2HKXA

Structure of cooa mutant (n127l/s128l) from carboxydothermus hydrogenoformans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKLLLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based hypothesis on the activation of the CO-sensing transcription factor CooA.
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Transcription regulator
molecule keywords Carbon monoxide oxidation system transcription regulator Coo
total genus 62
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hkxA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hkxA01
3F6VA 1Z6RA 3V8LA 1LNWA 4OLLA 3GUDA 3ECHA 3I54A 2ZMEA 2LF8A 1YLLA 2ATFA 2B5HA 3ECOA 1JXSA 3I53A 4K8FA 1R22A 1XGOA 3MAJA 1WGPA 3FMSA 3F8CA 4YFNF 3KLOA 1O3TA 1ONVA 1JE8A 2CQKA 4Q5SF 1GQGA 2MH9A 2PLYA 4GCVA 2DPDA 4HLXA 3WTVC 3RIRA 4I3PA 1LVAA 3KGLA 4OMZA 2Y48A 4PGGA 4LD5A 1J0RA 4XSXF 2EWNA 4XFIA 1Z91A 4DQ2A 2DU9A 4GYIA 1U12A 5E1RA 1ZRRA 4FAGA 5EZWA 5LEJA 4LUKA 4Z07A 4U7DA 3ZN0A 3T0YA 4G8XA 4J1XA 1S7OA 3TQNA 3P9KA 2IXKA 3JSOA 5KHKA 3M70A 1MJ9A 1O3SA 3WGGA 4YRDA 3KP2A 3BCWA 4AIHA 4WBBA 3FF5A 1NXMA 2ET7A 1EP0A 1FP1D 5DD4A 3J80Z 3OF1A 4ZU7A 1RUOA 2NNNA 3DKWA 2IXIA 1UCRA 2QDRA 3ZPLA 2UYBA 5HS9A 1CAVA 3HOSA 2P5VA 4EM1A 2BGCA 1Z6TA 1CAVB 3MEXA 2XGXA 4I02A 4XF3A 1FZPB 1Q1HA 4OMYA 1DGWA 4A0XA 4QLCU 2B0LA 5EEHA 1FBSA 5BY5A 1L3JA 2ZJ2A 5D4SA 4CXFA 5D8KB 3WU0A 2JPCA 5IT9K 2QJVA 4MEXF 1HKQA 1HW5A 3H3ZA 3L00A 4ZYGA 3I59B 2CO5A 1WA4A 2Q0OA 3HIFA 1NHAA 4HX7A 2IC1A 2BBYA 3GO5A 1T38A 2HKOA 2CAUA 5JHUA 3E5XA 1ON1A 3P9CA 1TQMA 3KFWX 2XVCA 2VC1A 3L9FA 4UXAA 3SXYA 4JBAA 1ON2A 3E6DA 1YQAA 2IA2A 3CO7C 4Q29A 4A6DA 1QO0D 3TO7A 4IHSA 3DPTA 3SFZA 1EH7A 4JTOA 3MQ0A 2ELHA 4CO8A 1XGMA 2QQAA 4LA3A 2QM3A 3BU7A 3WW4A 3HSEA 3F6OA 4F7ZA 2VE9A 3QU6A 3RDIA 4XLNF 2L3DA 2Y75A 4KUMA 1MKMA 4AD9A 1W5TA 1ZARA 4FHTA 4EWEA 4XSZF 1WKMA 3HTUA 3HUGA 1W7PA 4A0YA 1ODDA 3KP5A 2P8TA 3DXJF 1YW7A 1U8RA 2BNOA 5AVPA 2O6GE 3QP5A 1FBQA 1CAXB 4LGWA 2OQRA 4EM2A 5JR7B 5ICGA 3LA2A 5CU1A 1XE7A 1GHCA 1J58A 2OZUA 3V4GA 3T5XA 3NRVA 3HHHA 3CUQC 4ENJA 4TV7A 3EO6A 4QM8A 1V4RA 2NAZA 4FT8A 4QWQA 5J8FA 2G7UA 2DO7A 2QWWA 1IUYA 3IL2A 4G7ZF 2HTJA 2K4JA 2UXXA 5ICCA 4HBNA 4MGIE 1FYKA 2QVOA 4KDPA 5BOXA 3GYDA 5C6CA 3ZMDA 3GXOA 5K8SA 3VHRA 1MDMA 1BI2A 3V7CA 4IEVA 2WWYA 4UNOA 1J59A 3Q5FA 2PAEA 2IW5A 3SZTA 5LHIA 1YWKA 5FFXA 3DP7A 4LK0F 4UVCA 4HW0A 3PQJA 3W6KB 4PDKA 2V1XA 5AIQA 5F1RA 4LG0A 3WE2A 4OOIA 3H7JA 3CUQA 1J3PA 5HDNA 4MX3A 2KKOA 4HA8A 4PIZA 4YSFA 1CAUB 2FNAA 2XLGA 1EH6A 3QOPA 2IA0A 4RGSA 1T98A 1K6OA 3F21A 3JTHA 3OTFA 1BBYA 2RNJA 5CADA 3VFZA 1I27A 4RB0A 2PMUA 5CVRA 2STTA 4NB5A 4F8AA 1USSA 2HR3A 3FX3A 4G9YA 3J80K 4UV9A 1IN8A 3ZMTA 2MNGA 3ZMSA 5K5OA 4QM9A 1MGTA 1T0FA 3M8EA 2A6HF 2FBKA 1LB2A 2P5KA 2FMLA 2GC1A 4BH9A 4XF9A 3J81K 1ZG3A 2GZWA 1E17A 4KMUX 3CUQB 4LB6B 2F5EA 2YSRA 4M9ZA 5JVTA 1SFUA 3DF8A 3SCFA 1FI2A 4IVNA 2RN7A 3F8NA 5D5XB 2FXAA 2Q4SA 4AIJA 4ESFA 3WTUC 1QWRA 2D40A 1IXCA 2WTEA 5K5RA 2RGVA 2FSWA 2ZMEB 1LR5A 3I59A 4HLTA 3USSA 4YYOA 3ABUA 1VJ2A 2OBPA 2QENA 4MQVA 1SD6A 3HT1A 3PLQA 2XRNA 5DCMA 3REOA 1IZ1A 2GQQA 1VTNC 1T2KA 1F1ZA 4HVQA 1TQPA 1REPC 2MH2A 5A2QZ 4IRIA 1PMIA 2ACJA 5FQ0A 3SMHA 2DAOA 2QBYA 1YUDA 3ST7A 1DP7P 5D4RA 5H20A 3FMQA 2VECA 2IPQX 1B1BA 4P96A 2XROA 3K69A 1YFHA 3QAHA 4ZZLA 3HTSB 3KETA 1D8JA 2XLAA 3EBRA 2K27A 4A6EA 5ED4A 2JPBA 2EFPA 2GC2A 2H94A 4XF0A 4L9JA 4WXDA 2Q1ZB 4Q0QA 5C8WA 5FCCA 4D0PA 3T8RA 2ISYA 1QNTA 4O3MA 3WW1A 5K1YA 1R1TA 3LQQA 1QBJA 5DUKA 1IRGA 2KJBA 3MFKA 3EQLF 2A68F 1XCVA 4HX4A 1DZRA 4U0WA 3RPUA 2HQNA 1AOYA 4HF0A 1IF1A 2PAMA 2RKHA 3WTSC 1MJAA 4R1HA 1IW7F 2XKOA 2BEOA 4OIRF 5CYVA 3I5UA 3TNPB 2NS0A 3ZMVA 1IN4A 2RC4A 2P6TA 2ESNA 1G3TA 4HF1A 4MH0E 1RI7A 3FWEA 2B8MA 1P4AA 4M74A 4XLPF 5D5WB 2HWVA 4D7SA 3H1MA 5F64A 3JAMZ 2HTSA 3M7GA 3RYKA 2WV0A 4AVCA 3KP7A 5E1WA 4DNCA 5D5VB 2CWEA 3Q9SA 4KWLA 1UB9A 4UVBA 4LLLA 3T1BA 1DUXC 3D0JA 3KEOA 1X3UA 2MBFA 2HKXA 1U5TB 4MGZE 4N0BA 1HKTA 4YARA 4PIYA 3PQKA 2M45A 1TQIA 1H1IA 2ZFWA 1V3FA 3ES4A 3VB2A 1LJ9A 3H3UA 2PFWA 1RL3A 5BV6A 2DQLA 1PUEE 4CHUA 5LGUA 4MZUA 2RQPA 4U88A 1ZZ9A 3U10A 3ES1A 3CTAA 1O57A 4WK8F 1YW9A 2PYTA 4O5VA 3O3KA 2ZKZA 4KMFA 2M87A 1RZ4A 1IAWA 4LK1F 2IXJA 1SQ4A 3H1YA 2MLKA 3ABTA 4KFCA 5ILVA 2ESHA 4P9UA 5BPDA 4M9SA 2O1QA 3HRSA 4RAZA 4FX0A 1HW2A 4P9GA 3JW4A 3FXQA 2HZTA 1FYLA 5KVRA 5CVIA 1PDNC 3B02A 2K7LA 2FE3A 3SHRA 4LULA 4G6DA 3IWZA 2Q2EA 1ULYA 4Z82A 1FXZA 4LFUA 1P2FA 2V1DA 3F23A 4ORFA 3D0SA 4HYEA 4IETA 4ENMA 3H9AA 1QXRA 1BIAA 4UBGA 4BNCA 3LOIA 5D6EA 3DL3A 2O61A 1MD0A 2C6YA 2ISZA 5I0RA 2G7HA 3H1WA 4EJTA 1XDUA 3VEPA 3NJZA 2FRHA 1EH8A 4L0YB 3MDPA 1J3RA 3R60A 1Z1DA 2CG4A 1HXDA 4L0ZB 1QZYA 2EVXA 1R5GA 1W7PD 5I0UA 4EMSA 4JK1X 1OMIA 1ZRDA 3D5LA 3UKTA 3BZ6A 2QYOA 2M5WA 4E2SA 4S04A 4LMYA 2FMYA 3FXUA 3FFQA 1K7AA 5H6RA 3K9TA 5E8GA 3WG9A 3FM5A 3RI4A 2D1HA 3B73A 2EV0A 5I0SA 3C7JA 3OV8A 5TRDA 1GQHA 3KP6A 1YFYA 5DV5A 4KNYA 1TNSA 1I1SA 3KP3A 4RGUA 1QXJA 3K0LA 1PP8F 1KU9A 3FZVA 3AAFA 1E2XA 2P4WA 1ZZ6A 5D5UB 1SAXA 1FBUA 1AWCA 5JI6A 5A2QK 1NZCA 3H50A 1A04A 1R23A 5F6FA 4EQQA 3IBMA 3KGZA 4PCQA 4H0EA 2VBYA 3QU3A 2PMHA 3QPTA 1EPZA 1I6XA 4HQMA 1GXQA 3WGIA 4HBLA 5HLGA 3E6CC 2HS5A 1P92A 2HFHA 2IVMA 3TDUC 2GA2A 2ZNZA 2EFWA 2OAZA 3NEUA 2YPRA 4GGGA 4IHTA 2F5FA 4ZYEA 3MPBA 1O4TA 4EROA 5L3GA 1G3YA 3P7NA 3CLOA 2ETHA 5FB2A 3GWZA 1FYMA 2GC3A 2W84A 3EQEA 1XSXA 1FPQA 4B29A 1LEAA 3LSTA 4QGMA 2H6CA 1R5HA 4A0ZA 4EGYA 4MV2A 4QXKA 1BJAA 2PEXA 3E5QA 2EV6A 4RGXA 2IT0A 1CGPA 4M9XA 5FD5A 4HZFA 1K78A 2Q30A 5D6FA 4JV4A 2DW4A 5DD8A 3GYHX 4E70A 2P5LC 4KWJA 3F22A 2F4PA 1SFNA 2TDXA 4HV6A 4FBFA 3RNSA 1CAWB 3ACLA 4WX9A 1KU3A 3MZYA 1R58A 2V79A 5DDGA 4NVPA 1UPIA 3K1PA 2PFBA 3FXRA 1XGSA 2H09A 3ZN1A 3BB6A 3ETQA 3WW2A 1SD4A 2LF7A 1SFXA 4L18B 2IXCA 3JSPA 3WGHA 5D1IA 3SZPA 2UY9A 1O7FA 4BHBA 3WW3A 4BHPA 1XD7A 4A5MA 4Q0VA 3RKYA 2FOKA 4YNIA 1LDJA 1QQIA 2GWRA 4XFBA 5CVUA 3HT2A 4HN0A 3NKTA 4MUVA 3IHUA 3O14A 2FQ3A 3M3IA 4OFGA 5CVVA 3J7AO 2NYXA 2XIGA 3C3WA 2H6BA 3NQOA 3K2ZA 1CF7A 2XLFA 3R61A 1OYYA 2HQRA 2DT5A 5BUVA 1ZLJA 3GLXA 4I98B 2BNNA 1MDMB 3L7WA 3RKXA 5HLHA 5JCTA 3PNAA 3BPZA 4QGLA 2MA3A 2KJCA 1KQ0A 2IA1A 5FPXA 2L4MA 3UKVA 1CF7B 1RC6A 1S6LA 2KIMA 1QPMA 4A5NA 4L9NA 2XUBA 3LAPA 2A07F 1OI6A 4DINB 4Y17A 2JT1A 3JTGA 4AQ6A 2AXLA 4XBFA 4QGNA 1QGPA 4M72A 1XE8A 5CVJA 2YX4A 1NYWA 4RD7A 1HSJA 4KA4A 1J3QA 2GAUA 4D7TA 3HYIA 4WWCA 2VBZA 2PA7A 4UHTA 4OIOF 5L3EA 5I93A 2NRAC 5LGNA 3TDZC 1H9GA 1HBXG 1YIOA 2OPKA 2ZKLA 4M73A 3WTTC 1F4KA 5BXXA 3QRFF 1BC8C 4CGZA 3RJPA 4IRGA 5K5QA 1OD5A 4LB5A 2HJIA 5I8TA 2P17A 4LUMA 1QY4A 2FQPA 1FWZA 2ADUA 2V1UA 4A2UA 4LG0B 2O03A 1B6AA 2IXLA 5TJJA 3LWFA 4G7HF 3GFIA 2LSOA 3L2CA 3OCPA 3PVBB 3HRMA 5LRSA 4P9FA 3NL1A 3TGNA 2W57A 4OINF 1FY7A 3WU1B 4L5JA 1IPKA 3SXWA 3TOAA 3KZYA 4WXHA 4R79A 2VONA 5JSOA 1ZLKA 3G73A 3QP6A 1ZVFA 3H8UA 1BI3A 2E1CA 3LWCA 3U9GA 2D2WA 3G3ZA 4KN7X 1R36A 1S3JA 4GXOA 1FLIA 2DFIA 4WVZA 4META 3ROUA 2OZ6A 1ZNPA 1FX7A 3F3XA 5L3CA 5ILSA 3U2RA 1J7KA 2P7CB 2PTMA 4AWXB 1OKRA 2Q0AA 4JTNA 2O8XA 4RS8A 3RTRA 4KICA 2PI0A 5FLXZ 5DEQA 2D1VA 3Q9VA 1NE6A 3E5UA 1YTYA 1UW8A 4HLYA 2A3SA 4ZYDA 4Y13A 3IRQA 1Z9CA 1VP6A 4AXOA 5HS8A 2GA1A 4XETA 1S7AA 3KMHA 1CX4A 4HSLA 1DGRA 3CO6C 1XCBA 4ENKA 5L3BA 1MZBA 2W85A 2CW0F 2B9UA 1W7PB 5L3DA 4AVAA 2KRFA 3EYYA 5E1XA 2D5HA 4U7BA 2W24A 4UUVA 2XV4S 1KGSA 4R8HA 2PBIA 5DCFA 2YX7A 2GXBA 1OYWA 5FGMA 3JAMK 1G3SA 3GF2A 4YG2F 3BPXA 4G7OF 3V7RA 2FBHA 4KIFA 1STZA 5J6XA 4X6QB 2UYAA 4Q48A 4IEOA 2RV8A 4PJYA 2OA4A 1PM7A 2NNYA 2EB7A 4NHJA 3KZZA 5CLSA 3ERED 2K9ZA 4HQEA 3VODA 3IWFA 1JHHA 2EFQA 1TLHB 2XAQA 1S8NA 5E1ZB 2K0GA 1LQ1A 1IN6A 1ZGJA 1USTA 1ZH5A 1H9TA 2PQQA 2EFOA 3GX4X 1XMAA 3BY6A 5FLHA 2ETEA 2O0YA 5J8CA 1DPUA 2PN6A 3DN7A 2VC0A 2E1NA 5JSPA 4RB1A 1U6GA 3H92A 2QNKA 3D82A 4QMAA 2PAKA 1UFMA 2AS5F 2BE5F 3O2PE 3GEZA 2F5CA 1I5ZA 2X4HA 4Q47A 1R1VA 3M9AA 1YO5C 2UXNA 1D3YA 1WLTA 1OYIA 1XN7A 1ZRFA 2Z2SB 2FEZA 1U5TC 1G6NA 1IXSB 1DDNA 2Z33A 4BQAA 4RGRA 4RB3C 5KHJA 3RKWA 2GIVA 1IN5A 3ZMUA 1O3RA 1YYVA 4L2NA 4MTEA 4YFXF 1F5TA 4KWKA 1IPJA 3J81Z 2LNBA 2H0VA 2HOEA 1IN7A 2GXGA 2QQBA 4BHCA 1G3WA 4EGZA 3ZDSA 2KXLA 1Z7UA 2L4AA 3R6SA 5AIPA 4AIKA 4MGKE 4IERA 3F72A 3DFGA 5HLIA 1RTVA 1W4MA 1G4DA 2D93A 1D8KA 4ESJA 4LLGF 1EYBA 1W5SA 1X7NA 1TBXA 1JGSA 1KYZA 3V8KA 2RVCA 3TOBA 2D5FA 2UY8A 3NW4A 1KA8A 1U5TA 2M30A 2J5OA 2A6EF 2Z9OA 3IDCB 4XFHA 2OQGA 5D8LB 4U0VA 3LQRA 1ZZ8A 4AVBA 5JAXA 1FC3A 4XEZA 3F8MA 1TTYA 3BDDA 3BOQA 1O7LA 1ZAOA 4B8XA 2A61A 4E2QA 3IDBB 2FNPA 1FSEA 1P4WA 1HQCA 4PGHA 3WODF 4UXNA 4XFAA 1SD5A 1L0OC 3S7IA 4FAHA 4IEQA 3C1DA 5T3NA 4IJAA 4PIXA 1QZZA 5KBFA 1ZZ7A 1U2WA 2DPUA 3BJAA 2HYFA 3BWGA 3K1MA 2F2EA 4LA2A 5DUIA 3U11A 4IEZA 4H7LA 3IC7A 4RAYA 2K02A 4WXCA 5I0TA 4ZH4F 5LHGA 2VT3A 4MTDA 5E17F 4KIGA 4Q4ZF 2OZJA 1Y0UA 3E3VA 1WQ2A 1V70A 5E16A 2EV5A 3CL1A 2FBIA 1OFNA 3ELKA 1I1GA 4CICA 3EYIA 2XKPA 3RYPA 2IXHA 1SD7A 2W25A 5LLQA 1UHMA 2Z3YA 4M71A 2WC2A 2F5DA 4K2EA 2EFNA 4KN4X 5FDBA 2QQ9A 4U0YA 4IEUA 2OA2A 3LAGA 2QUFA 4HVOA 2MLGA 5FLIA 1Q5OA 3S0MA 2XL9A 2COMA 1L3LA 3FMRA 2BV6A 4JQFA 2UWMA 1LRHA 2VODA 4IXAA 4EWDA 5HDKA 4S05A 3BPVA 1B4AA 2N7GA 3E6MA 1YW8A 1DZTA 3W6JB 2XAGA 2IP2A 1ZYRF 3WTWC 2QZ8A 3JZVA 5KHGA 4KIBA 4ZYHA 1TQ5A 2VXZA 2EA4A 4OIQF 3S7EA 1D5VA 1T39A 2ET1A 3MYXA 2WFPA 1BOAA 2C0ZA 3RZZA 4ZZDA 4ENNA 2V6CA 4NQWA 4Q0UA 3OD0A 5FD6A 4IPAA 4Q0SA 2GU9A 4Q0PA 3T8TA 4XFCA 2QLZA 2YU3A 5KHIA 1DPRA 4HOBA 4AQ2A 2E7WA 2HEOA 3GFLA 5LBQA 1O3QA 1J9IA 1JHFA 1O5UA 1J5YA 2M1BA 2VBXA 3WTYC 2CGPA 3UKNA 1J2XA 3CLPA 1XSVA 3ZMZA 4M6XA 1FNNA 1YLFA 2P7VB 1TNTA 5ERIA 2I45A 4IEXA 2M8EA 2VQAA 1ZX5A 1BN5A 1MJBA 4UVAA 2ZXJA 3CDHA 5FLXK 2OD5A 3ISPA 4XF4A 5EEGA 5LHHA 4ZU4A 3M1EA 5L3FA 2XAHA 2Z69A 4CYDA 5ICEA 4J1WA 3E97A 1TW2A 2VN2A 1BM9A 4BAYA 1KU2A 4HF2A 1LDDA 5HS7A 2JZYA 1KQ9A 4ASNA 3LAJA 5FFZA 4I01A 1LEBA 4BYYA 3ML6A 3EHKA 2EA7A 4MNUA 3CJNA 5I91A 2MHFA 2MPFA 3FM3A 2HGCA 1OPCA 5ILUA 4G6QA 1RNLA 1SEFA 1FOKA 1EV7A 4I7HA 4N9IA 4ZU5A 2STWA 1F9NA 2Q8KA 4CZZA 3DQVC 4IF4A 1YS7A 3FHZA 1VR3A 2VOPA 4YIIA 2DK8A 4OIPF 1TW3A 4ESBA 1XDSA 2E7XA 5E8IA 3HOTA 1R7JA 1Y9QA 3G7DA 4O9GA 4UV8A 2MC3A 2DTRA 2GH2A 3LA3A 1WRJA 2A69F 5E18F 3BALA 2PHLA 1Z05A 5H6QA 1O5LA 3I4PA 2L01A 3U1DA 5JR3A 2OYZA 1BC7C 3ZQ7A 3IRRA 1ZHFA 2JTVA 3E6BA 3C3VA 3FE5A 1IRFA 1ZZBA 3LFKA 4CDGA 5HI0A 5I8YA 1ZG5A 4I0BA 2DLLA 5ICFA 5BQTA 2L54A 1ZZCA 4EJWA 1YFWA 1NE4A 4EJVA 2X0LA 3BJOA 3HQXA 3TO9A 2ZNYA 4BIFA 5KHHA 2O3FA 1SFEA 3COAC 3N97A 3F8BA 2EAAA 1WI9A 3KE2A 2YR2A 3S2WA 1K78B 4IEWA 4LLNA 4EM0B 1YFUA 3GZ6A 3GVAA 4KL1A 3HRTA 2BNMA 2CSOA 1HW1A 2O8QA 3SCHA 4FX4A 5J48A 1OR7A 4O9EA 4LLOA 3VOEA 1ZG1A 2J5PA 4LJZF 2JSCA 3TNQA 5HVQC 4ONUA 5LRRA 5FQ0B 4QX5A 3HRUA 3MWMA 2VT2A 2XASA 3U0ZA 1BIBA 1X8EA 3HSRA 4I2OA 3F8FA 4UBHA 1YG2A 2QBYB 4MGYE 5IT9Z 5DYMA 3K1NA 5JFRA 3IIAA 3MCZA 4B09A 1KQ8A 3CJXA 3I71A 3BP8A 2RDPA 5CJ9A 2JRTA 2H27A 4JVAA 1SMYF 3TKYA 5BS6A 3L2HA 3FZ3A 1LDKB 2KIUA 4L11A 4GO1A 1LKNA 1XB4A 3SHFA 2LKPA 4I09A 1FSHA 5HOOA 2OU2A 1WWXA 2XAJA 1Q43A 3LA7A 1KU7A 4A12A 1H1MA 4MHGA 3H7YA 3V8JA 4HDUA 3RYRA 2P6SA 2UZKA 3I0TA 2R7DA 1CAUA 4E2GA 3QACA 2VBWA 2IRFG 4GYGA 4HN1A 2L02A 4IEYA 2Z5UA 3ULQB 1KYWA 3KCCA 2VPVA 5E20A 1ZREA 1C0WA 4WF2A 3IKVA 4EV0A 4TLFA 3EETA 4EJUA 3HHGA 3MZHA 3WE3A 1XSDA 2HYGD 5EFUA 3OOPA 3ELNA 3EUHA 3R0JA 4PZJA 1JUHA 3CEWA 3QPHA 2DBBA 3DV8A 2KIFA 2DK5A 2CYYA 1HSTA 4RB2C 1UIKA 1GVJA 4KU8A 4XF1A 4BXUA 3NVCA 4HAMA 3O6BB 4Z2YA 3NSTA 1B59A 3CUOA 4ON0A 4YFKF 2G9WA 4N9HA 4M6YA 4HSJA 2K86A 4L9VA 4WZCA 3RPQA 2VE8A 1P4XA 4L5IA 5KK1A 2VOOA 5IT3A 4IESA 1GXPA 5JSRA 5DCMB 3GZ5A 4MGRA 3GFMA 4XFFA 2A5YB 5LEKA 1K79A 1SMTA 3FHIB 3KSCA 4G94A 5FO5A 3DEUA 4R52A 3ZP5A 4OU0A 3OGJA 4EWAA 1ZGAA 3KEQA 3KP4A 1UHWA 1BI0A 3L09A 1HKSA 2CFXA 2IJLA 1XMKA 5HDGA 5BPXA 3CO2A 2EK5A 5J7MA 4HV5A 1YFXA 3M8FA 2V09A 2R3SA 3EDPA 1B9MA 2Y0OA 1CAXA 2DQRA 2PHDA 1IXRC 3R4KA 5BMZA 4EJOA 2CAVA 4ETSA 1RGSA 4XRFA 4HDVA 3GFJA 3P9IA 5I8SA 1U78A 1X8MA 5LGTA 2Z99A 3I7DA 5AONA 4AVPA 2XHKA 3HSFA 1S29A 1ZN2A 3GBFA 4LEJA 4LTAA 2DCTA 4KU7A 1WSUA 3R0AA 1CAWA 3KLNA 1H0MA 5FLJA 1ZRCA 1T6SA 4HVRA 2K4BA 1FT9A 4I0AA 4Y15A 2CV6A 3I58A 4HMZA 1RUNA 1YS6A 4MEYF 5FPZA 1YHFA 2QVSB 3FJSA 2E9QA 2XAFA 4P55A 2V9VA 3N4MA 1UD1A 2Y0MA 2ZCWA 4L9TA 2LDUA 5J3UA 1X82A 4XFGA 2GC0A 4HX8A 2DI3A 1UCXA 1EY2A 4GULA 1PP7U 3SCGA 4WCGA 3C18A 2PJPA 1U3EM 1XGNA 1FP2A 2FF4A 1BI1A 3EJKA 2PQ8A 1UIJA 4O6JA 3WTZA 6PAXA 2HDCA 1Y3TA 4EVIA 2QCSB 2R7FA 4X6RB 3LZZA 3I64A 2XL7A 3BJ6A 2FU4A 2EA2A 2D45A 3CF6E 4MQ9F 3DPLC 2MD5A 4IEPA 4IRHA 1P6RA 2ZO4A 4KT5C 1XRUA 2PG4A 1B9NA 2EJRA 2ZBKA 1R1UA 1R00A 3TO6A 3IKTA 1Q3EA 1J1LA 3V7SA 3BROA 4P5OA 1J75A 5BPIA 3PFIA 3SQNA 4YIFA 2FA5A 4KYWA 2BYVE 3WTXC 3GW2A 1RIOH
chains in the Genus database with same CATH superfamily
4Y1VA 3F6VA 1Z6RA 1BVP1 2PLV3 3GUDA 2HQ5A 2BWAA 4HL0A 1IQDC 3FUOA 2B5HA 2LF8A 3FXLA 2ATFA 2Y60A 3ECOA 2C6SA 3T0BA 1AR63 1BA5A 4ZDLA 2CQKA 1IGOA 1X1BA 1F15A 5HXMA 4XOTA 3WTVC 1ETVA 3BT9A 5JMOA 3RIRA 5JR2A 3VZLA 1W2OA 4CEWB 2I2SA 2RR11 5FYUA 1J0RA 1MBGA 5CFCC 3OYJA 4DQ2A 3VB9A 1WBLA 1ZRRA 2A6ZA 3OBRA 3ZFFA 4HG2A 2ILMA 4Y33A 5C3EJ 5A3OA 4BS9A 4FTHA 1S7OA 1PO12 2WN2A 3LEIA 3MFAA 3HGYA 5KXBA 1QHDA 3BGAA 2DUOA 1MJ9A 1UMQA 4QAWA 3AG1H 4E7HA 2X85A 2WNOA 4AIHA 3G4SI 3FF5A 1NXMA 1W90A 1PGSA 3J80Z 3QD6A 4CXYA 3CD6I 1IG0A 3TEZA 1BLZA 1HXS1 2G9GA 3DKWA 3MLKA 1VRH1 1FNYA 1GMMA 1V9U1 1TE1B 2P5VA 4E7JA 2X6OA 5DM6F 3TEDA 2OPWA 1TZOA 1LE8A 1VALA 2XGXA 1ENRA 5C8CB 4OMYA 4AHYA 1DGWA 2W7NA 2B0LA 4LNVA 5FKNA 2IGNA 2ZABA 2DMNA 3LSJA 4CXFA 2FDHA 2WNVB 2XONA 3W20A 3PJQA 2PJRA 3ZGKA 2N8GA 3WU0A 5D8KB 4CDQB 2JPCA 4WM8B 3WR0A 4CYCB 3B3QE 4LOTA 2VVDA 2J1TA 2BOIA 2Q0OA 1NHAA 4FP2A 1M06G 2BBYA 5JWPA 1T38A 2HKOA 4Y22A 3BR2A 4XDOA 5BYNA 1TQMA 1IZ3A 3L9FA 3O1OA 5FJHA 4UXAA 3OGSA 1RVF2 4JBAA 3MKWB 2W91A 2Z4FA 2IA2A 1ETXA 1QO0D 3NV1A 1EH7A 4UT5A 1CJDA 1UMIA 2ELHA 2JA6J 1MS8A 3BU7A 2XJTA 2WADA 3ZDVA 1OVSA 4XKCA 4FOYA 1D7PM 4WVWA 1OFCX 5FO7B 2Y75A 1VBA2 4M3GA 3GTJJ 1ZARA 5DAXA 2WYFA 3HTUA 2BVBA 4P5HA 4YW2A 3B5LB 3WUDA 2YPJA 2DU1A 3DXJF 1YW7A 1U8RA 3U1KA 2BNOA 5AVPA 4UI9L 5H9SA 3QP5A 2FCVA 3LFMA 5A7NA 1LPQA 1CAXB 4LGWA 1Q8VA 2VQTA 4AGGA 4EM2A 1U9NA 3S1MJ 2ZEWA 5CU1A 1J58A 5E3LA 2OZUA 4Y3OA 3V4GA 1F35A 2Y8KA 5EGOA 2PMZN 3HHHA 3LMMA 4R4ZA 4QM8A 4FPFA 4QWQA 1S2KA 2G7UA 3FHNA 2QWWA 2UXXA 5ICCA 2VG9A 2VNOA 4P9XA 3WQBA 5FYYA 5FBJA 2QVOA 4KDPA 5C6CA 1K42A 4DYQA 3VHRA 1MDMA 2RS12 3FLTA 1NT0A 2WWYA 2JDMA 1J59A 4XUNA 3Q5FA 2A71A 5DZFA 2RS13 2PMWB 1FMD1 2ZGPA 4CDUA 5LHIA 1YWKA 2JUCA 3VHPA 4UVCA 3PQJA 3ASOH 1COV1 5AIQA 5JOWA 5FZMA 3CJIA 2LH9A 3I2FA 4YZ2A 2MC4A 5LWBA 3TEYA 2Q8OA 2LMDA 4QU1A 4MX3A 2BFUL 2WNUA 4FPOB 1ZBE2 2JDAA 1VPHA 1R71A 3ZMNA 4RL7A 5ISLA 1TWAJ 4RGSA 1K6OA 3F21A 3OTFA 3I3QA 1GP5A 2DWRA 1UOGA 4RB0A 1IV6A 5F5IA 2PMUA 5A1AA 2DCJA 2HR3A 1QQP3 3W2WA 4DBRA 3J8F1 4QM9A 2YZ4A 1DF0A 1LB2A 5AFBA 3UV9A 1VBB1 4NN0A 2GC1A 4BH9A 1LAJA 3J81K 1ZG3A 2GZWA 3OY9A 1E17A 2VY0A 4KMUX 3B69A 1C4RA 4PJ0C 3SCFA 4C0HA 1ZBA2 2Q4SA 2DTWA 3H35A 1EPWA 2HWB3 3O5SA 2HBUA 4YYOA 1RETA 1Q1VA 1XC5A 3ABUA 4IE5A 2ID4A 2QENA 2BU9A 2KDOA 4MXWA 3VDBA 4LO8A 2J22A 5DCMA 1RUI1 2X51A 3HNMA 3LIHA 5FP4A 1AR62 4HVQA 1TQPA 4IRIA 4GMP1 1K3IA 4XXPA 2W2IA 5JDBA 2HEYF 5IHRA 1OOPC 1SMVA 1X9PA 4C2TA 1DP7P 3RSNA 2W87A 1PK6C 3K69A 2ZGSA 5IVBA 1JKOC 2BXYA 3VKOA 2XLAA 2JVGA 2K27A 2ZEYA 1MS5A 2Q1MA 1QJX1 4JGYB 3WZ1A 2JKBA 4H7MA 4XF0A 4LBNA 4L9JA 4BM8A 1JJ6C 5FCCA 4D0PA 2QKDA 1RUG2 5K1YA 5GLUA 1N3PA 4B3AA 3LQQA 3O7OA 1RHI2 5DUKA 3MFKA 3UR3C 4YGEA 2A68F 1XCVA 3VYRB 2A6TA 1W6MB 3HB9A 1WW4A 1AOYA 4HF0A 2PAMA 3VD5A 2OCCH 3ZFGC 3AKSA 3G71I 2JDYA 4JDNA 3OPWA 2AENA 2MW8A 1IW7F 4OIRF 3S15J 3RCOA 3U1XA 3UKGA 2RC4A 3S3MA 5FRMA 1WW7A 2P6TA 1NLSA 5DUWA 1G3TA 4HF1A 4K7JA 4MH0E 1RI7A 3JR9A 4HKWA 4M74A 1YJKA 2KL4A 2JDNA 2DCEA 4FE4A 3H1MA 5F64A 1RUF3 2JDPA 3RYKA 4IGPA 1QHGA 3KP7A 5E1WA 5D5VB 2CWEA 1NA1C 3Q9SA 1AL23 2CDOA 4UVBA 1DUXC 3D0JA 1X36A 5LK7B 4BE3A 3DEWA 3IIIA 4BQOA 4IQJA 2ZXQA 4N0BA 4IDZA 2PJRB 1JI8A 4A3JJ 4YARA 3PQKA 1XSRA 1QU3A 4JHZA 1SCRA 3C7GA 1MMSA 1LJ9A 5A6XA 3N9QA 2DQLA 3D4KA 1N47A 3K4ZA 1GLHA 1ETQA 2LKSA 1YW9A 5FY1A 2PYTA 5GAGJ 3O3KA 3NWKA 4CEYB 4RMNA 2DBIA 2WT0A 2M87A 5FK7A 1HQNA 2XBO3 3PU3A 4JZRA 5IVVA 2IXJA 1SQ4A 5HCHA 2MLKA 3OYWA 4KFCA 3WNMA 4P9UA 4XAEA 3IV5A 1AA7A 1PIV3 4P9GA 1JH5A 3FXQA 2DTYA 2ZXHA 1BVVA 1RVF3 3GM8A 1PDNC 4E7LA 2Q2EA 4B4PA 4DGWB 3KB5A 3AMPA 1FXZA 3HUGB 4ABZA 3F23A 3WDWA 1GZTA 4BE1A 4EATA 3GNEA 5D21A 2OVUA 5FWJA 2X10A 2O61A 2C6YA 5FFOC 4EJTA 3GTGJ 2RMU2 3MDPA 1GZWA 5H2FC 4RR3A 1W7PD 3AP5A 2ZJPF 3JXSA 2E31A 3EYPA 5IK8A 3UKTA 4CU8A 3BZ6A 3Q9OA 2M5WA 4H3WA 1SVOA 3FXUA 3FFQA 3POBA 1ZYBA 4HSTA 1SVLA 3FM5A 1V5EA 3CCYA 2JJ7A 5I0SA 3C7JA 1O8PA 1AYN1 3KP6A 1HF0A 1YFYA 3UK9A 4KNYA 4GMP0 2ZGQA 1CD3G 1P9QC 1I1SA 4BQ1A 4BQNA 1PP8F 2X1DA 1SAXA 2CV1A 3AG3H 1NZCA 1HKDA 4YG0A 1RUH1 2VJIA 3OPZA 4UW6A 1F8VA 2E51A 3KVBA 1HJGA 1H1AA 2VH9A 1R23A 3INAA 4XHXA 3IBMA 3CQZJ 2ES3A 1Z7LA 3URFA 4GALA 3F2ZA 4H0EA 2OUHA 2ZGKA 3BUCA 2J7MA 4C9YA 3ESWB 1CPNA 1I6XA 1F36A 1J83A 2P3KA 1RPWA 3NJVA 3E6CC 1P92A 3WOGA 3TDUC 3CKHA 3WDTA 4CDUC 1PZ8A 4NIDA 2OAZA 2VJ5A 4BE2A 2MSYA 4GGGA 4IHTA 1PK6A 4FPYA 5L3GA 1V55H 4YM3A 2WO1A 3AG2H 2XF5A 3CLOA 1KD7A 1G9DA 4DXSA 2IS4A 2M0MA 4M3DA 3OYBA 3HBLA 2NVQJ 1XSXA 3AZYA 2DA7A 1JT0A 1D4M2 2DOFA 2VW0A 1LEAA 5IW0A 4PI2A 1MS1A 1BJAA 2WAEA 3HQRA 1XPWA 4Y20B 1VMJA 3KCXA 5FD5A 1K5MC 2Q30A 1K78A 3SH5A 1AHDP 5D6FA 2ARAA 5DD8A 3GYHX 3ZFGA 2P5LC 4KWJA 1WJDA 3DPUA 3F22A 4BCUA 4HV6A 2HWF2 3RZMA 4FBFA 1OJLA 3LNQA 3GZTB 3PVEA 1RC9A 2R93J 2HWF3 2V79A 3FMGA 1BBT3 3KF5A 3K1PA 3K4BA 2JECA 2H09A 1VAMA 3QODA 4CP0A 2V9PA 1SD4A 1XJAA 1HXS3 4L18B 1DU3D 5D1IA 2CU5A 3JRCA 4M3CF 4BHPA 1XD7A 3FISA 2D5VA 5HODA 2W1UA 1D0HA 2VPLA 1PUFA 5FUPA 1QQIA 5B1AH 3L2RA 2X5IB 5CVUA 4OQ8A 4OCTA 1G9BA 2VJXA 4MUVA 2K9SA 2NYXA 4XAAA 3C3WA 2O8KA 4QDSA 3LIGA 3R61A 1OYYA 2HQRA 2DT5A 2XJUA 3DEMA 1ZLJA 3GLXA 3WT3A 4AIDA 2IS6A 1GLNA 2A1XA 5CYYA 3IPVB 4WVMB 3UKVA 2KIQA 5IFPA 4B1LA 4HSRA 4D6QA 2KIMA 1DYKA 2XHNA 3KHBA 2XUBA 2V7FA 1XTAA 1FV2A 2JG9C 1QH6A 1R6RA 1ZK8A 1N75A 2IEKA 3JTGA 3DTKA 4AQ6A 4C30A 5FRNA 2AXLA 4FVVA 1NYWA 1J3QA 4CP1A 1T2XA 1VBC1 3F9KA 2GAUA 1W0UA 2WBKA 2QZ2A 4E6KG 3PVNA 5CEHA 1BXHA 4CXWA 2PA7A 4UHTA 1AR91 5A33B 4PJJA 1UG2A 5L3EA 2R92J 3TDZC 2WA3A 1YIOA 5A7OA 5FMOS 1NCQC 1R9TJ 1F4KA 1JUPA 1IRZA 5BNOC 4IRGA 4IOCF 4Z6YA 1W6MA 1QY4A 2FQPA 5ABJB 5IVCA 1FWZA 1Y4WA 2CGOA 2V1UA 2BUKA 5JLWA 4YZ5A 5TJJA 4BL0B 3HRMA 5LRSA 4P9FA 1WMEA 5FYVA 1QU0A 3WV6A 1I3QJ 1WCUA 3NV2A 3D5RC 2VIXA 1FY7A 2DJNA 3SXWA 3B6AA 5T52A 5JSOA 4P9YA 1VAVA 4UUSA 3QP6A 1FJLA 3X29B 1ZVFA 5IVFA 2E7TA 3RRDA 3AKRA 3ZN5A 3BU0A 1R36A 4UW5A 3V0BB 2DFIA 4QPGA 4META 4COUA 4BLJA 2HWC3 5L3CA 5ILSA 2BGOA 1LU2A 3H9QA 2O8XA 4AHXA 4DUXA 3CP2A 3I49A 3Q9VA 3I55I 1NE6A 2MYSA 4Y13A 4RQPB 1VP6A 3T3YA 1ZBE3 2X6XA 4XETA 3THTA 2DFFA 3H0GJ 3KMHA 1VBE2 5EYRA 5FZHA 3PMEA 3ENRA 4K20A 5L3BA 3PUHA 3JBG1 1MZBA 1VBE3 1GZCA 2ZMKA 1RB8G 3P5BA 4A3EJ 5L3DA 3GHNA 4AVAA 5J96B 1X33A 5E1XA 1YQ6A 3PHMA 1S2EA 1KGSA 3LOBA 3POSA 2OUMA 1AYM1 1D5YA 5DCFA 4LKEA 3GF2A 4QHOA 3HPNA 3N36A 1WJCA 3BPXA 4G7OF 2FDJA 3V7RA 2FBHA 4KIFA 1STZA 3AKTA 1K5MA 4Q48A 2UYAA 2RV8A 2OA4A 1VNDA 3ZYIB 3CDZB 3ERED 2FZ2A 4P5YA 4IXLA 1ZKGA 5FYIA 1QIQA 1S0FA 2FUG2 2DVDA 1PZ9A 1ZH5A 3N9PA 4Y5SA 1WCMJ 3BY6A 4XJ9A 2B7YA 1CZSA 4G4FA 4BXSV 2QQ8A 1U6GA 4KG0A 1ND2C 1R093 2QNKA 3IPVA 5FKBA 4QQ2A 2AS5F 2ZAHA 3GEZA 1I5ZA 2JG8C 1QOOA 2GMPA 4CDUB 1D3YA 3CJQB 1U5ZA 4N53C 2L7KA 1UXZA 1KONA 2Z2SB 3OBZA 4PF1A 2E34A 2WFF2 1NG7A 1U5TC 2IS2A 2O9LA 4LKDA 2D6KA 1E3HA 3I4IA 4C91A 3IAQA 1NG6A 4OQ9A 3ZSLA 1O3RA 4L2NA 3PNYA 4UUSB 2PHRA 3R05A 3KZIC 1IGNA 2HOEA 3HGGA 1VI0A 1IN7A 1G3WA 2R061 2KXLA 3PVOA 2L4AA 1GYKA 3R6SA 4AIKA 3BZCA 1H0BA 1K83J 3ZXEA 2WAAA 3F72A 4MFDA 3K75B 5HLIA 4HK8A 1RTVA 2D93A 4ESJA 4LLGF 5DUVA 1HLVA 1EYBA 5ABJA 5L9VA 1JGSA 4KITB 2RVCA 1KRIA 2KRHA 2D5FA 1RUH2 1TMF1 2PHWA 1KA8A 1JTYA 2NVTJ 4COWA 2J5OA 2IBDA 4RHV1 3T0DA 2Z9OA 2OQGA 5D8LB 3JRDA 2QFEA 3LQRA 3O8HA 3PIGA 4XEZA 1ZTRA 3BIEA 3F8MA 1TTYA 4XDQA 3HL2A 1WLDA 1ZAOA 1MNEA 4E2QA 4F92B 2WN3A 3WG3A 1FSEA 2ZEXA 3RKQA 1IDYA 3VBHC 1LHNA 4RGKA 4XFAA 1SD5A 1L0OC 3S7IA 3HBZA 2VUDA 3ZXFA 2F4OB 2HEWF 5BNOA 3DBLB 4PIXA 1QZZA 5KBFA 4M6VA 5DZEA 4XLFA 2F2EA 2R1DA 2VQUA 4LA2A 2TEPA 2VMDA 5FZLA 3VKMA 4ZJZA 3OUIA 2K02A 4YEJA 3DF0A 5I0TA 5LHGA 5DMYA 2OXBA 2WZR3 1N1SA 2VT3A 4MTDA 3IDEA 2SBAA 1UOFA 4Q4ZF 3IH2A 4AVTA 1UZYA 3JREA 3EYIA 2W48A 2XKPA 3RSJA 1GVDA 5LLQA 5FDBA 2QQ9A 1W06A 2QUFA 4HVOA 2MLGA 4DEQA 3W59A 1MZ5A 2WUHA 1S2BA 2WR9A 4XMAA 4LHNA 2J1AA 4JQFA 3VZKA 4CE8A 2UWMA 2R7WA 5FROA 2VODA 4IXAA 3WINE 4BK5A 2D98A 3BPVA 4HPQA 2PHUA 4ARXA 1OLQA 2C5DA 2XAGA 2VNRA 3AYAA 5L7OA 3WTWC 4KIBA 2VMEA 4ZYHA 2EA4A 3OYDA 1SCSA 2X9DA 3MYXA 2WFPA 3FXJA 2BP6A 5EDNA 1ONAA 2V6CA 5C4WC 1ENHA 2GU9A 1UY4A 1UZCA 3FK7A 1ULDA 3CCUI 2AEYA 1XNTA 4M3BA 2BZTA 5G04L 1J9IA 2KISA 4HG6B 1LEMA 1R4NB 1IHMA 2VBXA 3WF2A 3WTYC 3IDAA 5FP3A 2DYRH 1J2XA 4AC0A 1NLRA 4FTEA 3ZMZA 2P6CA 1C8NA 1VQMI 1WLWA 2LUWA 4NBQA 5ERLA 2VQAA 3ILRA 1BN5A 1MBEA 4IV1B 4QKBA 4A69C 2OD5A 2E35A 4DOZA 3DPRB 3CCVI 3ISPA 5LHHA 4UW3A 4DB5A 1Y9GA 5DDJ3 5FZCA 2DA4A 1BCXA 2Z69A 2JD9A 1TW2A 4BAYA 1X1PA 1LDDA 3IMNA 5FFZA 3BI3A 2DA6A 2EZLA 4MNUA 3VBUA 2ZX3A 2VZSA 2ZGLA 4YRVA 3FM3A 1T56A 3SH3A 3ZQLA 1OPCA 3THDA 3JQXA 3MI8A 4RQPA 2R5ZB 1PJRA 3HNBM 2LRDA 1FOKA 2VQ0A 4Q4X3 3VSKA 2DJIA 4ZU5A 2WNUC 4A44A 2STWA 1RUF2 5FMOL 4CZZA 3L9JT 2CJJA 2VOPA 2WINB 1TWGJ 1AR61 4IHYA 3S17J 4QPGB 1FTTA 1TT5B 1HN0A 2R5YB 2QSGX 4UV8A 3ZKUA 1WRJA 2WABA 5E18F 2CUJA 1Z05A 3ZYFA 3ZR5A 1W0TA 1O5LA 1C1LA 3NAPA 1AR73 1QDCA 2AHQA 4BJ5C 1BC7C 1PM4A 2Q1FA 4CA0A 1Z21A 3IRRA 3BTXA 3CCJI 1ZBA1 3CESA 3RZJA 4XORA 2JTVA 3WP6A 1ZZBA 1SLCA 5I8YA 5HI0A 1QPIA 1ZG5A 2DLLA 5ICFA 5BQTA 3ZCOA 1GV5A 1YFWA 4AM3A 2W9XA 4DS0A 4A6OA 3HQXA 5CFCB 3TO9A 3ACFA 1D0YA 4BIFA 5KHHA 1ND2A 1WJ5A 3F8BA 5KR7A 1GNHA 2E53A 1WI9A 1K4SA 2YR2A 4LLNA 3AP6A 2YBPA 1H8TA 3VKLA 3GZ6A 4N53A 5LY2A 4LOCA 3A0BC 3HOXJ 3KHCA 1FMD3 4H14A 4PSWA 3SCHA 2FDGA 1H2MA 2ECCA 2G4IA 3VSLA 3LSPA 4N8MA 1OCOH 5FY0A 4CSWA 4IV3A 4K3UA 1QA6A 2JSCA 4W65A 3AL5A 5LRRA 5FQ0B 2KDZA 4J25A 2JA2A 1NCQB 3VDCA 3MWMA 1LKXA 3I4NJ 1COV2 5GADJ 4Y26A 4I2OA 5FY9A 4UBHA 1W8TA 3HD8B 2BERA 4MGYE 1NZIA 5IT9Z 5DYMA 3HOVJ 1OQEA 3PFYA 5JPMB 2HOAA 1HQWA 3PUAA 1F4AA 3I8TA 4G6TB 2VQHA 2HYKA 1XC6A 2VBPA 2COBA 2JWPA 5DG1A 4Y1XA 3CJXA 4UFLA 3BP8A 1LODA 2RDPA 2JRTA 3VZJA 2XQRA 1SMYF 3NAUA 3RZKA 1OR7C 2L5QA 4UF0A 4QPIC 1W8WA 1LDKB 3UL2A 2UURA 3SHFA 2VZTA 2GNMA 4K1ZA 1ULCA 4IGQA 1KDKA 3H3VK 2Y31A 4HT1T 3G1MA 4DPNA 1N1TA 5CFCA 4AFDA 1D0ZA 2CUEA 2R7DA 3I0TA 5FTTC 1AXYA 3C7HA 1BEV2 2IRFG 1PGW2 4XICA 4LORA 4MO7A 4Y20A 1MS4A 1A31A 4PI0A 5IP7J 1KYWA 1ZREA 5EP9A 3VN4A 3HEFA 4BDYA 4DNYA 5JZGB 4Y5Z0 4IV1C 1FATA 1LFUP 3AYCA 3PIOF 4DUVA 1RVF1 1UPSA 3MZHA 2HYGD 5EFUA 2WFF3 2VL8A 3EUHA 3R0JA 4PZJA 3ZXLA 3VBSB 2BY3A 1HSTA 2ZMLA 2GMMA 3ZSMA 3OB8A 3O6BB 4Z2YA 3NSTA 3CUOA 2QQOA 4N9HA 3CMYA 4I3GA 2KRCA 4X0GA 2ECBA 1NUKA 4AG4A 1AL22 5DCMB 1LOBA 3JRAA 3GFMA 4XFFA 2OCEA 4G94A 3O1UA 5FO5A 2RM21 3K4MA 1DLCA 3OGJA 1YJ9I 2CMPA 4IL6C 1RIRA 4R9DA 4XVHA 4B47A 4BEHB 4RM3A 2HWE2 1H2LA 1IOAA 2Y0IA 2IJLA 3WF0A 5HDGA 2K9NA 5FR3A 2UWBA 1K12A 3M8FA 2RAEA 1AF9A 3EDPA 4NRPA 1B9MA 3WG1A 5HCAA 4ZKTB 1D1CA 1V9U2 5HXVA 1CAXA 4QD2A 5DN2A 1OOPB 3NRUA 2YFUA 5LZ6A 4MGQA 3C2BA 1UZWA 3PUFA 2JDUA 2L9VA 1X8MA 2QQNA 4AVPA 3HSFA 2WAOA 1ZN2A 3GBFA 2OX0A 2OF7A 4LTAA 2DCTA 4DO0A 1H0MA 1T6SA 4HVRA 2FX0A 2K4BA 1PO11 1G7YA 4J6GA 3OMYA 1QF3A 3MUZ1 4HMZA 4NOTA 3SISA 5LW9A 1AX0A 3FJSA 3SKJE 2E9QA 4FI9A 1GZWB 4P55A 3AMMA 2OC6A 5A3UA 2WWSA 2GNTA 4MIMA 5EZHA 3CJIB 4L9BA 5J3UA 4H55A 1WI3A 5CZKA 3AKPA 1EY2A 3SCGA 5LATA 1W6PA 4WCGA 2DOAA 3C18A 1XGNA 2XPJA 2YHJA 2FMDA 1BI1A 3VPRA 2J1UA 4CDXA 2PQ8A 4RHV2 4J01A 1DGRM 5EPAA 1WJBA 3WTZA 1RUF1 3SEZA 2HDCA 4ZXKA 1W39A 2QCSB 2LC2A 2JE7A 2XL7A 1D4M3 4HOOA 4L99A 2O0OA 3LGRA 3DPLC 1WJAA 1UJ8A 3O1SA 4HKLA 4XRSA 2R7TA 2WQ8A 3JBG3 1LGBA 3QLQA 3ZKYA 1XRUA 1AR72 3PUSA 3MIBA 3G1OA 3AL0C 3LQCA 3POJA 3IM0A 3IKTA 2JMWA 4W4ZA 2VJ4A 2PXJA 3GCMA 2K9QA 4F55A 4LJHA 4AE2A 3TBIA 2ZGMA 3WTXC 3GW2A 3ATGA 1RIOH 3KEYA 3UT0A 4OLLA 1US2A 5C5UA 4AEDB 1TVGA 4AYBA 3BR5A 2QQIA 1QJY3 3BTLA 5HNHA 3BTZA 2ZGUA 1DGWY 4QB2A 4YFNF 1T6GC 2E33A 1JE8A 4Q5SF 4IEJA 4DQAA 5F5AA 4RSUA 2PLYA 4GCVA 4PUSA 2CW7A 5FKCA 2W82A 4A42A 4U36A 3TL4X 3KGLA 5FOJB 4PGGA 1POV3 2EWNA 3H9GA 3ECQA 2D44A 4GYIA 5E1RA 3IKWA 4FAGA 3V65A 2WYSA 4NJ4A 4AR2A 1VMFA 4XQFA 4MXVA 5LEJA 1UX7A 5CKQA 1PNGA 4U7DA 1R091 2ME6A 4G8XA 2DA1A 4IE7A 4LIVA 3VGIA 3P9KA 2YV8A 2IXKA 4XNFA 2CWSA 2NVUB 3AJZA 3C7EA 4HPKA 5CKNA 1F31A 3JQWA 1PK6B 1H9PA 2DMPA 4ASMB 1EP0A 1FP1D 2WA0A 1R49A 3UGHA 4QB1A 5A6YA 5DG2A 5DTDA 3B01A 3K70D 1ETKA 4XHBA 3ZPLA 2HU9A 3FC0A 3I2IA 5JOYA 5L9RA 1VBE1 4CDWA 1CAVA 3HOSA 4COVA 3OOXA 3GCXA 5BNQA 3FFZA 4II2A 4Q8LA 4FXGB 2K40A 1DU0A 2BBVA 2B39A 4A0XA 4WV8A 1FBSA 3RGBA 2DDBA 1Y6IA 3ACHA 5BY5A 1RUJ2 1L3JA 3VBOB 4PQQA 2B4KA 2WQZC 2ZACA 5BNNA 1GNZA 5CPRB 4L0PA 3AMNA 1A6QA 4I30A 1HKQA 1NCQA 5FZKA 3H3ZA 5M3FJ 2TNFA 3T2OA 4DXTA 1CQTA 2IC1A 2DFHA 4LO4B 4OHWA 5JHUA 1VQ6I 5F3CA 3ZRGA 3OYGA 1ON1A 3TP0A 4AI9A 3CBNA 3IH3A 2XVCA 4Q4X1 3OOUA 1OKOA 4P08A 2XJSA 1HRV3 1ON2A 3E6DA 1YQAA 5DZGA 2NXNB 3K4JA 3GLLA 2XB5A 4Q29A 3TO7A 3DPTA 3SFZA 3BG6A 2XF6A 3MQ0A 1HIXA 1NOVA 1B8IA 2VXRA 4LA3A 3DCFA 4BA6A 4F7ZA 2VE9A 4CRQA 4XLNF 2L3DA 4KUMA 1WMDA 1ACCA 1MKMA 4AD9A 1W5TA 3JB4C 5FZOA 5F3GA 3HUGA 4CUBA 3MD2A 1W7PA 3IAPA 1AR92 2IS1A 2A6YA 1ODDA 2RR13 4P14A 2Q2EB 1ZBA3 2IZWA 3TB0A 2VOWA 2O6GE 4BXXJ 1FBQA 2E36A 4CCMA 4CDXC 1Z3YA 3CZ6A 5ICGA 1DQ2A 3LA2A 3QH7A 2OQ7A 3U21A 1GHCA 5TISC 4FPLA 4AGVA 3MLJA 3CUQC 2R7XA 5AFEA 4ENJA 1HX6A 4LMFA 3J26N 4FT8A 2WFF1 4XONA 4UB6C 3U14A 4G7ZF 1BR4A 2HTJA 5EXOA 1FYKA 4MXWB 3AFHA 2DVAA 5K8SA 1UYYA 1BI2A 4IEVA 3OS0A 4UNOA 3H5AA 2YUSA 4HFSA 2AREA 4XL9A 1UAIA 1IG3A 3T4VA 2PAEA 1BL0A 5IVEA 4D94A 5FFXA 3DP7A 2ZX1A 4HW0A 3W6KB 3M1CA 4LK7A 5F1RA 2UWCA 2C9AA 5DUUA 4BPZA 2ZJRF 5CG8A 4LG0A 1J3PA 3M1HA 1Y8RB 2KKOA 1W0OA 4AU7A 5GTIC 5F0FA 1CAUB 4YGDA 2BOJA 3ABMH 1IS3A 2EIMH 4LQRA 1XNCA 4ZHNA 3VFZA 5M5YJ 2XGDA 4LKSA 1WD4A 2Y34A 4AVVA 5CVRA 4NB5A 1ASJ3 4LHSA 2VI6A 1DGLA 3KT1A 3J80K 1WCQA 1MGTA 3M8EA 4Y52J 2P5KA 3JBG2 1OOPA 2FMLA 1GOGA 4NUBA 3BC8A 4PJLA 3D3AA 1VB4A 3CUQB 4X1EA 1BBT1 5FZ9A 4F91B 2F5EA 5IK5A 5DPNA 3R0RA 1SFUA 1FI2A 3RQ4A 4AIJA 4ESFA 2OW4A 2D40A 1IXCA 1S7EA 2WTEA 5K5RA 1VBD2 4I0WB 4TSVA 1LR5A 3USSA 2L7FP 1GR3A 2VQLA 1VBD3 1DQUA 4LOSA 3M3YJ 2KD7A 1VJ2A 1OF4A 4XTMA 1IZ1A 1REPC 3A0KA 5F1JA 5A2QZ 1QNWA 2LTPA 5J1UA 2VNVA 1IC8A 1YUDA 2EIDA 5D4RA 1WCDJ 3KYLA 2VECA 4B4CA 2VBDA 1B1BA 2ZHKA 4RA2A 4A45A 4ZZLA 3KETA 1D8JA 4YVSA 3A22A 1GV2A 1AKHA 2JPBA 4WM8C 5EF6A 2QSHX 4E27A 1U9OA 3K6GA 1D2QA 5BNGA 5BNNC 4WXDA 1H8AC 2LW8A 2R16A 4TXWA 1E5RA 5F6LB 1JOPA 5A3TA 2PHTA 5FPVA 1ORKA 2ISYA 1QNTA 2DUPA 1GV9A 4FFGA 1UG0A 1R1TA 3CCRI 4CDXB 1MACA 2WWJA 2KJBA 1POGA 3EQLF 4XDPA 3T09A 1AX2A 1AYN3 2VL4A 4CCJA 1DZRA 3RPUA 2GMEA 3K4LA 2HQNA 2IXSA 4A3IJ 1R4MB 2EZKA 1VBC3 4DXRA 2M34A 1AYN2 4Q4X2 1MJAA 3HKZA 2XKOA 1VBC2 1BJQA 2NS0A 4HNUA 1ND3B 1GP4A 2WNUB 1MZFA 1CN1A 2ESNA 4AHWA 3RWNA 4L97A 2JE9A 2ADEA 1MBHA 3FWEA 1C28A 4XMIA 4D7SA 1VQNI 3JAMZ 4OHXA 3ILFA 4NRMA 4AVCA 3ZYGA 2OTJI 2Y69H 2VO5A 4DNCA 4M3FA 1W5CC 1SVMA 2HOTA 1UB9A 4LLLA 1RUJ1 1HDDC 3KEOA 3SZGA 1X3UA 3OGVA 4CZSA 5F32A 4Q26A 4EE2A 5BNNB 1AJKA 4PIYA 5L7OB 4OAYA 2LRPA 2M45A 2PHXA 3ES4A 4E4ZA 2A3XA 2JWTA 2PFWA 1RL3A 3DWLE 1PUEE 4CHUA 2CSGA 4JX0A 2RQPA 3U10A 3CTAA 4O5VA 1Y8QB 2ZKZA 4KMFA 2PELA 1RZ4A 1BR1A 4BACA 1IAWA 3JRGA 4LK1F 4CCNA 2JG8B 2VVEA 1N25A 5F8PA 5KHDA 2O1QA 3APBA 4M9SA 5BPDA 4RAZA 1Y1WJ 2VCBA 3HJEA 1HW2A 3OYAA 5KVRA 4QXHA 3GF6A 5I0DA 1JYCA 1HV0A 4AAPA 2K7LA 4G6DA 2JK3A 4ZONA 2H8WA 3I2DA 2EICA 1OFSA 3DLAA 1RUI3 4HYEA 2K9MA 4XYXA 1X1CA 2WDBA 4PQ9A 2EILH 1BIAA 1E5IA 4HPKB 3S32A 4BNCA 3LOIA 4D7YA 1CONA 3VBFC 5FKMA 5D8AC 2G7HA 2O7OA 3AMHA 3DBRB 2HWF1 3VEPA 3NJZA 2F17A 3OL4A 1J3RA 3R60A 3J7MA 1HXDA 4R9CA 3AP9A 3EPZA 2M9HA 1O8SA 3S2HJ 1R5GA 5AVAA 4E8DA 4EMSA 4XOGA 5E6HA 4JK1X 3SEPA 1OPOA 1OMIA 2QYOA 4LBQD 2D43A 4KWUA 4EZ4A 2FMYA 1UZVA 1K7AA 1X9TA 2W39A 5H6RA 3RI4A 1LFBA 3OV8A 1TG7A 5DV5A 2QA4I 4PCRA 3MIGA 1QXJA 2PMZA 3KF3A 3K0LA 4CDQC 3WNKA 3AAFA 3LKJA 1JI6A 3U4XA 5FJ8J 1ZZ6A 2A05A 5D5UB 1FBUA 4BISA 2BRTA 5JI6A 1QJU3 4ASKA 3ZQQA 3VDDB 3BTAA 3KWVA 2CFOA 4EQQA 1AR71 1W36C 5A32A 1GFF2 4PCQA 1LULA 5L19A 2VBYA 5FP8A 3QU3A 3KV6A 2R063 1EPZA 5LA2A 4LO6B 2M4GA 2NN8A 3NAPC 1OCPA 2D6MA 2IVMA 4W6XA 2GA2A 1SLLA 3USUA 2HWD3 1A6CA 3MIDA 1ALYA 4DRVA 4NO4A 2X09A 3NEUA 3Q0VA 1Z3XA 1SANA 1Z67A 4ZYEA 3MPBA 1O4TA 3G6JB 4XRSG 2JVHA 1G3YA 1QQP2 5FB2A 2IGKA 3GWZA 3EQEA 1A35A 5F37A 5K7ZA 1WD3A 2GM4A 1FPQA 4B29A 1XG1A 4QGMA 2JENA 5JMCA 1ETYA 5GLTA 4QXKA 4EGYA 3S8PA 1W2AX 1QMJA 3TN93 5H9RA 2EV6A 4OI0A 2IT0A 1CGPA 5A3MA 1RR8C 1S0CA 2E60A 3N7KA 4JV4A 2DW4A 4UFIA 4E70A 1QH7A 2F4PA 4IV3C 2TDXA 2FHRA 1OQDA 2FCTA 3CMGA 5ANQA 3VBHB 3MZYA 3BG9A 2PFBA 3FXRA 3OYNA 1IS4A 1XGSA 3MLLA 4PDWA 3WW2A 1SLIA 1ZBE1 1YE9A 5C70A 3WGHA 3SZPA 2UY9A 2V6EA 4A7YA 2VZRA 2HWE1 3WW3A 3N9MA 1HDKA 4OHYA 1WW6A 5EG0A 1XOYA 4Q0VA 2HVSA 5K0UA 2JG9A 1S4CA 5EJ3A 1LDJA 1Z77A 4U2AA 3N9LA 2RM22 3BLYA 3MIHA 3HT2A 2I07B 3NKTA 1YC61 3O14A 3VV1A 2FQ3A 4NPRA 4OFGA 5CVVA 1FMD2 3CMEI 3J7AO 3WF1A 2XIGA 1AL21 3TOJA 2Q8CA 2H6BA 4JKKA 3K2ZA 1CF7A 1JBCA 2K2SA 5IT6A 2BNNA 3FXKA 3RKXA 5HLHA 5JCTA 3PNAA 2MA3A 4XLCA 1TNRA 2F4IA 2P4EA 1FV3A 4JC1A 1S6LA 4GMP3 4BY7J 3PNTA 1QPMA 4XACA 4L9NA 2A07F 2WB1A 5A1FA 5FO8B 2R043 3KM5A 1GUIA 1FIPA 3CMAI 3WEZA 3WSOA 1VQKI 5FZGA 4D8MA 1A8DA 4N4NB 1PGW1 4XBFA 1BEV1 4M72A 1XE8A 3OS2A 2WT2A 4RD7A 4GIQA 3CHXA 1DYPA 1W9FA 4D7TA 5LASA 1L7LA 3QH6A 2DODA 1KXGA 4NHMA 5IAXA 2NRAC 1PVEA 4PF5A 3ABLH 1H9GA 1VBA1 3VBHA 2ZKLA 5E3OA 4JGZA 2Y30A 3DTIA 3B00A 4Z1VA 4CGZA 1RUG1 4LB5A 5CFDB 5I8TA 4LUMA 1CX1A 1L7RA 1T33A 4GKXA 4A2UA 4W50A 5C8CC 3WDYA 2O03A 1FOXA 1QJX2 4G7HF 4CP2A 2LSOA 4QT6A 5CG9A 5GM0A 4A93J 4YELA 2CDPA 4WM7B 4CDQA 2JDHA 1T8IA 4COZA 2W57A 1OT5A 5J40A 1HB4A 4L5JA 3QBQA 3M07A 1IPKA 4R79A 2VONA 1VQ7I 4ES8A 1ZLKA 4W8JA 1RUI2 3AK0A 3H8UA 1BI3A 4ZC3A 3LWCA 2D2WA 2ERFA 4KN7X 1S3JA 2HPIA 3M8JA 1YRNB 1FLIA 2BW3B 4WVZA 3WNLA 1ZNPA 3F3XA 5JI9A 3VDXA 4AWXB 1OKRA 3T08A 3RTRA 5J37A 3BG3A 3ZFEB 4NHXA 4E7IA 1K61A 4BBRJ 3I3BA 2A3SA 1D1AA 4TYSA 3IRQA 3I4MJ 4GWIA 4O7XA 3ONQA 3BG7A 1OA4A 1F2NA 5KNLA 2M8GX 3CO6C 1XCBA 4ENKA 1VBB2 4GKYA 2W85A 5DUXA 2CRGA 1W7PB 3NKGA 4CA9A 4UUVA 3BTCA 1GT0C 3GZEA 2GXBA 2FDFA 1OYWA 1W6NB 5FGMA 4FFFA 1T6BX 5EJ1B 5A80A 4RLFA 4YG2F 1UAAA 2HPMA 2KM2A 4CVUA 3IH4A 4HKOA 4X6QB 4IEOA 2XGCA 1PM7A 2RQQA 4W97A 2K5CA 4M3EA 4NHJA 4JAAA 5CLSA 4LBLA 1XU1A 4HQEA 2J1VA 4G3YC 1S9HA 3M3CA 4AI1A 1W8HA 3K2OA 2XAQA 3ZIXA 2K0GA 2A6WA 1IN6A 2YMZA 1H9TA 3GX4X 1DCSA 2O0YA 1KDMA 1DPUA 4RGAA 1QVTA 3FIWA 3K4KA 2E1NA 2BY2A 4CPBA 3CMMA 4NNJA 3D82A 3CLQA 2Y9ZA 3E1F1 3JU9A 3MPPG 1UFMA 2RS11 2BE5F 3O2PE 2JICA 3J7HA 1LUJB 1YO5C 2UXNA 2DF7A 1OYIA 4QKNA 3C7OA 1ZRFA 4KISA 1R1ZA 4INDA 1ETWA 1G6NA 2Z33A 2FCUA 3U75A 3AM2A 4RGRA 5KHJA 4UB8C 2QKLB 5EGOB 1IN5A 1RUD1 4YFXF 1F5TA 3T0AA 2P6HA 4B3XA 1IPJA 1XNAA 2HVQA 1VBA3 1XNDA 2LP0A 3DKXA 4D5FA 1W2NA 2AXTC 2NOGA 2X1EA 5FUIA 2NS7A 1AHSA 1ZR2A 5AIPA 3WP4A 1IKQA 2W94A 3U37A 2PN5A 4IERA 1V6MA 5DS9A 1BMV2 3LPFA 2CU7A 2RJ2A 3VLBB 3FKIJ 1E3PA 5LBCA 1BYHA 4XJZA 3MKYB 1KYZA 2I10A 1M4WA 3TP3A 1KITA 3POFA 5E3MA 3IDCB 4XFHA 4U0VA 5FBZA 1JU4A 1SZBA 5JAXA 1FC3A 3JRIA 4Q5OA 3HN3A 4B8XA 5LA9A 2A61A 3K3OA 1P4WA 3PDQA 4PDWC 1BW5A 4PGHA 2LFBA 4CEWA 3H0OA 2W3JA 1YITI 4BBSJ 2AQFA 4XURA 1RKWA 2QF7A 3HOWJ 4IJAA 4AF9A 5HV4A 2DPUA 2XMLA 2IGMA 3LEKA 1WUVA 2BOLA 4ZH4F 1DIWA 1LGNA 1OPMA 3M3EA 1HQLA 5E16A 2EV5A 3B94A 2LM3A 1QJEA 3LOCA 2CUZA 2IXHA 3MO4A 3JB8A 4M71A 2WC2A 2F5DA 3LSHA 4K2EA 4KN4X 2M0CA 4I76A 2OA2A 1VRH3 3TMOA 5FLIA 2XL9A 2COMA 2DTZA 2PLV1 1L3LA 1BK0A 4CEYA 1VRH2 2BV6A 2HOSA 5BNPC 4EWDA 4Z2AA 1CZVA 3ZQIA 3KT4A 3V0BA 5IYCJ 3JZVA 3MEPA 4QPIA 5K7PA 2E32A 3WVJA 3N35A 2XUMA 2E2IJ 3VDAA 4OIQF 2YY1A 3O1TA 4DYCA 4CUAA 4LLFA 4H4KC 2ET1A 3CZUA 2UU8A 2KMUA 1JTZX 5IYBJ 3Q0UA 4ZZDA 2QE3A 5LCWL 4Q0UA 5FD6A 1H2KA 4Q0SA 3T8TA 4HOBA 1HLCA 1P7IA 4AQ2A 1DLLA 4JKLA 1ULFA 5FUNA 1J5YA 1TMF2 1V6IA 4AYBN 1SLBA 3T1LA 1OQYA 5T55A 3UKNA 3CZJA 4QDRA 4K8RB 4KI5M 4NMIA 3I56I 1TNTA 4CCKA 2M8EA 4E7SA 5A70A 3VHOA 3EUHC 4UVAA 4PJMA 3CIHA 3WHUA 3W5MA 3CDHA 4AFCA 4BLIA 4R9AA 2K3PA 1MSFC 2R062 1LOFC 4XF4A 4ZU4A 1ULPA 3MGUA 2CQ7A 4CYDA 4J1WA 2DBNA 5A7SA 1KU2A 3LAJA 1LHVA 5KXCA 4BQ4A 4BYYA 4LHLA 3ML6A 5IUQA 2EA7A 3CC7I 4OI4A 3A7QA 3CJNA 3X2QH 1Y7BA 2QEXI 2HWC1 5I91A 2MHFA 3F95A 1NCRA 3OYWB 2NVXJ 1MW7A 1RNLA 4GAZA 4IQ4A 1OCRH 5J4YA 4PT6A 1WMXA 5IPAA 5J1RA 2I8DA 3DQVC 5IYYA 5FPBA 1VR3A 4YIIA 3BQYA 4OIPF 2M3AA 5FYZA 1TW3A 3L2VA 1XDSA 4DJAA 3O1RA 3FL7A 1TWFJ 1U0AA 4FOVA 5M3MJ 3G7DA 1PVXA 1JN2P 4C2MJ 2MC3A 1PX4A 3LA3A 4TWTA 5SV8A 2PHLA 1VQ9I 4GB33 3K77A 2VKVA 4IL7A 1XYOA 5JR3A 2EPFA 2WIIB 1IS6A 4WM7A 2O14A 2QSFX 3E6BA 3C3VA 3FE5A 3LFKA 4B1MA 3I9V2 2CWMA 5FZ4A 2DCZA 3OUJA 1HA8A 4OMCA 4FOWA 1NE4A 5J98B 1AYM2 3WY6A 2ZNYA 1A6IA 1VIWB 2ZJCA 1SFEA 2G19A 3N97A 2ZX0A 5JPNB 4QX2A 1K78B 5HCBA 1ZGWA 3M4FA 3GVAA 1SPPB 3HRTA 3GTPJ 2BNMA 2CSOA 1HW1A 2LY1A 4N43B 3FUQA 5KXEA 2RNGA 4O9EA 1ZG1A 2J5PA 4LJZF 5HVQC 2RMU3 4BDVB 1JGGA 3AXEA 3B9IA 4V2GA 2XASA 1UYPA 3U0ZA 4RDUA 4ZS2A 5KXDA 3F8FA 3NO8A 3S1QJ 2QBYB 1VQLI 4UAPA 5J09A 3K1NA 2XXZA 3D8CA 1AR81 1W8NA 2ZAAA 4A3DJ 4DUWA 3IIAA 1KQ8A 2J1RA 1BR2A 4IE0A 5FMBA 5GLZA 3TKYA 2QTWB 3VBUB 1HN1A 1S0BA 5FZIA 2KIUA 1W9SA 4DY3A 4XQWA 2LKPA 2XAJA 2C4XA 4N7UA 2LBFA 1Q43A 1OH4A 2WZR2 1H1MA 1RUD3 4IHWA 5T5PA 5GZEA 2LD5A 3RYRA 2P6SA 4NHYA 1F5JA 3JUUA 2ZFUA 2UZKA 3CNAA 1CAUA 3QACA 1AL0G 4E4HA 5IK4A 4GYGA 2K3FA 3KZ4C 4A7ZA 5E20A 1UYZA 1C0WA 4WF2A 3H0DA 2GP3A 4ISRA 3IKVA 4EV0A 1PIV2 4TLFA 1FEXA 4XIDA 3T2QA 2DA2A 4OMDA 1VQ8I 3PM1A 1PVC2 4CPBD 3ELNA 1JUHA 2VZVA 2DBBA 5HV0A 5F04A 2E63A 2GSYA 1I6HJ 1GVJA 1SFPA 3PSIA 2ZX4A 4KU8A 2E2JJ 2H0BA 2A3WA 4XJ8A 2ZXIA 1YQ8A 4HAMA 4CDWC 5BNPA 2K86A 3RPQA 2VE8A 4L5IA 5KK1A 2VOOA 4QB6A 3GZ5A 1B72B 5JUVA 1SMTA 1K79A 3FHIB 3KSCA 1WW5A 3DEUA 4R52A 4B8EA 3UJQA 3KEQA 1W0NA 3ZFEC 3HJRA 2OQ6A 2JE8A 1DHKB 3B6CA 1UHWA 1UOJA 3L09A 4IZZA 1HKSA 5BPXA 3CO2A 1RUH3 4HV5A 1YFXA 3IUOA 1O4ZA 2GLOA 3TW6A 2ZA9A 2Y0OA 3K2AA 2Q8EA 4RAGA 3S14J 2DQRA 2W08A 1LOGA 2IWGB 4KBZA 1IXRC 3Q3SA 4EJOA 5BMZA 4XRFA 3GFJA 5I8SA 1U78A 2XHKA 4ZZ5A 2VUCA 3QCWA 3GTMJ 4KU7A 3R0AA 1CAWA 3KLNA 1A34A 1JXNA 3KVAA 1MQTA 4B48A 3IP4B 3B93A 3AZWA 1FT9A 4I0AA 4Y15A 1VLNA 2BQPA 1X4OA 3C8XA 1RUNA 2LROA 5FZDA 4MEYF 3OIPA 2KP6A 1D4M1 4S2FA 3WF4A 2V9VA 1UD1A 5IATA 4L5EA 2ZCWA 4L9TA 1TP4A 2KFDA 3AJYA 4XUPA 2GC0A 3K10A 5A6QA 3RMYA 4GULA 1PP7U 4AQSA 1FYUA 5J3LA 2PJPA 1SG3A 3ZR6A 2LYCA 2H1LA 2FF4A 2ZPXA 5F39A 4AI2A 4O6JA 1B35C 4QPIB 3V0AB 6PAXA 5LBFA 4UFKA 4EVIA 3WP3A 4RQPC 1X58A 2DXIA 1JKPC 1OC1A 4GA9A 2EA2A 1SFKA 2BVLA 4C1WA 4B1RA 2FBEA 3DU6A 4MQ9F 4OYUA 2MD5A 1JZ5A 1J09A 5LFAA 3WX5A 5EZGA 2P3IA 1E0EA 2NLRA 1B9NA 2ZBKA 3KQRA 1R00A 4RFT0 3V7SA 3BROA 1RUJ3 4MO3M 2Z42A 2MABA 5FXVA 1J75A 5FZ1A 1DGWX 2FA5A 1SFYA 1ITYA 4KYWA 1AZDA 3RZGA 3ZFFC 1W8OA 2KZVA 5KC5A 3RJ2X 3V8LA 1FOD3 2A7AA 1JUMA 3ECHA 2XH6A 3I54A 1WFXA 2PX9A 2ZMEA 1YLLA 3HR9A 3RVHA 3I53A 4K8FA 1R22A 3BQZA 3G1LA 3MAJA 2W0XA 2JUGA 5T54A 3FMSA 3F8CA 5JIUA 3PIJA 3KLOA 4BQXA 1ONVA 3S6PA 3NNLA 2MH9A 1PGL1 3JCUC 2DPDA 3DKYA 3VYUB 2RM23 3ZXKA 1LVAA 2O5RA 4LD5A 2CY6A 1QOSA 2RMU1 4XSXF 3VBRA 4XFIA 2DU0A 2YC2A 3A0NA 5EZWA 1DQ4A 2XQXA 4RR3B 4Y5TA 2CL2A 3ON7A 4Z07A 1JW6A 4U87A 3ZN0A 2VCCA 3T0YA 1NK2P 2C24A 5JI7A 4DEVA 2P37A 1YQ2A 2BFUS 5KHKA 5GZDA 4AEJA 1N78A 1O3SA 2BGPA 2P0WA 3BOPA 5E79C 3KP2A 1NH3A 2HDWA 4JQTA 2QCOA 2P34A 2B42B 2ET7A 2XSJC 2JX9A 5DD4A 3D6EA 3DXUA 3AZZA 3HOYJ 4ZU7A 3W6VA 1T95A 2NNNA 5A7WB 4JX6A 3WDVA 3LSKA 1UCRA 1ULGA 5EYXA 2NMOA 1VZ0A 2YBSA 5HS9A 3PUQA 4EM1A 2JQ7A 4XIOA 1I1EA 2BGCA 4RAFA 3VKFC 1Z6TA 5EHDA 1ODNA 3POGA 4YVSB 1E5HA 4XF3A 1XMXA 1Q1HA 2ZHNA 2BVVA 3L2WA 3MZ8A 4NROA 4FPCA 1Y39A 1RUE3 2D3RA 4W1UA 4YVWA 5AC93 1OCTC 2ZJ2A 1NLQA 2MEV2 1W3XA 4LBKA 1VB2A 4UFMA 3I3LA 3I3MA 5APAA 2MEV3 3PTYA 4MEXF 2XG3A 3WG4A 2YXSA 1J1TA 1WPKA 3CQOA 1YNAA 4QQLA 1WA4A 3HIFA 3HPGA 3GO5A 3E5XA 3MV11 4V2WA 2FDIA 3ZMOA 2CH0A 2JB4A 2VKHA 3KFWX 1A36A 3UESA 3THPA 2VC1A 4OUSA 3VZOA 2DVGA 3OG2A 4NIIA 3VDDC 4IHSA 1UX6A 1LENA 4JTOA 1U5YA 2V4AA 1RHI1 1JYNA 4LKFA 4HNVA 1XYPA 1XGMA 2MD0A 2QM3A 1QJY1 3WW4A 3HSEA 3F6OA 3QU6A 1UY2A 4E9KA 4FHTA 1R64A 4EEFG 1FIAA 4YW5A 4YW7A 4LITA 3KP5A 1SEUA 1WBFA 1Z7S1 3HOUJ 2VASA 3VD4A 1GUUA 2J1SA 3TYJA 2X1CA 2RJKA 5JR7B 1B35A 1VAKA 2EQRA 1W3VA 4FE7A 2YPDA 5DAWA 1XE7A 4XZUG 2ICWG 1H6XA 3LSMA 1MMDA 1QJU1 1HRV1 3P3PA 4TV7A 3EO6A 5EQUA 1V4RA 4NAMA 4K21A 3HNYM 4BE0A 4EYUA 5D8AB 2DO7A 2QQWA 3NJXA 3IL2A 3O1PA 2K4JA 3MN2A 4II3A 2DCKA 4MGIE 4BQQA 5M5WJ 4Q4Y1 2NVYJ 5BOXA 3GYDA 2CUFA 2AUYA 3ZMDA 3GXOA 4CCLA 3FN9A 2RS52 2OUJA 4W6WA 2QQVA 5IJRA 3KX2A 3ZYBA 2K85A 5FYCA 5AC92 2Y6HA 4D7NA 3MUY1 5FRAA 1RMU3 4LK0F 4MFEA 5FV3A 4Y1UA 4PDKA 2V1XA 4E7KA 4CUCA 2ZMEC 2VKEA 1RMU2 2W1SA 4B7KA 4FFHA 1V6OA 4A7KA 3J8F2 3H7JA 1JJ8C 2XBO2 2BHYA 3BN6A 4HA8A 1WHUA 4KGGA 4PIZA 3J8F3 4IO9F 5KWRA 3OGGA 3H42B 2RS31 2XLGA 1EH6A 5DAQA 3QOPA 4DFSA 1JYTA 2RE9A 4EN6B 3H8XA 2Y26A 1BBYA 3TBDA 2RNJA 4AFAA 1R1A3 3VYSB 5CADA 3AG4H 1L7QA 2QQJA 4JGZB 1GKBA 3LE0A 4GWNA 3ZXAC 4F8AA 1USSA 3FX3A 4UV9A 3ZMTA 4P9JA 3LL7A 2XR4A 1OLMA 4Z2WA 2BY1A 5FZ6A 4QKFA 5F3IA 4YW3A 1CIWA 2A6HF 4J00A 1R082 4XKWA 2AEZA 3AKZA 4JX5A 2VOVA 3NMBA 4XF9A 3CJIC 1EUUA 4X6AJ 4YZ3A 3AX4A 1XBFA 1F5FA 1Q8SA 2YSRA 2HQAA 4B4QA 2RN7A 3F8NA 5D5XB 5H9PA 3C7FA 3WTUC 1QWRA 1FNZA 4A3MJ 2RGVA 1JUSA 2ZMEB 3I59A 3QYEA 3LB9A 3IN9A 5F5QA 5T5LA 2OBPA 4MQVA 3M3QA 4DMIA 1SD6A 3PLQA 4OHZA 3H9JA 4BOWA 3REOA 2GQQA 2FD8A 4F52A 1VTNC 1F1ZA 1JHNA 2JEMA 5A3WA 5FQ0A 1W2TA 3U07A 3PMSA 2LY2A 3A0HC 2QBYA 3ST7A 4GH4C 5H20A 3FMQA 3IB3A 2IPQX 1QDOA 4P96A 4G12A 3E1SA 1DG6A 2IFWA 2RJLA 5E88A 1AXZA 1T08B 3QAHA 3HTSB 3AMQA 4A6EA 1DQ0A 2DA3A 2GC2A 1FPN1 2H94A 4HETA 4L8QA 2R7EB 1QKQA 2Z5WA 4Q0QA 4LR4A 2VUAA 2DFCA 4Y1ZA 3WW1A 3A21A 3CCSI 1TWHJ 4M4RA 2CNAA 1QBJA 5T50A 4N43C 3LSEA 3LSGA 4ZS3A 3UGFA 2YU1A 1TME1 4HX4A 4U0WA 4Y4RA 3BCBA 5FMCA 3PUBA 1IF1A 3LD8A 5C3PA 2RV9A 2OKXA 5CYVA 4D5CA 3M7AA 3VBSC 1IN4A 2E6VA 1ODMA 2DVBA 5ACA2 3LPGA 4MGSA 1MBFA 1W36D 4RM2A 2VPRA 4CZCA 3VHNA 4XLPF 2NS8A 5D5WB 2HWVA 4C3IJ 3PJYA 4FQGA 3K4CA 2WV0A 3ZQHA 2V26A 4LG3A 1OBNA 1XE0A 4D6SA 3HZJA 4M0NA 4QXBA 4WVVA 4KWLA 3KQ4B 2MBFA 2BTVC 2E2HJ 2WKKA 3GJBA 1YYNA 4NPLA 4Y7NJ 4MYEA 2EXHA 4Q4V1 1YQCA 2W4SA 1YXWA 2ZFWA 1A3KA 2CS3A 2G0EA 2O8OA 5L7OC 4CXXA 3H3UA 5C3QA 3VBFA 2F4LA 5T5OA 4IOAF 4XKVA 1G9FA 3AVSA 1WGXA 4C1XA 3OBAA 4CUGA 2LY9A 1JYXA 2LTNA 1ACIA 2XPVA 1HXS2 4LO5B 4RR3C 1FOYA 3ABTA 1NCRB 5F27A 3WXPA 2F4MB 1MIJA 5B3SH 2HDDA 3HPHA 5FZAA 1Y1VJ 3MBWA 3JW4A 2VKDA 4OHVA 2HZTA 2M7BA 1FYLA 4K1YA 2JDKA 5FKOA 5CVIA 2FE3A 2WSVA 3IWZA 2X5IA 1LCLA 2A5WA 5A3LA 4LFUA 2C9KA 1P2FA 2LOOA 4IETA 1EAH3 4UBGA 3DL3A 2NP0A 1VQ5I 1MD0A 4B44A 3JCIA 3OSGA 3H1WA 1Z0HA 2RG4A 1XDUA 3AL0B 2CW8A 2FRHA 1EH8A 2RR12 1YIPA 1X50A 1Z1DA 4XN0A 2CG4A 5DABA 1UZ0A 1PO21 5I0UA 4NQWB 4JGZC 2ZBJA 3BIWE 3K4AA 2VXJA 5LK5A 4E2SA 3D1NI 1W9TA 3K9TA 4OUEA 3WG9A 2D1HA 4XILA 3B73A 1RKTA 4BIOA 4M3CE 4AEKA 1AU7A 3POWA 1TNSA 1H4GA 1UNBA 1W6NA 3KP3A 4RGUA 1S72I 5CQEA 2W46A 1RITA 3FZVA 1IDZA 1E2XA 3GHMA 4QKDA 1AWCA 3H50A 2KZGA 1A04A 2XB0X 1YOVB 5F6FA 2ZX2A 3K4DA 1HV1A 2PMHA 5K7FA 3QPTA 2R4GA 1GXQA 3WGIA 3NARA 4HBLA 5HLGA 2HS5A 2HFHA 4FPHA 1G9AA 1Z78A 5FAXA 3OYIA 5JLVA 3HWJA 4XQDA 3FBMA 5FKLA 5B2GB 3LDBA 2YPRA 2F5FA 2HWD2 3JD72 1K45A 4B43A 1RESA 3EUAA 4MSVA 1ASJ2 5J47A 3JD73 3S5AA 1FYMA 2W84A 1FX5A 2A5ZA 4BMEA 4V2VA 3C2HA 4WZFA 3LSTA 3G2BA 2WS93 2H6CA 3RI8A 1R5HA 4MV2A 1UQXA 1PO23 2ZHMA 1NQJA 4RA0A 1UU6A 3BPSA 5EIYB 4COYA 3Q8AA 4M9XA 1EKEA 4HZFA 2R072 1DBNA 1AR93 3H8OA 1MBJA 4OI2A 5JVGF 3MW2A 1OLRA 4ZPIA 2GOXB 1ZELA 4HEA2 3ACLA 4WX9A 3AL6A 1R58A 5DDGA 2DDUA 4NVPA 1UPIA 1ENQA 1QJX3 5JXHA 1IO2A 1VMHA 3DGTA 3ETQA 3P6BA 2LF7A 5FYHA 5IVJA 2IXCA 2FQ4A 4AVSA 3WDXA 1O7FA 4BHBA 4A5MA 3QYFA 1GDTA 3EMRA 4NC7A 3PNVA 3OJBA 2FOKA 4YNIA 2WNVC 1R1A1 1WH5A 2VXDA 2RS53 3M3IA 1NY71 4NE9A 4JCKA 2DYCA 4CP9B 3NQOA 2PQSA 1MEC2 2XLFA 3N3HA 3SH4A 3PO2J 4BB3A 4Q4W3 4I98B 4XW3A 1OURA 1MDMB 2KPMA 1B72A 3BPZA 4DIQA 4A6SA 1JU3A 4BKXA 3S2DJ 2KJCA 4YPJA 4P1WA 2AQEA 5JHFA 5FPXA 4CCOA 1EV11 2AACA 1IPSA 4A5NA 4N43A 1OI6A 1LU1A 4Y17A 1RUC1 1QRYA 1TEIA 2V5DA 1E5SA 3NQHA 1H8TB 4XKBA 4QGNA 2KA3A 1QGPA 5CVJA 3K51A 4IV1A 2WSUA 5KC6A 2VBZA 1QJFA 4OIOF 1UY1A 2B9VA 4FO9A 5I93A 3SDBA 2P1BA 1XX5A 1HRI2 1PNFA 1QVUA 4V2FA 2DMTA 5FJKA 5JXGA 4M73A 3W2AA 2VZUA 1UY0A 3QRFF 1BC8C 2DMUA 4XUTA 4QPGC 1GZ9A 5A7PA 2W00A 3Q8EA 4BJ0A 2HJIA 5IOZA 4AHZA 3GJAA 1ENSA 1LNSA 2ADUA 2HH9A