QCSB 4BIFA 1QXRA 4I3PA 1ZVFA 1BIBA 2OBPA 4BH9A 1Z05A 1ZX5A 2MA3A 1BBYA 3SCGA 3CUQC 1DUXC 4HMZA 3FZ3A 5C8WA 5BMZA 1C0WA 1RTVA 4IEZA 5H6RA 2C6YA 2EV0A 4E2SA 3DQVC 1JXSA 2UYAA 2WV0A 3CDHA 1R5HA 2XRNA 5LEJA 5E17F 2OA2A 4IJAA 5DYMA 3Q9SA 2XLGA 3HTUA 2EFOA 5ICCA 2BBYA 3DF8A 2QUFA 5DEQA 1W7PA 2M30A 2OZ6A 5BXXA 3S7IA 3M1EA 5J6XA 3ACLA 4OFGA 4HVQA 1MD0A 4HF1A 3WW1A 2ZMEA 4IHTA 3FMQA 3F72A 1T2KA 3PFIA 2DK5A 2O6GE 1TNTA 1G3YA 2EA7A 1S7OA 1WSUA 2UYBA 3EYIA 3CO2A 5TJJA 3KFWX 3LAJA 2EV5A 4L5IA 1YLLA 5I0UA 5DD4A 4AVAA 1IN4A 2QBYA 1USTA 3R0AA 3EQEA 4R52A 2O3FA 1X82A 4OINF 3SQNA 4MTEA 1JHHA 5KHKA 3T1BA 1P4XA 4LLNA 1ZG3A 4KWLA 1TQPA 3VHRA 1XMAA 2PQQA 4G8XA 1T6SA 2DFIA 3CO6C 4PIYA 1T38A 4PZJA 3LQRA 4EM2A 2R7DA 4D7TA 3TGNA 5D5VB 3H1WA 2M87A 2YX7A 4NQWA 4QXKA 2RV8A 5FQ0B 4UVBA 2QVOA 4G7OF 2HFHA 3FF5A 3BY6A 4ZYGA 4Y17A 2LF8A 3DPLC 3BJAA 4XRFA 1GHCA 3ES1A 4BAYA 2XAQA 1OD5A 4OIRF 4L0ZB 3RZZA 3IWFA 3IDCB 5FLHA 4IEWA 2NYXA 1IPJA 3SMHA 1UW8A 4N9HA 5BV6A 4MQ9F 2DPUA 1U5TC 5JVTA 2XAJA 2HQRA 3KEOA 4L9NA 1RC6A 2YX4A 3ZMUA 2OYZA 3P9IA 1TBXA 4HW0A 1OPCA 3P9KA 2OA4A 3R61A 4XFIA 4AVBA 3I58A 3L09A 1J3QA 1Z7UA 2WFPA 4LB6B 4XF3A 4AD9A 4XLNF 2H94A 1RUOA 2YSRA 3CTAA 4IVNA 4A12A 1XGNA 3BPZA 1BIAA 4HLYA 2RKHA 3BPVA 3C18A 4MGRA 4O9EA 2FU4A 1UB9A 2Y0MA 3U9GA 1F9NA 1YLFA 3BOQA 3ISPA 3IL2A 2DQLA 2EJRA 4NB5A 1DGWA 4CYDA 3S0MA 2C0ZA 4WK8F 4AVPA 2DTRA 1J0RA 4PJYA 2F5FA 2V1DA 4A0YA 4AIJA 2GAUA 2XL7A 5I93A 1YYVA 5FCCA 3TOAA 2HWVA 3GVAA 1J7KA 4M71A 3HTSB 3E3VA 1XDSA 1HKTA 1BJAA 2BV6A 5FLJA 1MZBA 1LKNA 2KIUA 4G94A 2P4WA 3N4MA 4HLXA 1ZYRF 3WGHA 2YU3A 1L3LA 1ONVA 4QGNA 1U78A 1KA8A 3EJKA 4KDPA 1MJAA 1FPQA 1RZ4A 4Y15A 4I0BA 5DCMB 5DCMA 1BM9A 3BROA 5J8CA 2V1UA 2PHDA 2COMA 2RQPA 4ZYHA 1IPKA 5I0SA 5BPXA 2P17A 1QNTA 1LR5A 3W6JB 3WGGA 2DBBA 3ML6A 4P55A 3FHIB 4UNOA 1G3WA 1U5TB 2P6SA 5DV5A 1TQ5A 3FE5A 3O3KA 4F7ZA 5BQTA 3UKVA 2ELHA 2G7UA 5FDBA 4K8FA 1QGPA 4L5JA 2VXZA 3ZN1A 4JTNA 5C6CA 2A3SA 1I1GA 1R5GA 5D6FA 5FPZA 5BPIA 5FFXA 5DDGA 3GBFA 3F6VA 2GU9A 2QQBA 5H6QA 3ZMVA 2ZXJA 4KN7X 1SMYF 4RGUA 4XFBA 4FHTA 4QGMA 2PI0A 5HVQC 4M9ZA 1CAWB 1WLTA 3KP2A 4RB1A 1EP0A 2XVCA 4MGIE 2BE5F 1MJBA 1QQIA 5I8SA 3VB2A 2ETHA 2HYFA 1Y9QA 1SMTA 3VEPA 5JSRA 1DPRA 3BPXA 1ZZ7A 2VC1A 4G7ZF 3FM5A 1L3JA 1SFEA 4Y13A 4IEQA 3L9FA 5HOOA 1G3TA 1J1LA 3KP7A 4LLGF 1Z9CA 2CAUA 3R60A 4ZH4F 4FBFA 2Z3YA 3JSOA 3S7EA 4L9VA 5LBQA 2PFWA 1PP7U 2PA7A 4AQ6A 4LUKA 2ZCWA 2QNKA 4YFNF 2EFWA 2H6BA 2XL9A 2H09A 1KGSA 1YW9A 2BNMA 2F4PA 3U0ZA 1CAUA 2ET1A 2IC1A 2KKOA 5D6EA 3RNSA 2E9QA 3TOBA 4E70A 1CX4A 2EA4A 1U6GA 2IP2A 2JPCA 5HDGA 4A2UA 1QXJA 2BYVE 3NSTA 1K6OA 3D82A 1FSHA 3CLPA 3JAMZ 1PM7A 4CHUA 5L3BA 3EDPA 1Z6RA 3JZVA 3FMRA 4KMUX 1R36A 1V3FA 3P7NA 5K5OA 3MPBA 1IAWA 1FY7A 4UVCA 3G7DA 3HHHA 4Z07A 1S3JA 1BC8C 1BI0A 4OIPF 2D5HA 4EJTA 4RGSA 3NJZA 4R1HA 2P6TA 4OIOF 5CVVA 2HDCA 4FAGA 4PGHA 3EBRA 4G6QA 4KYWA 3GEZA 1EH8A 3J7AO 4EM1A 5JR7B 4JV4A 4LA3A 1G6NA 1U5TA 3DFGA 1O5UA 2L54A 2ISZA 2BNNA 1YFYA 4UXNA 3RYRA 1JHFA 5I8YA 3D5LA 4EWEA 1Q1HA 2AXLA 1J75A 1FX7A 5HS8A 4I02A 3R6SA 5J48A 3V8LA 2K86A 2VE9A 1KQ0A 2EK5A 2ZBKA 1YFWA 2P8TA 1P2FA 4HYEA 3DV8A 3BJ6A 4M74A 3BB6A 5JCTA 4KUMA 1EYBA 3CO7C 2V09A 4WXDA 3MZHA 3SXYA 2A6HF 5J8FA 3I54A 5BY5A 3F21A 4LUMA 2VBXA 3QP5A 3TNPB 4O9GA 3S2WA 2RNJA 3I64A 1L0OC 3HSEA 3WTSC 3UKTA 4HDVA 2OPKA 2ZNZA 5LRRA 1U3EM 3M70A 4ZU5A 3WTVC 1R1TA 4HV6A 4ENKA 3F8BA 4EGZA 4BQAA 2DCTA 2K9ZA 1RI7A 4L2NA 1X3UA 3MZYA 3RDIA 2HGCA 3GF2A 1OFNA 4AQ2A 4Q0QA 2Z33A 5BOXA 2GZWA 3NQOA 2WWYA 3ZDSA 4AIHA 2XGXA 1H0MA 4ENJA 2Y75A 2K7LA 2PN6A 1CAUB 3HSFA 1WGPA 3REOA 4A0XA 1FYLA 2XLAA 5F6FA 5AONA 2O03A 2Q0AA 3F23A 3JW4A 1F1ZA 5LHHA 1S6LA 3ZMSA 3I7DA 2IVMA 5E1RA 4WZCA 3J80Z 2MNGA 2K02A 4XETA 2V79A 2CO5A 1ZG1A 4KIGA 4KNYA 2HTSA 5ICFA 3EUHA 5I0TA 4Q0SA 4ESJA 3GXOA 4HLTA 3M7GA 3HHGA 3P9CA 2Z2SB 1TQMA 4ENMA 2NNYA 2JZYA 4E2QA 4HZFA 3QOPA 2WTEA 2M8EA 4R79A 4OMZA 2D2WA 2VT3A 3G3ZA 3TO9A 3WTTC 3I59A 2PG4A 2OAZA 4I7HA 4XLPF 3M8FA 5BS6A 4MZUA 3MWMA 3K0LA 3BJOA 5KVRA 2XHKA 3DKWA 1O3RA 3JTGA 4UV8A 3K69A 1HW1A 2MBFA 3VODA 1G3SA 1GXPA 1AOYA 4MEYF 3CJXA 3HRMA 3CJNA 5L3GA 2CAVA 2F5CA 1RUNA 2PAMA 4LA2A 2DAOA 3IRRA 2IPQX 3Q9VA 1QZYA 1VJ2A 2XIGA 4HSLA 1LNWA 1CAXA 4MHGA 3R0JA 4MH0E 4XFHA 2V9VA 1D5VA 1DGRA 3LQQA 3FXQA 3IC7A 5K1YA 1I6XA 3J81Z 1LDDA 4DINB 3ZPLA 1QY4A 4BXUA 1J9IA 2NAZA 1ZZCA 1FZPB 2O61A 4QMAA 1EH7A 4TLFA 5EFUA 3E97A 1YW7A 4JVAA 3NKTA 2Q4SA 3JAMK 1Z91A 3TO6A 1B59A 1PDNC 2Z69A 4HQMA 2YR2A 1RL3A 1FLIA 1O3QA 2PEXA 3K1PA 1FWZA 5ICGA 1B1BA 4WXCA 1FBQA 2ZMEB 2MH2A 1VR3A 3KCCA 3QPTA 4G6DA 3SCHA 1FBSA 2E7XA 2B9UA 3K1NA 3QU3A 5EEGA 4AIKA 1K78B 1ZZ8A 5DD8A 2CSOA 3JSPA 4EJVA 2X4HA 4B29A 3RKYA 4P5OA 1YS7A 1YFHA 2FQ3A 5D5WB 3NEUA 4X6QB 1KQ9A 3QACA 3U11A 4ON0A 1WA4A 4HVRA 1HQCA 3CL1A 5K5QA 2IXKA 4U0YA 1J59A 4H0EA 3KP5A 4F8AA 2ADUA 3F3XA 4FT8A 5BUVA 1ZRDA 1U12A 3G73A 1Q43A 4I01A 1OR7A 3ROUA 3DL3A 4RGRA 2IRFG 3FM3A 5CU1A 2GH2A 2QM3A 2LDUA 4Z2YA 2RC4A 4OOIA 4KU7A 3OV8A 4D0PA 5FD6A 2I45A 4ONUA 4UVAA 3MAJA 4A5NA 5TRDA 3C1DA 2FQPA 3KETA 4LFUA 4XF1A 4MNUA
chains in the Genus database with same CATH superfamily
4W4ZA 1FP2A 1RIRA 3B73A 2FZ2A 1OOPC 4AYBN 4XURA 4PCRA 1X7NA 4MV2A 4M0NA 2QQ9A 4AHXA 1J5YA 3LOBA 2HYGD 4DOUA 2AR6A 3GBWA 1Z3YA 4BHCA 2ZEYA 5D8KB 1XPXA 3ACHA 4IE6A 4AEMA 3AZWA 3TOJA 2FD8A 2HU9A 1UF2C 3DBHB 2ET7A 5EYYA 3I4NJ 2M0MA 2HYJA 4KIFA 1QEXA 5ICEA 4AFDA 2C4XA 1SVMA 1RUI2 4OHXA 3BTCA 3CCUI 1WLDA 2HQ5A 4IV3A 1WW6A 2ZMNA 3S3NA 2E60A 1TME2 4E4DX 1GXQA 2VPLA 3K4NA 2VZQA 2F4MB 2D6PA 2OQGA 2Q0OA 2MLGA 4YFKF 1DP3A 3Q9OA 3ABKH 5D5UB 2GXBA 4AVCA 3NVCA 3VBHC 1JZ7A 4CCKA 3D5OA 2HBUA 4JDNA 1DZTA 2CGPA 3HBZA 2EFPA 1G9CA 3KWVA 4J1WA 4ZU7A 1MMGA 1P92A 5LEKA 2EXJA 2L4MA 4BK5A 2GOMA 2K46A 1JUSA 1QU0A 1S4CA 2FDKA 4CCEA 3WU1B 4D6SA 4NWWA 3JRHA 5C8CB 1WW5A 2CUEA 2K3PA 3A02A 1XPWA 4QWQA 4BHBA 3DU6A 2WRAA 3PMSA 2L5QA 2Y0IA 1AX1A 2X6XA 3Q0VA 1P7JA 1O4YA 3QLQA 2WC2A 2C6SA 1LDJA 2A6WA 1P6RA 3CLOA 4IESA 3OL3A 4U0VA 2XF6A 2CY6A 2VBZA 5JR2A 2Y6HA 4F52A 2VW2A 3SLIA 2DW4A 2ZS6B 1H8VA 3T0DA 5HPOA 3OR1C 4NPLA 1T0FA 3SH4A 3W5NA 1YITI 1UNBA 3IDAA 4RR3B 2E7TA 3AP5A 2CWEA 2VGDA 2ACJA 3EO6A 4B4PA 3KV9A 3QWLA 4EM0B 3B69A 1CF7A 2X10A 3H1MA 3ZLIA 2XASA 3WVJA 1J3PA 2NP0A 3HJRA 1KZHA 1OC1A 5EZHA 4EJOA 4LK0F 4GJZA 3VBRC 5A2QZ 2UXNA 5GADJ 2PAKA 2HVRA 4OHYA 1OKOA 1FTZA 2YU2A 4HN0A 2KT0A 1PZ8A 1UZYA 3ZQQA 4XOGA 4BQWA 4YW6A 1DP7P 2I74A 3USUA 3ASOH 1VQ8I 1R092 3T8RA 1TWGJ 2VZPA 1PGL1 2R7UA 4Q2FA 4L9TA 3S93A 3VD3A 5E8AA 2A5ZA 3KT1A 3HT1A 3TRSB 4ZKTB 5A7OA 4CTEA 2ADDA 4JQRA 4AQTA 2XB0X 1L7QA 4FP3A 2DUOA 5AVPA 1VQPI 5A3OA 4QDSA 2FDGA 1W0PA 4YG3A 1BOBA 2VQ0A 1OYWA 1OCOH 4YVWA 5AC92 1YS6A 3LD8A 2X0LA 2DMQA 3CDLA 4LBMA 4NRQA 1LE8B 3KP6A 3ZGKA 4YIFA 4LQRA 1RUE2 1HRV1 2EIJH 1CF7B 3AMNA 1I27A 4HNVA 3H0GJ 4LORA 1FXZA 1W6MB 1W7PB 4CXYA 4LOCA 1WD3A 3OGGA 1QHGA 3QRFF 1YX3A 2ESNA 1O8PA 3PIOF 4UW4A 3EHKA 2E32A 3BR0A 2OZJA 4IQ4A 4QGLA 4AEKA 2NS7A 2IAIA 3THCA 2E63A 1IGNA 3M3OA 2LF7A 1NZIA 1MS4A 1JZ4A 4AI9A 3JCUC 5DUWA 2A07F 1XSXA 4ZZDA 2EVXA 3RMYA 4CCMA 4RGGA 1Y9GA 1B35C 4MLOA 2I07B 4O61A 5L9VA 3A1YA 2M34A 5GZCA 4GWNA 3DCFA 2DK8A 3NRVA 1YEWA 1UPSA 5H20A 1GZTA 3FIWA 4W8JA 4NIGA 3OS2A 3OPTA 3MF9A 3FBIB 1DYOA 5FO7B 3BN6A 4WVWA 5K0UC 1ZARA 3FUOA 3ABMH 2QZ2A 4QPIB 5KR7A 3W2AA 1C57A 3M4OJ 3HEIA 1BBT3 3AFHA 2XJPA 2W25A 3JRCA 1BVVA 4CDUB 1IG0A 3UETA 4H3WA 3WF0A 3RYPA 1PM4A 1WCDJ 1GUUA 3ZOIA 5KAFC 3AXEA 2DFHA 4BZ4A 1H0BA 2WLQA 3HL2A 2BY1A 5SV8A 1GZWA 4M9XA 2CQQA 4HQEA 1QQP1 4OU0A 2XF7A 2EFQA 4AU7A 4B47A 1JI8A 1D2SA 1I1SA 1H1MA 2P7CB 4K8RB 3TO7A 3TQNA 4JGZC 1QZEA 2EIMH 3WW2A 1RUI1 1MS8A 4DOZA 3OIPA 2HPIA 1Y3TA 1YQ2A 4AEDB 2H0VA 2JRTA 4ASNA 4FE4A 2L01A 1GNHA 4RM3A 2PELA 5FY5A 3ZR8X 4QPOA 1US3A 2YU1A 5FOBB 2V1XA 1XGSA 2HWC3 4L5EA 1H9GA 2VBYA 4MHRA 4BDYA 1MS0A 2E2HJ 3GF6A 3SHFA 5JHUA 1V0AA 1YHFA 4FOYA 3S32A 4XLHA 3BZ6A 4QM8A 1JGSA 3ZYFA 3WTUC 2HS5A 2ZEWA 1HBXG 2JVHA 4DNCA 3PU3A 3PNAA 1ZREA 4ISQA 1KS4A 3IIAA 2F5EA 1JKPC 4BJ5C 3QPHA 1IZ3A 5E8IA 4JGYC 4JGYB 1U8RA 3NV1A 3DEMA 1ETYA 5FRNA 1ULOA 4JKKA 3J8F3 2WY8Q 3AL0C 1DG6A 2K4BA 2AUYA 1LEAA 3PNTA 1Z0HA 4UY8I 1DFQA 1SD5A 3A7QA 5LA1A 3OYEA 3VL8A 2QENA 5JXJA 3U78A 4JDMA 5KBFA 1N3PA 3V0BB 4QDRA 3OR2C 2KQRA 4XQDA 4AL9A 4Y33A 3CF5F 2DU1A 1BR1A 1RUD2 3OCPA 2V72A 3O1SA 1QVTA 2DMPA 4HF2A 3K2AA 1A35A 3O1TA 1IRGA 4QX3A 3HOZJ 3RKXA 1RUH1 3IM0A 5BNOA 2DOEA 3FFQA 3IAPA 1F5JA 1T6GC 3T2PA 1ENXA 1R7JA 4HKWA 1XYOA 4Q26A 4YRVA 3THDA 1RVF2 3FXKA 3GNEA 3HD8B 5A80A 5H9PA 5A3LA 3IRQA 2W24A 2W00A 4L0YB 2UWAA 1AWCA 5J7MA 1GU3A 1K4TA 1R22A 4IPAA 4XEZA 3WDXA 4BMBA 3F8MA 1MZ6A 4WV8A 3QAHA 4HPQA 2A69F 5KNLA 2B42B 1R1A1 3FDYA 4AK3A 2MEV1 3ABUA 4DGWB 5IOZA 3KVAA 1TEIA 1V9U2 2M1BA 4C2MJ 4HKOA 3RFRA 4YW7A 4YW3A 3CCLI 1ASJ1 1JMUB 3RMXA 3I0TA 4XDPA 1O3SA 4CH7A 1Z6TA 3LEIA 2HYKA 2BWCA 3ABTA 1H1IA 2JSCA 3W9AA 2A6ZA 1GLNA 2LALA 1KONA 1UU5A 3KLNA 2J1AA 5FREA 3F8FA 4LD5A 2PLYA 2CSGA 4KFCA 4K2EA 3CMYA 4KMFA 5ILUA 1CZTA 1RR8C 5HCHA 3CNAA 3ZQGA 1CQTA 2L9VA 2CTVA 2UY8A 4DB5A 1PMHX 1JKOC 1RUC1 2RDSA 2L9LA 2X8KA 2WO1A 5A6XA 3KSCA 3OOUA 4MTDA 4Q4ZF 2RAEA 2L2OA 4A6EA 1W06A 3APBA 2KPMA 5HV4A 1SLLA 2V7FA 2ID6A 3LIGA 3KIOA 3NKGA 1YIPA 5ILVA 3HOYJ 1ZHFA 5JZGB 1SD6A 4XL9A 4MIMA 5IVBA 3TP3A 2OVUA 4QB1A 3HNMA 1O57A 3AL5A 1TNFA 3OL4A 1UZVA 1FEXA 3BZKA 2CQ7A 5FGMA 2R7RA 1HJGA 4QPGB 5LWBA 5E3OA 1ZG5A 2AS5F 2K9SA 1GQHA 4RR3A 3RJPA 1CIWA 1PP8F 1U0AA 4BDZA 2ORXA 1IN8A 5A7NA 5ACA3 3WW3A 3S5QA 4DMIA 1T98A 1Y4WA 2VVEA 3AYCA 5EJ3A 1W6OB 3AXDA 5FB2A 2WFF2 3C3VA 3PDQA 5LGUA 2FZ1A 4P08A 1ENSA 1VALA 2B7YA 2OPWA 3ZM8A 1KFXL 3LSKA 1ZNPA 4HA8A 4ZPIA 2ME0A 1G8XA 3G1OA 2JE9A 5DZGA 1ULPA 3MKZA 2ME6A 4FAHA 2TDXA 2DVBA 3MIDA 2A6XA 3MLJA 3BOWA 3JBG2 2FE3A 3PVBB 4OHZA 5LBEA 2RR13 5T55A 2FNAA 1AHSA 5JSPA 2CV2A 3IIIA 1W3VA 1R091 3ST7A 1FP1D 4FXKB 3O0WA 2PHLA 4NR1A 3ZR6A 5CYVA 1HB4A 1EY2A 5FTTC 1WCSA 3OBTA 2VQTA 2J22A 2WS91 2QUOA 1UCRA 4NHJA 5CLSA 3AG2H 1ST8A 2DT5A 3KCYA 2M5WA 3NNGA 2WFF1 4YFWA 4LO5B 2DCEA 5DAWA 2LH9A 4XF4A 4LR4A 2A71A 3WG4A 3WQBA 2EV6A 1UY4A 3GXUA 1AJKA 2QE3A 3POGA 2OQRA 3EYYA 2W91A 3BQYA 5EYXA 5FLIA 1IXRC 3WNXA 3USSA 3QODA 1W6MA 5IAVA 4BACA 1AR91 2FXAA 3R0RA 3GLXA 5E16A 4WM8B 2FBKA 3EB7A 5B1BH 5GAGJ 2A6YA 2NVYJ 3BQZA 3AP7A 2RS52 5IFTA 2JT1A 3D0SA 1UJ8A 3S1RJ 5JSOA 1FMWA 1DHKB 1AR82 5A33B 2ZMEC 4RS8A 3CJRB 2WB1N 3DPTA 1NE6A 2JICA 4LLFA 2BFUL 2MD5A 1B8IB 1AJOA 2JN6A 4UV9A 3VBSB 2M4KA 2F2EA 4EJWA 1ULCA 4TV7A 1UCXA 1LJ9A 4NC8A 4NIHA 5ERIA 5C3OA 3VBOA 4V19K 3S5AA 5F2SA 4HEA2 3K1MA 4Q47A 3D3AA 1IZ1A 3IH4A 1XGMA 2VPVA 2KMUA 5K7HA 3USUB 1W9SA 1VBA3 2ZJCA 2IWGB 2L7FP 5FPUA 3K3OA 1F35A 2HXOA 4C8DA 1TG7A 4ZYEA 1YJLA 2IXHA 4RAGA 2MD0A 3N9MA 3JUUA 4W6YA 1LRHA 5I91A 3U1XA 4UWDA 2GN3A 1R23A 1JYCA 1O7FA 2DU9A 2V6CA 3K9TA 4QDQA 5LA9A 4GALA 4HDUA 5FZOA 2EB7A 3J81K 3RPUD 2IGNA 3BOPA 3MLLA 4AYUA 4BQ1A 4QB6A 5CVUA 2QJVA 3O7OA 1QOSA 2W87A 1TW2A 2Y69H 1GMMA 5CA6A 5GLWA 5J09A 1SCSA 1EV7A 2PLV2 1Z78A 4MEXF 5LLQA 2R0QC 1UXXX 4R9BA 2WL1A 2DYCA 3T5XA 3HT2A 1LOBA 3QPLA 1S72I 2VZVA 4PIZA 3V4GA 1ZBE1 3OF1A 3OUJA 3S16J 4I30A 4KISA 2VTXA 2X5IA 3UJOA 4I6ZA 3V7RA 5KAIC 2XAFA 4RD7A 2QQ8A 4LTAA 3V0AA 4NUBA 2BZDA 3V7SA 1WWYA 3M8EA 4AYBA 3GTKJ 4QT6A 2XUMA 3RI9A 4RB2C 4O65A 1RUD1 2JE8A 2HWF3 3R05A 2RS32 1W36D 3AX4A 3HIFA 3AVRA 1QJY2 4RSUA 2JA5J 1XS9A 1IJWC 2HKXA 3FK7A 3KLOA 1K7AA 1AKHB 2VCMA 1RUJ2 5FLXZ 4OI0A 3I4PA 1LQ1A 5IP6A 4R8HA 2VUCA 4OZXA 3TNQA 2RVCA 2DF7A 4RR3C 4LK7A 3K4LA 4MO7A 3FBMA 2YS9A 2ARAA 2OD5A 1HW2A 3FXRA 2ZKLA 4A3DJ 2WO7A 3UL2A 4EVIA 2ETEA 5ACA2 4KMQA 2FOKA 5EEAA 1AYM1 3U37A 3LA7A 4PQ9A 2NMOA 1MKMA 2JECA 2ZJPF 3BUCA 3ZXKA 2VOPA 1T8IA 1FOD1 2RS12 4XW3A 2CW7A 4LKDA 2KD7A 1A31A 2VE1A 3MUZ1 5FY8A 1VTNC 1GP5A 2ES3A 4XCAA 4XUPA 3DKYA 4J00A 5GTHC 2E19A 4COVA 4GULA 1PGW2 4NBQA 5CG8A 1T6BX 2Y38A 4CEWB 5A6YA 4XFAA 4DO0A 3BCWA 1WLCA 3MQ0A 1J3RA 4B7KA 2MPFA 4BQYA 3VYTB 5FO5A 3C3WA 2P0WA 4META 1HJFA 4A4AA 2GBYA 4Q0PA 3U10A 2C9AA 1E5SA 1ZVFA 4JX5A 4YW4A 2CMPA 2NVUB 5G05L 4M3CA 1GBGA 1OUXA 1OQDA 3K4KA 4BEHA 5ANQA 4XTPA 2AH2A 5FYVA 1DUXC 4A42A 3FZ3A 4OHVA 1QMJA 1W3XA 4EZHA 2EV0A 3DQVC 2UYAA 1RMU1 4QQOA 3ENRA 1K83J 2XRNA 4INDA 2XLGA 1AU7A 2ZGUA 5H9QA 1Y9MA 5DEQA 4PQQA 4BLJA 3VZOA 2M30A 5EIYB 2VCBA 2HBTA 1K5MA 2Z79A 5IYCJ 1VQ9I 5BXXA 3S7IA 5J6XA 1VQ6I 3ACLA 1MACA 5BNOB 4OHWA 3HGGA 1IDZA 1MD0A 4RYDA 2Z42A 2ZMEA 4IHTA 3FMQA 1T2KA 2DK5A 1ETXA 2OV7A 1BJZA 4IV3C 2CRGA 3PJQA 4YW1A 2VBDA 2EA7A 2JKBA 5E88A 4FPFA 2HWD2 1PK6C 2YHJA 3A0KA 3FXJA 3VDDA 1IN4A 2QBYA 3MFAA 1USTA 2BOIA 3LFUA 1MSEC 3I2JA 3EQEA 3WINE 4JDOA 4OUSA 1R093 1S0CA 3FISA 4IV1B 5A7SA 2WNUC 3PFYA 4MTEA 1JHHA 1V6IA 5KHKA 4II2A 2R061 1P4XA 2PQQA 4K1ZA 2OF7A 4MG2A 4QD2A 3NWTA 1T38A 4FPKA 5D5VB 2M87A 3VSLA 3O8HA 4OI4A 4JHZA 2E1MB 5FQ0B 4G6TB 2W1OA 2HOTA 2XBO3 1A5JA 2FDHA 4E9KA 2Y34A 3A4UA 1Y39A 2EBIA 1K6YA 1Y8RB 4BAYA 3VZLA 3WDUA 3C8XA 4U36A 3A01A 4XAEA 2EIKH 4L0ZB 5JLXA 3I4MJ 4PJLA 4IDZA 3G71I 2JENA 1POV1 4K1YA 1EAH1 1RUG3 4MQ9F 4GB32 2D3RA 1MVEA 5JVTA 1Z67A 2JK3A 1C8M1 3H3VK 2ZGLA 1RC6A 4BQXA 5A32A 5F5QA 1LESA 1IQAA 3A0HC 3DTKA 3FKJA 4HNUA 4NRMA 3I58A 1Q8QA 3L09A 2WN3A 5JZGA 1LHOA 3NRUA 5FYUA 2R073 2WFPA 1UX7A 2VZ1A 3J4UH 1CD3G 2FCTA 3N7LA 2Y2ZA 3AJZA 1UOJA 1FATA 1H2LA 3CTAA 4IVNA 4A12A 1HN0A 2MFZA 1KD7A 2I2SA 3HZJA 3C18A 3R4UA 2YC4A 4K9SA 4K6BA 1UB9A 1IKQA 4ZJZA 1F9NA 1J83A 1YLFA 2P3IA 1VBC2 4MFDA 3PNVA 2EJRA 2WBKA 4JRLA 4NMIA 2G1MA 3K4ZA 4XABA 2C0ZA 5J96B 1J0RA 2F5FA 2V1DA 4GMP0 3QPSA 4JX6A 5IOYA 2VOWA 2D3SA 3PUFA 2MC4A 5FZFA 5GTIC 2HWVA 3OYMA 1X1BA 4M71A 4P9IA 4M00A 1VQLI 3GTMJ 3VLBB 2BBVA 2RREA 2KIUA 2WR9A 4H4KC 2XBO1 3N4MA 1ZYRF 3WGHA 2YU3A 2BVBA 4Q4W1 4BE1A 2AGSA 4QGNA 3CQZJ 3EJKA 2I8DA 2M7AA 1BEV3 2F4LA 5DCMA 5JVGF 2BZTA 1TMF1 2COMA 5E3MA 1WHUA 4ZYHA 1IPSA 4XC9A 4XMAA 1IPKA 1V6KA 4XKBA 4YGEA 2XC7A 2DBBA 1RUH3 2X48A 5FMCA 4P55A 4UNOA 2OQ6A 1LKXA 1NQDA 1LEMA 1G3WA 1U5TB 2P6SA 4B1LA 4A3GJ 3FE5A 4L97A 1MZ5A 2G7UA 1OBNA 3NV4A 4K8FA 1QGPA 2DMUA 4JTNA 4XCBA 3CC4I 3I2DA 1ASJ2 4Z8BA 5FPZA 5DDGA 4GIQA 1J1TA 4RAFA 3U4SA 2XGDA 3F6VA 1RUE1 2QQBA 2ZC2A 3ZYHA 1K5MB 4A3XA 4CA9A 3ZMVA 4FHTA 1MVQA 2PI0A 4WM8C 3VBFA 3FXLA 4YG6A 1JN2P 3QCWA 4RB1A 1IG3A 3J7YJ 3CMGA 2XVCA 2RJKA 4B3AA 1COV3 1K5MC 4II3A 1XB9A 2HPMA 1JTYA 3VB2A 2HYFA 3TW7A 4IE4A 4DZPA 4BQOA 2VC9A 1MS3A 4ZDOA 4G7ZF 1ZBE2 4PJMA 1SFEA 4Y13A 5HOOA 3KP7A 4LLGF 1Z9CA 1BA5A 3VD9A 4PHZA 3R60A 4FBFA 3N35A 3S7EA 3KT7A 2PA7A 4GWMA 4XVHA 4LUKA 5GZFA 2WQ4A 2ERFA 3MLKA 1N77A 3ZX7A 2XL9A 5LZ6A 2BXYA 5A7WB 5FZ4A 4HETA 3FBYA 3J8F2 3TOBA 3SEQA 5A7QA 3KS7A 1RVF3 4RMNA 1ODMA 4DZGA 4P9WA 5KXCA 1TMF3 3CLPA 3JAMZ 4BB3A 1PM7A 2NOJB 3NJVA 3EDPA 3FMRA 3OWTA 3H1CA 3MPBA 1FY7A 4UVCA 3G7DA 4PJ0C 3SQOA 3AMHA 2TCTA 1UHSA 2UURA 1BI0A 2X85A 4M3BA 3P5BA 4BUPA 3I3EA 4MADA 2BHYA 5CVVA 3K6GA 1AL22 4PGHA 3TMOA 3EBRA 2R6QA 3GEZA 5FZ3A 2V1NA 5JR7B 4BE0A 3FUQA 1G6NA 2L54A 5CKMA 5SV5A 1D7PM 2AXTC 3THTA 1YFYA 3OGVA 1JHFA 5E89A 1VI0A 2G0EA 1FX7A 1UG0A 2VH9A 4EZ4A 3R6SA 4XZPA 3BU0A 4JX4A 2ZBKA 1P2FA 2X5IC 3MIGA 4NHKA 4HYEA 3DV8A 4X8NA 4M74A 4QXCA 2JDAA 5JCTA 3VDDB 1TC3C 1TWHJ 1SPPA 3MW3A 1PVXA 4NC7A 2DA6A 3I54A 2MYSA 4FPCA 4V2FA 4O9GA 3QH7A 3S2WA 1PVC2 3CU7A 1BK1A 1MR5A 3I64A 3CHXA 3GCMA 3HSEA 3T0AA 4P00B 4HDVA 2OPKA 3M70A 2E26A 3BG3A 4LO6B 4AI1A 3B7MA 2CV1A 4Q8LA 3OS1A 2R7SA 1DGWX 2LUWA 1VAVA 3MZYA 2E31A 3RDIA 3CESA 2HGCA 1HKDA 4Q0QA 2Z33A 1MBGA 1NOVA 1W8FA 3VBOC 1RMU2 4AHYA 1R5ID 2VASA 3ZSLA 1QJX3 1R64A 5FKMA 2Y75A 5IVYA 3DWLE 9ANTA 2JG8A 1QNYA 5CFCB 4P9LA 3ECQA 5AONA 2J1VA 2B45X 2O03A 3F23A 3JW4A 1JOJA 4XJ9A 1UYXA 4WM7A 4C91A 2JB8A 2KZVA 5J40A 4N43B 5E1RA 4D3WA 1N1SA 3J80Z 2K02A 4CE8A 4M6VA 3IUOA 2H1KA 5ICFA 1X50A 5JMOA 3DEWA 4Q0SA 4HLTA 3SDBA 4E7ZA 3P9CA 5C71A 2PJRA 4IKFA 1OA3A 2NNYA 2JZYA 3PUQA 1BKZA 5IVEA 2RG4A 3QOPA 2WTEA 2JDMA 5FP7A 1XTAA 4OMZA 4BXSV 2D2WA 2VT3A 2VNVA 1COV2 3WTTC 3AKTA 4Y5SA 1HXS2 2OAZA 2E6VA 1BCXA 3MWMA 1D4M2 3K4CA 4LBKA 1OCRH 4EE2A 3VODA 5F5CA 5FOJB 3MEPA 2R0HA 4AHZA 2KM2A 3HRMA 1W0TA 2YROA 4FTSA 4LA2A 4F92B 3LCPA 1W6NB 2R92J 2XG3A 1FX5A 5B3SH 2P3YA 4FP2A 4QPWA 2JDHA 4MH0E 4B44A 2V9VA 4Y1VA 1R4NB 1PYVA 2CUZA 3INAA 1RESA 3PJRA 3IC7A 1AYM3 3DBRB 4BXUA 1J9IA 1FZPB 2IZWA 4QMAA 5EFUA 1AYN3 3WHUA 3E97A 1YW7A 4RHV2 3TO6A 1B59A 2Z69A 4LO8A 2HI3A 5B5EC 4S2DA 1XU2A 3NAPA 1S0BA 3N3HA 4CEWC 5ICGA 1FBQA 2OQ7A 4LHKA 3VDDC 2DA1A 2NMNA 5KHDA 1VQKI 1VR3A 5ISLA 2AC1A 3KCCA 4CZCA 2LRPA 4ZY9A 3QU3A 2QQUA 4AIKA 3ZDVA 1K78B 1ZZ8A 2CSOA 2X4HA 1YRNA 4ZTJA 4C1XA 5HODA 5JMCA 4PSXA 1ALYA 4XBNA 3QACA 3U11A 1PMJX 1UOGA 3ZXGA 3VDBA 3VV1A 1WA4A 1QKQA 1UU4A 1HQCA 4N7UA 3F3XA 4RBOA 1U12A 2B9SA 1Q43A 4OMDA 4I01A 1OR7A 1O4ZA 1GWLA 2Y6GA 2YUEA 1X9TA 2IRFG 5LASA 2NZ9A 1FOXA 5FXZA 2ECCA 2LDUA 4IZZA 2PHWA 2QFEA 3OYWA 4CUBA 1VBB3 2CUFA 3OV8A 4OCTA 4D0PA 1XNDA 4NROA 3TEYA 3PNYA 2E53A 4LFUA 4XF1A 5FZDA 4EATA 4MNUA 1K5JA 2GNMA 1B6AA 1WA6X 1VB4A 3FLTA 3C7OA 3PLQA 2ZB9A 4QHZA 2DVAA 4N7IA 3RZLA 5IATA 2YFUA 1NHAA 1PZ9A 2DTZA 1UYPA 4X8PA 2P3KA 3FKIJ 2GWRA 3HYIA 1WBFA 4WVMB 2DVFA 4FFGA 3J26N 5D4SA 2PFBA 4GRIA 1WJ5A 5BYNA 3MIBA 1WJBA 5KXDA 3HOUJ 5DAXA 4UYBA 3E6MA 4YYOA 2L3DA 1ZLKA 3A01B 5CG9A 3RTRA 3NAUA 4BY1J 4IE0A 3WF4A 3ZFFA 4E7JA 2E1OA 3ETQA 4PUSA 3AG3H 3AP9A 3K4AA 5FZKA 1WQ2A 4GMP3 4AI0A 5HDKA 1UIJA 4GWIA 5TISC 3E1SA 2QLZA 2A68F 2FDJA 3LSHA 4M6XA 2VXDA 1Q8VA 2Y64A 1QU3A 2P5VA 3VUOA 3F8NA 1OYYA 2ZZJA 2QQWA 2W08A 2MHFA 1BI2A 1QDOA 5DS9A 4GKXA 4QX7A 5FPBA 2VN2A 2JG8C 1RHI2 1UZWA 3NW4A 2VE8A 3E0JB 4CCNA 3O5SA 3RZKA 2BRTA 4B8XA 3LWCA 2H8RA 1XGOA 4FFFA 4ISRA 2RDRA 2RS33 1VMFA 3OD4A 2GC1A 2VCCA 1NCRB 1XD7A 1N25A 4E8DA 5EZWA 3LSTA 3CZUA 3T0BA 3JBG1 4CZSA 3EQLF 4AI8A 1EPZA 2F4OB 4C3JJ 3VZMA 3FX3A 1VMHA 4I98B 3H3LA 4WCGA 1RUF3 4GB33 1EV13 5GLZA 4PBPA 3GTPJ 5FR3A 4FTHA 2XXZA 2ZFWA 2R063 5AIQA 2D40A 1GICA 1FAYA 3AZVA 1IW7F 1QWRA 4A3IJ 2B0LA 4RS5A 1JZ5A 3KZZA 2D5FA 2LNBA 3JD73 2W94A 4LBNA 2CWSA 5IK4A 5CNAA 2XQRA 1DQ0A 2YBPA 5IVCA 1R1UA 2ARCA 1W8TA 3OIOA 4EQVA 3MKWB 4B3XA 3FLPA 3LQCA 5IT9Z 4ZZ8A 2XR4A 1VBE3 3NNMA 3MN2A 1OURA 4JZRA 2Q1MA 5L3DA 2XJTA 1QNWA 4TXWA 5K0UA 3I97A 3RG0A 5HI0A 4WVZA 4HANA 4YG0A 1HV1A 1YWKA 1UAIA 4YIIA 1US2A 3GJBA 1QO0D 4CDUC 2GA2A 4RAYA 2W57A 3GFMA 2H6CA 2PTMA 1E5IA 3WE2A 1O5LA 3GFLA 3HQUA 3KGLA 2UU8A 5ED4A 2FSWA 1RGSA 1RNLA 2V4JC 3LZZA 2KP6A 3H50A 4NVPA 4Q4W2 3TP0A 1N47A 4R9DA 3GFJA 4IEUA 2IA2A 4X6RB 3G1LA 4JHTA 4LK1F 3ZSJA 1Y8QB 1Y7BA 2ZJ2A 5EZGA 4XXPA 5E1ZB 3ECHA 5F37A 4UI9L 3ZOBA 4YM1A 1KRIA 1V6OA 4E7HA 1NKGA 1B35B 4RGKA 2KR2A 4H14A 1UZCA 3BG9A 1IO2A 1O4XA 3G4SI 3J7ZI 3ZFGC 1GQGA 4KITB 1ENQA 1YI7A 5FZ0A 5FZ6A 2HWF2 4M3EA 3VGIA 1LHWA 3I56I 3F9KA 2DMTA 1R1VA 2GQQA 3COAC 4D6QA 3WR0A 5HLHA 2DLLA 2QSFX 2STTA 2JWTA 5A7WA 2R5ZB 1RUC3 3TN92 4JP0A 5JXIA 1QJFA 1YW8A 4Y20B 1PUFB 4KI5M 1LDKB 4WM8A 3VBFC 1EKEA 3T1LA 5GZEA 4PLNA 1V5FA 5CVRA 4CP1A 1NT0A 4LBQD 3JRDA 3IH3A 2JDYA 2BDRA 3D4KA 3WLUA 3VBUA 4RA2A 2PHUA 1ZGJA 1YQ8A 2LY1A 5HS9A 3OPZA 3FHZA 2R7VA 2VIXA 3LMMA 5ANNA 1ZRCA 2DWRA 5BNNA 1RMU3 2D7FA 1RPWA 3FWEA 3SC7X 3ORJA 3SCFA 2XWJB 2IT0A 3LSEA 2ZGTA 4YVWB 3AKZA 3HOXJ 5GPCA 4M01A 1OFSA 2PN5A 4IRIA 3B3QE 1R083 4ASMB 2DBIA 4RN5A 4V1PA 2E1NA 3GO5A 1AXKA 1BR4A 2ELKA 4ASLA 4FE7A 4BIOA 2D43A 1RUE3 1ZYBA 2XKPA 2WNUA 1PO11 1UHWA 3WTYC 5CFDC 2BNOA 2ZHKA 3WOGA 3ABZA 4TZDA 3MV01 3UKNA 1K4SA 5IVJA 5H2FC 2QYOA 1XN7A 2P7VB 4E7LA 2Z99A 2JKXA 2EFNA 1YQ6A 2PMWB 2EAAA 5DCFA 4DBRA 3JD72 2W9XA 1SD7A 1AR92 3AZZA 5KK1A 3O1PA 3KLSA 3I3BA 1W2AX 1BJQA 1JT6A 4OMYA 3OTFA 5BNPB 3VYSB 4ZC3A 2OUHA 3HUGB 5C70A 3S3MA 5HCFA 1DF0A 4BISA 1ZR4A 1DQ1A 1EH6A 4D0QA 1BW5A 2LROA 5I8TA 5LGNA 2J5OA 2GMPA 3NL1A 3FLRA 3VZKA 3ZQFA 4A7ZA 1QH7A 4PLMA 3ELNA 1NQJA 3EXUA 3M8JA 1MJ9A 3UR3C 5FZAA 2IXLA 2FMLA 1IXSB 2MG4A 4IGPA 5J98B 3DPRB 4A7YA 2ORZA 4CGZA 4AFMA 4DYCA 3ZXSA 2P5BA 5HV0A 3BPSA 3ERED 3DKXA 5GLTA 2WZEA 5FKKA 1R081 3WG3A 1W28A 4CDUA 3CCMI 4P96A 4M4PA 4N0BA 4BQQA 2DA7A 3OYBA 2RMU2 4N90A 1V6LA 3IKWA 2YFZA 1S7AA 1H2MA 4FPGA 1PK6B 2HDWA 1OF3A 4XFGA 4Q48A 2D6MA 1Y0UA 4CU7A 1ZR2A 1AUYA 1PNGA 3PL8A 1I3QJ 1VBB1 4P9XA 4EJUA 4GGGA 4IV3B 2PJPA 2VZTA 1V6JA 2P1BA 1IF1A 4WX9A 1NCQB 3CJIC 4P1WA 3N9LA 3F22A 1VQ5I 2NM1A 3JXSA 1ULYA 2XMLA 5KHGA 1YX5A 2R7TA 4GH4C 1S0EA 1W0NA 1YQAA 3OIQA 2QBYB 2CW8A 2XLFA 5HNFA 4W65A 1CR7A 3CP8A 3HB9A 3WP4A 5IJRA 2HXIA 2GIZA 1XSDA 1RINA 1JYWA 2X6WA 3CCSI 4KU8A 4YG2F 1EV12 3OSDA 4ZXEA 1YI2I 1V70A 4UBHA 4CYCB 1VP6A 5EG0B 2GXAA 5FYCA 4M3FA 5EWSA 3N9PA 5DDJ1 1EUTA 1FC3A 4AW7A 5LHGA 2J1UA 2VW1A 3UGHA 1KYZA 2ZMLA 5IT9K 2EQRA 3C2GA 3LEKA 4P9UA 3A0BC 1OI6A 4PK4A 4XQWA 2BJSA 1BEV2 5IY5H 2XJRA 4HXCA 1VQOI 4BQ5A 3U2RA 1E2XA 1ULFA 3DTEA 4XJWA 4ARXA 3T4VA 3FHAA 3GBGA 1TL8A 5F64A 5L19A 5FPXA 3B6AA 2K0GA 1GR3A 1R1A2 5DUKA 2HLEA 1P4WA 5E1WA 1TWAJ 3IBMA 1JUPA 3WG9A 1CWPA 3CCRI 3KM5A 2NXNB 5LK5A 4HX7A 2R1BA 1NY72 3HPHA 3W6VA 2Y26A 5K5RA 1DDLA 4LK6A 3I3QA 1PO22 4XLFA 2W1UA 4YFXF 4X6AJ 3MPPG 5GZGA 4DFSA 5EYRA 1EF4A 4IV1A 1PJRA 3SZTA 3N9QA 5D8AC 2UY9A 3WGIA 2R7QA 4D1QA 3NAPC 4CEWA 3RGBA 1IN5A 4CP0A 4WWCA 4P5YA 1QA6A 1UHMA 3LEGA 3BYWA 3EMRA 4K7JA 1HB1A 3JRBA 1Y43B 1SLTA 2R043 3JTHA 4GB31 4JAAA 2MLKA 1X3WB 2Z5UA 3ZN0A 3M3QA 1ZTRA 3E5XA 1SFYA 3SFIA 4B1MA 3KF3A 2VNRA 2WLPA 4ES8A 5FAXA 4BDVB 1AL0G 1H4GA 4OI1A 5CKNA 2IGOA 1D1CA 2WZR3 4N43A 4Y5Z0 5JFRA 3RRDA 2JDPA 4RHV3 2KXLA 3MFKA 2KRCA 1PVC3 1WJDA 4QTRA 2VBPA 4I09A 1W04A 3HEFA 2BY3A 4IRGA 2G7HA 1V6MA 2Q30A 1GNYA 1JODA 2K4JA 1RC9A 4WF2A 4Q4X3 4GDFA 2QKLB 1MZEA 2CNAA 3AC0A 3BT9A 2BHZA 3WDYA 2ZGPA 3GALA 2OZUA 3HOTA 3NMBA 5JVVA 2VI6A 3I59B 4DYQA 4P02B 5C4JJ 2UZKA 2LREA 2DCZA 3BKZA 4KH9A 1V4RA 3Q8EA 1QPMA 3T0YA 4Z92B 3D8CA 2BXZA 4XACA 5JOYA 3HRSA 1JZ3A 3ZMOA 1H9WA 3MYXA 4BYYA 5JI9A 3RCOA 3H8XA 5LATA 4UFJA 3KX2A 1ENRA 3CF6E 4G9YA 1ENHA 4Z82A 4OQ9A 3OYHA 3AL0B 1MZFA 5C3EJ 5H9RA 5FMDA 1WW4A 2F6BA 4OLLA 4PDKA 3AZXA 4MYEA 4C1WA 2FBHA 2DYRH 5F3IA 4UB6C 1S1AA 5B1AH 5FYHA 3PUBA 4HF0A 3HSRA 1B9NA 4QX2A 3SKJE 1ZA7A 4JOMA 2KIQA 2MC3A 5JAXA 2FNPA 1NY71 1VNDA 1B4AA 2V4AA 2TBVA 4LBQB 5A3PA 1JYTA 4GYIA 1LHNA 2P2KA 3K4MA 5J36A 3GJAA 3WP3A 5GLVA 5IAXA 1DDNA 3POJA 3ZQ7A 2QQAA 2G4IA 2PMHA 2DFBA 2H8WA 5JLVA 2FHRA 2J1RA 1W90A 4A3ZA 1NAEA 3W58A 1WFXA 2KRHA 4LJZF 5TSWA 4Y22A 2EIGA 4CO8A 3WG1A 3F6OA 1DQ6A 3ILRA 5HNHA 2CHHA 1H2KA 1OLRA 1F4AA 5DUVA 4UFMA 4IEVA 4LG3A 3LGRA 3L2HA 3HWJA 3ESWB 4KWJA 1I39A 2FCVA 4J01A 5FBJA 3PSIA 1VBD3 3LIHA 2Y9ZA 5F27A 1PO12 4NAMA 4ABZA 2LY9A 2XSDC 3WODF 3TWIA 2R7WA 1VPHA 3B00A 2KIFA 4E7SA 1SFNA 1PMIA 5APAA 2W5FA 2DTYA 2DODA 2KDOA 1HKQA 2D6LX 4HKLA 4CU8A 1WCUA 3M2MA 2JG9A 2JJ7A 2VQUA 4S2FA 1UU6A 2XPWA 4Q4Y1 3ZXJA 2XJSA 5LRSA 1PIV1 3KHCA 1W8NA 2AQEA 4Q0UA 1AR71 2F6CA 2ZO4A 3CEWA 1AR62 4FPEA 1WW7A 1BN5A 4Y7NJ 4P9JA 4RQPA 1V54H 5JPMB 2Q8DA 2BW3B 1FOD3 2ZFUA 5FRMA 4Y1UA 5FKOA 1MMAA 1YFUA 1PO21 3VHNA 5FKLA 1W39A 3O14A 4ZZLA 3WP6A 1XSQA 1ETOA 3MIEA 3SDGA 3JBG3 1PIV3 2HQNA 5D2AA 5BNNC 1LGBA 1PGSA 1SQ4A 4K3UA 4S2GA 4LO4B 2B63J 1ULEA 1IRFA 1B72B 3EYPA 2VAUA 4UF0B 5CKTA 1AX0A 2QTWB 3BR2A 3GYDA 1GT0C 5FD5A 2ZGSA 2R5ZA 2P37A 3A0NA 3GZ5A 1DQ4A 3I71A 2QZ8A 2GM4A 1W1WE 1WBLA 2WNEA 1FMD2 1HF0A 4EQQA 5IW0A 3RJ2X 3H92A 4N4OB 4PFOA 2NN8A 2XVLA 4MX3A 1XMKA 1UY2A 2DPDA 4IQJA 3A23A 4JGZA 5FMOS 5LBCA 3GDBA 5A2QK 1XG1A 1XMXA 2OX0A 3BI3A 1LGCA 4E2GA 1VQ4I 1S55A 3POWA 2DURA 4M6YA 5LK7B 3T1MA 1JGGA 2YDEA 1W6QA 4QQ2A 1RETA 2BUKA 1AR73 3RZDJ 4Y22B 4PJNA 2LSOA 2JDUA 4Q4V3 3Q8BA 1ND3C 2BEOA 1UD1A 1R00A 2DTWA 3LAPA 1D8JA 2K9MA 4BIFA 1QXRA 4YFZA 2DV9A 1ZBA3 3GCWA 2QSHX 2OBPA 2MA3A 1BBYA 5IHRA 3AYAA 5A3WA 2X1CA 4HMZA 1YI9A 3E7LA 3T2OA 2GNTA 4E2SA 2WAQA 3ZCOA 3OSFA 4JCKA 1HDDC 2OA2A 5E17F 1Z0XA 4IJAA 3Q9SA 3TL4X 2JUCA 2AENA 2EFOA 3KYLA 3DF8A 2CH0A 2QQLA 5A7PA 2W46A 1RUF2 3LDBA 5FYZA 4K20A 1ND2C 1GWMA 4OFGA 4DS0A 3WW1A 1BBT1 2F48A 4EN7B 1F5FA 5M0TA 1OPOA 3PFIA 2A73B 5C4WB 4C3IJ 2VO5A 3UGGA 3ASIA 2FDFA 1S7OA 3BVCA 2XONA 4JRAA 1TP4A 2WWSA 4CVUA 1YLLA 3AFKA 2DUQA 2ZHLA 2JWPA 1EAH3 3DYPA 4R9CA 1JT0A 2JUGA 3SQNA 1D5YA 4KWLA 1TQPA 4HONA 1TZOA 4XIOA 5B4XA 4QPYA 3CO6C 1UQXA 2ARBA 3TN91 2VMEA 1W8OA 1C8M3 3OBRA 4EM2A 4D7TA 5C3QA 1P9QC 3CJIA 3VDAA 4XN3A 2ZBJA 5F6KA 1BZWA 3HOWJ 2QVOA 4G7OF 3BY6A 3I2IA 3CIHA 2LF8A 4CDWB 2WWUA 2EF6A 3SH5A 1NA1A 5C5TA 2J1SA 1R1A3 1OD5A 1DQUA 4ES9A 2JXAA 4XQFA 3RZZA 5C9AA 2NVTJ 4GZ9A 1SACA 4L8QA 4IEWA 4QKFA 3SMHA 4TSVA 5AVAA 4ZYAA 4N9HA 2DPUA 1MEC3 2Y31A 3NQHA 1RITA 4L9NA 2HEVF 1K42A 5C33A 1VRBA 3P9IA 1TBXA 4XXAA 1OPCA 2Y9YA 3P9KA 3S2DJ 2QKMB 4XFIA 4IE5A 3BTIA 1J3QA 4DW6A 2VMIA 2R7OA 3MFCA 1TNRA 1N75A 2M9HA 4XF3A 2XOMA 4RQPC 2E7AA 4XLNF 3LE0A 2K3FA 2BOJA 3JRIA 1PVEA 1RUOA 2N8GA 5CQEA 2A3XA 3AG1H 5JXGA 4NPMA 2RKHA 1XSRA 5JOZA 4MGRA 1H9PA 1W36C 1Q1VA 2EINH 3U9GA 2WT2A 2DQLA 4NB5A 2ZX2A 4K21A 1DGWA 3S0MA 2CL2A 3M8LA 4PJYA 2VMHA 4AIDA 2XL7A 2GAUA 2VZOA 3D5RC 3GLLA 1F2NA 3P1IA 1PHMA 5FCCA 2OCEA 4HPKA 2X09A 1J7KA 1ETVA 1XDSA 2BV6A 5FLJA 5FYIA 4G94A 2P4WA 1GNZA 4QKDA 3PO3J 1NLQA 2YB7A 2W39A 1C28A 5CBLA 2DJNA 2EIBA 1I9RA 4DY3A 4LHSA 1U78A 4KDPA 1MJAA 4FSJA 5DCMB 2YZ4A 3BROA 4N43C 4CDWA 2PHDA 4XPVA 3HKZA 4M3GA 2HWB1 3CMEI 3R4DB 3WGGA 2WAAA 2DJIA 3ML6A 1W2OA 4Q4V2 4JX0A 1YJ9I 5DV5A 4Q27A 1TWFJ 3WF1A 4IGOA 2ZGKA 4F7ZA 4JC1A 5F5AA 2W1QA 5FDBA 1RUH2 1SLCA 5D6FA 1DLLA 2FJ1A 4RGAA 2EAKA 2BGOA 3NJXA 1ZK8A 1JJ8C 3AB0A 1F9KA 3PTRB 3OBAA 3OYKA 1WLTA 1WMXA 4RLFA 1HXS3 1EP0A 2R93J 1VAMA 1DBNA 4MGIE 1REEA 3M4FA 1Y9QA 3VEPA 1DPRA 3BPXA 4F3JA 1ZZ7A 2BV4A 3CCEI 5LY1A 4IEQA 3L9FA 2M3AA 4OWRB 1IV6A 2CDPA 1J1LA 4FQGA 1MH3A 3J7HA 1VLNA 4IV1C 5LBQA 1QHHD 1AYN2 1PP7U 4AQ6A 1BQPA 1OXCA 3L2WA 2R7ZJ 2AQFA 3EUAA 4OAZA 3VHPA 1H8TA 3S1MJ 1KGSA 3RKQA 1ZM1A 2BNMA 2F4PA 3DUIA 3U0ZA 1CAUA 3MVPA 1SBFA 2FQ4A 5C4XJ 4TN7A 1JS9A 4IE7A 3VYUB 2E9QA 4XIDA 4COUA 1XU1A 1R082 2IP2A 2NVQJ 4EN6B 2JPCA 5JPNB 1YQCA 2BYVE 1SLIA 3NSTA 4XOPA 4FPYA 1V5GA 5L3BA 1Z6RA 2D44A 2K40A 4AE2A 1V3FA 1ND2B 3NNFA 4KWUA 1YQ5A 3FXMA 3RVHA 4CRQA 3GTJJ 3BIEA 4H7MA 4XZUG 2VZRA 3O12A 2D5HA 4EJTA 3NJZA 1RUJ3 1BW6A 3SKVA 4A6SA 3SITA 3WV6A 3BR1A 4AVSA 3VZJA 1FNZA 1WCKA 1TT5B 2KISA 4G6QA 4X0GA 2Y30A 2X6YA 1EH8A 4LA3A 4AWDA 1O5UA 1X2NA 2ISZA 4D7YA 1VBD2 2CYFA 2CGOA 3UKGA 3LDKA 2HQAA 3DLLF 4X1EA 1D1BA 3B01A 5HS8A 5J48A 1S0IA 3G1MA 2L7MP 2ZOEB 2K86A 2NQYA 4F55A 1PVC1 1YFWA 2P8TA 3CZ6A 3U4XA 4YW2A 4UF0A 3BJ6A 3BB6A 5T5LA 4KJZA 5FWEA 5FYBA 2OC6A 2V09A 1DGWY 3DPRC 3KV5A 1X4PA 2ZABA 2ICWG 5BY5A 3F21A 4LKSA 4AEJA 4NAOA 4H2AA 2VZUA 3W5MA 1NG0A 4RL7A 1CZSA 5LRRA 1PUFA 4ZU5A 1R1TA 3ON7A 1JYIA 4ENKA 3POIA 5DN2A 3K70D 2K9ZA 1X3UA 4IO9F 5IK5A 1W8WA 4XBLA 2J42A 3WZ1A 3A03A 3OGRA 2GZWA 3NQOA 1AR93 1PX3A 5B66C 2KZGA 2XGXA 1H0MA 1UYZA 2E7QA 2WNUB 1KGYA 2PN6A 3KEYA 3BZCA 2BY2A 4NJ4A 2RDNA 3ZFFB 1WGPA 3REOA 2E1MC 5D21A 5F6FA 2GNBA 3HNBM 5K9YA 2GMEA 3DXUA 2O8OA 2DT7B 3JQXA 4XNFA 1I5PA 2Q0AA 3S6PA 1F1ZA 2UWCA 4DRRA 1S6LA 4ZS2A 3BC8A 4BOWA 1NXD1 4WZCA 3CDIA 2MNGA 4GAZA 4CCOA 2HWD1 2V79A 4LMFA 4KNYA 2CS3A 1G7YA 5I0TA 1RUC2 3LSDA 5ABJC 4ATFA 3WG7H 2F17A 3W20A 2HOAA 2Z2SB 1V6NA 4ENMA 1OCTC 4BBSJ 4BQNA 4U2AA 3K75B 2RR11 4QQHA 2WA4A 4CP9B 2LKSA 2PHFA 2YGLA 3VBRB 1LPQA 4AF9A 2JG9C 2A6TA 3TO9A 1ND3A 1OOPA 2Y33A 5T54A 4I7HA 2V5YA 5CFCC 4XLPF 3ZIXA 5BS6A 4MZUA 3BJOA 4ASKA 4N4NB 1MQTA 3DKWA 1URXA 1FMD1 1YO8A 3AFGA 2XHNA 4DY5A 3QH6A 1G3SA 4F91B 1AOYA 4MEYF 1VBA2 4FPHA 3O1MA 3CP2A 1Y1VJ 2VUDA 5L3GA 2F5CA 1LVKA 3A2KA 1ZBA1 2YV8A 3IRRA 2DMNA 3ZFFC 2L0KA 4FO9A 4OUMA 1QZYA 3H0OA 5J1RA 4YIRX 3CMAI 3PJYA 4GJYA 4LKFA 4TLGA 1C3HA 3R0JA 4XFHA 3UK9A 3SEPA 4D94A 1B72A 1BLZA 1HB3A 2ZGNA 3W2VA 1VBC3 4QX8A 5KC6A 3FXQA 1I3HA 3J81Z 4DINB 2RR12 5IVFA 2NAZA 1ZZCA 1OQEA 2I10A 1EH7A 1GDTA 1RXGA 2WN2A 1LEDA 2BVMA 3NKTA 2VMDA 1C4RA 4HQMA 1Q8SA 4LE4A 1RL3A 1H30A 1GUIA 2MH2A 4G6DA 3QPTA 3SCHA 3JCIA 4QHOA 3JSPA 4XORA 4B29A 3RKYA 1I6HJ 3ILNA 1UMIA 3OBZA 1YFHA 2HVSA 2FQ3A 3ZYIB 4D5FA 2OJED 1REFA 4UW3A 3PO2J 4ON0A 2RNGA 4HVRA 2I5UA 2XGCA 2IS6A 1IS5A 1J59A 2EZHA 2ADUA 4D5CA 2W68A 3G73A 1U5YA 3ZN6A 1UKGA 4BEHB 2DU0A 4RGRA 2X6OA 3LEMA 2GH2A 4Z2YA 5EV7A 1SFKA 4KU7A 5FY1A 1UYYA 2J1EA 5FD6A 2RMU1 4ONUA 4UVAA 4A5NA 1CVNA 2NLRA 4RFT0 2FQPA 3B9CA 5H9SA 4LJHA 1YJNI 2NNNA 2KFDA 4M73A 3CQOA 1LCLA 3V0BA 1FOYA 4IXAA 2LR8A 2R30A 4N9IA 1VBC1 4FX0A 3M3IA 1M06G 5EXOA 1WKMA 3M3CA 3T08A 1F15A 1W9FA 4IHWA 1ZZ6A 1A78A 1LFBA 1J2XA 3DEUA 3HOVJ 5FPAA 4Q29A 3FMSA 2PQ8A 4Q1PA 4B4CA 4KL1A 1X58A 3FXOA 3OY8A 3ZMZA 3H3UA 3M1HA 4OYUA 2OXBA 4OZOA 4XDOA 5FO8B 4CCLA 4CDQA 2ZKNA 1TNSA 1ZN2A 2RJ2A 1RUD3 3RSNA 3PIPF 1SFUA 4M3CB 1Z7LA 4QX5A 3HOSA 2V9KA 5EJ1B 2CQXA 4HBNA 2B7EA 4PSWA 4L11A 3DXTA 1Z7S1 4V2WA 2RN7A 1Z3XA 4IHSA 4NHYA 4JQFA 2JE7A 2FOWA 3AVSA 3IPVA 2XV4S 3KVBA 5JIUA 3POEA 3LFKA 4A6DA 3ONQA 1E3OC 1JUMA 2WZ8A 4BXXJ 3HRTA 1R71A 4IEPA 3OD0A 2QQMA 4EMSA 1OA2A 2C9KA 3VBSC 3UNPA 4YELA 4E27A 1WJEA 2VKDA 1RKWA 3DYOA 2R7FA 2DCYA 3ACIA 1ZRRA 3HXLA 4DXSA 2BY0A 4A6OA 3NJYA 1JYXA 4AXOA 1FOD2 1MH4A 1USSA 3TDUC 3ATGA 3ZFGA 3RSJA 4LLOA 4ITCA 5C9AC 4I3GA 1WMFA 3WW4A 4P14A 2HKOA 1OMIA 3DXJF 1R9TJ 1SBEA 1W2UA 2CYYA 5FLMJ 2WUHA 1AKHA 2R3SA 4O3MA 4PF1A 2RM23 4PBOA 5L73A 5CVIA 4TTGA 4UFKA 1KU3A 5FZOB 4CZZA 4FCYA 4KBZA 4KIBA 2IFWA 2GNDA 1OH3A 3RQ0A 4Q4X1 5D5XB 4GFBA 2DFEA 1XCVA 1H9TA 4ZDPA 1W5SA 1TTYA 3QQAA 2QCOA 3H9AA 3BR5A 4UAPA 3F2ZA 1AXZA 4XKWA 1VRH2 1D0GA 3OSGA 5T3NA 1XNBA 5L7OA 1YTYA 1XE8A 2DA2A 4A44A 1QRYA 1FT9A 2MEV2 2VW0A 2LKPA 1JH5A 5JLWA 1RXFA 3S3OA 3NNLA 2WZR1 3WF2A 2WWJA 1W6PA 4RHV1 2HOEA 4KWKA 1H88C 3MZ8A 3H8UA 5IUQA 3IB3A 2OW4A 1VRH1 2G9GA 1LECA 1CGPA 2N7GA 3UV9A 5FWJA 4F83A 3KE2A 3VBHA 5AC93 3BG6A 3LAGA 1NX9A 3AK0A 1BMV1 1LB2A 3KYDB 3VPRA 3RIRA 2IEKA 3VWBA 4MGZE 2DCJA 3J7MA 4COZA 4EV0A 1ODDA 2VM9A 2STWA 1LOAA 3WCRA 3VOEA 1E0EA 4XSXF 3Q3SA 4CDWC 5FJ8J 4LLLA 4B1RA 3K46A 3EPZA 3KYCB 3KMHA 1FI2A 5L3FA 3HVDA 2A6EF 4PCQA 2W48A 1AYM2 4ZU4A 3ZYPA 3D1NI 4LG0A 3KHBA 1G86A 2KJBA 3L2CA 2GIVA 1NXMA 2QQIA 3GZ6A 4XILA 3ZXDA 1XC5A 2WINB 2ZHNA 3H7YA 2RQQA 4BCUA 5J47A 1N3OA 5A33A 5D1IA 1RUJ1 1UELB 2VUAA 5E1XA 4BY7J 5DAVA 4XUNA 5JUVA 1HXDA 1OF4A 4XSZF 4HL0A 4CDXB 4Z1VA 2JA2A 5HLGA 1BC7C 6PAXA 2CW0F 1WMEA 2W1SA 4XE9A 1MMSA 2O9LA 1SEUA 1NG7A 1N1TA 2C5DA 4GXLA 3ZYGA 3V7CA 3O6BB 3A4CA 4OULA 2V4VA 2DDAA 3PVNA 2NRAC 3OOPA 2L4AA 5CFDB 4J1XA 1NYWA 1QJEA 1H89C 4XICA 2VPRA 5FPVA 3CD6I 4Y4RA 2UWMA 2Z9OA 3M7AA 2VVDA 4LOSA 1GZ9A 3IHUA 4BL0B 1S9HA 1W99A 1GWKA 1V00A 3CUOA 2DCKA 3FXUA 3E5UA 3GCXA 4RGXA 4YARA 5BNOC 3OMYA 4ITVA 3MW4A 2ZAAA 2PAEA 2CFXA 4IW3A 3WCSA 4I0AA 3ZXAC 4IERA 1KYWA 2UXXA 4L18B 2B9VA 2JQ7A 4ZYDA 1OHFA 1QVUA 5DUUA 5FLVA 3H8OA 3ASNH 3I3LA 3MW2A 5FRAA 3C7JA 5T5JA 3MO4A 2JSPA 4XTMA 3F8CA 2DYSH 3E5QA 3LL7A 2GOXB 4L9BA 1FYMA 3O1UA 1UZ0A 3CJTB 3GFIA 1I50J 3Q5FA 2K27A 4E6KG 2KDZA 3K70C 1NA1C 5FY7A 1U2WA 4HVOA 3VDXA 5KHIA 3WTZA 2DUPA 5JR3A 3ZFEC 1HQWA 1OSGA 4GO1A 3HN1A 4SBVA 1YUDA 3HN3A 4UW6A 4HPKB 1RJ8A 2HTJA 1CQ9A 1CAXB 2JEMA 1TE1B 2DI3A 3V65A 2BP6A 3RKWA 1HQLA 4GXOA 3E6BA 1BL0A 3GM8A 5E6HA 3OYDA 1SLAA 4PIXA 1AYN1 4YZ3A 3OB8A 1KDMA 3SH3A 4PI0A 2MW8A 4UT5A 4YM3A 1MNEA 1YFXA 1CJPA 5ILSA 1JE8A 2GC2A 3KZYA 2E35A 3P5JA 3CF2A 1T95A 2R7EB 3RZJA 1FPN1 5F1RA 1QBJA 4P9FA 4XJAA 5F08A 2Y6KA 2PYTA 2VUMJ 1SFXA 1GQPA 2HEYF 3RI8A 2RS31 4IL6C 2LYCA 2VOXA 1ZGAA 3T3YA 5D8AA 3WQ0A 1R58A 2WSVA 2BGPA 1E3HA 1MS1A 4JGZB 5FZEA 4KT5C 4EWAA 1ONAA 2WO2A 4AM3A 5FJHA 1X19A 4G12A 5F9TA 3WXPA 5KHJA 1FYKA 1LNSA 3S57A 1JOPA 2RS53 3J8F1 3WT3A 3G6EI 5DM6F 2VMGA 2RDPA 5J3UA 1IN7A 3I2HA 3MHZA 4B43A 1DGRN 3WY6A 2VL8A 2NPIA 4YZ5A 3AYEA 1VBA1 3UYJA 2VQHA 2NS0A 4MGQA 4DQ2A 2WV1A 2PHRA 1HSTA 4FISA 3FC0A 1QHDA 2RM22 3B94A 4C3HJ 1YO5C 4WVMA 4BBRJ 2EALA 5LB6A 4S2HA 1HDPA 4XMYA 5IWFA 3K77A 3Q0WA 3DN7A 1H4HA 1MNDA 2GSYA 1W5CC 2WAQN 4RQPB 1OKRA 2ELJA 1GKBA 5CYYA 3PIJA 3QD6A 2FA5A 4KG0A 4URAA 2Q8KA 2RV9A 2A6VA 3DKQA 1UN1A 5KHHA 5A3NA 2R071 4H55A 3MMYB 1K61A 2XF5A 1NH3A 2EIDA 1TW3A 4HSRA 2YPRA 3TW6A 1AXYA 1O4TA 4MGYE 4CCDA 2VXRA 5F39A 4NIDA 2KJCA 1ZZ9A 3X2QH 4BPZA 2HDDA 3AG4H 3CBNA 1HRI2 1MGTA 2EZLA 5F0HA 3WG2A 4JGYA 3BG7A 1Q8PA 3J80K 3JRAA 4Q4Y2 4U7DA 1IG7A 4Q4W3 1D1AA 3JB4C 4XFCA 3IKVA 4U7BA 4HX8A 1XDUA 2WJSA 3UNGC 4CDQC 3HQRA 5E8GA 3PTYA 3L2VA 2ZKZA 4ZONA 1R4MB 3I2OA 5IT3A 3K4DA 2PHTA 3GHNA 1LUJB 1W6QB 2YMZA 2E5NA 4MO3M 2WQ8A 1Z1DA 3PQKA 1ACIA 2WS93 4XUQA 3HC7A 2K9QA 4M4RA 1FIPA 2JA8J 3IN9A 5FV3A 3TAYA 1D4VB 5CFDA 1JW6A 4A3MJ 4GYGA 2HVQA 1FMVA 2P81A 4UUSA 3MDPA 5IYDJ 3CZJA 2KRFA 3BODA 2VTXJ 1ZA4A 4IF4A 2RMU3 4P9YA 4KGGA 3H3ZA 3S8PA 1HRV3 2PLV1 5DZFA 1OLME 2CU5A 4ZDLA 5A1LA 4BMEA 4L92A 4LT5A 3I49A 4NIAA 3VKOA 3ZN4A 5D8LB 2VT2A 4YM0A 4AG4A 4XMIA 3SHRA 3LA3A 4JK1X 1WCMJ 4R4XA 4U88A 3PSFA 2RGVA 2VULA 1Y0NA 2VOKA 3ABLH 1S2EA 2C1FA 1SVOA 1NE4A 4RLQA 1IXCA 5E18F 2WAOA 1K78A 2W52A 4YSFA 1RUG1 1PUEE 4QPQA 3PUIA 1IS3A 5E20A 3CDZB 4OUEA 2ZX1A 5JWPA 1GVDA 4ENNA 2W2IA 1OLQA 1CONA 2X9DA 2A5YB 4QAWA 2FBEA 4D69A 1ON2A 1WUVA 2QQOA 5FY0A 2R5YB 3GTGJ 1YIOA 2P5KA 1IKPA 5KXBA 5L7OC 1H8AC 1UX6A 3BIWE 2IXJA 2IS4A 1JU4A 2LLKA 2WFF3 1XE7A 4XUTA 4ZTFA 5F3EA 1BI3A 1DLCA 1GYKA 3RWKX 2CUJA 3GZEA 1T33A 4V2GA 3OUHA 3LNQA 4OQ8A 2CJJA 5LHIA 4IX7A 2QWWA 1IHMA 1TLHB 4G4FA 2A3WA 3ZR5A 2AREA 5BNPC 4O5VA 2UV1A 4A93J 1YYNA 1A3KA 1JKQC 2YPJA 4FI9A 1UG2A 5GKAC 4LHNA 1LEBA 1SPPB 2XGEA 5J1XA 3UESA 1UY0A 2FF4A 4Y20A 1S0GA 4YNIA 3AAFA 3MGUA 2LC2A 4D9JA 3CC2I 2V73A 3WE3A 3S15J 4AEDA 1AA7A 1V9U1 3TEDA 3ERMA 2JDZA 4JQTA