2HKXA

Structure of cooa mutant (n127l/s128l) from carboxydothermus hydrogenoformans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKLLLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based hypothesis on the activation of the CO-sensing transcription factor CooA.
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Transcription regulator
molecule keywords Carbon monoxide oxidation system transcription regulator Coo
total genus 62
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hkxA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hkxA01
4U7BA 3H3UA 1QWRA 3I53A 4FX0A 1K78B 1YFWA 1D8KA 1UHMA 3CEWA 5F64A 2O3FA 2KKOA 2Q1ZB 5K1YA 4IEVA 4U0WA 3RIRA 4ENMA 2ACJA 5FDBA 3WGIA 1O4TA 2O6GE 3TOBA 1QXRA 2DW4A 2UY8A 5D5UB 1NXMA 2ZCWA 1BIBA 4XLPF 2VBXA 1R5HA 2A6EF 3JTGA 3HSEA 4KN4X 4D7SA 3B73A 4B09A 1P6RA 1MJ9A 4PGGA 2LSOA 5A2QZ 1LDDA 1FSEA 3JTHA 1MZBA 3BP8A 1FBSA 2B8MA 3QACA 4A0YA 2DPUA 1LVAA 4KICA 1XRUA 1HKQA 1XGOA 4KMFA 3OOPA 1U5TC 4HN1A 4ZYGA 2MH9A 1J5YA 4Z2YA 2R7DA 1K78A 4Q0VA 1GQGA 3MYXA 1BI3A 2M30A 2XAQA 1S29A 1XB4A 1L3LA 3FFQA 4A5NA 2PMUA 1R1UA 3CUOA 1E17A 3QU3A 3HRSA 3B02A 4XFGA 1D5VA 1PM7A 2HTJA 2Q0OA 2IXCA 2OZJA 2P5KA 4PIZA 3KFWX 3TO9A 3I59B 4CO8A 3I4PA 1IXRC 1HW2A 2EFPA 1EY2A 4U0YA 1B1BA 1YYVA 1I5ZA 1Z6TA 5BPIA 3DEUA 2HDCA 1HW5A 4UNOA 3K1MA 1DP7P 3NEUA 1OKRA 3G73A 1HSTA 3SHFA 2D45A 4FX4A 2XAHA 2FMYA 2XKOA 1EH6A 1KQ8A 1LKNA 3GFMA 5I93A 3PQKA 2QDRA 4HSJA 1P92A 4K8FA 4RB1A 2B5HA 4G7OF 4G9YA 2PBIA 5JR7B 3O6BB 1J59A 4EWDA 2P5LC 1Z05A 2R7FA 4KFCA 3MWMA 3GW2A 4UVCA 1SQ4A 4BYYA 1ZARA 2CYYA 4UUVA 3FHZA 4MV2A 4LLOA 3ABUA 4XFHA 3I59A 1JHFA 1Y9QA 3GFJA 5ICEA 3TDUC 5HS9A 2A69F 2IA0A 3V7RA 4OIPF 1F9NA 3O2PE 3I5UA 5DDGA 1P2FA 3GYHX 3UKNA 3U2RA 3TNPB 1TNTA 1S7AA 1YLLA 1FBUA 3ETQA 2Z69A 5E8GA 4J1WA 3V7SA 3HOSA 1LQ1A 2IPQX 2GIVA 2M5WA 3V4GA 4P55A 2H6BA 5K5QA 1LB2A 2XROA 3ZP5A 2DPDA 4XFIA 4K2EA 4XF4A 4S05A 4HF1A 5JFRA 1XMAA 1W7PA 4NVPA 4M9XA 5F1RA 4GO1A 4EWAA 1AOYA 1QNTA 2PAEA 2M87A 4UHTA 3E5XA 1G3TA 3PLQA 3L09A 3F8CA 2D1VA 1IPJA 5FLJA 2K4BA 3GEZA 2XHKA 3MEXA 3IRRA 2DU9A 4IRHA 2IXLA 5KVRA 2HEOA 2VBYA 2ZO4A 2ATFA 3ZDSA 3OF1A 2LDUA 3REOA 1W7PD 3SCGA 2Q0AA 2QQBA 1W4MA 1IRFA 4IEPA 3ZMZA 2MA3A 3AAFA 2FBIA 5KHKA 1S6LA 3HHHA 4IPAA 4IERA 3HYIA 4M73A 3IIAA 2D1HA 3DQVC 1EH8A 3ML6A 3F8MA 2E1NA 2K7LA 1ZG1A 1LDKB 1IXSB 2LF8A 3GYDA 1I6XA 3BJ6A 4IRIA 4L18B 4ASNA 1RUOA 2Z99A 3MPBA 1YLFA 1GVJA 4WZCA 1YW9A 2KXLA 3M1EA 3WGGA 1B6AA 2CWEA 5D4RA 4L5IA 1IN5A 4L5JA 2V09A 1ZZ8A 3EBRA 5K5RA 4M72A 2PHLA 4EJOA 2IXHA 4L0YB 2UYAA 2BE5F 4LG0A 2HKXA 1F1ZA 4IF4A 4MTEA 2A07F 3H7JA 4IEUA 2ESHA 4DINB 3LFKA 1CX4A 2E7XA 3EQLF 3T5XA 1QZYA 2KRFA 2KIFA 2V1UA 1IXCA 3TNQA 4EJUA 4QWQA 2FA5A 3S7IA 1PDNC 2WWYA 4EVIA 5LGTA 1R36A 1CAUB 5FFXA 4XFAA 5K5OA 3SCHA 4XF1A 3KEOA 5LGNA 5E1ZB 1ODDA 1UCRA 5JSRA 2O61A 1REPC 3G7DA 1HQCA 4ZZDA 4R1HA 3TQNA 1H9GA 3ZQ7A 4AVBA 1IF1A 4M9ZA 3H1WA 3RNSA 3E5UA 3RTRA 4XBFA 1T38A 1BJAA 2IXJA 4AVCA 3FHIB 2NYXA 3LWFA 4UXNA 2W57A 1EPZA 1QO0D 4I98B 5I8TA 2XLAA 1YW7A 2XVCA 1J2XA 5BPXA 4I09A 2UXNA 5LHIA 2Q30A 3D5LA 3QU6A 4EM1A 3WTSC 1FT9A 1J3PA 3J81Z 3GF2A 2MHFA 3JAMK 4AWXB 3IWZA 1B9NA 2MC3A 1H0MA 5J3UA 1J9IA 3TO6A 1J7KA 4DNCA 5L3CA 2IA2A 3FMSA 3HRTA 2HGCA 3PVBB 2Z2SB 1EYBA 2F4PA 4XF0A 2PHDA 1T6SA 3KP4A 3I58A 1PP7U 2O1QA 3TDZC 2DI3A 2EV6A 1QZZA 4CXFA 1O7LA 2NAZA 2QQ9A 3WTTC 1XDSA 1PMIA 3ST7A 1LEAA 3QAHA 3IKVA 4QGNA 2GZWA 2L3DA 3QPTA 4IEZA 5K8SA 3QP5A 5D1IA 2V79A 4YARA 3IDCB 5BV6A 2GQQA 1HBXG 2DK8A 2V1DA 1ZG3A 3KMHA 3BPXA 4A0XA 5JR3A 4GXOA 1FOKA 3CO6C 4AVPA 5FQ0A 4EMSA 2ZBKA 1ZRFA 3VHRA 3PQJA 2GC2A 4O9EA 2GC0A 4Q0UA 1FX7A 2QM3A 2VONA 2DT5A 5AONA 3TO7A 4BH9A 4BQAA 5LHHA 3LA2A 2FOKA 1MDMB 1KA8A 3NSTA 5CADA 1QGPA 2FNAA 3K69A 5BQTA 5BMZA 4HVRA 3IDBB 2PN6A 1ON1A 4E2GA 2H94A 3MZYA 3LSTA 3K1NA 3RPQA 2FBHA 3FJSA 4HVOA 1QBJA 4OOIA 3C3WA 3K9TA 1XCVA 1P4XA 1RTVA 4S04A 2EVXA 4IVNA 3BJAA 3F6VA 4NHJA 4Q5SF 1O3TA 2VECA 4ZU4A 3HQXA 3KGZA 1F4KA 2MLGA 2QQAA 2H09A 2G9WA 1VP6A 1WA4A 2BNNA 5LBQA 2PMHA 5J6XA 3FXQA 3BPVA 4HLTA 4HF0A 3WTVC 1X7NA 4OIRF 1H9TA 2QZ8A 4AQ6A 3FWEA 2K9ZA 2VOPA 4ZH4F 4CGZA 2UXXA 5L3BA 4M71A 4CICA 4I0AA 5CVRA 2FQ3A 3E3VA 5TRDA 3WW3A 1I27A 4BHBA 1MKMA 1WGPA 5AIQA 2GC3A 4HYEA 4WK8F 4I0BA 2EA2A 3QP6A 1F5TA 2MPFA 2FMLA 4WXCA 3F72A 3IKTA 3QPHA 1DZTA 2X4HA 2ADUA 5H20A 1KQ0A 3GFIA 1ZRDA 3BWGA 4EJVA 5T3NA 2XV4S 3ELKA 2VC0A 2QJVA 4PIXA 2ETHA 1HXDA 1T98A 5FGMA 2DCTA 2C6YA 4XETA 2F2EA 4HV6A 5I0UA 3H92A 1DPRA 1ZH5A 1SFNA 3E5QA 4XFFA 3K1PA 4RB2C 5CLSA 4LEJA 1U6GA 2BEOA 2P5VA 3CDHA 2VC1A 3D0SA 3R6SA 4YFNF 1CAWA 4MEXF 4CHUA 1B4AA 5FPXA 4O5VA 4KWLA 3M9AA 1IZ1A 1B59A 3BB6A 3HRMA 4Q0QA 5J48A 4LTAA 2L01A 3BJOA 3KGLA 1FP2A 5H6QA 5L3GA 1SFXA 1KU3A 2UWMA 2H27A 1NHAA 3TGNA 4ETSA 1DPUA 4F8AA 2EFNA 2DLLA 4OINF 1SD5A 2OZUA 1X8MA 1LJ9A 1FBQA 4Q0SA 2DAOA 4JBAA 5I0TA 5HS7A 2F5FA 1T39A 3CJXA 1ZHFA 2Q4SA 1FC3A 3FM5A 1WKMA 4F7ZA 3PFIA 1DGWA 1MD0A 4M6YA 3OTFA 3MZHA 4A2UA 1UIJA 5LGUA 3WW1A 3BCWA 3FMRA 4WCGA 4IEWA 4BIFA 2EK5A 1RI7A 5LEKA 1X82A 1CAXB 1V4RA 2DFIA 2EFQA 3CLOA 2QWWA 1J1LA 2XL9A 3ZPLA 3USSA 4N0BA 5DUKA 3ZMSA 1YS7A 2CV6A 3BY6A 3MQ0A 4L9NA 2V1XA 3PNAA 3HTUA 3SXWA 3CUQA 4LLGF 3FZ3A 1HW1A 3WG9A 3I64A 1IAWA 1NE4A 1MGTA 2G7UA 3CF6E 5LRSA 1ZNPA 4AVAA 5BUVA 4AXOA 3JSPA 4EM0B 3SFZA 2ZMEA 4P9FA 3EQEA 3HIFA 2OZ6A 4UXAA 2ISYA 4EM2A 2ESNA 4ONUA 2F5EA 2XIGA 2LKPA 4KL1A 2ZJ2A 4KN7X 4A6EA 3KCCA 2OPKA 2HKOA 1TW3A 2DTRA 3F8FA 1VTNC 5JAXA 3ACLA 3GZ6A 4HBLA 3SQNA 3GO5A 3EO6A 5E8IA 1YHFA 4JTNA 4I7HA 5ED4A 3QOPA 3VOEA 4ESFA 4Y17A 2EJRA 2VBZA 3ZN1A 1XDUA 2VBWA 3RKYA 4GGGA 2MBFA 3IWFA 3I0TA 4YFXF 1UIKA 3O3KA 4A0ZA 2L54A 3MDPA 1TQPA 4XEZA 3L2CA 3BALA 1X3UA 2QENA 2QVSB 3IBMA 1YFHA 2STWA 2HR3A 1BI1A 2FE3A 1QQIA 1NE6A 1EP0A 2F5CA 2RKHA 5AVPA 2K0GA 4XF3A 4N9HA 1A04A 3E6DA 1XD7A 4RB3C 2RGVA 4IHSA 1TLHB 4OLLA 1ZRRA 4UV8A 3S0MA 2QNKA 4QMAA 2E1CA 2A3SA 1U12A 5C6CA 2FXAA 1IN7A 2K02A 2CSOA 3U9GA 2DQLA 3KE2A 2HTSA 4G6DA 4EJTA 2ETEA 2Z9OA 5HDGA 4CDGA 4D7TA 3M3IA 1J0RA 1NYWA 4I2OA 2A68F 2EFOA 5FD5A 2UY9A 3GUDA 4EWEA 3TKYA 5KHHA 1BM9A 4MH0E 4WBBA 1USSA 3U11A 2P6SA 3FXUA 1ZG5A 4G8XA 2M45A 3KP7A 3V8JA 3R0JA 4KA4A 4QXKA 3SCFA 3F8NA 1KYZA 1XSDA 3CUQB 1JUHA 4LMYA 3LAPA 2Z33A 2BYVE 3IHUA 4L9JA 5FLIA 5D5WB 2DBBA 3GFLA 5EEHA 1TTYA 5DD4A 2W85A 2QBYA 4HSLA 1BI0A 1J58A 2STTA 3C18A 4AIJA 3EJKA 2HZTA 5HI0A 1G3WA 1BOAA 1Y0UA 1L3JA 2WV0A 2QLZA 4O6JA 3SXYA 5ICFA 4QGMA 1H1IA 4FAGA 2E7WA 4J1XA 2OU2A 1K6OA 4LUMA 1RNLA 3CL1A 1BBYA 3E6MA 4PGHA 5BS6A 1U2WA 1R1VA 2ZKLA 1ZAOA 4RGSA 1ZX5A 5FQ0B 1TQ5A 2YSRA 1XE8A 1FSHA 2P6TA 3L2HA 5I0RA 4G6QA 3KP6A 3UKTA 1SD7A 1WQ2A 4YNIA 3U10A 3WW2A 1UFMA 4LLLA 1GXPA 3IL2A 1CAWB 4U0VA 1CGPA 5H6RA 1NZCA 5CVJA 3IRQA 5LHGA 1GQHA 2QYOA 3J81K 4KMUX 5E1XA 3VB2A 3L7WA 3M8FA 1RZ4A 1Z1DA 5EEGA 3CLPA 5JSPA 4PIYA 3MFKA 3BZ6A 2ZNZA 2EAAA 2VODA 4IJAA 3F22A 4B8XA 2MD5A 3M8EA 4HX7A 2K4JA 1EV7A 5KBFA 1S8NA 1XMKA 2OD5A 1ZZ7A 2GA1A 3FMQA 1TW2A 2Q8KA 1YUDA 5IT9Z 2XKPA 2HWVA 4WF2A 5HLIA 3MCZA 3ISPA 1JE8A 2AXLA 2IRFG 1ZVFA 2GXGA 2IVMA 3OCPA 2CQKA 1XSVA 2X0LA 3GWZA 4U7DA 4META 1DZRA 4MHGA 3GXOA 3G3ZA 4R8HA 1KQ9A 1XGSA 2ZKZA 4L9VA 3GLXA 5JCTA 5J8CA 3WTYC 2H0VA 1ZLKA 2LNBA 1KYWA 2JT1A 4XSZF 2NNYA 4EGYA 2PQ8A 2Q2EA 6PAXA 3WU1B 2KIUA 1ZZ6A 1U5TB 5TJJA 2HQRA 5KHGA 2CFXA 1LRHA 1LEBA 3UKVA 4LUKA 2HYGD 4YIFA 2V6CA 4HZFA 1ZYRF 4ON0A 5FLXK 2VE8A 4FHTA 4KIGA 2D93A 3V8KA 1SMTA 3BOQA 3E6CC 1FXZA 2AS5F 3F23A 4QX5A 1MDMA 2VPVA 1WI9A 3P9CA 5D5XB 1KU9A 1ULYA 3HTSB 2L4MA 1UHWA 5D8LB 1T0FA 2OA4A 2VN2A 3DN7A 5EFUA 2PI0A 4ORFA 1FP1D 1WWXA 4HDVA 2FRHA 4LK1F 1SFEA 4KYWA 3GBFA 5E18F 1O5UA 4H0EA 2DK5A 2LF7A 3RI4A 5BY5A 4HLXA 2O0YA 4HF2A 2P7CB 2EB7A 1SMYF 4L2NA 3HRUA 1IN8A 2NNNA 3LAGA 2VE9A 1XE7A 1G3YA 3WE3A 5CVUA 3E97A 3ROUA 4RGRA 2HFHA 2VT2A 2FBKA 2XASA 4QM9A 1BN5A 3RYRA 5LEJA 1O7FA 1OPCA 5FB2A 2P4WA 3K2ZA 4XFCA 3T0YA 3P9IA 2IP2A 5ICGA 1ZN2A 3KETA 1ZREA 2OQRA 4ZYDA 4G7HF 3H3ZA 2P8TA 4U88A 3DPTA 4FAHA 2F5DA 3RZZA 3R61A 2VOOA 2UYBA 2QCSB 1RC6A 2XGXA 4KWKA 5ILSA 2FNPA 4HA8A 3ECOA 5D4SA 3S7EA 3FZVA 2M8EA 5KK1A 5HS8A 1DDNA 4HAMA 5J8FA 2D5HA 3WE2A 4MUVA 3J80K 5CYVA 2K86A 5I8YA 2A6HF 4A6DA 2JPBA 3ULQB 5A2QK 1SFUA 3NQOA 4O9GA 4CYDA 1FI2A 2GC1A 4BHCA 5ILUA 1K79A 4MEYF 2C0ZA 3RYPA 1ZZBA 1Y3TA 1V70A 2PFWA 4IHTA 4R52A 3ABTA 5DD8A 1YG2A 2I45A 5DCMA 1TBXA 4YYOA 2O03A 1YWKA 4PZJA 4IRGA 2A5YB 5JHUA 2IT0A 2G7HA 3D82A 2GWRA 1YTYA 4Y15A 1R5GA 1W5TA 4HV5A 4MGZE 3MAJA 2EA7A 2J5OA 3HHGA 5E1WA 4LGWA 4ZYHA 1XN7A 2JPCA 4X6RB 3O14A 3WODF 5E17F 1OYYA 4D0PA 1L0OC 2L02A 4LLNA 4TLFA 2CW0F 4LB5A 4AIKA 1BIAA 3D0JA 3M7GA 3KP3A 1Z9CA 3DXJF 3EYYA 5E16A 3LOIA 1BI2A 4JQFA 5D6FA 4L0ZB 4IEOA 3WTXC 2D40A 3U1DA 1J3RA 1WSUA 1YW8A 4QLCU 5IT3A 2XLGA 4ZU5A 4P96A 3I71A 4MGYE 1P4WA 3OD0A 1IUYA 4WXHA 2IW5A 5DYMA 3H1MA 3NW4A 4HN0A 3I54A 5LLQA 1SAXA 4MX3A 4HX4A 2KJBA 4Q4ZF 2MH2A 5CVVA 3T8RA 4JV4A 4JTOA 4IESA 1RL3A 1SD4A 4KWJA 3R4KA 2J5PA 4ZU7A 1XCBA 4LA3A 3M70A 2JRTA 4ZZLA 1LR5A 1IW7F 1UD1A 3RKXA 4E2SA 1HKSA 4LK0F 5DCMB 3BPZA 1G3SA 5F6FA 4IETA 3EDPA 2Y0MA 2FQPA 3J80Z 4P9UA 2MLKA 1YQAA 2NS0A 2QBYB 2V9VA 2CAVA 4XFBA 4M6XA 2R3SA 2O8XA 4RD7A 3CJNA 3EHKA 5HOOA 4EV0A 4ESBA 2XLFA 1OI6A 2YX7A 1D3YA 1E2XA 5D5VB 3KSCA 1R58A 1YO5C 2D5FA 2GXBA 1QXJA 2HS5A 5E1RA 4IEQA 2FEZA 3H9AA 1H1MA 4HOBA 3K0LA 2PAMA 1O3SA 2P7VB 1YIOA 3V7CA 3S2WA 1O5LA 1CAUA 4MGKE 4LD5A 3WW4A 4GYIA 2XAJA 4UBGA 2EFWA 5HDKA 2OAZA 5FD6A 2PEXA 4YIIA 1ON2A 4BHPA 1DGRA 4GULA 1YFUA 5FFZA 5ILVA 5FO5A 1CAVB 1ZGAA 4ENKA 4EQQA 5HVQC 5D6EA 1T2KA 3H8UA 2QUFA 2PAKA 3N97A 1RIOH 1W7PB 4M9SA 4H7LA 3LA7A 3N4MA 1WRJA 4YSFA 2COMA 4NQWA 1IRGA 1UCXA 2EV0A 4OU0A 3OGJA 2Y75A 1TQIA 4RGXA 1U78A 2KJCA 4EGZA 5L3EA 2CG4A 4MGRA 2PTMA 4HX8A 1BC8C 4Z07A 2PFBA 4M74A 1D8JA 4MTDA 2FSWA 4OMYA 3DP7A 4YRDA 4N9IA 3TOAA 4IXAA 4DQ2A 1WLTA 3FE5A 2HQNA 2VQAA 1R7JA 2Z5UA 1U3EM 2BBYA 3ZMDA 5LRRA 3KLNA 1X8EA 2WFPA 2M1BA 3J7AO 2RC4A 5IT9K 2ZMEB 1HSJA 5L3FA 4Q47A 5ERIA 2GAUA 1SD6A 3P9KA 4KIFA 2HOEA 1MJAA 3FF5A 4RS8A 5D8KB 4I02A 4Q0PA 2IA1A 3WTWC 4EJWA 3RDIA 3DL3A 2XRNA 1I1SA 2N7GA 3ERED 2MNGA 3FM3A 3VEPA 3VODA 4R79A 4WX9A 4O3MA 1Q43A 1O3RA 1RUNA 5HLHA 4RGUA 4WXDA 3CO2A 4CZZA 1OMIA 4ENNA 2RV8A 3Q5FA 4AQ2A 1FYLA 1R1TA 2DQRA 3CTAA 1C0WA 2CGPA 5E20A 2W24A 3DV8A 2PQQA 1LDJA 1ONVA 3WTUC 4KU8A 3F6OA 3NRVA 5BPDA 2JZYA 1Z91A 2WC2A 4G7ZF 3JW4A 4GCVA 5KHIA 3EETA 3OV8A 3ZMVA 2XUBA 1GHCA 2HYFA 3RYKA 4HMZA 3LZZA 5KHJA 5JVTA 4I01A 4A5MA 3SMHA 2Z3YA 4UV9A 1PUEE 1Z7UA 1Q3EA 2CO5A 3SZPA 1XSXA 4KNYA 5I8SA 2JTVA 1UPIA 4ZYEA 3ZMUA 4ENJA 3GZ5A 3HSRA 4Y13A 3BDDA 3VFZA 5J7MA 4XLNF 3WGHA 2PJPA 1FNNA 1U8RA 4IEYA 1OFNA 4WWCA 3L9FA 3I7DA 1J3QA 3W6KB 5JSOA 2BNMA 2ZFWA 5CVIA 3C7JA 4G94A 3HUGA 3U0ZA 5DEQA 3NVCA 5CU1A 3JAMZ 3ELNA 3RPUA 2K27A 2YX4A 1EH7A 1PP8F 4Q48A 4XRFA 4RB0A 4L11A 2OYZA 4LJZF 2P17A 3JZVA 3F3XA 4KDPA 2ET7A 5DUIA 1FPQA 4LG0B 2HJIA 1OD5A 1KU2A 4OMZA 4PDKA 3CO7C 4UVBA 2L4AA 4HQEA 4OFGA 4UVAA 2WTEA 3QRFF 5FLHA 5FLXZ 4L9TA 1FY7A 1Z6RA 3LA3A 3JSOA 5BOXA 1CF7A 1G4DA 4MGIE 2NRAC 1TQMA 2ZXJA 1V3FA 3FXRA 1FWZA 5HLGA 3E6BA 1RGSA 1K7AA 2ET1A 2DO7A 1W5SA 2RNJA 3LQQA 2EWNA 3Q9SA 1FYMA 4PJYA 5FCCA 1BC7C 1JHHA 2W84A 3ES4A 3KP2A 3HT2A 2PLYA 2B0LA 1STZA 1P4AA 1CAXA 4X6QB 2RVCA 2A61A 4GYGA 2D2WA 3L00A 1XGNA 1VR3A 2TDXA 4XSXF 3COAC 2XAGA 4LULA 2GH2A 4WVZA 4RAYA 1ZLJA 3WU0A 4IEXA 3LQRA 4HQMA 4HBNA 3EYIA 2JSCA 1J75A 3H7YA 3NL1A 1KU7A 1MJBA 1XGMA 1ZZ9A 3DPLC 5FPZA 1USTA 4OIOF 2EV5A 1ZRCA 4MNUA 5ICCA 2PYTA 3C3VA 1CF7B 4BNCA 1HKTA 1FZPB 3C1DA 4HLYA 1R00A 3BROA 1TNSA 5AIPA 2BV6A 2PA7A 1AWCA 2Y48A 3GX4X 4AIHA 1YS6A 1ZZCA 4UBHA 4FT8A 4MZUA 1OR7A 1QPMA 2EA4A 1KGSA 5EZWA 3WTZA 4OIQF 1LNWA 5DCFA 3F8BA 4KIBA 3DKWA 4E70A 5CJ9A 4P5OA 4MQVA 3ZN0A 3T1BA 2GU9A 1FLIA 2BGCA 4AD9A 5C8WA 1R22A 3T8TA 4KUMA 4Q29A 5I91A 2BNOA 4YFKF 1I1GA 1U5TA 2GA2A 3KLOA 2VXZA 5I0SA 3FX3A 2YPRA 1S7OA 3R0AA 4KT5C 3LWCA 3HOTA 2W25A 5DV5A 3NJZA 1FYKA 3EUHA 1R23A 2FU4A 3KZZA 4LA2A 3BU7A 2VT3A 3HSFA 3RKWA 2IJLA 4LB6B 1IN4A 4P9GA 3DF8A 1OYWA 5L3DA 1UB9A 4BAYA 3Q9VA 4MQ9F 3H1YA 2E9QA 4A12A 1JXSA 4NB5A 2XAFA 3KZYA 5JI6A 2O8QA 3CUQC 2Y0OA 3V8LA 2ISZA 2XL7A 1SEFA 2IXIA 3ES1A 1G6NA 3KP5A 1YFXA 4RAZA 1JGSA 2IC1A 2OBPA 1GXQA 1S3JA 2PG4A 1OYIA 4FBFA 2FF4A 1O3QA 3NKTA 3GVAA 3SHRA 5BXXA 2RDPA 3R60A 4ESJA 2UZKA 2OA2A 4Z82A 2H6CA 4QGLA 3ZMTA 4JVAA 1VJ2A 4HDUA 2RN7A 2ZNYA 3SZTA 5HDNA 1ZGJA 3W6JB 2OQGA 1IPKA 3IC7A 4PCQA 4BXUA 3LAJA 4XF9A 2YU3A 2KIMA 3P7NA 1CAVA 3KEQA 4LFUA 2YR2A 4JK1X 4TV7A 4QM8A 2RQPA 2B9UA 3DFGA 1DUXC 4B29A 2QVOA 1QY4A 4I3PA 2ELHA 1YFYA 1Q5OA 4YG2F 3H50A 1O57A 2CAUA 3ECHA 4E2QA 2IXKA 4KU7A 4HW0A 4HVQA 3HT1A 1Q1HA 4EROA 1IN6A 1B9MA 1UW8A 3F21A 3RJPA
chains in the Genus database with same CATH superfamily
3H3UA 2XUEA 1G9BA 4BY1J 3I53A 4FX0A 3DPUA 3IIIA 3CEWA 4A3CJ 2Q1ZB 2X09A 2A75A 5H9SA 4U0WA 4RBOA 4GA9A 1DG6A 2VXJA 3AC0A 4XKVA 3J7LA 1LGCA 2R7EB 4O65A 1QXRA 2UY8A 1BEV2 3HM5A 2VOWA 5IVBA 2VBXA 2GP5A 3K46A 1KS5A 1FJLA 2A6EF 1BW6A 1J09A 3JTGA 1ST8A 3AJYA 2UWCA 1VBA3 4BJTA 2FD8A 1TNRA 4A3IJ 1SVMA 2VL8A 3T1LA 5GAHJ 4DXRA 1GZCA 3ZYBA 1MIJA 1LDDA 2W2IA 5H9PA 1FSEA 2Y38A 2W94A 3HC7A 1OA4A 1JOBA 4R9CA 3CESA 3H1CA 4LBOA 1G86A 1XRUA 3GZAA 5IYBJ 4XRMA 2MH9A 1J5YA 1K78A 4A44A 4Q0VA 2GM4A 1XC6A 3ZFFC 5IVJA 4LKDA 5FO9B 3FFQA 3CMYA 1R1UA 2HWE1 1JYTA 1RHI3 1V9U2 5F04A 5FYHA 1SCRA 1PM7A 2HTJA 2Q0OA 2OZJA 4YGBA 4CDXC 4IX7A 2YV8A 3BG3A 1HRI2 1GT0C 3I4NJ 1IKQA 2OS2A 1AX0A 2WADA 4M0HA 1DYKA 3G4SI 4YVSC 2G4IA 5JWPA 1R6RA 4F91B 4C30A 1R4NB 1HSTA 3GLLA 2D45A 2D6KA 4MO7A 2WABA 2DCKA 4J00A 3A0BC 5J96B 4G9YA 2W47A 2PBIA 3DPRB 5JR7B 1NCRC 4UW4A 1DP3A 5CKMA 1HXS2 5FYMA 1LUJB 2QQMA 3MWMA 1WJDA 3POWA 3DU5A 4I30A 3ZMNA 4YM0A 4BYYA 1BR1A 4MV2A 4LLOA 5FP9A 2F6BA 2ZX4A 4DFSA 2JK3A 5E3NA 4KT6A 4EE2A 1Z3XA 2RS51 2SLIA 1NA1B 5HV4A 1Y9QA 1E57A 2WAAA 3TDUC 4AFDA 2W7NA 3GTKJ 4WV8A 1X2MA 1ZELA 2HDWA 2A69F 1W0NA 2ZHKA 1QHGA 2E71A 1VAVA 4CXYA 1P2FA 4NO4A 3UKNA 5IVCA 3U2RA 1HV1A 1MH3A 3OMYA 3CJIB 1R1A3 4NHLA 4QXHA 2W87A 2VNVA 2XC7A 2QDNA 1A36A 2VASA 4AVTA 2DMNA 4P00B 3DWLE 3V4GA 4OUEA 2R073 3FUQA 4DYRA 3NKGA 3DLLF 3FC0A 3JBG1 4XQWA 2VZ1A 1J84A 5DG2A 5F1RA 3URFA 4EWAA 5F3CA 1BJZA 2VZSA 3OY8A 1IV8A 4UHTA 4GZ9A 2JDPA 2JQ7A 3F8CA 3WUDA 2V4AA 1E3HA 4FETA 4DUVA 4AGVA 2HVRA 4IRHA 3POIA 2IXLA 3FIWA 2HEOA 2WAFA 2ZO4A 4PT6A 1GP6A 3JRFA 3CCEI 1B72B 2AQFA 3CHXA 3OF1A 2LDUA 3SCGA 3OOUA 1W4MA 4UF0A 3ZMZA 3RI8A 5BNOC 1ETQA 4V1PA 1T56A 3HYIA 2WN2A 1C8M2 2D1HA 1HX6A 1A8DA 2B42B 2I2SA 1EH8A 4NIHA 1V6OA 3AZVA 1IXSB 2LF8A 5FY0A 1I6XA 1ZBA3 3I3EA 4IRIA 2PN5A 2FD5A 1RUOA 3MPBA 3A01A 1YLFA 4WZCA 5L9RA 2D6LX 4S2HA 2NS7A 3M1EA 1ULPA 2WNUB 4OI0A 1BK1A 2CWEA 1W0OA 5D4RA 2V09A 4IHYA 3SYTA 5K5RA 2LTPA 5JLWA 2PHLA 4Q1RA 4Q1PA 1X19A 3GZNB 2WZR3 2BE5F 2KHMA 4PJJA 3UKGA 2ESHA 4DINB 4D8MA 2E7XA 1UZCA 3T5XA 1EAH1 3JD73 3TNQA 4AUXA 2V5DA 1RB8G 1W2TA 1ZQ3P 1UXZA 3LIGA 1GFF2 1PDNC 1PHMA 2PJRA 3DTKA 4EVIA 1CAUB 1ONAA 1DIWA 4XF1A 2X6YA 3O1VA 2XWBB 4F3QA 1REPC 3G7DA 4JYKA 4R1HA 3WP6A 1JHJA 2VJJA 3W2VA 4JGZC 2K9LA 2W92A 1BEV3 1FV2A 3LWFA 4JX0A 1QO0D 4I98B 2DCEA 3RCOA 1YW7A 1TME3 1S72I 2KQRA 4LJHA 5ABJC 3PUQA 4RM3A 3WHTA 4RSUA 3AXEA 1QOSA 3WTSC 1U5YA 1GP5A 5DZGA 5DM7F 5ACA3 4IZZA 1R71A 2VG9A 3WV6A 4LK6A 2VMIA 1PYVA 4H4KC 2JN6A 5IFTA 3WSOA 5IAXA 1X1PA 2DWRA 1SLIA 2IA2A 1RUC2 2VZRA 1M4WA 3PVBB 3EUHC 4BMEA 4XF0A 5KWRA 3F0CA 2DUQA 4LE4A 5GTHC 2IUWA 2O1QA 2R5ZA 3TDZC 4FOQA 3BKZA 5DMYA 3MW3A 1QZZA 4CXFA 1PMIA 3ST7A 1X4OA 3OYEA 3HEFA 3IKVA 3HWJA 3ZQHA 1UOBA 2GZWA 4E4DX 3QPTA 2R7TA 2QSGX 3I2FA 5K8SA 2JE8A 4AEKA 3KHCA 3NV4A 2DJNA 1AL22 2RDSA 3QP5A 2RR13 1JOJA 1WMXA 1UU5A 1AHDP 3IDCB 4P9LA 2XBO1 2GQQA 4L5EA 1HBXG 4QT6A 2JENA 2VY0A 4M3GA 2WSUA 3BPXA 4OI2A 4GXOA 3CO6C 4AVPA 2VB6A 1K5JA 4EMSA 2ZBKA 5IP7J 1PIV2 1S2KA 3AYAA 3VHRA 1V6IA 2XAUA 1BA5A 3ZYHA 5EZHA 2CYFA 4D94A 2X8KA 4RR3C 4RLQA 2VONA 3TO7A 2OF7A 5JI7A 3DBLB 5LD2C 3CMEI 4XOPA 5JLXA 2DYSH 5IYDJ 4HL0A 5GZCA 4BQAA 5LHHA 1LOBA 3LA2A 1RUF1 2FOKA 1I3QJ 3W20A 3PO3J 3NV1A 3OR1C 4M0NA 3KB5A 5FP8A 5CADA 1QGPA 2NM1A 2Q8CA 4HVRA 2FJ1A 5BMZA 5C9AB 2PN6A 4E2GA 3MZYA 2R041 1JOPA 3ZXSA 3RPQA 2WB1A 2FBHA 4DXZA 2D6PA 3C3WA 3K9TA 4XLFA 4S04A 4XPVA 4ARYA 1AKHB 2CSGA 1VMFA 3VKFC 1JTXA 4FPLA 3CCUI 2H09A 2JDHA 4OYUA 4L8QA 5D8AA 1BJQA 3ZQCA 2BZTA 5J6XA 4MGTA 3SEPA 1RUH2 3BQYA 2OUHA 1QJY2 2BOJA 2PMWB 1LNSA 1R081 2K9ZA 5CG9A 3A02A 4ITVA 3NV2A 5CVRA 2FQ3A 2WA3A 1BVVA 4QX0A 4UFMA 3WW3A 1I27A 1MKMA 5AIQA 3UGFA 4B4CA 4QX3A 4HYEA 1MNDA 2MEV2 4D6SA 2EQRA 1XNBA 4LKSA 2EA2A 4LO5B 3QP6A 1KJRA 4IE7A 5FIXA 5BNNB 2XGDA 1NLRA 2WA4A 2IXSA 1AA7A 2JA7J 2CGNA 2X6OA 4BBRJ 1TE1B 1QQP3 2B45X 2WNUA 2WLPA 5FGMA 2DCTA 3WCRA 2C6YA 4XETA 1GKBA 2DMTA 5GAEJ 2DVGA 1ZH5A 1SFNA 4RB2C 5CLSA 4QPQA 2O8KA 5M5WJ 3WXPA 2P5VA 3CDHA 3D0SA 1UZZA 4QKNA 3K3NA 4UWDA 3AVRA 4O5VA 2CU7A 4B1MA 4GRIA 4XE9A 4RFRB 4H14A 3JXSA 1RUG2 3H35A 5F27A 3V56A 4LTAA 2L01A 1ZBE1 1JZ4A 1O4ZA 2EAKA 4ZC3A 5L3GA 4KI5M 2H27A 1HQWA 2ECCA 2IVJA 1QVTA 1DPUA 4KWUA 2R7ZJ 3J7HA 3ZYGA 2DFCA 2EFNA 2OZUA 3HNBM 1IPSA 1A6IA 2A6XA 1CVNA 1B35B 1S0BA 5FO8B 5FRMA 4UYBA 5HLTA 1I3HA 3CJXA 3T4VA 1W6QB 2Q4SA 1YIJI 4M3CE 4BQ2A 2FDKA 5DUXA 4A2UA 3OBAA 1UIJA 2GOMA 3KHBA 3BCWA 3WW1A 1JZ5A 3O0WA 2CV2A 1YJKA 4UW6A 2VZOA 1SDDB 2WY7Q 1X1CA 2DFIA 3C7EA 3NAPB 3USSA 2ZEWA 4CUGA 2CV6A 4XMAA 5DXDA 5IOZA 3MQ0A 4E4HA 5C8CB 2BY1A 3CDZB 1D1BA 2NPIA 3AM2A 3EXUA 4R9AA 3I64A 1IAWA 2YY1A 3RG0A 1MGTA 4RL7A 1RUI2 2G7UA 4H55A 3PFYA 5BUVA 1OLTA 3POBA 3VZOA 3EQEA 2VMGA 4NQWB 4U2AA 2ZMKA 5EGOA 2ESNA 4ONUA 1Z21A 1PVC2 2CUJA 2DVDA 4A6EA 4E7HA 4WZFA 1TW3A 1JN2P 3POEA 1UY3A 3RWKX 4D69A 5KXCA 3VOEA 2W08A 3PNVA 5FYYA 4Y17A 4HSRA 3GZEA 2VQHA 1MBFA 1SACA 2VBWA 3WVJA 2ENRA 3K70D 3O3KA 4LE3A 1KITA 4FXKB 1W0PA 4XEZA 1OPMA 1WLCA 4NHKA 5HPOA 1QQP2 1RUE1 3OYCA 1QQIA 2RKHA 1T33A 3HGGA 4N9HA 2OTJI 1BOBA 3ZRGA 1POV0 1TLHB 1PUFA 5JZGC 3AMMA 2QNKA 3S57A 3RZDJ 2A3SA 1AR63 2FXAA 4OHYA 1O4XA 2PQSA 3B5LB 4LHNA 5HCHA 4HPQA 3ZLIA 2AEYA 4YW1A 5JOZA 4EJTA 4P9WA 1WCSA 4R9BA 1LHUA 5IWFA 2EBIA 3QODA 2ADEA 3T0DA 2ZZQA 2GALA 5FJKA 5LZ6A 1S2EA 3THPA 5DAVA 3GUDA 3TKYA 5ABJA 2AO9A 1CPMA 4NC8A 3OG2A 4L0PA 2ZB9A 4YZ5A 2VTXJ 2B4KA 3IV5A 5LWBA 2P6SA 1W99A 4W6WA 1ETWA 2FDIA 3WNLA 3F8NA 2E5NA 3TN93 1JUHA 2WL1A 2WQ8A 4D6RA 2E60A 4GJZA 3K77A 1VIWB 3P3NA 1IC8A 5EEHA 1Q56A 1R091 3VHOA 3KD4A 4HSLA 1UHSA 5HI0A 4IOAF 3VBHC 1BOAA 1Y0UA 1LECA 2WAEA 3TB0A 2E51A 4O6JA 4K9SA 4HK9A 3FL7A 2R7RA 2OCCH 4FAGA 2EILH 1A31A 2VJ4A 2O9LA 4LUMA 4BK4A 1OF4A 3CL1A 5H9RA 2IZWA 4PGHA 4YZ4A 2ZFUA 1U2WA 1R1VA 2ZKLA 3FBMA 2F4LA 1ZAOA 5FP4A 5FQ0B 5T55A 1K61A 2EXJA 3ZKUA 3V0BA 2DF7A 1CWPA 3OL4A 2VGDA 3UNPA 2NP0A 4BQ1A 4YNIA 1IG0A 4BQWA 4W1UA 4LLLA 4MXWB 4U0VA 3H9GA 1CGPA 1NZCA 1YQ8A 5LHGA 1POGA 1IDYA 1Y8QB 1PO22 5E1XA 5EYXA 5KCMA 3T3YA 4CP2A 1QJY1 3M8FA 2A6TA 5E6HA 4OI4A 1S0FA 1YHQI 3N9QA 4DB5A 4B3XA 1DQ2A 3MFKA 4ASKA 3BZ6A 1Z7S2 4IJAA 1LKXA 2MD5A 3M8EA 1PO23 4BCUA 2K4JA 2MD0A 1XMKA 1L7RA 3FMQA 3SISA 3WZ1A 2LY2A 4WF2A 5HLIA 3L2WA 1RXFA 3DKYA 1UMQA 2K9NA 4K1YA 2IVMA 5C9AC 4H2AA 3PUAA 1WH5A 3GXOA 4FO9A 1X36A 5F7UA 2VZQA 4LO7A 1XGSA 5JCTA 3RWNA 3CNAA 1JJ6C 4Q4Y2 1FOWA 2JT1A 1IHMA 1AL23 3WU1B 2XVLA 4XQDA 2Q5TA 2VW1A 5TJJA 2D6NA 1LRHA 2M7BA 1DZQA 3U4SA 3K4BA 1B8IA 3PL8A 1K12A 1D2SA 5FLXK 1WMEA 4BQ4A 4Y52J 4KIGA 2D93A 3V8KA 1G9FA 4QPOA 4XL9A 4MGQA 3Q3SA 3BOQA 1UQXA 3MF6A 1FNYA 3H8XA 1QJU3 3IPVB 1KU9A 1OKOA 1UHWA 5D8LB 1XJAA 1D7PM 4HDVA 2FRHA 3WNOA 5E18F 4Q4Y1 1HLVA 2LF7A 1RUJ1 4ZY9A 1LEDA 1TP4A 5JOYA 2OKXA 1QDCA 4LHKA 4QU2A 1SMYF 4L2NA 3HRUA 4NHYA 5CFDC 2NNNA 2EIGA 3LAGA 1H2MA 5IP9J 5GAGJ 2Q2EB 5B3SH 2WWJA 3N7JA 4RGRA 1LHOA 1V0AA 1W8NA 2LKSA 2PLV1 4ASLA 1PVC3 4HFSA 3RYRA 5FB2A 3RMXA 5T5JA 5L7OA 1IDZA 3P9IA 2ZZJA 4NAMA 1JUMA 2YGMA 1H88C 4ZYDA 3DPTA 1OBNA 4FAHA 2YC0A 3R61A 2QCSB 1RC6A 2XGXA 4PQ9A 5FOBB 1ND3A 1OC1A 3QQAA 2ZGNA 5D4SA 4RS5B 2VQUA 2L9RA 3JB8A 3MBWA 2YU9J 1AZDA 3MO4A 1DDNA 4HAMA 3QCWA 2L5QA 5JOWA 1AR72 5CYVA 3FXKA 3AKQA 5I8YA 2A6HF 2XHNA 4BXSV 1ACIA 3RRDA 3PO2J 5JXIA 4PQQA 3NQOA 4O9GA 4CYDA 4B1RA 5ILUA 2HLEA 2C0ZA 1HXS3 3I2GA 2PFWA 3C2UA 1RRJA 4BQ3A 3WU2C 3KVBA 4FPEA 4PLNA 1GZ9A 3IPVA 4YYOA 3ORJA 2BOLA 1YI9A 4IRGA 2A5YB 3C7FA 1EF4A 1PMJX 3THTA 1SPPA 5HCFA 3AFHA 1YITI 3CCJI 4ZXKA 4D1QA 4LR4A 2GN3A 1P8JA 1XN7A 4O7XA 2ZHMA 3O14A 2XMLA 3DUIA 5E17F 4P9IA 4D0PA 1L0OC 4W97A 1MS9A 1R64A 2YFZA 2EZIA 1UAIA 3MEPA 4GALA 4XC9A 1B09A 3ZM8A 3P5JA 5FZ7A 1OFSA 1BKZA 1DDLA 2D40A 2VMEA 3DKQA 1YW8A 1GICA 2WNVC 4LBQB 4ZU5A 4P08A 4O61A 3JREA 4WM7C 1QZEA 4YZ3A 5DYMA 3H1MA 4PLMA 4HX4A 2J42A 4DJAA 2JVHA 4Q4ZF 4AAXA 5M0TA 3T8RA 3MIHA 2R042 2A3WA 2QSFX 5A7WB 4LA3A 3M70A 2JRTA 3F9KA 1UD1A 4JGYA 4YM3A 2ID3A 5DCMB 3BPZA 3K7AJ 1UX6A 4IETA 3L2RA 2HOSA 1VBA2 2E26A 1UY2A 5IATA 3MIGA 4XNFA 4QPIB 1RVF2 1R092 1W06A 3A0KA 2O8XA 4WM8C 2HWC3 4X8NA 3CJNA 1L7LA 4EV0A 5A7NA 4ESBA 1G9DA 1NG0A 4BLIA 1WJCA 5JIAA 3LEIA 1ITYA 1FEXA 4FPCA 1YO5C 2D5FA 2R071 3M4OJ 3ZYIB 5E1RA 1K4SA 3HR9A 4DEQA 1UMIA 2BXZA 1AL21 1H1MA 2DTWA 3T2TA 1RUJ3 2P7VB 1QOTA 4MHRA 1LE8B 4X6AJ 2JD4A 2HQAA 4GWIA 5FZ1A 4GYIA 1LHWA 5A33B 3DLAA 3NQHA 1COV2 1F5JA 2ID4A 4ZS2A 4FISA 4YIIA 1ON2A 1RKTA 3K70C 1SLAA 1YFUA 2W9XA 2ELJA 3GTLJ 2LS6A 4CPBA 1CAVB 2XF7A 3D5OA 1H4GA 5D6EA 2X05A 1T2KA 5CEHA 5FZKA 3F2ZA 3H8UA 2FUG2 3PSFA 1RIOH 3LQCA 1W7PB 3LA7A 2L9VA 4BIOA 5FYBA 5FZFA 1IQAA 4OU0A 5DUWA 1MNEA 1TQIA 2KJCA 4EGZA 5L3EA 1HC8A 1BXHA 2CWSA 1SLTA 4MTDA 2FSWA 4Q4V2 3QOEA 5C3RA 2RR12 3N9PA 2C5DA 5DZEA 3TOAA 1A34A 5A3WA 3VBSB 2BJSA 5A33A 3HUGB 1HRI1 4UW5A 5GKAC 3ZR8X 3KLNA 4ZTFA 3UNGC 1FX5A 2WFPA 5GLUA 5CAZA 3IM0A 1US3A 4P9JA 2ZMEB 3FBYA 4XMIA 2VW0A 3DEWA 2HDDA 2HOEA 1COV1 3ZFFB 4I02A 4Q0PA 3I56I 2CQ7A 2E1MC 4IEJA 1I1SA 5CNAA 3ERED 2MNGA 3FM3A 1W9SA 1HLCA 4CXWA 4PFOA 3O8GA 2R5YB 1OUXA 4CZZA 1RUG1 3VBUB 1OMIA 4ENNA 2ZXIA 2JDZA 5LASA 3Q5FA 4AQ2A 3QYBA 2DQRA 2OTLI 1C0WA 2W24A 3DV8A 4FASD 1LDJA 3IAQA 3WTUC 4P5HA 4KU8A 3K10A 3NRVA 2EIKH 5BPDA 1Z91A 1Z78A 4GCVA 5KHIA 3MV01 2DTZA 4GH4B 2CV1A 2WBKA 1VBA1 3RYKA 1MMNA 1DGRN 3S3NA 1C5HA 4I01A 2RQQA 4L9BA 2Z3YA 3J8F3 3FMGA 1PZ7A 2JDYA 4KNYA 3SLIA 3RI9A 1VQOI 2D97A 3ZMUA 1W05A 4ENJA 2P37A 4JDOA 3OY8B 3AP7A 2VMFA 3VYSB 2RS31 1GDTA 3BDDA 3VFZA 4AI9A 1W2UA 4K7JA 4XLNF 3WGHA 1H9WA 5J4VA 4IEYA 4Z6YA 2GDFA 3L9FA 4BACA 3WG7H 1J3QA 3W6KB 4DY3A 5CVIA 2KPMA 4G94A 2LFBA 3OYIA 1HRV2 5CU1A 1FYUA 2K27A 1PP8F 4XIDA 1UOJA 1LE8A 2YROA 5C70A 3BG6A 2OYZA 4KDPA 4QPGA 3WQ1A 3H9QA 2ET7A 5DUIA 3K4JA 3ZN5A 1OD5A 5FPUA 4PDKA 2XVKA 1W3VA 4U87A 2L4AA 4OFGA 5JXHA 2C6SA 5E88A 1I6HJ 4OUSA 3LA3A 3JSOA 4A3GJ 2ZXJA 1V3FA 1GUUA 1ODMA 3FXRA 5FWJA 2LD5A 5HLGA 2CDOA 2DO7A 5C3SA 2RNJA 3NNLA 1Y9MA 2EWNA 4TSVA 3UR3C 4S2DA 1FYMA 5B1BH 3JD72 1JHHA 1GBGA 2W84A 4FQGA 3KP2A 1ND3B 1LOFA 4GIQA 1W6PB 1SMVA 3NNJA 1BYHA 4EN7B 3D4KA 1NTCA 3BPSA 2PHTA 1P4AA 4XJWA 4X6QB 3L00A 2LUWA 1XGNA 2TDXA 4XSXF 2XAGA 3J8F2 2R16A 2GH2A 2XJPA 3JRCA 3SFIA 1OLRA 4UT5A 3MICA 2GIZA 5J40A 2WYSA 3BC8A 4HBNA 3CJTB 4XACA 4LBQA 3KPHA 3H7YA 2VLAA 1S0EA 5FKBA 4L92A 5SV5A 3VYUB 4BDVB 1ZZ9A 3ZYRA 3OYKA 3CJIA 1W6OB 3BCBA 3HOWJ 4CUBA 2K3PA 1U0AA 3R4SA 3NWSA 5ICCA 2PYTA 3ZX7A 2HXIA 1DYPA 2R0QC 1D1AA 1X58A 1OLME 1FZPB 3W2AA 5J4YA 2WSVA 1R00A 2JG9C 3BROA 1D0HA 5GJ6A 5AIPA 5IVEA 2WS93 1YIFA 4GD4A 1ZZCA 4UBHA 3NNGA 3ZIWA 2M7AA 1VQ4I 5EZWA 2W39A 5DCFA 1MPXA 4KIBA 1MEC3 3ZR6A 3A0HC 4E70A 2GNDA 2GU9A 1XPWA 2BGCA 1C1FA 2EIEA 2E2HJ 5C8WA 1R22A 1QNWA 4NMIA 2BNOA 3POFA 2QQUA 2A5WA 3KLOA 3K2AA 3HPNA 3J8F1 5GADJ 4XJ9A 2HVQA 3B9IA 3BQZA 5FY1A 2DFFA 2TNFA 4QX7A 1LGNA 1JJ8C 2RM23 3B93A 1TT0A 5E89A 2DCYA 1QU0A 4HSTA 4XAAA 4AI1A 4BAYA 1A5JA 2B9SA 4XHBA 5T52A 4N53C 4P1WA 3KZYA 4CVUA 4X1EA 4AHWA 2Y0OA 2ISZA 3DPRA 3ES1A 3CJQB 3FISA 1NK2P 4FFFA 4CDQA 5FXZA 3TEZA 1FOD3 2PG4A 1OYIA 4B4RA 1X33A 4FBFA 2FF4A 1O3QA 2ZMNA 3NKTA 2BBVA 3PNYA 2NVYJ 4XW3A 4D7NA 3MPPG 3SHRA 3Q8FA 4ESJA 2JX9A 4Z82A 1OLMA 4E7KA 5M5YJ 2RN7A 1WUVA 2OQGA 1IPKA 3IC7A 2YG0A 4BXUA 2ZAAA 1I1EA 2D3SA 3CP8A 5FZOB 2KIMA 4RHV1 3P7NA 4JK1X 4MOAA 2B9UA 3DFGA 2MGQA 1M06G 2W4SA 2QVOA 1QY4A 5F5AA 3BZKA 1YFYA 3H50A 1O57A 3GHMA 2NVTJ 2ZSIB 4HVQA 1Q1HA 4EROA 3F21A 1ENXA 3B01A 1OCOH 4U7BA 2QQ8A 5EG0B 1YFWA 2R7SA 2WY8Q 1D8KA 4BK5A 1TL8A 3JU9A 5FK7A 1JH5A 4E7IA 3OBZA 3RIRA 2O5RA 3RMYA 5FZ0A 3AVSA 2M8GX 5FDBA 3QYFA 3WGIA 5DN2A 1WW4A 4CDWB 2QUOA 2ZCWA 3BCAA 2VJXA 4I0WB 3MFAA 3ENRA 4CA9A 1R5HA 4B09A 1P6RA 4PGGA 2LSOA 3IN9A 1MS8A 3TBDA 4N7UA 5A2QZ 2DMUA 2P6HA 4XBNA 3MD2A 3G1OA 3BP8A 1SG3A 4IV3B 1PNGA 3ZN4A 4FI9A 5JXGA 3T09A 3QACA 1LVAA 2DURA 4KICA 2QQPA 1CR7A 3TMOA 4BE2A 4KMFA 1U5TC 2Y33A 4HN1A 3WP4A 4ES8A 3HB9A 1QJY3 3MYXA 3OB8A 1QH6A 3ZFEC 2M30A 1VRH2 2XQXA 3WG1A 3U1KA 4A7KA 3CUOA 1E17A 2IXCA 3NAPC 3GZTB 5BNOA 3D5RC 3WLUA 3C7GA 3ILRA 5FUNA 2QQJA 5A3NA 4A3ZA 4AI3A 4FTBA 2EFPA 4XKWA 5FLVA 1B1BA 2ZXWH 3E7LA 1YYVA 1TZLA 1I5ZA 1W8FA 4K21A 2L9NA 4YGCA 1XB9A 3DEUA 4UNOA 3K1MA 4NPMA 1OKRA 3G73A 3SHFA 4FX4A 2KRCA 1LPQA 2WAQA 1EH6A 2VZ3A 4ZZ8A 1KFXL 1LKNA 3GFMA 5I93A 4BQQA 3PQKA 2QDRA 5T5OA 5KHDA 3JRAA 2E32A 1W8ZA 4K8FA 3JBG2 3WY6A 3ASOH 4G7OF 1T8IA 2P5LC 1Z05A 2QBXA 2R7FA 2JD9A 2CWMA 3S5QA 1AU7A 4UVCA 3DCFA 2I07B 1ZARA 4UUVA 3FHZA 4YEJA 2ZJCA 1NAEA 1JHFA 1VI0A 1G9AA 5ICEA 3BR3A 1W8UA 1FOD1 2R1BA 1H0BA 1QJZA 2IA0A 3V7RA 5E8AA 3O2PE 1JS9A 5FYSA 2XB6C 1GQPA 2BVMA 2AEZA 4B4QA 4D3WA 4QPGC 1YLLA 2PJRB 5B66C 1BCXA 1VBC1 1CQ9A 1GANA 2WAOA 4M00A 5K5QA 1LB2A 1NOVA 2HXOA 2GXAA 4N43C 4XF4A 4S05A 2EF6A 4QHBA 2B46X 4R9DA 2VQ0A 4NVPA 2VE1A 4Y26A 3WD5A 5EPAA 2ZGQA 3ERMA 2EPFA 2JIGA 4WVMB 2PAEA 2M87A 4XDPA 1EA3A 3JQXA 1G3TA 3I2OA 1KDMA 2ERFA 2D1VA 5FLJA 3LEMA 4Y1UA 3MEXA 3IRRA 2FQ4A 2K9QA 5HCBA 3VBSC 2DU9A 4QKFA 5FAXA 1N77A 4ZXEA 2DA3A 3AFGA 3HOXJ 5FPVA 3AKRA 5FBJA 1Q8OA 3ZKYA 3ZDSA 1GZTA 1IRFA 4BZ4A 4GB33 2FBIA 2W1UA 5KHKA 1S6LA 3HHHA 4D9JA 4IERA 4CCOA 3J7NA 3ML6A 2K7LA 1IJWC 1ZG1A 3WF1A 3G71I 3GYDA 3BJ6A 5JI9A 5F2SA 3TRSB 2DU0A 5FTTC 3PVOA 1VQ5I 2Z99A 2PHXA 4YZ1A 1FTZA 1FAYA 3PM1A 3WF3A 1IN5A 4L5JA 2HBUA 1U5IA 3EBRA 3VBRC 2E31A 5FXXA 1F1ZA 4IF4A 4MTEA 2A07F 3H7JA 4IDZA 3U78A 1CX4A 5K0UC 1C5IA 1QZYA 2KRFA 2V1UA 1IXCA 4R4XA 2F17A 4EJUA 1F2NA 3Q0UA 1STMA 4ATEA 5FMCA 4AOCA 4QWQA 2FA5A 4FE7A 1TMF3 4Z2AA 5LGTA 3JQWA 1UYXA 1R36A 4XFAA 4B4PA 5K5OA 1AYN2 3KEOA 1RUD2 5LGNA 2LREA 4UFKA 1UCRA 1X1AA 5JSRA 2O61A 3A4CA 1WBLA 4NC7A 4CA0A 1YQCA 4M9ZA 5C4JJ 3H1WA 3RNSA 3NWKA 3SDGA 5FLMJ 4XBFA 2MEV1 1T38A 1YQ6A 2NYXA 4C9YA 1KZHA 3KX2A 4NNJA 1WCDJ 1OQDA 4CDUB 2UXNA 5E3MA 3D5LA 1CZVA 5FK8A 3BR1A 1FT9A 4U36A 4Y22B 3J81Z 3GF2A 3GTPJ 1BZWA 2MHFA 2YMZA 5FREA 4HXCA 1W5CC 2VIXA 4UOJA 3S2DJ 3IWZA 1B9NA 3UJOA 4IGPA 4DNCA 4GMP3 3FMSA 4B43A 1X4PA 3HRTA 1W3XA 2HGCA 4QDRA 2Z2SB 2PHDA 2EZKA 3KP4A 2L2OA 3I58A 1RUJ2 2A3YA 1YI7A 4QDQA 3G1MA 1XC5A 2QF7A 1VQKI 2VVDA 5F5QA 1ETVA 4IQPA 1SZBA 3WTTC 3ZXDA 2WZR2 4OAYA 1KD7A 1LEAA 3QAHA 3W6VA 4PJLA 3BN6A 1GYKA 4C3IJ 5F32A 5A3OA 3SNMA 1ERDA 2RS33 2VBDA 2R7OA 3PVNA 2ZS6B 3C2BA 2DK8A 4XRSA 3J9SA 5T5LA 3BTAA 1TVGA 5IUQA 1VBC2 1Q8VA 4LT5A 5JR3A 5FQ0A 1IS4A 3LDRA 1ZRFA 1MVQA 4O9EA 4Q0UA 2GC0A 1QHHD 1YJWI 2BZDA 5GM0A 3B7MA 2DT5A 4YG0A 5GALA 2R0HA 1AR83 1W6NA 1PUFB 4BJ6C 2R32A 2OX0A 1GUIA 2VQCA 3S16J 1WD4A 1E0EA 3IDBB 1ON1A 1UZVA 2H94A 3P1IA 2I10A 3CCLI 3K1NA 1Z77A 2LYCA 2VXRA 3BJAA 4OCTA 4DUXA 4Q5SF 1NUKA 1SLLA 1O3TA 3HNYM 3JUUA 5JMOA 1F4KA 5CA6A 2DDAA 3OYWB 1VP6A 1WA4A 2BNNA 5LBQA 3CLQA 2DVBA 3ALQA 4Q4W3 1X1BA 3SZGA 1X7NA 3Q8BA 5A7QA 2BQPA 1NX9A 4AQ6A 3DEMA 2VOPA 1H9PA 3NAPA 4M71A 4I0AA 4ET7A 2XGEA 2IEKA 4LOSA 1ASJ1 2KP6A 4BHBA 1OOPB 2GC3A 2IGOA 3OGSA 1GOHA 1Y9GA 2OQ7A 4R4ZA 4DZGA 3GBWA 4AE2A 1RR7A 1F5TA 2FMLA 2VJIA 3IKTA 2HPMA 5H20A 1KQ0A 4DBQA 2H1KA 1RUD1 2MEV3 3KV4A 4JP0A 1AR73 3ELKA 4INDA 2VC0A 1T98A 1OVSA 1F4AA 5I0UA 3MLJA 3H92A 2DOFA 4LG3A 4XFFA 3K1PA 2YPDA 3S17J 1Y7BA 3TWIA 3TYJA 2BEOA 3GM8A 3CU7A 3ZYPA 1CAWA 2QA4I 1ENRA 2J22A 1NA1C 3OPTA 5FZ8A 3M9AA 2H0BA 2VULA 3OUHA 3QPSA 2HH9A 1NG7A 5JZGA 1JUSA 1R49A 2W1WA 2J1TA 1IS6A 3O8HA 1JGGA 3Q8AA 5K7PA 4TZDA 2DXIA 3IAPA 1CPNA 2UWMA 4YW3A 4F93B 4DNYA 3TGNA 1HRV1 5FJ8J 2GMPA 5DG1A 1EV13 4PK4A 2RS11 2NQYA 1GOGA 1UU6A 1LHVA 3FN9A 4EATA 4UAPA 4OINF 4V2WA 1MBJA 4SLIA 2HEVF 1WCKA 1X8MA 1LJ9A 2JUCA 5C3QA 4JX4A 4DGWB 2FDGA 4BUPA 2DAOA 4JBAA 5I0TA 1DHKB 5HS7A 2NLRA 5LBBA 1W8OA 2FCVA 1XPXA 4ABZA 1ZHFA 4E7JA 1AXKA 1OUSA 3PFIA 2MYSA 1DGWA 1MD0A 4XORA 4XKCA 2BY2A 3FMRA 4ZKTB 4M6VA 1S9HA 4LBLA 4WCGA 1AXYA 1SBDA 4IEWA 5F08A 4BU2A 5DUVA 4CPBD 3AL6A 1JUPA 2EK5A 1O59A 1RI7A 1QJU2 1OQEA 2QZ2A 1VQ9I 1CAXB 1V4RA 3AP5A 2EFQA 1PZ9A 2RREA 4YW5A 2XL9A 4N0BA 1YS7A 1AJOA 3BY6A 5FYZA 1VB2A 2XB5A 3VBSA 1NY72 4I99C 1QKQA 2P5BA 3PNAA 4S2GA 3J7ZI 4HNVA 4A3LJ 1ULEA 1MSEC 3IUOA 3CUQA 4LLGF 3OOXA 1B35A 1N3OA 5DAQA 3WNNA 3OGGA 2DFHA 4AVAA 2NVUB 3VD7A 3OSDA 4AXOA 3SFZA 2ZMEA 3HIFA 4UXAA 4COVA 4XTMA 2ISYA 1XU2A 3K51A 2QSHX 2ZEXA 1GWLA 3O0VA 2ZEZA 4LO4B 5CG8A 2A6ZA 4DYQA 3AZWA 3HN1A 4YFZA 1AR92 2V26A 3KCCA 2OPKA 4B8EA 2HKOA 3H3VK 3F8FA 2Y64A 2DBNA 3ACLA 4UFJA 4HBLA 3SQNA 2F5VA 3EO6A 5E8IA 4JTNA 4XJ8A 4PUSA 1D4M3 3TL4X 3WUCA 2EJRA 2VBZA 4E4ZA 1XDUA 5J47A 3RKYA 2JEMA 2MBFA 2X51A 1ZBE3 4JX6A 1W8HA 3RZHA 1UIKA 4A0ZA 2GMMA 3MDPA 3K4KA 2WO3A 1ASJ2 1ETXA 2IFWA 1Z0XA 2HR3A 2FE3A 1W04A 5A6YA 5C9AA 5A70A 2K0GA 2LALA 2VNOA 1SCSA 4OLLA 3H5NA 3K4CA 5CKTA 2E1CA 2JE7A 1VQPI 1IN7A 2DUOA 3KE2A 2HTSA 1NCQB 4KGGA 2HWB3 2PLV3 1FMVA 2ADDA 2KR2A 2Y6GA 4CDGA 4D7TA 1J0RA 1NYWA 1MZ6A 5IK8A 1LVKA 2A68F 1ZBA2 3AK0A 2UY9A 4EZHA 3ZXKA 3VV1A 4EWEA 1OR7C 4II3A 5D8AB 3O5SA 5DS9A 2JG8B 1X3ZB 2ECBA 1QJEA 2OV7A 2E34A 1AF9A 1ZG5A 1VB4A 2M45A 1R083 3R0JA 4KA4A 4QXKA 1KYZA 4KG8A 1XSDA 3KLSA 1ACCA 2R5ZB 4B7KA 2VKHA 2BYVE 4L9JA 2DBBA 3LEKA 3GFLA 5F5IA 1TTYA 4A6OA 2WQ4A 4NIDA 5F0CA 2ZACA 1XTAA 1BI0A 1J58A 1DGRM 4XBLA 3W58A 1L3JA 2WV0A 4XDQA 2QLZA 1HJFA 2HWF1 2X5IC 3SXYA 1YX5A 5ICFA 2JA5J 4QGMA 2OU2A 1K6OA 2YDEA 3OEBA 3ZOIA 4CDWC 3ZFGC 1ASJ3 1N25A 4A3KJ 1ZX5A 5FMDA 2NXNB 5TISC 4Y1XA 1XE8A 1AR62 4Y22A 4LBMA 4G6QA 3UL2A 1WQ2A 2XB0X 2Y6FA 2A70A 4W65A 3S6PA 3LSGA 1XMXA 3WDUA 5CVJA 4XCBA 5FXVA 4Q4V3 4KMUX 5LBFA 2A6VA 4JHZA 4FQZA 2VQGA 4A3JJ 4G6TB 4OULA 2ZNZA 4EN0A 3UT0A 3KZIC 4IL7A 2E7TA 4OHZA 5CQEA 1JYCA 2OD5A 3R4DB 2V9KA 1TW2A 2EIDA 1Y6IA 2HWVA 2XKPA 4BQ5A 3L2UA 3MCZA 5ANNA 5FPAA 3ISPA 5LCWL 1ZVFA 3ZSJA 3OCPA 2VBBA 4DYCA 3WX5A 1XSVA 5JOXA 2OUMA 3MKLA 1MBGA 4META 2Y69H 3T4HB 3S3MA 3DYOA 1LODA 4BEHA 2YBSA 3ESWB 5LBEA 3WTYC 1C8NA 2LNBA 1APLC 1KYWA 2E5ZA 2NNYA 4YG6A 3B94A 4NROA 2Q2EA 2ZBJA 2KIUA 2QCOA 1ZZ6A 1FMD3 2NVXJ 1LEBA 2BP6A 4BJ5C 2JWPA 2GLOA 2A3XA 1ZYRF 4ON0A 5ISLA 2VE8A 4FHTA 2QQVA 1QJX2 2RE9A 3E6CC 1R093 3I2KA 4YM2A 3F23A 2VPVA 1PO13 3ZGKA 1IOAA 1ULYA 4A3XA 5JPMB 2UWBA 2L4MA 2EZHA 1T0FA 2OA4A 5EFUA 4DQAA 1YRNB 4LK1F 2DA1A 3VHNA 1APNA 4K3UA 1GU3A 3POSA 3AP9A 3GBFA 5CBLA 2G9FA 3ZXGA 2YC4A 4TYSA 4G4FA 2LRDA 2OXBA 2P7CB 2EB7A 1RUI3 1EAH3 1SVOA 1NA1A 4G9SB 3WE3A 2ZGLA 3LD8A 5CVUA 3ROUA 4HONA 3IKWA 5FZLA 2XASA 2VTFA 1GZWB 1SPPB 4CU9A 4CDXA 2G9ZA 1HN1A 1OPCA 1OXCA 2WDBA 2P4WA 4WM8A 3K2ZA 4CU7A 3T0YA 3GMEA 5FZ6A 1VQ8I 2D6MA 2UV1A 3KETA 3B00A 1ZREA 2ZOEB 1Z7S1 1JBCA 3M3EA 2FDJA 1H1AA 3UESA 4ITCA 1DF0A 4FVVA 3RZZA 1J1TA 2VOOA 1AL0G 1F4HA 4KWKA 3AX4A 1GSLA 1S5LC 5A1LA 3S7EA 1YCIA 4J6GA 1GVDA 4EYUA 2RM22 1O91A 3BG5A 1IQDC 2JPBA 2Z1DA 3BZCA 2RDNA 3WG2A 2KZGA 3RQ4A 2YBPA 2CRGA 2Z79A 1ZZBA 4OUMA 2CHHA 4R52A 2JDNA 5DD8A 1YG2A 2HOAA 1H89C 2A1XA 3LEGA 1H8TA 2FHRA 4AVSA 2O03A 4DRRA 1YWKA 4E4SA 1U8BA 2XG3A 1YTYA 4Y15A 4YW2A 3HEIA 1W5TA 4HV5A 1TWGJ 3UYJA 4MGZE 3MAJA 2J5OA 3HHGA 4LGWA 4ZYHA 2JPCA 2VMHA 1U0JA 3BIWE 1KEXA 2C26A 4MVTA 4LLNA 1YIPA 4BDZA 4LB5A 4AIKA 5FRAA 1BIAA 5F8PA 4C91A 3H5RA 2BY3A 3DXJF 4BGDA 3LOIA 2ZSHB 3OPWA 3TOJA 1IV6A 3U1DA 1J3RA 5GTIC 1A3KA 1ENQA 1Y8RB 4QLCU 5IT3A 4P96A 4CZSA 1E3OC 1P4WA 3ZYJB 1MMAA 2Y2ZA 1CJDA 4WXHA 1XNAA 4HN0A 4BKXA 4GB31 2KJBA 2IAIA 3IAM2 2PMZA 5CVVA 3UJQA 3LL7A 4JV4A 2J5PA 1XU1A 3M3QA 5EJZB 3SITA 1JTYA 4ZZLA 4E2SA 2HYJA 1JZ8A 4LK0F 3ASIA 2QKMB 5F6FA 4OMCA 1QQP1 1RUE2 1F36A 4AYBA 1PO11 2MLKA 4XFBA 4M6XA 1W9FA 5FKKA 2ZGTA 3L2VA 1SDWA 4JCKA 4RD7A 2BFUL 1K5MB 2XLFA 1OI6A 1D3YA 1E2XA 2BPA2 3KSCA 1R58A 3O1PA 1QXJA 2R063 2B7EA 1ODNA 2Y0SN 3J7YJ 2VCCA 1ZA7A 1O3SA 1O5LA 3ZVXA 4HPKA 4MGKE 5F3IA 4LD5A 3HD8B 2XAJA 1PVC1 1SFOJ 3IH2A 5C4XJ 5HDKA 4FFIA 2OAZA 4AVVA 4YZ2A 2PEXA 4IV1C 4BHPA 1A78A 1DGRA 5ILVA 3GCXA 2XPVA 4ENKA 4Y20A 4EQQA 3OYHA 4LHLA 2AXTC 4ANJA 1MQTA 1DFQA 1UYZA 2WV1A 1UZ0A 4C90A 1BBT3 2QUFA 4A3EJ 2TEPA 4M9SA 2XPUA 4H7LA 1WRJA 3CCVI 3CQOA 5BYNA 1VBB3 4NQWA 2EV0A 1Y39A 2X5IA 2DV9A 3OGJA 5FY7A 4MGRA 1PVXA 1BC8C 2W5FA 4LIVA 2HWF3 4CDWA 3ZFGA 4S2FA 3NJXA 3MV11 4HPKB 2VR4A 2ID6A 2RNGA 1S55A 3U4XA 4OWRB 1YJNI 2VCBA 5LA2A 2Z5UA 3MMYB 1UF2C 4D5FA 2BBYA 3E1F1 4AQTA 3ZMDA 1VPHA 1VZ0A 5LRRA 3VN4A 2QGUA 3CCSI 1IZ3A 3MHZA 1V5GA 4QXCA 5AC93 4LQRA 3J7AO 4XUTA 9ANTA 5IT9K 4RYDA 2KM2A 5L3FA 4Q47A 5ERIA 4MFEA 1SD6A 4FPOB 1MJAA 3FF5A 4LBNA 1FPN1 2RMU1 4OAZA 2IA1A 3RDIA 4C2UA 1N78A 5FKMA 4LHSA 2NVQJ 1WJFA 1WJEA 1UYPA 4O3MA 1O3RA 4CCCA 5HLHA 3CJIC 3CO2A 3AG1H 3FXLA 3GNEA 1EV12 2RV8A 1J83A 5EYRA 3N36A 5GLZA 1UL9A 2R072 3SH5A 5F37A 1R1TA 1C1LA 1SANA 1G8XA 2JG9A 1JZ6A 2V7FA 2TRTA 2W68A 2XJSA 2ELKA 4XCAA 4QPIC 1RVF1 1FPN2 4NN0A 3EETA 2YUEA 1GHCA 1Y56A 3NNMA 1WMFA 3DXUA 4HMZA 1RR8C 1TWCJ 1PGL2 2HBTA 4UV9A 1PUEE 1Q3EA 1PM4A 4HANA 4Y33A 4RR3A 2D7FA 3RZMA 2E63A 4DBRA 2XJRA 1UPIA 4ZYEA 3N9LA 1D4M1 2M4GA 3GZ5A 3VZJA 4YVWC 4Y13A 2WUHA 5HXMA 4W6YA 1T0FC 1U8RA 2IS6A 1KQRA 3OBRA 3L1PA 2Y0SA 2R92J 3HBLA 5EYYA 5JSOA 3VBFA 2ZFWA 3WQ0A 3C7JA 2AENA 3ZXFA 2A7AA 1GV5A 1XSQA 3NVCA 3JAMZ 1EH7A 4XRFA 3UV9A 4RB0A 1SC7A 4LJZF 3ECQA 4OHWA 3D8CA 3F3XA 3WEZA 4P02B 3MW2A 4LG0B 1HDPA 4QB2A 5C5UA 1EKEA 2R062 3VPRA 2I74A 1KU2A 3CO7C 4UVBA 1QF3A 4IV1B 4L9TA 3S5AA 1FY7A 1Z6RA 2VPRA 5BOXA 3ETPA 1G4DA 4MGIE 1TQMA 2PMZN 1VFCA 1JTZX 3OYJA 3PUHA 2YFUA 2ET1A 3LSEA 1ZKGA 1TG7A 3LQQA 1DQ0A 1N75A 3U21A 5FCCA 3BLYA 3ES4A 2IFRA 4AEDB 1STZA 1LHNA 3FLTA 1LESA 1CAXA 3VDBA 2UURA 2RVCA 1IS5A 2A61A 4M3BA 2D2WA 3HVDA 2WIIB 1Q8QA 2YUSA 4MGSA 5F2WA 3COAC 3AKZA 4DZPA 5AFEA 1YC61 3OSGA 4IEXA 3BI3A 2V6EA 3DKXA 4HETA 4JX5A 5HNFA 1VBC3 3EYIA 4E9KA 3LDKA 4XOGA 1B72A 5E3LA 2KRHA 1USTA 2EV5A 4EQVA 3DECA 4XMYA 1ZBA1 3AMHA 3AKTA 3I97A 1CF7B 3BTIA 1OSGA 3ABLH 1DLLA 2WAQN 4HLYA 2DMPA 1FIAA 2QKLB 1HDKA 2JE9A 1TNSA 2O0OA 1AWCA 3RSNA 1REEA 2A71A 2ZGPA 4FT8A 4MZUA 2EA4A 1UO9A 5KR7A 1V6JA 3HZJA 4OIQF 4QD2A 2E53A 2VTXA 2JA2A 4P5OA 4MQVA 4FPKA 1QDOA 4YGEA 3SKJE 4AD9A 3T8TA 4BE1A 5I91A 4XM3A 5E3OA 3G6EI 1REDA 2HPIA 4F55A 3WCSA 1I1GA 1U5TA 3O0XA 1POV1 2B39A 5I0SA 4NRPA 1DQ1A 3R0AA 1W6MA 2W25A 2YHJA 3ZPOA 5KAFC 4AW7A 5A32B 1R23A 3KZZA 2BDRA 3HSFA 3RKWA 4XUQA 3H0DA 1N1TA 3GJBA 4P9GA 2JRMA 3DF8A 1VAMA 2A5ZA 4JQRA 1UB9A 3OYFA 4LXLA 4MQ9F 4AVZA 1ULGA 4S0HB 2J1RA 5JI6A 2Z5WA 1O8SA 3GTQJ 5A1FA 2XL7A 2IXIA 3T1MA 3CJRB 4RAZA 3DBRB 4YW4A 5TSWA 4A42A 3A0NA 3ON7A 2OBPA 3IMMA 1GXQA 1S3JA 2BWAA 2N8GA 5IAVA 3HKZN 1RUI1 2Z16A 2HYXA 4CRQA 3GVAA 4XDOA 4AFMA 1DU6A 4FPHA 3R60A 3W21A 2OA2A 2VW2A 2Y6KA 4HT1T 2F4MB 5DABA 4JVAA 2NS8A 4HNTA 3BTYA 2XSDC 3HPHA 2ZNYA 3SZTA 5HDNA 1ZGJA 3HGYA 1JW6A 1FV3A 3WQ7A 5IYYA 1WA6X 4XF9A 4B7EA 2YU3A 1DP0A 1CAVA 3KEQA 4XN0A 2QTWB 4AHZA 1RHI2 3MLLA 4QM8A 2VU9A 4IE6A 2GNTA 2RMU3 3PUIA 4I3PA 2W46A 1EUUA 3A21A 1Q5OA 4RGKA 2CAUA 4PCRA 3ECHA 1PO21 2IXKA 4ISRA 1WLDA 3HT1A 3AG3H 1IN6A 1B9MA 1K78B 2WO2A 4AK3A 1QJX3 2WB1N 4CE8A 2XF6A 1UOGA 2O3FA 2KKOA 4IEVA 4ENMA 2EALA 5M5XJ 5L9VA 2OUJA 2VZVA 3POYA 2YBKA 3TOBA 5FYTA 2L9SA 2DUPA 5D5UB 2JG8A 2QFEA 4QPWA 1ETYA 2UWAA 5DDJ3 5A3MA 4KN4X 4D7SA 1SLCA 3B73A 2VCMA 4QB1A 1MJ9A 2HWB2 4QQLA 1QJX1 3OYMA 3PURA 2W1OA 3JTHA 3MW4A 1EPWA 4BQOA 4JGYB 2B8MA 2WFF3 4A0YA 1QA6A 1W36D 1K5MC 5EIYB 2HWE3 2XSJC 1X50A 1ND2A 2XAQA 1S29A 1XB4A 4XICA 2QEXI 1L3LA 3KEYA 5EV7A 4A5NA 2PMUA 5BNGA 1VE0A 3B6CA 1TZOA 3HRSA 3B02A 4XFGA 1D5VA 2QQLA 2XJUA 3M1CA 3VBHA 4GMP1 2J1EA 2P5KA 4PIZA 3KFWX 2DOEA 3N3HA 1WPKA 3I59B 4CO8A 3N9MA 3I4PA 1HW2A 2WQZC 3L9JT 1FNZA 4U0YA 5CZKA 5H2FC 3JRHA 4GH4A 1Z6TA 4D5CA 1DYOA 2HDCA 1UNBA 1DP7P 2PHRA 3AMNA 4MYEA 1MR5A 2XAHA 2FMYA 2XKOA 5EP9A 1H6YA 3SEQA 4LKFA 2AGSA 1F35A 1RUH1 4HSJA 2EXIA 1P92A 4RS5A 3ABMH 4RB1A 2B5HA 4AYBN 1BMV2 1MSFC 3O6BB 4EWDA 5L36A 3CCRI 4KFCA 3DTEA 4K8RB 3PL0A 4HG6B 2X9DA 4LITA 4BPZA 3GW2A 3BIEA 1W2OA 3K48A 1VQNI 1LU2A 3ABUA 3ZFGB 3I59A 1YEWA 1WFXA 3GFJA 3O1OA 1WCMJ 3VBFC 3U37A 5HS9A 4NIAA 2QQIA 1NH3A 1QIQA 4OIPF 3WNXA 5DDGA 2BWCA 5ACA2 1E3PA 3BVCA 3GYHX 3C7OA 3RZOJ 1TNTA 5FUIA 1FBUA 2Z69A 4FOYA 2F6CA 1H2LA 3H0OA 2E35A 1OCTC 5E8GA 3AJZA 3HOSA 3LFMA 2ZJRF 4Y20B 3FHQA 2IPQX 2XBO2 4AYUA 3LB9A 2GIVA 2L7MP 2M5WA 5A7SA 1W8TA 3VDCA 4P55A 2H6BA 1UKRA 2DPDA 3AYEA 4XFIA 4IO9F 4K2EA 4M3CA 5JFRA 1S7EA 3M7AA 2K40A 2GBYA 1W7PA 2KDZA 2A73B 1AOYA 2D5VA 4MO3M 1MZEA 2AUYA 3NMBA 3PLQA 3L09A 4HKLA 1OCPA 2XHKA 4LPLA 4GFBA 5KVRA 5J36A 1PGSA 1H8VA 2ATFA 1JU3A 5A6ZA 3FHNA 4Q2FA 4PFPA 3REOA 1W7PD 1ZA4A 3D3AA 2Q0AA 2Y34A 4PDWA 2QQBA 5BNPA 4IEPA 2MA3A 1IRZA 3AAFA 2QKDA 1POV3 1H2NA 5A7WA 2HWC2 4XJUA 4LORA 4IPAA 4FSJA 2PHUA 2XDVA 3DQVC 1AR93 3F8MA 2CQNA 2JB8A 3DBHB 2E1NA 1LDKB 5IPAA 4L18B 4DXSA 2V72A 1QMJA 4A4AA 1K6YA 5FUPA 1PGW2 5DM6F 2KXLA 1ZK8A 2VQLA 1LOFC 5EZGA 1JYXA 2EICA 1I9RA 1MS0A 1V6NA 1PK6B 3FLRA 1R1ZA 4QTRA 4F92B 4M72A 5KAIC 2ARBA 5J1RA 3CKHA 2UYAA 4LG0A 1DGWX 3VD5A 4N90A 3OD4A 5FYUA 4TLGA 4N53B 1Q8SA 1AR91 3EQLF 4NDLA 1UY4A 3RFRA 4AIDA 4B44A 2Q1MA 3BODA 4RQPB 4JC1A 1GV2A 2VAUA 5LY1A 2DVAA 4QKDA 1WW6A 2DYRH 3INAA 3SCHA 1ODDA 4BJ0A 1HQCA 4ZZDA 5GZGA 3TQNA 4RDUA 1H9GA 3ZQ7A 1IF1A 4XZUG 4Z2WA 1YE9A 3ZSEA 2DMQA 1VAKA 3VSLA 5DUUA 1GLNA 3RTRA 2ZC2A 4AVCA 1X3WB 3FHIB 2ZTNA 4GJYA 2BOIA 4DEVA 3D1NI 1EPZA 1VBE2 1TNFA 4QQHA 4XIOA 2XLAA 4NUBA 2XVCA 4AFAA 1J2XA 3AMPA 2IVIB 4I09A 2ZXHA 5LHIA 2Q30A 3M3OA 4Y1YA 3WQBA 3QU6A 2ZMLA 5C4WC 1DQ6A 4AGRA 1J3PA 1GR3A 4QKBA 2EIBA 4CU6A 4AWXB 2MC3A 1H0MA 5J3UA 1J9IA 3BTZA 3TO6A 1LOGA 3WP5A 1Z67A 5F0HA 5L3CA 3GTJJ 4YIRX 4V19K 1AVBA 1EYBA 2F4PA 1WMDA 1T6SA 4XUNA 1HRI3 1PP7U 2WNVA 5FR3A 4WM7A 2J1UA 2X1EA 3JR9A 4IV3A 1XNCA 2EV6A 2XXZA 2NAZA 4B1LA 1RMU2 2QQ9A 1XDSA 3G2BA 3ZXEA 2BW8A 4JAAA 1CZTA 1NZIA 4QGNA 2X5IB 3OS0A 1NQJA 2R7WA 1SVLA 1DBNA 2VZTA 4OVEA 1Y1WJ 5D1IA 4YARA 5KXBA 5L9BA 1HA8A 1P7IA 2V1DA 1PIV1 4Z1VA 2YGLA 1W90A 3KMHA 4A0XA 4OI1A 3BUCA 1Y1VJ 1FX7A 2QM3A 1MW7A 4BY7J 3W59A 3HOZJ 1OLQA 3I3MA 1LENA 1YO8A 2DN0A 1WLWA 4XLEA 2JG8C 3AB0A 4OHXA 3MKYB 3K69A 3LNQA 3VBOA 4OQ8A 1GV9A 3JCUC 2VUMJ 4HVOA 3FJSA 3LFIA 3CQZJ 4OOIA 2GSYA 2XPWA 4PF5A 1LFUP 4JRLA 2CS3A 4NHJA 5DAWA 4KITB 1E5HA 3HQXA 3VD9A 2ZKNA 2MLGA 1AR81 3HAGA 2LP0A 5J98B 3FXQA 3DGTA 1YRNA 4HF0A 3WTVC 1H6XA 5EF6A 4OIRF 4BEHB 2QZ8A 1FPN3 5CKQA 5IK4A 1K83J 5ABJB 4ES9A 5IT6A 5L3BA 4CEWB 4PBPA 3A7QA 3U1XA 4M4RA 1OF3A 2PHFA 4CEWA 3E3VA 5TRDA 3LPFA 1WGPA 4I0BA 3VGIA 4JGZB 3S15J 5KXDA 1DQUA 3U75A 3W2WA 4GH4C 3F72A 2Q8OA 5FO7B 2FOWA 2ADUA 4A41A 3GFIA 2E7AA 4LMFA 3BR5A 1JHNA 4DY5A 3H36A 5T3NA 2XV4S 4QHZA 2ETHA 1TMF2 2O7OA 2LR8A 3CC4I 3ZXAC 1NLQA 2V4VA 4HV6A 4NIIA 1DPRA 4AEDC 3VBUC 1W39A 1TWFJ 3MN2A 4LEJA 3AKSA 4IE0A 2VC1A 3R6SA 5SV8A 4MEXF 4BM8A 2DJIA 2HQ5A 5FPXA 1IG3A 4KWLA 3BTJA 1IZ1A 4A93J 2WS91 1FTTA 4QIWN 3BB6A 3HRMA 4Q0QA 1YJ9I 3BJOA 3KGLA 1FP2A 3ZXJA 2QQWA 2M9HA 1NHAA 4ETSA 3AXDA 2DCZA 5B4XA 2CH0A 3C7HA 3PJYA 4HOOA 1OCZH 1SD5A 4Q0SA 3KYCB 3MKWB 3KCYA 2AH2A 4M4PA 3UETA 3I9V2 3B9CA 2F5FA 1AKHA 1OFCX 3WDXA 1T39A 2LM3A 1RPWA 2XJTA 1WKMA 2B63J 2XR4A 1IUFA 3OGRA 4M6YA 3OTFA 3MZHA 2PX9A 1AYN3 1LJ7A 4P14A 4Z8BA 1UG0A 1F9KA 1NG6A 3G6JB 4CDUC 4QXBA 3HPGA 2V9PA 3CLOA 2JICA 2RS12 4Y7NJ 3ZPLA 1DQ4A 3PVEA 3S1MJ 2GP3A 4CEYA 1DGWY 2V1XA 2M34A 1GZWA 3GHNA 4NJ4A 3AP4A 1GNHA 1R1A1 3HTUA 3SXWA 1HW1A 3WG9A 3ASNH 1NE4A 4IUGA 4LBKA 1MQTB 1BHGA 3CF6E 4AZZA 1H30A 1BK0A 4CP1A 3N9NA 4J01A 5FJHA 3JSPA 1WCQA 4EM0B 4BOWA 3U14A 2XIGA 4KL1A 2ZJ2A 4KN7X 1ENHA 4M3CF 5T5PA 1L7QA 1C8M3 4EN9B 2HZDA 5FFOC 2YB7A 2FZ1A 3GZ6A 2R7QA 2GNBA 3EUKL 3GO5A 5JVVA 3TN92 2VOXA 1R1A2 3OY9A 3ZN1A 3O1RA 5DPNA 3IWFA 3I0TA 1OOPC 3B69A 2L54A 3RVHA 2FCUA 2ZHLA 3BYWA 2P1BA 1TQPA 2EH3A 3BALA 4BQXA 4F83A 1YFHA 1JZ2A 1NCRB 1KS4A 1W6OA 3K2OA 5C3PA 2F5CA 3KYDB 5B5EC 2CNAA 4XF3A 5DAXA 5KNLA 2VMCA 4B3AA 2Y6HA 4IHSA 1XOYA 2DTYA 1ZRRA 4UV8A 3V0AB 2WNVB 4QMAA 5C6CA 2K02A 2CSOA 3U9GA 2DQLA 2HWD3 3T2PA 1HV0A 1NKGA 5CKNA 1V6MA 2VUCA 1REFA 5HDGA 4LLFA 4V2FA 2XWJB 5JUVA 4D0QA 2ORZA 4I2OA 2VZPA 4H3WA 3AZZA 2ME0A 3KT1A 2EFOA 3BR0A 4Y1VA 4IHXA 1X9TA 4PJMA 5KHHA 2ZHNA 2JJ6A 4WBBA 2VM9A 3ACGA 5IVFA 3NJVA 2WFF1 3U11A 3FXUA 2AYHA 3KP7A 3V8JA 3TAYA 3JRGA 1R9TJ 3FXOA 3K4LA 1RUG3 3CUQB 3OBTA 3ZFFA 3LAPA 4WVVA 3PU3A 5LK7B 3IHUA 4XLCA 3POJA 5FLIA 3ZSKA 5DD4A 2W85A 2IWGB 2STTA 1VLNA 1XXNA 3EJKA 2HZTA 2P3IA 4XURA 5CQGA 2WBMA 2WO1A 3KF3A 1LOCA 3RJRA 2ZGSA 4DOZA 1NCQA 3PMEA 2E7WA 3Q8EA 4NHMA 4FP3A 4YG3A 3E6MA 4N8MA 5LK5A 4M3EA 2JA8J 1GWMA 4PSXA 2CUFA 3O1SA 4E8DA 2P6TA 1VNDA