2HKXA

Structure of cooa mutant (n127l/s128l) from carboxydothermus hydrogenoformans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
218
structure length
218
Chain Sequence
b'ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKLLLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide oxidation system transcription regulator Coo
publication title Structure-based hypothesis on the activation of the CO-sensing transcription factor CooA.
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Transcription regulator
total genus 62
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hkxA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hkxA01
2FQ3A 4PDKA 3I54A 2R3SA 3KEQA 2IC1A 1KU3A 3J81Z 2VT2A 1VP6A 4Q29A 4HW0A 2B9UA 2P7CB 5ED4A 1TQIA 1ZG5A 1C0WA 1IF1A 3P7NA 5LLQA 1SD6A 2VE9A 5D5VB 3VHRA 4Q0VA 4YFNF 4KYWA 3H1YA 2FOKA 1P2FA 1ZX5A 4Q47A 1YTYA 3F6VA 3GYDA 3F3XA 3DQVC 2K4BA 2QBYB 3I58A 1EP0A 2Q1ZB 4R79A 1FSEA 1DPRA 1O3TA 5AONA 3NRVA 3ES4A 4IEYA 4KMFA 2BV6A 4QGNA 4Y17A 3JSOA 1PDNC 6PAXA 5AIPA 1ZRCA 4IEOA 5JR3A 4M73A 4RGUA 3M9AA 4HX8A 1XGOA 1K79A 2XL7A 2QQAA 4IHSA 4YIFA 3KE2A 4L5IA 3LQQA 2D45A 3P9KA 3QOPA 5BPIA 2VXZA 4XF0A 1EH8A 2A61A 1ZRFA 1USTA 5J8CA 1XE7A 1RNLA 1PUEE 3RI4A 3EBRA 2M8EA 2MC3A 1CAXA 4MGKE 3GZ5A 5HDKA 1XDUA 5HLHA 1Z91A 2K27A 2PEXA 5CVRA 3IC7A 5LGNA 5ILSA 5HI0A 1SFNA 2IXHA 3VEPA 1CAVA 3EHKA 3PVBB 4JBAA 3RZZA 4EGYA 2Z69A 2ACJA 3PLQA 3WGIA 4K8FA 3R61A 1VR3A 3ZMDA 2HGCA 4HSJA 1OYYA 4JVAA 5FFXA 1LVAA 3ZMSA 4CZZA 4U7DA 4KU8A 4A6DA 4AVPA 3VB2A 5JVTA 2PA7A 4O5VA 3F8CA 2JT1A 1FSHA 4L9JA 5C6CA 3HHGA 4HLXA 3WU1B 5LHIA 3JAMK 1Y3TA 5E1XA 1IRFA 5CLSA 4HZFA 5AIQA 4G6DA 1SFXA 3KGLA 1YFYA 4IHTA 4KDPA 3D5LA 1H1MA 3DL3A 4XF3A 1K6OA 2G9WA 2O8QA 5BPDA 2FNPA 3J80Z 4E2SA 2HEOA 3EYYA 2OA2A 4FT8A 4U0VA 3NSTA 3RIRA 4CO8A 1ZZCA 4UV9A 3ZN1A 2FF4A 4BIFA 1P4AA 2W24A 3IDCB 1GXQA 1PMIA 2DT5A 2WWYA 3BB6A 2XLGA 2QQBA 1TBXA 3JZVA 1XD7A 3BZ6A 3WTYC 4LULA 4IRIA 5IT9Z 1R1UA 4AIJA 3G3ZA 3QRFF 2GC3A 1FPQA 5KHIA 3KP6A 4RGRA 1BC8C 4L0YB 2Z5UA 2VOOA 5J6XA 1D8KA 2HWVA 3R0AA 2D1VA 5J48A 4OOIA 4WXDA 3LWFA 5HLGA 4CDGA 5A2QZ 4LA2A 2CWEA 2HS5A 3U1DA 4EJWA 1L3LA 2EWNA 3HOSA 4D7TA 2OYZA 1CF7B 2DBBA 2EJRA 4L2NA 2EV0A 4U7BA 1FNNA 1ZHFA 2W57A 2PN6A 4OLLA 1ONVA 4RB0A 1MJBA 1JE8A 1LKNA 2CAVA 3NL1A 5D5WB 1ZLJA 3WU0A 2CO5A 1XMKA 1LB2A 4O6JA 4LD5A 5DUKA 2KKOA 3F6OA 3FHIB 1QXJA 2IA2A 1YFXA 1J59A 3CUQC 1XB4A 2PAEA 1R36A 4YIIA 1EH6A 3T1BA 4MX3A 2OQRA 4EWAA 2LF8A 3RDIA 4KFCA 2A5YB 4BYYA 1KGSA 5K1YA 3HT1A 2V1DA 4ETSA 4GGGA 1FBSA 1SD5A 2K4JA 4G7ZF 1LEBA 3HSFA 3VOEA 4ASNA 2WTEA 1BC7C 1LQ1A 4GXOA 4O9EA 3FXQA 4O3MA 4YNIA 2JZYA 2IXJA 2ESNA 3WTXC 3RKYA 1XGNA 1BN5A 1ZLKA 4AQ6A 3QU3A 1J75A 1FY7A 1G6NA 3VFZA 2EAAA 2A3SA 2DCTA 2HYFA 2COMA 1T39A 1DZRA 1IN7A 2JPBA 4X6RB 2Y0OA 2A69F 4LEJA 3EUHA 5CADA 4UVCA 3ZMTA 2KJCA 4I0BA 2ZJ2A 3IIAA 4FX4A 1JHFA 1J9IA 1Z1DA 2BNNA 3O3KA 3N4MA 5L3FA 3DKWA 2IPQX 1MJ9A 2D1HA 4P5OA 1DGRA 5JI6A 1S7OA 3F8MA 1EH7A 1YW8A 1ZRDA 4EVIA 5ICFA 1QXRA 1V70A 3T8RA 3ST7A 3I53A 3H3UA 3E6CC 2QVOA 2YX4A 2PFBA 3QP6A 3IRRA 3B02A 2GAUA 2OU2A 2IA1A 1WLTA 5H6RA 3CUQB 2A68F 3TOBA 2XAFA 3FZVA 1RUNA 1YFWA 1Z6RA 2MBFA 1FLIA 1O3QA 2N7GA 1L3JA 1F1ZA 4OMYA 5AVPA 4QMAA 1W5SA 4DINB 1KA8A 3HIFA 4Q0UA 4Z07A 1ZNPA 1X8EA 3QAHA 2F4PA 5HDNA 2OZ6A 2DPUA 3LWCA 4ON0A 4RS8A 4UBHA 1XSVA 4RGXA 4XLPF 2PAKA 3RPQA 1IW7F 1I27A 3FXRA 1XGSA 5D8KB 4RB2C 1YS6A 4L5JA 4HV5A 3IRQA 2GU9A 5K5QA 4XEZA 2QVSB 3SXWA 2HFHA 1MDMA 4MHGA 5JSRA 4CYDA 1HSTA 3ERED 1XMAA 2VT3A 2O03A 1OFNA 4AIKA 1CAWA 4Q0SA 1O7LA 1EYBA 5KHHA 1BI2A 1KYWA 3FMSA 1YYVA 2VC1A 1J3RA 1MGTA 3HRTA 4LLOA 1BJAA 1H9GA 1JGSA 5D6FA 2G7UA 2HKOA 3E6BA 1GQGA 3E5QA 3JW4A 1IXSB 2ET1A 1ULYA 1X3UA 3LA2A 2VE8A 3CDHA 5KVRA 3JTGA 4I98B 3HTUA 2MA3A 1MJAA 2B0LA 3H9AA 1ZN2A 3WGHA 3GLXA 1GXPA 2ZBKA 4LJZF 3WW2A 2NAZA 5E1RA 4WXCA 3T8TA 1FYLA 3SCFA 2EV5A 3RYKA 3FX3A 1QBJA 2L01A 5FPZA 3OD0A 4ZU4A 4U88A 3WODF 5EFUA 2V79A 4WXHA 5DCMB 4RD7A 3F8FA 2Q0AA 5FDBA 2Q30A 3AAFA 3I0TA 1MKMA 3OOPA 5E1ZB 2PQ8A 2M1BA 4G8XA 4NVPA 2VODA 3FWEA 2VBZA 5BOXA 1V4RA 4TLFA 3REOA 4HN1A 1XE8A 1UHWA 1T98A 1XSXA 1KQ9A 1XSDA 2XAJA 1IAWA 3C1DA 3BDDA 5FLXZ 4WVZA 4I2OA 1ZH5A 3H1MA 4L9VA 2DTRA 5JSPA 3UKVA 3I59A 2ZCWA 2EFNA 3DF8A 2J5OA 2FBIA 4MTEA 3MYXA 5BUVA 3R6SA 5HLIA 4G6QA 4JV4A 3KEOA 1UCXA 2IXLA 2M87A 1B6AA 4BXUA 3GW2A 3FFQA 4IETA 3FF5A 2O1QA 2QYOA 2QJVA 1GQHA 3F72A 4M72A 2XLAA 2EVXA 1X82A 4QGLA 5I93A 1LNWA 3L2CA 3NEUA 4KICA 1I1SA 3ELKA 3NW4A 2ISZA 1QZZA 3MQ0A 3BPXA 4BAYA 4KN7X 1CAVB 2WFPA 2QENA 2MPFA 1ZGAA 3QP5A 2JTVA 3NQOA 1YW9A 2ZNZA 4EV0A 2YU3A 4WX9A 4DQ2A 4EM2A 2KIFA 4ZZLA 4META 1OPCA 4KU7A 2O3FA 2V1XA 2F5FA 1ZZ7A 3GX4X 4JK1X 3FJSA 1R22A 1CAUB 5IT3A 3ZMUA 5F1RA 1H0MA 3EO6A 4Z82A 1B9NA 1O3RA 3VODA 3SZTA 3WG9A 2RVCA 2P5KA 4NHJA 4NB5A 1WKMA 4KN4X 3W6JB 3E5XA 2GC2A 2M30A 2VBXA 2M5WA 1U8RA 2Y0MA 4XFHA 2Q4SA 4WK8F 4ONUA 1UPIA 4IEZA 1SMYF 1BIBA 5L3EA 4HBNA 4MH0E 1OD5A 3ETQA 1S6LA 5EZWA 2JPCA 3BOQA 3OGJA 1BI0A 1TQPA 4QM8A 1IN8A 4E2QA 4L9NA 3I4PA 1J7KA 2GWRA 3S0MA 4LLLA 3Q5FA 1J3PA 4XLNF 2K86A 2Y48A 3NKTA 3LFKA 3BCWA 1VTNC 3LQRA 4IXAA 1YFHA 4A0YA 5HOOA 1OYIA 5FD6A 3TNQA 1J5YA 1HW1A 3EQEA 3LA3A 4E70A 2HDCA 1QY4A 3GVAA 5FQ0B 3SMHA 5LEKA 3NVCA 5BPXA 1YUDA 5LGUA 1SAXA 1K78A 4PGGA 1U78A 3FMQA 2FMLA 2GXBA 5D4RA 3K0LA 3H7YA 4OFGA 1D3YA 5C8WA 1HSJA 2F5CA 3K69A 3U2RA 2FU4A 2UY9A 2ZXJA 3IKTA 5CVVA 5DD8A 1SEFA 2EA2A 2RN7A 2K9ZA 5I8SA 3HRUA 1GHCA 4YG2F 2X4HA 3LSTA 5ICGA 2ZFWA 5JHUA 2RV8A 2RDPA 4HV6A 4MQ9F 4EWDA 1LDKB 3LAJA 3CLPA 1B4AA 2FMYA 1ZZ8A 4KL1A 5BMZA 4XF1A 2CV6A 1W7PA 4LA3A 4H0EA 3LOIA 1QZYA 1NE4A 4E2GA 2NNYA 2D93A 3ZPLA 1BI1A 1ZVFA 2L54A 2WV0A 4QGMA 2P4WA 3TDUC 4XFBA 2CW0F 5FLIA 2XHKA 2MD5A 3FXUA 1LDJA 1WSUA 2FNAA 2KIMA 3TGNA 5I0UA 1KQ0A 1HBXG 4HOBA 2STTA 2KXLA 1T2KA 2FE3A 4EWEA 3PQJA 1SD7A 5TRDA 5ICEA 2F5DA 2JSCA 1D5VA 4KT5C 2KJBA 2ISYA 3C18A 3K1PA 4PCQA 5K5OA 3SQNA 2E1NA 2NNNA 1LDDA 2BE5F 2IVMA 4KWLA 4WF2A 1HQCA 2QBYA 2MNGA 5JCTA 1HKSA 2LSOA 3KFWX 3OV8A 2DFIA 5CVJA 3RJPA 4BQAA 4D7SA 1UD1A 5I0SA 3MPBA 3EETA 4J1XA 3OCPA 2Q2EA 1BOAA 1J1LA 3K9TA 5DYMA 5FPXA 4HAMA 4LG0B 3ZMVA 2MHFA 2QLZA 4CICA 4LLGF 4N9HA 4AIHA 2GC1A 1R58A 4IEQA 3UKTA 2PJPA 1FX7A 4UXNA 4ZYDA 3ELNA 1U5TC 4MV2A 4EROA 4JQFA 1S29A 4MGIE 5J3UA 1IN6A 5HDGA 1FXZA 2VN2A 2F5EA 4BHCA 4XF9A 2DLLA 4L9TA 5D5XB 2DAOA 5BS6A 2L4AA 1X7NA 1DZTA 2UYBA 4OIPF 3IDBB 1FP2A 5FLHA 3GEZA 4LMYA 3LA7A 1G4DA 1CX4A 3KZZA 4WCGA 3QACA 3WTWC 1IRGA 4ZYGA 1R1VA 5DEQA 5E1WA 5I8YA 4FBFA 3B73A 3FZ3A 4MNUA 2EV6A 1WI9A 1G3YA 4O9GA 4HF2A 4A2UA 1CAWB 4OU0A 3QPHA 2AS5F 3ZDSA 5K5RA 4Q5SF 1ZRRA 2ZNYA 1L0OC 3FMRA 2V1UA 1ZG3A 2DK5A 3H1WA 2GA2A 3FM3A 2PMHA 5D4SA 1O7FA 3GYHX 1ON2A 2A6HF 2D40A 3KLOA 2MLKA 3NJZA 3E5UA 3TDZC 3LZZA 3GF2A 1U5TB 4A12A 4D0PA 4P9GA 2IT0A 5F6FA 2ZO4A 3V8JA 1FBUA 1Z6TA 4PZJA 2OPKA 1YG2A 5LGTA 1ZZ9A 2QDRA 1FOKA 1R23A 3MZHA 1ZREA 3EDPA 2W84A 5FFZA 5FO5A 1O57A 4PIZA 1QQIA 2R7FA 4IRHA 4A0XA 1FC3A 2RC4A 1T38A 1OYWA 3CO2A 3ACLA 1WRJA 3GFJA 3K1NA 3CJXA 2DI3A 1ODDA 2C0ZA 2H0VA 2XAQA 2EA4A 4L11A 1HKQA 2B5HA 3TO7A 3J81K 2J5PA 3QU6A 1JXSA 4OINF 2OZJA 1QWRA 3WTVC 3KP3A 5J7MA 5HS7A 2W25A 3RPUA 3DN7A 3HSEA 1DUXC 1LR5A 2STWA 2O6GE 2PFWA 4M74A 2DQRA 3TKYA 3Q9SA 1YWKA 3MFKA 1PP7U 1CF7A 2H6CA 1E17A 4R1HA 3GWZA 4R8HA 3FM5A 1K7AA 4LB5A 2K0GA 4KIFA 1TW3A 1UB9A 3TQNA 2ETEA 3L09A 2NYXA 4HQEA 4AWXB 2CSOA 1WA4A 4R52A 5DV5A 1Q43A 3WW4A 2V09A 1TQMA 4XFCA 3GFMA 5LRSA 3MEXA 1ZGJA 4TV7A 5L3DA 3I5UA 2Y75A 2HR3A 4H7LA 2BNOA 2LDUA 3F23A 1WGPA 3RNSA 4AXOA 4Y15A 3C3VA 4GCVA 1O5UA 1IPKA 2VBYA 2HJIA 3DEUA 4WZCA 5LBQA 1FYMA 5JAXA 1YQAA 4M9ZA 3BPZA 4IEWA 1RL3A 3Q9VA 3GUDA 4QLCU 3SHRA 5BQTA 1STZA 4UNOA 1VJ2A 1P92A 3I7DA 1F5TA 3K1MA 3V8LA 3WE2A 2CG4A 3V7RA 3ECOA 1QPMA 4M9XA 4UHTA 4YFXF 1D8JA 1S3JA 2HZTA 2XIGA 2XRNA 3E3VA 2ZMEA 2DO7A 5HVQC 4PIYA 3KCCA 2K02A 2V9VA 2HQNA 2UXNA 1T6SA 5D1IA 1FZPB 1Q5OA 2P17A 4B29A 1R00A 1TNSA 4J1WA 3L9FA 2A6EF 5DDGA 3KP4A 2EFOA 1R5HA 2UXXA 1HXDA 3T0YA 4HMZA 5LEJA 3WTTC 4M6XA 2ZKLA 1XGMA 2IXKA 4N9IA 5JFRA 4PIXA 2ET7A 4UVBA 3O2PE 2E1CA 1YLLA 2IP2A 2PBIA 4QXKA 1EY2A 2E9QA 2FXAA 1QO0D 4IERA 3SHFA 2RNJA 2GH2A 5H20A 3CUQA 3HRMA 1G3WA 1SFEA 3IWZA 2CFXA 5K8SA 3F21A 3S7IA 3BROA 4AD9A 4RGSA 1G3TA 4QX5A 3HQXA 1W5TA 3J80K 4ZZDA 2FEZA 3FHZA 1ZG1A 2LKPA 1H9TA 2PG4A 2PHLA 3U9GA 5BY5A 2XKPA 4FAGA 5IT9K 1NE6A 1CAXB 4G94A 4QWQA 4B8XA 4Q0QA 3GXOA 4XFAA 5J8FA 4BNCA 1TQ5A 1XCBA 3GFIA 4A5NA 4Y13A 4S05A 4QM9A 1K78B 4MUVA 5KHJA 4I3PA 4Q48A 1YS7A 4WWCA 2GZWA 2GC0A 2XL9A 2HKXA 2DW4A 4IEUA 2KIUA 2PTMA 3PNAA 5A2QK 1KYZA 1SD4A 4GULA 1YLFA 4HVQA 5F64A 3H3ZA 1ZZBA 1U6GA 2P5LC 1IPJA 4LUMA 2VOPA 5E16A 2Z2SB 3R0JA 5E17F 1IN5A 4FAHA 3HHHA 2X0LA 4YYOA 3ZMZA 4LB6B 1USSA 5EEHA 3E6MA 2Z9OA 1QGPA 4YRDA 3SCHA 1J2XA 4HBLA 5ILVA 5LRRA 1H1IA 5L3CA 4HDUA 1F4KA 1O4TA 4HF1A 1XRUA 2CAUA 2MLGA 1U12A 3KGZA 2DQLA 1J0RA 3BWGA 4ENKA 4HF0A 2VPVA 4EM1A 2VBWA 5DCMA 5ERIA 3H8UA 1JUHA 1EV7A 1Z7UA 3COAC 1AWCA 2XGXA 3OTFA 2P8TA 3USSA 2UWMA 1OR7A 1JHHA 4ESBA 3IHUA 1XCVA 2QZ8A 3PQKA 1X8MA 1UW8A 4UBGA 4OIRF 1I1GA 3BU7A 4IRGA 3JSPA 1KU2A 3DXJF 5L3BA 2HQRA 2W85A 3ZQ7A 3G7DA 3M70A 4IEXA 4ZYHA 1UIKA 3P9IA 3M1EA 1WQ2A 3M8EA 2PMUA 4BH9A 2XV4S 4MGYE 2HTSA 2DPDA 5JR7B 4KWKA 1MZBA 4KIBA 3TO6A 2GIVA 1FT9A 4KMUX 1R7JA 4AVCA 2Z33A 1DDNA 5I0TA 2MH2A 2NRAC 4KWJA 1XDSA 4NQWA 4IF4A 3U0ZA 1KU9A 5CJ9A 2BGCA 5DD4A 4XBFA 3V7SA 3ML6A 2C6YA 1CGPA 4KNYA 1W4MA 3MZYA 3SZPA 1RIOH 2EFPA 1REPC 3WTUC 3FE5A 5JSOA 3U11A 1IN4A 2RQPA 3BPVA 4EJOA 2O8XA 4MEYF 4ZH4F 1BM9A 2P5VA 1TTYA 4G7HF 4I02A 2BYVE 4KUMA 2VC0A 4BHBA 3DPLC 3WTSC 1T0FA 4CXFA 3WTZA 2H6BA 5FGMA 5L3GA 3KP7A 3I64A 3I71A 1J3QA 4AQ2A 3WW1A 3HSRA 4HX4A 4IEVA 4Z2YA 3MWMA 2P6SA 1CAUA 4I09A 4OIQF 4PGHA 1W7PD 5E8GA 1WWXA 4CHUA 3OF1A 1RGSA 1U2WA 3RTRA 4U0YA 3TO9A 2LNBA 2Z99A 5E18F 2H27A 2ATFA 1LEAA 4LGWA 3HUGA 2OAZA 2FRHA 1FP1D 2A07F 4HN0A 2QQ9A 1IUYA 2EK5A 5HS9A 5D5UB 3HT2A 4YSFA 4EJTA 2NS0A 2DK8A 1HW2A 1E2XA 5I8TA 2CYYA 1R1TA 1YO5C 2IJLA 4Q0PA 1NHAA 4A0ZA 5DUIA 1F9NA 5KHKA 2PI0A 1Q1HA 3SXYA 3M7GA 5TJJA 2GXGA 3BJAA 3DP7A 1O3SA 2MH9A 1U3EM 2ADUA 4PJYA 1UHMA 1PP8F 3KSCA 3SFZA 3ECHA 4P9UA 1KQ8A 2G7HA 3RKXA 3LAGA 2UZKA 4HVRA 3IWFA 2O0YA 4EGZA 4YFKF 3CJNA 2EA7A 2IRFG 1Q3EA 4ENJA 5FD5A 4LUKA 1P4XA 1ZZ6A 5FQ0A 1RC6A 1LJ9A 2OQGA 4B09A 2E7XA 4UVAA 1SQ4A 1G3SA 3BALA 3WGGA 4AVAA 3CEWA 3S7EA 2EB7A 2FSWA 1I5ZA 1UFMA 4HDVA 5FLXK 2CGPA 4OIOF 4KIGA 3IL2A 1FI2A 3ZP5A 1O5LA 2XKOA 5E20A 2XAHA 4EM0B 1MDMB 1FBQA 1P4WA 1UCRA 3GO5A 3T5XA 1SFUA 3CO6C 4U0WA 3U10A 2QM3A 4EMSA 1OMIA 2LF7A 4I7HA 5FB2A 3ZN0A 3M8FA 5EEGA 2OA4A 5CVUA 4I01A 2ELHA 4IESA 1FYKA 4M6YA 5KHGA 3CLOA 2XUBA 3DPTA 1IXRC 3TOAA 4F8AA 3TNPB 1YHFA 1I6XA 4X6QB 3HYIA 2QWWA 2IW5A 4M9SA 1DP7P 2XROA 4RAZA 3UKNA 4ZYEA 4XFGA 4RAYA 4HSLA 4MZUA 4UV8A 2ZMEB 2B8MA 4LFUA 2GA1A 2VONA 4MGZE 4CGZA 4IJAA 1B59A 5HS8A 2I45A 4LTAA 2YR2A 1RTVA 1B1BA 2YSRA 4L0ZB 5CU1A 2FBHA 4MEXF 4BHPA 3EQLF 3BY6A 4LK1F 4HQMA 1ZARA 5H6QA 4HX7A 3W6KB 3RYPA 1BBYA 1TW2A 1Y9QA 1YW7A 3HOTA 4K2EA 3O14A 5CYVA 2IXIA 1S8NA 3GFLA 3EJKA 4EQQA 4L18B 3P9CA 2XLFA 4LG0A 3ULQB 1J58A 4XFIA 3BJ6A 4HVOA 4A5MA 1FWZA 4LLNA 2VECA 1Y0UA 2OD5A 3E6DA 3O6BB 2RKHA 3I59B 2HOEA 4G7OF 4IVNA 3S2WA 3WE3A 4ESJA 3SCGA 1XN7A 4A6EA 3KP5A 4ENMA 5D6EA 1NXMA 1RI7A 3R60A 3E97A 3F8BA 4IPAA 2CQKA 3F8NA 3JAMZ 4ORFA 4UXAA 4P96A 5LHHA 3D0SA 5CVIA 2BNMA 1B9MA 3HRSA 3R4KA 4ZU5A 2R7DA 2VQAA 3GBFA 3CTAA 1R5GA 1OI6A 1Z9CA 1Z05A 3ISPA 1YFUA 1A04A 4MTDA 2PAMA 3KZYA 5D8LB 4I0AA 1HW5A 1BIAA 4IEPA 2UY8A 4XETA 3KMHA 2H94A 4RB3C 2D5FA 2OZUA 4DNCA 2H09A 2EFWA 3D0JA 2KRFA 3RYRA 4HA8A 2XAGA 2GQQA 2ESHA 2V6CA 1RZ4A 1NYWA 1ON1A 1DPUA 3L2HA 2JRTA 1TNTA 1NZCA 5ICCA 3LAPA 2D2WA 3WW3A 3QPTA 4XF4A 3K2ZA 3F22A 4UUVA 2O61A 2PLYA 4XRFA 1U5TA 3V4GA 1BI3A 1TLHB 3ES1A 5T3NA 2XASA 1HKTA 4ESFA 1GVJA 3V8KA 5FCCA 1LRHA 3H7JA 2QNKA 4HLYA 3RKWA 4XSXF 4MQVA 4FHTA 3CUOA 3L7WA 4OMZA 2FBKA 2QUFA 4ENNA 4HLTA 1V3FA 2AXLA 5ILUA 2DU9A 3IKVA 3EYIA 2YX7A 1IZ1A 3C7JA 1MD0A 4FX0A 1S7AA 2L4MA 3CL1A 4XFFA 4XSZF 2QCSB 2BEOA 2XVCA 2D5HA 2PYTA 1RUOA 5DCFA 2FA5A 2BBYA 2Z3YA 1ZAOA 3C3WA 4RB1A 2M45A 3M3IA 3KLNA 2IA0A 3N97A 4JTNA 5LHGA 3ROUA 3DFGA 2IXCA 2PHDA 4N0BA 1OKRA 3J7AO 2FQPA 1IXCA 2L3DA 3H50A 4GYGA 4EJVA 1KU7A 3KETA 4P55A 3G73A 1PM7A 4P9FA 3ABUA 3V7CA 5KBFA 2HTJA 3JTHA 3HTSB 4S04A 2OBPA 1QNTA 5I0RA 4JTOA 4MGRA 4HYEA 3CO7C 2WC2A 4GO1A 5KK1A 3IBMA 3CF6E 3D82A 2TDXA 2UYAA 1DGWA 3PFIA 2L02A 4ZU7A 2K7LA 2F2EA 3H92A 4M71A 2PQQA 2E7WA 2Q0OA 4YARA 4EJUA 1ZYRF 4KA4A 5E8IA 1YIOA 1P6RA 4GYIA 2ZKZA 4WBBA 2Q8KA 1UIJA 3MDPA 3GZ6A 1SMTA 2HYGD 4Q4ZF 3L00A 5BV6A 4AVBA 3BP8A 1AOYA 1W7PB 2P7VB 4G9YA 5BXXA 2YPRA 3DV8A 5I91A 2EFQA 3MAJA 4F7ZA 2RGVA 3MCZA 1EPZA 2P6TA 3BJOA 2ETHA 4LK0F 3KP2A 3ABTA 5FLJA
chains in the Genus database with same CATH superfamily
4PDKA 2R3SA 3HQRA 4A41A 4UI9L 1NG6A 4FPOB 1ETVA 1VP6A 2B9UA 2W91A 3O1RA 3MZ8A 4RR3B 4XUOA 1MNDA 1TQIA 1ZG5A 4NE9A 5FZBA 5D5VB 4YVWC 4Q0VA 4YFNF 4KYWA 2W48A 4NHYA 2JG9A 3H0DA 2A71A 1P2FA 1AX0A 1JI6A 2K4BA 4BB3A 1VBC3 2QBYB 3AB0A 4YM1A 3I58A 2Q1ZB 2VOWA 4CDWC 5FRNA 2Z16A 4XQFA 3SNMA 3H9QA 3IMNA 1OOPB 4IEYA 4QGNA 1IDYA 3RI9A 1TEIA 1PDNC 1XG1A 3TEXA 1GANA 5DS9A 1RUD3 3ZXFA 3BG3A 4AI2A 1W6OB 4RGUA 3ZYPA 3M9AA 3ZOBA 3KE2A 3QOPA 5EWSA 3WUCA 4A3MJ 4JHZA 5GLVA 1D4M3 3OSDA 1RETA 1OA2A 5FXXA 1OD3A 2A61A 1SDDB 4O65A 1RNLA 1PUEE 3M3YJ 2M8EA 3AP9A 4MGKE 3H8RA 2AREA 1H1AA 2JE9A 5TSWA 2W82A 1UMHA 5CVRA 1UWWA 4DOUA 4QHOA 5GKAC 3CC4I 3LGRA 3EHKA 1C1LA 1IG0A 3UJQA 4ARYA 4IE4A 4EGYA 2Z69A 2RREA 4K6BA 4XJUA 3BIEA 1LVKA 5GM0A 2PMZA 3GTPJ 4K8FA 1VR3A 4RS5B 3ZMDA 4OUEA 4AIDA 1OYYA 2ILMA 1JZ3A 4A6DA 2AQFA 3FXOA 3VB2A 2PA7A 4O5VA 2QQWA 3F8CA 1POV3 3OYBA 1MEC3 5C6CA 5JUVA 2NS7A 3HOBA 2KA3A 2QQLA 1GZWB 9ANTA 5FRAA 3FMGA 4GMP0 5CLSA 4N7IA 1GR3A 1SFXA 1UYZA 3KGLA 4JKKA 1C5HA 4DBRA 2FDJA 1K6OA 1RUC3 3KYDB 5BPDA 5GZFA 2R16A 4FISA 2HEOA 4N43C 3EYYA 3CCLI 1XC5A 4U0VA 4B4PA 2E51A 3WF4A 2ZZQA 1XNDA 4NUBA 2FF4A 3USUA 2RJKA 5CNAA 3OOUA 4OVEA 1PGL2 2E2HJ 1O59A 5BNPB 1U5ZA 3K3OA 1N78A 3ZN6B 1TBXA 3JZVA 3BZ6A 4YG0A 4XXPA 3OUJA 4AIJA 5H9QA 2L5QA 2L9RA 3G3ZA 3QRFF 1N1TA 2GP5A 2VZVA 2Z5UA 1D8KA 2HWVA 2HBUA 1Y9GA 2ZXIA 4BQQA 5FOBB 5A70A 2HWD2 4OOIA 1LODA 3AFHA 3ONQA 5A7WA 5C5UA 4CDGA 5A2QZ 2FX0A 2OUHA 3HOSA 4D7TA 2OYZA 1CF7B 2DBBA 2IS1A 4L2NA 2R042 2ZGTA 2H1LA 3J8F3 3LCPA 4OLLA 1MJBA 1PO12 1JE8A 3IPVB 1DP3A 4UW6A 2IVIB 1ZLJA 1LB2A 4LD5A 5DUKA 3F6OA 4MYEA 1QXJA 1L7RA 3UETA 2VW2A 2AGSA 3WQ0A 3U14A 2PAEA 5HNHA 3WZ1A 1NCQC 2GNDA 4QPIA 2O0OA 4OI1A 5CKMA 2LF8A 3RDIA 4KFCA 2DOAA 4Y33A 1QOOA 4FPLA 2V1DA 5LA1A 1FBSA 2K4JA 5E3NA 1APNA 2FQ4A 4CDWA 1VBE1 4A3KJ 4O9EA 3FXQA 1VB4A 3I4NJ 4JRLA 1ZLKA 3KVBA 3QU3A 2A3SA 4MGSA 4P9YA 4C0BA 2COMA 2JSPA 1BBT3 5F5IA 4GJYA 5FKOA 5FROA 2WV1A 2OUMA 4CUBA 2A69F 4LEJA 1FPN3 2CU5A 3PUAA 4KITB 3IIAA 4ZKTB 4LORA 4HG2A 4IO9F 1D0GA 3O3KA 4C1WA 5J36A 1JTXA 3UK9A 5L3FA 3DKWA 4D8MA 1DGRA 3F8MA 3GTOJ 1W2OA 3RCOA 1KS5A 3BZCA 4EVIA 4KMQA 2NLRA 4Q4Y3 2ZB9A 5FYZA 1YQ6A 3E6CC 3BOPA 2ZXHA 3B02A 2KDZA 2OU2A 3N7JA 2JUCA 2VMIA 3CUQB 3LSRA 2D98A 1KONA 4XXAA 1YFWA 1Z6RA 5EEAA 2MBFA 3ZQCA 4UFLA 4XKBA 2D3SA 3MI8A 1FLIA 1O3QA 1F1ZA 2IXSA 4OMYA 2PMWB 4QMAA 1PVC3 3ENRA 1KA8A 3NJYA 4BE3A 1WD4A 5CAZA 1X8EA 5HDNA 2DPUA 3LWCA 4RS8A 3OSGA 5FY7A 3SH3A 4X1EA 2V9KA 3RPQA 3OYIA 4OZXA 4RLQA 1ODMA 1K83J 1YS6A 2H8WA 4GD4A 1GMMA 2ZGSA 2E36A 2DODA 2GU9A 5K5QA 2OJED 1TC3C 3G2BA 3PJYA 1X1CA 5I0DA 4XOGA 2QVSB 5FBZA 3WP4A 4CYDA 2R7RA 2JA7J 1PO21 2PHRA 3WNMA 4XQ4A 2ZGPA 4MIMA 3ZFEC 3M8JA 4Q0SA 1O7LA 1OJLA 1UKGA 1K5MC 1T6BX 1TNRA 1YYVA 2DCEA 2DFBA 2QQVA 4UF0A 2WN2A 2VUCA 5FMBA 2DUOA 3KHCA 1HB4A 1IXSB 4NNJA 1TWCJ 2F5VA 1H6YA 3W58A 3WGHA 2R7EB 5JVVA 2ZBKA 4LJZF 3CMGA 4JX0A 2ADEA 5E1RA 3W21A 3VBSC 1FYLA 3S2DJ 1ZTRA 3ZXJA 3CMEI 4CUCA 4U88A 2DWRA 2Q0AA 4EN6B 3I0TA 3QYBA 3WHUA 4LO5B 3JD73 3AXDA 4CP9B 3OB8A 5KC5A 4HNVA 1B8IB 2VODA 3S15J 1G9BA 3HQUA 5BOXA 2AXTC 3REOA 1MSEC 2G4IA 3ZQIA 5F32A 1KQ9A 1CQTA 4KWUA 4D7NA 1QF3A 1Z3XA 1ZH5A 3W9AA 4DS0A 2EIJH 1BYHA 3VBRA 3UKVA 3P3NA 1DBNA 2J5OA 2FBIA 3CP2A 3LKJA 5DUWA 4RR3C 3K4BA 5FZ1A 3R6SA 4XJWA 1D1AA 4JV4A 1M4WA 3KEOA 1OA3A 2WIIB 3LSPA 1ZK8A 1OQYA 1P9QC 1IPSA 3PUIA 5FWEA 4BQOA 4N53A 4YFZA 3ZSKA 1OOPC 4UFHA 5JHFA 3IMMA 4RHV1 2O1QA 3HXLA 2XVKA 2LR8A 1NA1C 3PVNA 1TVGA 2Y6HA 1GQHA 5DM7F 2HH9A 1E0EA 2EVXA 1X82A 4JQRA 2JDHA 5JR2A 3NEUA 2HZDA 3MPPG 4FFIA 1QJX3 1CAVB 5IHRA 1UU4A 2HVQA 1LPQA 1R091 1ZGAA 4CDXB 3QP5A 2YZ4A 3MFCA 1FTTA 5B5EC 1X4PA 1VQOI 4CRQA 1E3OC 2GXAA 5L9VA 1H2LA 1H2NA 2F5FA 1XYOA 3Q3SA 3DKXA 5J3LA 5F1RA 2B9VA 2E7TA 2RAEA 5DPNA 3SZTA 1SDWA 2Y33A 3WG9A 1KJLA 1ACCA 2RVCA 4OYUA 2ZAHA 3AMNA 3VKFC 2W0XA 4JX6A 1HDPA 3E5XA 4QPOA 4RS5C 2Y0MA 3C7OA 2Q4SA 3RKQA 1ZBA3 3IAQA 4ONUA 1UPIA 4JAAA 5FPVA 3I56I 5ABJB 1OD5A 1AR83 2ZKNA 3K2OA 3LFMA 3FXMA 1TQPA 2CV1A 1ND2B 4QM8A 1SVOA 4CU8A 4B4CA 2RMU2 3SFIA 2W46A 2B63J 3APBA 1MMSA 1RMU2 4CZSA 4DQAA 1UG0A 2VCMA 2R0FA 4DXSA 1ITYA 5JXJA 3ZFEA 2VH9A 3ZIXA 4BLJA 3CIHA 1J5YA 3EQEA 3BKZA 5DZGA 4YRVA 3RGBA 1QY4A 5FQ0B 5F1JA 3TRSB 5F27A 4XAEA 1SAXA 3LNQA 4PJLA 3AMQA 5GLWA 5D4RA 2L7FP 3H7YA 2C5DA 4IHXA 3GGLA 2UWBA 5C8WA 3BR1A 1RUG1 5IOYA 2H8RA 3U2RA 1JTZX 5K0UB 2UY9A 1AR62 3KT4A 1SEFA 3MW2A 5I8SA 2ZJRF 4IE7A 1YRNB 1QJY3 3ZYRA 5ICGA 4BM8A 4FTSA 3POGA 1UF2C 4HV6A 2HLEA 2ZHLA 4MO7A 4YW1A 3GZEA 5BMZA 4C8DA 1ASJ2 4CU7A 1SLTA 3IAPA 1VRH1 3NJXA 3OGGA 4Y22A 3IM0A 4E2GA 2P81A 3K7AJ 4YM0A 2J7MA 4YFWA 4EZ4A 1VAVA 4CA0A 4FPCA 4A3ZA 1FMVA 2WV0A 4QGMA 4FE4A 5FLIA 5CFCC 2RM23 1VBA1 2DDUA 2XHKA 2GMEA 4M3CB 3TGNA 3SDGA 1HBXG 4GB33 3I3LA 5DG2A 2KXLA 2ZGLA 2ZACA 2FE3A 5FZ9A 2WAEA 2A6WA 3VLBB 2F5DA 4RR3A 2JSCA 3H0OA 2WAFA 5KWRA 5M5YJ 2W1QA 1NY71 4RQPC 2EALA 2DCZA 3MBWA 3SQNA 2BE5F 4WVMB 4KWLA 2DFCA 1TWFJ 3A0BC 2GDFA 1X19A 1VF9A 2QBYA 1AZDA 3AKQA 5FK8A 5JCTA 4K20A 3CZJA 1OOPA 2VBBA 3OV8A 5CVJA 5I0SA 5L7OC 1UD1A 1OVPA 2XJTA 3WG1A 3EETA 2VUDA 3OCPA 4CUAA 3OYWA 3ASNH 2DA3A 2W1SA 1VQLI 5DYMA 4HAMA 5F0FA 3SEEA 2L9SA 2QLZA 3LE0A 1W6OA 5AVAA 1IDZA 2R32A 2CQQA 4UXNA 3OYDA 1X9PA 2V9PA 2JDZA 1U5TC 4MV2A 2HWB1 1NG0A 5FYIA 2PLV2 4K21A 3RS6A 3CCUI 2JDKA 3IP4B 1BJQA 4L9TA 2L4AA 4YGDA 2V4AA 2OVUA 2ZX2A 4TWTA 3WHTA 4C0HA 4Y4RA 3PL0A 3IDBB 1RR7A 3GEZA 1YXWA 4LMYA 3K4LA 1CX4A 4M6VA 3WTWC 1VBB2 3VBHB 3SLIA 1YCIA 1HLCA 3EXUA 2EV6A 1S4CA 1AKHA 1QJEA 2EIGA 4GQ7A 1G3YA 3V56A 2LROA 3QPHA 5M3MJ 2XBO1 2YS9A 3I8TA 3GTJJ 3D8CA 3RZOJ 4Q5SF 3OYJA 1UYPA 4YG6A 4XUQA 3PFYA 2V1UA 2VOVA 2G0EA 3WP5A 1FOD3 1GZWA 3JUUA 2HOSA 2A6HF 2D40A 4H2AA 3OSFA 3BG5A 2GNTA 3GHNA 4A12A 4Y5Z0 3POBA 1LFUP 4S2HA 1JHNA 2J1UA 2GOMA 1SLCA 1FBUA 2WZR1 3FC0A 5E3LA 4P9WA 5FWJA 4XYXA 2OPTA 2QDRA 4QWNA 1R23A 1AR71 5BNPA 2R7FA 2VMDA 2JE7A 4A0XA 3ZN6A 3PM1A 2RC4A 4AEKA 4HPQA 4W6YA 1ZA4A 1ODDA 2XAQA 2EA4A 1VMHA 1HKQA 3VD3A 3TO7A 2J5PA 1V54H 4Z2AA 1QWRA 2ZGRA 2WAAA 3CMMA 3WTVC 3PTRB 5HS7A 2P3YA 2W25A 1A6CA 2Y64A 2VMEA 1DUXC 4M74A 4RFT0 3CMYA 2ZXQA 4LBMA 1YWKA 4LLFA 1PP7U 1CF7A 2H6CA 3POYA 2UWCA 5DQ0A 2LREA 3BTJA 2JA8J 3SQOA 3NNJA 3FM5A 1K7AA 4LB5A 2K0GA 1W0PA 3TQNA 4IGQA 2ETEA 1OKQA 1MBFA 4ZJZA 4JX4A 3IPVA 2E2IJ 5DG1A 4R52A 4GFBA 1ZGJA 5FY4A 2E2JJ 4TV7A 1ETOA 1D2QA 4P5YA 4H7LA 3F23A 3RNSA 4AGGA 2NMNA 4QT6A 4ES9A 1C3HA 2LMDA 1O5UA 1IPKA 1REDA 3WNXA 2KIQA 2HJIA 2W3JA 3SEZA 1FYMA 5JAXA 3JRBA 2DDAA 1YQAA 5FUIA 3OYKA 1N3OA 3BPZA 4IEWA 4HSRA 4MHUA 4UNOA 2FMDA 3WXPA 3V7RA 2N8GA 3S17J 4BK5A 1LEMA 2VJIA 3R4SA 4D7YA 1S3JA 2CQ7A 1Y39A 2Z5WA 3OUHA 3MIFA 2HOAA 1IQDC 4XMAA 4Q4V3 4CDUB 4LBKA 4U87A 3M1CA 4Y1YA 3Q8FA 2ZHKA 2G9FA 1FZPB 1Q5OA 3GNEA 2A6EF 4CDXC 3J26N 4YW7A 3S57A 1HXDA 5LEJA 5A3OA 4PIXA 4N9IA 5JFRA 1GZTA 2ET7A 1WLCA 3GTLJ 4GJZA 1GNHA 3HPHA 4A42A 4D94A 5IOZA 1VQ9I 4YW4A 2CNAA 2J1SA 4AVZA 4IE0A 3J7NA 1POV0 1UQXA 2GH2A 5FRMA 4W1UA 3CUQA 3HRMA 1G3WA 1UY4A 5K8SA 3BROA 4AD9A 1PIV2 3C7EA 1G3TA 2M3AA 3HBKA 3LD8A 3TOJA 3FN9A 2F6CA 1ZG1A 1BEV3 4XTMA 5DZEA 4FFFA 4XOTA 2D6LX 1JMUB 2G19A 3SJMA 3HPNA 4ZS3A 2IWGB 2PHLA 2WNVB 2ARCA 2ZC2A 3CDIA 3A02A 3ZYJB 3OBRA 1Y8QB 1AXYA 1QU0A 5ABJC 4FAGA 3O0WA 3GZUC 5J8FA 2WDBA 1BMV2 2O9LA 4Y13A 1CIYA 4I3PA 5CKNA 1YS7A 2GC0A 2HKXA 2DW4A 1OCOH 2E1OA 5GPCA 4KISA 4IEUA 5B4NA 2TUNA 3JBG3 4A7ZA 2CUFA 4YM3A 2JKXA 3WCSA 4A3GJ 1RUE1 2VTXJ 3E1F1 2RE9A 3T1LA 3OG2A 4Q4X2 2FZ2A 4V2VA 5CG8A 1IN5A 3MKLA 1GP6A 1KDMA 5J40A 4NC6A 3BR3A 2Y34A 1C1FA 3VBUC 1GDTA 4HBLA 1S2KA 3JQXA 3IN9A 1BR1A 1QU3A 4HF1A 1XRUA 2VCAA 5K0UC 2XHNA 5DTDA 4URAA 3OGRA 1P7IA 1JUHA 1VLNA 4CP9A 2P8TA 5B4XA 1B8IA 2UWMA 3V65A 4ESBA 3TEYA 2ZJCA 4LHKA 2QZ8A 5G04L 3BU7A 4A7YA 3DXJF 3ZQ7A 3PDQA 3T0AA 2VXDA 3VBOB 4IEXA 4ZYHA 1UIKA 1AUYA 3M1EA 3M8EA 1UNBA 3W59A 3NWSA 1HRV3 4MFDA 4JHTA 2FD8A 1OLQA 1JZ7A 1QDCA 3NWTA 1FT9A 1KEXA 4P9IA 4LBQB 2Z33A 4AVCA 3MKYB 4BUPA 4AQTA 4KWJA 3EUHC 3AVRA 1K5JA 4IF4A 4Y1XA 3E1SA 4UT5A 3PNTA 1KU9A 3FBNB 5CJ9A 2BGCA 1HRI3 2R7OA 4L5EA 4QXHA 5FZ4A 1MMGA 2XGEA 3MZYA 4C2TA 1CZSA 2HPMA 1C57A 1REPC 3WTUC 3FE5A 3JR9A 1IQAA 1WD3A 4CEYB 1ULGA 4C3JJ 3NV2A 2WY8Q 1PM4A 2A05A 1U0AA 2WFF3 2DMTA 3ZXKA 2VC0A 4CDXA 4BHBA 3DPLC 2X5IB 1H30A 3WTZA 2ZABA 4P02B 3I64A 4N90A 1A78A 1MS9A 4HX4A 1IG3A 4I09A 1WJBA 4Q4W3 1W7PD 4CHUA 1IGOA 3VDDB 3AZZA 3RZHA 3RTRA 2LNBA 4E8DA 4D6QA 4G12A 4LOSA 2ATFA 1H8TB 5JIAA 3HUGA 4B7KA 4YW5A 4LHLA 4NR1A 3VBHC 1QNYA 3JRFA 1IUYA 5HS9A 3HT2A 3RZMA 1QGLA 2IJLA 3AZVA 1DG6A 3TW7A 4A0ZA 1LOFC 3UT0A 1ULOA 1ND2A 4RGAA 2BJSA 4H3WA 1XYPA 2A6TA 5IK8A 3BJAA 2MH9A 5DXDA 1U3EM 1DQ1A 4PJYA 1UHMA 3VDAA 1AX2A 3KSCA 2Z42A 4P9UA 2XAUA 2HOTA 3FHAA 4CCEA 2F4IA 4FASD 5EG0A 1UN1A 4OAYA 1W2AX 2ZOEB 5FY1A 2JIJA 1YI9A 2ZA9A 3VSKA 1UELB 4YFKF 1CONA 4RGGA 1UX6A 2WQ4A 2BVVA 2EA7A 2XRLA 2DF7A 1OLRA 3CQZJ 1YQ8A 3MD2A 1P4XA 5FQ0A 3TB0A 4UVAA 1SQ4A 1LEDA 3G1LA 2ZS6B 2R0QC 3MVPA 1Y8RB 3URFA 2EB7A 2BGPA 1S2EA 5C3RA 1MMNA 4NIHA 1S0BA 5IVEA 2X85A 4HDVA 1X3WB 2IGMA 1ZBE2 2R4GA 4HFSA 1ENXA 2V1NA 3ZP5A 2JENA 4E4SA 5E20A 2M8GX 4EM0B 2E7AA 1V6NA 5E79C 3T5XA 1PX3A 3KQ4B 1YRNA 4QX7A 2QM3A 2L9LA 4EMSA 1OMIA 2LF7A 2EIKH 4XDPA 3LSMA 3ZYBA 3AJZA 3SEPA 2FDHA 4W4ZA 2TCTA 2OA4A 3FISA 1A6QA 4I01A 4GKYA 4OHZA 3CLOA 1XBFA 4DZJA 3AJYA 4B3AA 4YEJA 5T54A 3HYIA 3RJRA 5A7PA 4M3CA 5FP4A 1VMJA 1JKPC 2A6VA 1W3XA 3V0BA 4KQ7A 3UKNA 3FKJA 5GADJ 4RAYA 4HSLA 4MZUA 2FD5A 2LK2A 4IGOA 3MLLA 3GHMA 1VBC1 2VONA 5LBEA 4NPLA 1B59A 4Y4YA 3LOBA 2YSRA 5CU1A 1X3ZB 5FYVA 4B7EA 3MW3A 4WVMA 2E6VA 4BHPA 2AO9A 3AM2A 2VUAA 4RA2A 1ZARA 4XLHA 2R5ZB 3DYMA 5H6QA 4HX7A 5TISC 1FTZA 2VKHA 1RUD1 4UYBA 3RYPA 5FY8A 3WF2A 4JDMA 1TW2A 2JK3A 2JWTA 5FZLA 2X1DA 1FMD3 4E4HA 3VZOA 4EQQA 4CDQB 1V5GA 4NO4A 4HVOA 1FWZA 2QQ8A 1D4M1 4CDUC 4E7HA 4LO8A 1GZCA 5D8AB 2WL1A 2RKHA 2XJPA 4IVNA 4JC1A 3ZPOA 2R1DA 5A1AA 2JB4A 4JKLA 1RUH2 1DHKB 3K4NA 2C26A 2W95A 3R60A 3JB4C 1T08B 1TZOA 2YXSA 4ORFA 4UXAA 5LHHA 4FPEA 1EKEA 2BNMA 3N36A 2ZEYA 2W92A 3GTMJ 3I2FA 3CJQB 3GBFA 2R1BA 3VBFB 1SLAA 2RDSA 3OR2C 4MTDA 2LFBA 5F0HA 1W28A 3AG1H 3DU6A 3KZYA 5D8LB 4BMEA 4A7KA 2UY8A 1QMJA 5LCWL 1JBCA 3KMHA 3WY6A 1POV1 3OGVA 1MEC1 3ZQGA 2Z79A 4DNCA 2OC6A 5HXMA 3WHBA 2EFWA 2WNVC 1BXHA 3RG0A 2KRFA 2XAGA 1HKDA 1NYWA 1DPUA 3WNLA 1RUC1 2W39A 2O7OA 4RDUA 2B7YA 3WW3A 4UAPA 4OHXA 1KFXL 3K2ZA 3ILFA 4UUVA 4XRFA 5C8CA 3V4GA 1BI3A 1TLHB 5T52A 1HKTA 4INDA 2BFUL 1Q8QA 3ZR8X 1DGLA 2XVGA 2MEV2 1MBHA 3L7WA 1AJKA 4OMZA 3I2IA 1YQ2A 1V3FA 3IKVA 3HJRA 1IZ1A 2Q8CA 1P8JA 2CYFA 4Y26A 3B94A 3ACFA 2QCSB 1GUIA 2D5HA 3AYDA 3W3CA 3LSHA 2BOJA 1RUOA 2CH0A 2BBYA 2LH9A 1ZAOA 4RB1A 3N97A 2IA0A 1WMXA 2XUMA 3VHOA 3CLQA 3M3OA 4FPHA 3PVOA 1RESA 3M2MA 1IXCA 4GYGA 4EJVA 1KU7A 2LY9A 1PJRA 3G73A 1PM7A 3J8F1 3JRDA 1ND3C 1MBEA 3HL2A 2W68A 3TN92 3HD8B 3G6JB 3JTHA 1GT0C 1QNTA 2JN6A 5FZHA 4YZ1A 1QVUA 3EYPA 2WC2A 3VGIA 4IE6A 1IHMA 4E7JA 2UYAA 4IX7A 4WM8B 4E4DX 3CDLA 4BE0A 4ZU7A 3PL8A 5IP6A 4FO9A 2DVAA 4XBLA 2ADDA 1BW5A 1QZEA 3K4JA 1W0UA 1B35C 2ZKZA 5FBJA 1WGXA 1JW6A 1DU0A 3AK0A 3L00A 1IRXA 4NHLA 3MV01 4AVBA 5GZCA 3BP8A 1AOYA 4G9YA 5BXXA 4EZHA 1IG7A 5A7SA 5I91A 2EFQA 1CD3G 1BBT1 3GCXA 3KP2A 4JYKA 1FPN1 3AMHA 3VV1A 1C8M2 4AF9A 3L1PA 5B1BH 3KQRA 5LWBA 1LCLA 2IC1A 4CDUA 3OPWA 4CEYC 2WLQA 2GP3A 2SBAA 5ED4A 1IF1A 4XJ9A 1A8DA 3K10A 1SD6A 1G59A 3H1YA 3PSIA 1LU1A 3AP7A 1ZX5A 4Q4Y1 3F6VA 3NKGA 3F3XA 4AU7A 4FQZA 2I10A 2BY2A 4FCAA 4R79A 1FSEA 4ET7A 1DPRA 4I76A 3NRVA 3LF7A 1W9YA 3VDDC 3TW6A 5AIPA 3ITQA 4CA9A 4IEOA 5JR3A 3P5BA 3B01A 1PVC1 4GWMA 1XGOA 1K79A 5K7ZA 1H8TC 2XL7A 5JDBA 2R93J 4ES8A 2QQAA 3KV5A 4FXKB 3LQQA 2AEZA 3ZDVA 5GLTA 1DLLA 1S7EA 4PLOA 4JGYA 2BPA2 1WJEA 2K3FA 1V9U2 1EH8A 4XF0A 5HV0A 2WNVA 3IT8A 4IHVA 4K3UA 1XJAA 2LRPA 3EBRA 5HDKA 4I99C 1Z91A 2NS8A 1DF0A 3AG3H 2PEXA 1X1BA 4EYUA 1SEUA 2E26A 1SFNA 2ZX0A 2PELA 3BCAA 3QD6A 3NWKA 4JBAA 3GTGJ 1W05A 3VKLA 1WJFA 3AKPA 3WGIA 1XX5A 1OURA 1CPMA 3N9QA 3VWBA 3R61A 1IS3A 1DQ5A 2DVDA 1AYN3 1EUTA 4HOOA 4JVAA 2GALA 1FOWA 1LNSA 4AEDB 2OQ6A 2D6KA 1Y1WJ 1E5RA 4D69A 4XVHA 1UXZA 4E7IA 3BZKA 1R1A2 5JVTA 1ONAA 3K70D 1FSHA 3KV6A 1PO23 3HHGA 3AP4A 4AR2A 2ME0A 3JAMK 2VBDA 5EYRA 4P9LA 4D9JA 2BGOA 1YFYA 4IHTA 5J98B 4ANJA 5CQGA 3JD71 1H1MA 3ZQFA 3P6BA 2FCTA 2FNPA 4UUSA 1GOGA 4OHVA 2JX9A 4NOTA 1UKRA 1ETXA 4NC8A 1EAH2 4UB6C 3IDCB 1F36A 4A3EJ 1W8OA 1I1EA 1T95A 3W2WA 1SACA 1JYVA 2QQBA 2WQ8A 3PUBA 4LULA 4IRIA 4DYRA 1S5LC 1W06A 3VBOA 4QB1A 4CCOA 2GC3A 1FPQA 3KP6A 2VOOA 3RVHA 1QJZA 2BU9A 3DEMA 2D1VA 1RYYA 3LWFA 5HLGA 1AVBA 4EJWA 1L3LA 2EWNA 4LBQA 2B4KA 2R7QA 2EJRA 2EV0A 4U7BA 1ZHFA 1HLVA 5ACA3 1RUJ3 3A0KA 4OMDA 1DU3D 1JHJA 4N4NB 4XUPA 1H89C 2R6QA 2VC9A 5LFAA 5D5WB 4PDWC 1XMKA 1QJX1 2JA6J 4CCLA 4IW3A 2Y31A 4CEYA 3FHIB 5J1RA 5FO7B 2CJJA 2IA2A 1VALA 2W94A 2A6ZA 2ZTNA 4LKSA 5DZFA 5LBCA 1XB4A 4RHV3 3K4CA 2R073 4LBNA 2NOGA 4YIIA 3WV6A 3KD4A 4MX3A 2X5IA 4EWAA 2RR12 1S0JA 2RNGA 4QHZA 4GGGA 1SD5A 4YVSB 4G7ZF 4BJ6C 3HSFA 5HCBA 4GXOA 4O3MA 2EILH 2EH3A 5FZDA 2Y8KA 3CESA 1WLDA 3RKYA 5DUVA 2W47A 2QA4I 5A3UA 2DCTA 1X58A 3ZN4A 1IS6A 2JUGA 1REEA 5IATA 5GTIC 1DZRA 2RS13 1ZBA1 3KYCB 4X6RB 5CADA 3DF0A 3ZMTA 3L2QA 3CZ6A 2KJCA 2M0MA 4I0BA 3WQ7A 1G9CA 1YJ9I 2XUEA 1AR81 5EYYA 3O1OA 1JHFA 1UAAA 2C1FA 1Z1DA 2BNNA 4I30A 3L2UA 3N4MA 2WZ8A 3Q9OA 1MJ9A 2VB6A 5HPOA 1KRIA 2VE1A 5T55A 4CVUA 4HXCA 3K2AA 1QJU2 2AC1A 3IRRA 2YG0A 4ZDLA 3WCRA 5TGTA 2XAFA 3FZVA 2HWF2 1YJNI 1RUNA 2VY0A 2J1AA 2EINH 2QSGX 1MW7A 3LMMA 3N05A 2JVGA 4PK4A 2C4XA 4U36A 1W5SA 2NVYJ 4Q0UA 3ZXEA 4AYBA 1VQKI 4RGXA 4KGGA 4XLPF 2PAKA 3UGFA 3FXRA 2AYHA 4GMP3 4PBPA 4P00B 3T2PA 4HV5A 4FOWA 1QJY1 5DN2A 4FXGB 1WJAA 4XEZA 2HFHA 5JSRA 4BQ4A 1R1ZA 3ERED 3T4VA 3Q8AA 3POSA 2E53A 1OFNA 5EV7A 4XORA 1B72B 4FPYA 1WA6X 3WP6A 1KYWA 5D2AA 3THTA 3WR0A 2RM21 3HMYA 1RC9A 3LFIA 1JYNA 5D6FA 1H9GA 1PNFA 2G7UA 2LW8A 2PHXA 3FKIJ 1PVEA 2HKOA 4GB31 4AAXA 1IS4A 1Q8OA 3E5QA 1Y43B 2YV8A 3KIOA 1TME2 5CIRA 3OOXA 5A7OA 1RUI2 4LG3A 5KVRA 4I98B 4BBSJ 2LOOA 3HTUA 3H9AA 4QDRA 2K3PA 4ZXKA 5F3EA 3BU0A 2NAZA 2B45X 4WXCA 3NV1A 3T8TA 3SCFA 2EV5A 3RYKA 3FX3A 4AI0A 1SVMA 2VZ3A 5FPZA 3H5NA 3OD0A 4HKOA 4ARXA 3WODF 3F8FA 5FDBA 1YIFA 4OAZA 3NV4A 1MKMA 2NYYA 4G8XA 1GOFA 5L36A 2ID4A 2JG9B 3D5RC 2R5ZA 1JXNA 3HB9A 1X36A 1DYPA 1T98A 1XSDA 3O1VA 4CDQA 2RS53 5KNLA 1KDKA 4WVZA 4I2OA 1YJLA 5AC92 4FPKA 2OCCH 4L9VA 2DTRA 2XH6A 5D8AA 2ZCWA 2ZGNA 3DF8A 4ZTFA 5HLIA 3W2VA 1V6OA 1W03A 4IOAF 4G6QA 1V5FA 2ME6A 3GW2A 3S1MJ 3ORJA 2BP6A 5AFEA 1KITA 3FF5A 3HVDA 4A69C 2MABA 2QYOA 3LFUA 4RLFA 3F72A 2BY0A 1FAYA 3WEZA 1HDKA 5A6QA 3VBFA 3OS1A 3B7MA 3RZKA 3M07A 5I93A 5IK4A 4G9SB 1LNWA 4LO7A 3BG9A 1NZIA 1W0OA 3NW4A 4LHNA 2ISZA 1QZZA 3CJTB 5DDJ3 4BAYA 4KN7X 2QKLB 2JTVA 2PMZN 2ZNZA 2YU3A 4QU1A 4WX9A 1SANA 1ZKGA 1FOD1 2KIFA 3HN3A 4KU7A 1QJFA 3DXTA 4MXVA 2VM9A 1ZZ7A 3D4KA 1MS0A 4JK1X 3MLKA 1VBD3 3UR3C 1ASJ1 1WJCA 3DTEA 5C3OA 2GN7A 1RUF2 4FE7A 1PZ9A 1LHVA 2OXBA 4IDZA 4G4FA 4BQ1A 2DBNA 1DIWA 2JWPA 4GALA 2JDYA 3I3DA 3W6JB 3CJRB 2HI3A 2XONA 1U8RA 5C5TA 4XFHA 4JQTA 2O5RA 5IWFA 2NQYA 4HL0A 4AEDC 2AH2A 1I3HA 4WM7B 1BIBA 2ZXWH 2Y0SA 2QDNA 3ETQA 2JPCA 2VULA 1BI0A 4L9NA 4FCYA 2XGCA 3O7OA 1J7KA 3ZSEA 3ZYGA 1Y1VJ 2ARAA 3B00A 5FXWA 4Z1VA 5EF6A 1JZ4A 4XLNF 2K86A 2ZAAA 5E3OA 1GQPA 3BCWA 5GLUA 4AHXA 1URXA 3POEA 1K4SA 5FYTA 4IXAA 1YFHA 3MW4A 3GBGA 5HOOA 5FD6A 2VZPA 3TNQA 2B46X 3BTXA 3OIPA 1R082 2HDCA 2VVDA 3GVAA 2QQPA 1GSLA 4MADA 3AG4H 5BPXA 4EN0A 3HNYM 4XQDA 1K78A 3FMQA 2PLV1 2FMLA 5JMOA 4OUSA 1OISA 1TE1B 5HNFA 3ZXLA 3K0LA 4IQJA 4WM8A 1NT0A 4OFGA 3VL8A 1HSJA 3I4IA 1U0JA 2ZXJA 3IKTA 2EPFA 2K9ZA 1GHCA 1I3AA 3T2TA 3S93A 2X4HA 3LSTA 5JHUA 2QZ2A 2RV8A 1AL22 1OCTC 4QPGB 4HRIA 1RVF3 4QPIB 1HV0A 3OD4A 4ZC3A 2CV6A 2X6OA 3BG7A 4IKFA 1MVQA 3M8LA 2D93A 4Q4V1 3ZPLA 1CZVA 1MS8A 2L54A 3AKRA 1QH7A 2WSUA 3D5OA 2IEKA 3TDUC 4M00A 4XFBA 4AGVA 4BXXJ 2KIMA 1KQ0A 2D6MA 2BW3B 5FJ8J 2STTA 4EWEA 3OL3A 1G8XA 2WWSA 1D5VA 4YW2A 2KJBA 2HVSA 5C3EJ 1F5JA 3K1PA 4PCQA 5K5OA 1LDDA 2IUWA 5KXCA 4YVSC 4CCJA 1HQCA 2MNGA 2KD7A 2DFIA 3RJPA 1UPSA 1AHDP 1VAKA 2DTWA 1PGW1 5IP7J 3LSGA 1GWKA 1J1LA 5J1YA 4LG0B 2AACA 2WLPA 2C24A 4CICA 2C9AA 1G9FA 1MIJA 2GC1A 1WCSA 1MBGA 2VL8A 3UKTA 1FX7A 4DJAA 3KCYA 4FI9A 3VZKA 2DOFA 3ELNA 2EAKA 4ZY9A 1IKPA 3THCA 4ZZ5A 5J3UA 2WO2A 1FXZA 5FKMA 1Q56A 2G9ZA 2ES3A 1NLSA 2HWC3 2DAOA 3K75B 4CSWA 4ITCA 3T08A 4LOCA 4LQRA 2UYBA 3KZIC 3JBG1 4OIPF 1FP2A 1RKWA 1N3QA 2CHHA 1J1TA 3LA7A 3HG9A 1F15A 1ULCA 3KWVA 3QACA 1IRGA 1Q1VA 1R1VA 5A3MA 5E1WA 5I8YA 3K77A 4FBFA 1ACIA 1CESA 1VMFA 5C7GA 4XR6A 4AHYA 5FZ8A 3OPZA 4DPNA 4O9GA 4HF2A 4AQSA 4AEDA 4XRMA 1LGBA 1ULEA 4C9YA 2HYXA 1K42A 3ZDSA 4LO4B 1UZYA 4M01A 2ZNYA 2WQZC 5JI9A 1L0OC 3FMRA 3IV5A 3GTQJ 2RVAA 2WSVA 2DK5A 2XVLA 1K3IA 1RUE3 2GA2A 2R30A 3FM3A 2PMHA 4XLFA 1O7FA 2IFWA 1ON2A 4ZDOA 1YRZA 3F95A 3LZZA 4A45A 1XC6A 4D0PA 4P9GA 3IIIA 2IT0A 2ZO4A 1Z6TA 3S1NJ 4PZJA 2OPKA 4Y24A 5LGTA 1ZZ9A 3O5SA 4ITVA 2W84A 2GNMA 2VVEA 3I2KA 4TYSA 3G1MA 1K12A 1QQIA 5A80A 2NVUB 1K45A 1CN1A 1HRV1 1WRJA 2WJSA 3CJXA 2DI3A 2C0ZA 4FPGA 4JDOA 2FJ1A 1ZM1A 2V6EA 3ZXDA 1MACA 2OZJA 3KP3A 2IGOA 1Z7S3 4B47A 1HRI1 3RZGA 2Q1FA 3DYPA 1WMEA 2XJSA 1N25A 3Q9SA 4Q1PA 1CZTA 1H0BA 2Y0IA 1DGWX 1RHI3 2WABA 1E17A 4R1HA 2VKEA 3CJIB 1GBGA 2XJUA 2EIEA 2AEYA 1JT0A 3HGGA 4KIFA 1TW3A 2JG9C 4ZS2A 3FHNA 3L09A 3VYUB 3PUSA 2V5YA 4M0HA 2WFF1 3OJBA 3GFMA 5A3PA 4RA0A 3MEXA 1WMDA 3PNYA 2L2OA 3I5UA 2Y75A 2HR3A 1BL0A 1I50J 1WFXA 1VBE2 4AXOA 1GLHA 3OPTA 3PUQA 4GCVA 5DUUA 1MZEA 2W08A 3X2QH 1Q8VA 3DEUA 5LBQA 1G2HA 5FMOS 4NN0A 4Q4W1 4AFAA 2EZKA 1IS5A 1US2A 2VMCA 1YC61 2CWMA 3Q9VA 4QLCU 3UJOA 3SHRA 1STZA 1VJ2A 3K1MA 3BR2A 5LB6A 5FZEA 1D0HA 1GLNA 2XIGA 3QBQA 3E3VA 4E4ZA 2ZMEA 5F04A 4FPJA 1OFCX 1IGNA 2V9VA 2UXNA 2E7QA 3FXJA 5FP3A 4B29A 2P17A 2CGNA 4V1PA 4J1WA 5GAGJ 3TAYA 3KP4A 2VXRA 4C1XA 3CP8A 2EFOA 4A3CJ 4HMZA 2RS33 3WTTC 4N8MA 2IXKA 2FDKA 4UVBA 3RQ4A 1JYIA 3O2PE 3GZNB 1AYM3 4QXKA 2IP2A 1A36A 1EY2A 1AU7A 4M3CF 2LUWA 2FXAA 2EF6A 4NJ4A 1HCRA 2XSJC 5FPBA 3R4DB 4COUA 4W65A 5H20A 1TWGJ 3IWZA 2R7XA 2P5BA 4PJNA 2VZUA 4FFGA 2QQJA 3N7KA 3AFKA 3H1CA 3WU2C 1OF3A 4O7XA 2FDGA 1H9TA 4NIGA 1O8PA 3NAPB 4XDOA 2ZMKA 4XONA 3ZKUA 4WM7C 2PJRB 3A4CA 1CAXB 4G94A 4Q0QA 3GXOA 1PO22 4XM3A 4BNCA 3KV9A 1WW4A 4A5NA 1SG3A 4S05A 1KGYA 2VUJA 4XDQA 4MUVA 5E89A 2XL9A 2DTYA 2VQHA 3POIA 4BKXA 1RXFA 1ETWA 3DBRB 1SFYA 3ME2A 1ZZBA 1U6GA 1W8HA 5JOZA 2VOPA 2W1OA 2Z2SB 5E17F 3HHHA 2JRMA 2R063 4YYOA 5C4XJ 5FZ6A 1USSA 4AYUA 4YZ5A 4RAFA 2XQRA 3IH3A 1QGPA 1QKQA 3FBYA 1J2XA 1W6NB 5ILVA 3PIGA 1AF9A 1WWYA 1HXS1 1H1IA 1SBEA 2ZMNA 3U78A 1COV3 1TG7A 2DVFA 2WB1A 1W0NA 3S5AA 1AJOA 2CAUA 2MLGA 1U12A 2DQLA 2KP6A 1VE0A 3JCUC 4HF0A 5T50A 1EV13 1EV7A 1Z7UA 3BT9A 1AWCA 1JI8A 1KS4A 2LD5A 3MIBA 4CU9A 1V6MA 1F43A 3BTYA 3JRGA 4I0WB 4QPIC 1FMD1 4F93B 3IHUA 2VI6A 1XCVA 3OY8B 1N77A 2Y9YA 3PQKA 4UBGA 4OIRF 1T2XA 3JSPA 1KU2A 5L3BA 3G7DA 5LY1A 4R9DA 3O0VA 3POWA 4IUGA 3P9IA 1WQ2A 2YC2A 2KDOA 4CCMA 3WDTA 2MSYA 1VQ7I 4MGYE 3OYWB 4AZZA 1D2SA 4BK4A 3U4XA 2DPDA 3W2AA 4KWKA 1QQP3 1MZBA 2V5DA 4CXWA 3LPFA 4RHV2 3ILNA 1R7JA 5HV4A 3K3NA 2COBA 1RITA 5I0TA 2CV0A 4NQWA 1JZ6A 2E63A 2XDVA 4F91B 1HJGA 2NM1A 5DD4A 4XBFA 5LZ6A 2C6YA 3S3MA 1DFQA 3PNVA 1W4MA 1RIOH 4M3EA 2EFPA 1R092 1W8ZA 5H9PA 3LQCA 3U11A 2RQPA 3BPVA 3TP3A 1HDDC 1YQCA 2X6YA 4MG2A 4GH4A 2O8XA 4ZH4F 1OXCA 4C30A 2W1UA 1TTYA 1ALYA 1S0CA 2MGQA 1SCSA 2BYVE 1IV8A 4BDYA 1T0FA 2H6BA 3LEMA 5L3GA 4QHBA 4PF1A 1Y9MA 3T09A 3RWKX 1S0FA 2ZEWA 4AI3A 3JQWA 4J01A 2D6OX 3IKWA 1AKHB 1NKGA 2EIDA 1ZR2A 4IEVA 3MWMA 5J4YA 2R49A 2P6SA 2QKDA 4PGHA 1RRJA 1X2NA 5CQEA 1V55H 2WZEA 2Z99A 1JODA 1AR93 4LGWA 2OAZA 4FP3A 4DBQA 2ARXA 5CYYA 2YPJA 4ZXEA 2QQ9A 4K9SA 1HV1A 4YSFA 4EJTA 3PO2J 1BCXA 1E2XA 1ETQA 4WM7A 3LSDA 1NHAA 1G7YA 5EIYB 5J09A 3MICA 2PI0A 5LBBA 3Q0VA 3DKYA 1NCRB 3AZYA 1KQ8A 3RKXA 5FYYA 4DXRA 3H35A 3LDKA 3IWFA 2WS92 2O0YA 4EGZA 1F31A 3OMYA 3A01B 4AVVA 4AWDA 1MNMC 3CJNA 1ZRIA 3ZSJA 4ENJA 4PT6A 1RUG2 5BNNA 2EBIA 1I5PA 2E7XA 4IV3B 5EGOB 4AVAA 1XNBA 3S7EA 4BY7J 2FSWA 1W1WE 1I5ZA 4PUSA 4NROA 3ZFGB 2CGPA 4OIOF 1OF4A 3BOWA 1KJRA 5ANNA 3IL2A 1Z67A 1O5LA 2XKOA 2KPMA 2XAHA 1VRH2 1MDMB 3IAS2 1UCRA 3QODA 4KJZA 1SFUA 3NQHA 3VBRC 2L9NA 2YYOA 1VBA2 4QPGA 3N9LA 3M8FA 5EEGA 2BUKA 3SC7X 1O4YA 2ZGQA 5CVUA 3T4HB 1W36D 2ELHA 1MR5A 4AC0A 5A1LA 4M6YA 5KHGA 3DPTA 2QCOA 2XUBA 2KZGA 4N53C 1WZ2A 2DOEA 1UY1A 4Q5OA 5A6ZA 2D3PA 2BW3A 4YGCA 4ASMB 2HWE2 1K61A 4AE2A 5DAWA 2CW7A 5FZFA 1P7JA 3QLQA 5LD2C 2K9MA 2VZOA 1KD7A 2XR4A 2EIMH 5HS8A 1WUVA 1DYOA 4A93J 3EQLF 3BY6A 1DQ2A 1Z0HA 4R4XA 5IFPA 1BBYA 3RZDJ 5DABA 3GDBA 1VPHA 3N3HA 5FZCA 5IAVA 2CDPA 4K2EA 1S8NA 3EJKA 2HWB2 4LG0A 3BG6A 2XB6C 3LSIA 4LLNA 2WNUA 4XILA 2VECA 1Y0UA 4OULA 3OWTA 3MF9A 3I59B 5FYBA 2HOEA 2DJNA 3S2WA 2K5CA 4M3DA 4CCNA 4P5HA 5FZMA 2D97A 3SCGA 2YB7A 4Y1UA 2ZZJA 3ZSMA 4QDSA 2UURA 2CQKA 1UY2A 5EQUA 2MD0A 2WYSA 3HRSA 1YNAA 3R4KA 3P3PA 2R7TA 2WO1A 2QSHX 3P1IA 2HWD3 4GWIA 3CTAA 1R5GA 3WDYA 1CWPA 1YFUA 2Y6JA 3ZYHA 1AYN1 2XBO2 4LIVA 2P0WA 4WVVA 1YJWI 1H88C 3GLLA 2JD4A 2YU2A 4AHWA 2R043 3NARA 4RB3C 1OFSA 1UHSA 5D21A 5JOXA 2H09A 2TRTA 1PO13 2VKVA 3D0JA 2B7EA 1MMDA 5CPRB 2FCVA 4R9CA 1PUFB 2V6CA 4XUTA 3RWNA 2MFZA 1TNTA 2KT0A 3UYJA 2AZ5A 2WZR2 3LAPA 4ASKA 1YHQI 2XPWA 4QIWN 4P9JA 3ETPA 2CUEA 1AR72 4CEWB 1KZHA 3HEFA 4ESFA 1C8M1 3V8KA 3H7JA 1LHWA 3BCBA 4XRSG 2CS3A 3QPSA 5FLVA 4D1QA 4BBRJ 3KLSA 2A3XA 1RR8C 3EPZA 2QUFA 4ENNA 1QA6A 4BZ4A 4AM3A 5F37A 1MD0A 5C70A 2L7MP 3IB3A 4MXWB 3BLYA 5FYHA 5GJ6A 2ZPXA 1LGCA 3H3LA 2VZ1A 1HQNA 5F3IA 2YMZA 2M0CA 4A3BJ 2VNOA 2QQMA 3M3IA 3JRHA 2GM4A 3VZJA 4XMIA 3ROUA 4M3FA 3DFGA 3Q8BA 4ISRA 4BXFA 2PQSA 2PHDA 1OKRA 2L3DA 4A6OA 5ACA1 1Z21A 1RUJ1 2GSYA 2QQKA 1GV2A 4P9FA 2NMOA 1FEXA 3CJIA 3V7CA 5KBFA 3THDA 4S04A 3CC2I 1E5SA 4CYCB 3AYCA 1GNZA 4GO1A 1JUSA 1ULFA 4ZZ8A 1YJKA 4YG3A 3D82A 2VUMJ 5JLXA 2R071 2L02A 2QQOA 3OYHA 4M71A 2CW8A 4P1WA 2E7WA 3H36A 5IVBA 5KXDA 3KYLA 2M34A 3ZM8A 1IUFA 2B9SA 4AFDA 1ZYRF 4KA4A 1P6RA 3GCMA 1NXD1 4B1LA 4K1ZA 4WBBA 2CQNA 2Y38A 3GF6A 2HYGD 4Q4ZF 3GZ6A 4B3NA 1BVVA 5BV6A 2ZHNA 2VR4A 1XMXA 2VU9A 3DV8A 3AVSA 1D0ZA 5CISA 2RGVA 4F7ZA 4E8CA 5FYSA 3MCZA 1EPZA 1OC1A 2ETHA 3CF5F 2RS11 2QF7A 5FLJA 3DWLE 4AAPA 5C33A 3I54A 3KEQA 1V6JA 3HOUJ 1KU3A 2X6WA 4D5FA 3C2UA 4HW0A 5IFTA 3BTCA 4G3YC 3HUGB 3VHRA 3RQ0A 4CP1A 2JDUA 4KGQA 3UV9A 1PK6A 2X1EA 2X48A 3DQVC 4D3WA 4NHMA 1W36C 2X09A 2D44A 1OPMA 3PVEA 5JZGB 1O3TA 4F92B 3ES4A 2BV6A 4Y17A 2Q2EB 3JSOA 3F9KA 1Y4WA 5J37A 2KQRA 2ECBA 3CCQI 4HX8A 2DBIA 3A0HC 4IHSA 1A5JA 4L5IA 4JGZB 2Y60A 1W8NA 2BWCA 5EG0B 1W8TA 4D7MA 3CC7I 1C4RA 3WT3A 3WF3A 5FZKA 4GMP1 1ZRFA 3NAPA 1USTA 1XE7A 1ZR4A 4DGWB 4Y3OA 4JOMA 4FP2A 2PJRA 1YEWA 4NC7A 2MC3A 1CAXA 2ZGKA 1XDUA 5BNPC 2HU9A 4LR4A 4QKFA 5EHDA 5B3SH 3IC7A 1AXZA 3BI3A 5LGNA 5ILSA 4GKXA 1NCRC 3VEPA 1G9DA 2JEMA 1FIPA 5LASA 5FYMA 4YVWB 1RINA 4AG4A 2ACJA 2JA2A 2LVSA 2I2SA 2R7UA 5A32B 2KLOA 4C3IJ 3JREA 4AVPA 3TMOA 3T2QA 2JT1A 4IV3C 3RRDA 3ZFFB 5K4LA 1FNYA 4HLXA 3WU1B 5LHIA 3RSNA 1W6NA 1Y3TA 5E1XA 1AXKA 2BY1A 1IRFA 5B1AH 4G6DA 2DUQA 4CZCA 4KDPA 1W8WA 4HSTA 4UW4A 3DL3A 2G9WA 2D7FA 1CJPA 4Q2FA 3V0BB 2NN8A 3W6VA 4E2SA 4FT8A 3RIRA 4CO8A 4UV9A 2QSFX 3R4UA 2YPDA 5F3CA 3FLRA 4BIFA 5A6XA 3IH4A 2W24A 2YBKA 3OY8A 3OYGA 1GXQA 2RS51 4TN7A 4K8RB 2DT5A 1X2MA 2WWYA 2XLGA 5IY5H 3MIHA 1XNTA 4KH9A 3DCQA 1R1UA 2RV9A 3K4DA 5FYCA 5KHIA 2LM3A 1E3PA 4L0YB 4J00A 5J6XA 3FIWA 3WDXA 5F5CA 1J09A 1OLME 3ABMH 2CWEA 2HS5A 3U1DA 3H5AA 3JCIA 1NUKA 5JOYA 2M7BA 2DA1A 1FNNA 1MS1A 5KAFC 2DMUA 2RMU3 1VZ0A 1ONVA 5FP8A 2DCYA 3NL1A 4TSVA 1S1AA 3OS2A 1RMU3 2VVFA 5DDJ1 3KS7A 3BGAA 5F0CA 3VYSB 1YFXA 2XOMA 4N43B 1ORKA 3CUQC 1BOBA 1R36A 2VCCA 3LEIA 2P4EA 3T1BA 2JD9A 2A5YB 4BYYA 4ETSA 1VBD1 3ABZA 1UU5A 1SBFA 5IVJA 3VOEA 4ASNA 2WTEA 2AHQA 3S1QJ 3JXSA 3GMEA 2JZYA 1JTYA 4CP0A 1AR63 4RAGA 2KMUA 1J75A 2R7WA 3WG4A 3PMEA 1T39A 1MS4A 1JS9A 1W6QB 1UOFA 1D0YA 1IN7A 1CVNA 1QHGA 4UVCA 1H4HA 1JUIA 1ASJ3 5C8CB 2ZJ2A 2V4JC 3S30A 2A75A 5HCFA 1M1EB 2VQUA 4LKEA 1OSGA 1C5IA 4P5OA 5FV3A 2DJIA 3B3QE 1S7OA 1GOHA 1YW8A 2NP0A 4IGPA 5ICFA 1QXRA 1V70A 3T8RA 3ST7A 3I53A 3QP6A 5FIXA 1W9FA 4FOVA 2E32A 1NCRA 4R4ZA 5H6RA 3CZUA 3DXUA 3TOBA 3U1XA 1NCQB 1WMFA 2WAOA 3U4SA 2DA7A 3FBIB 2JQ7A 2N7GA 4G6TB 3A01A 1L3JA 4P08A 1REFA 2P34A 5AVPA 4IV1A 4DINB 4DZGA 3O8GA 4PF5A 3HIFA 3W5NA 3BIWE 1VB2A 3DBLB 4Z2WA 4Z07A 2XB5A 1ZNPA 3QAHA 4IV3A 3AG2H 4ON0A 5EGOA 3ACIA 4UBHA 3OUIA 3WP3A 1XSVA 1RJ8A 2Q5TA 2VBPA 2I5UA 1IW7F 1XGSA 1PGSA 4RB2C 3PUHA 3ZPYA 3VD9A 3ZFGA 2CUZA 3GALA 3IRQA 1LOCA 1WJDA 1WCUA 3HDDA 1MDMA 4MHGA 1RVF1 5FMOL 1H9WA 1JJ8C 1XMAA 2PLV3 2O03A 3ACGA 1QPIA 3I3EA 2GOXB 3V42A 2WT0A 5BYNA 4ASLA 3O1SA 5JLVA 4AIKA 1CAWA 2VPRA 4JRAA 3DPRB 3FMSA 2VC1A 3LL7A 2RDNA 4OI4A 1MGTA 3HRTA 4LLOA 1BJAA 5JWPA 5IYCJ 3ALQA 3JW4A 1X3UA 1VBB3 1TT0A 1OPOA 1VBC2 2JECA 2MC4A 3LA2A 1HN0A 1LOBA 1OCPA 4ZPIA 2MA3A 4OCTA 3GLXA 5HCHA 5A3TA 1GXPA 3WW2A 2O14A 5HBAA 1QBJA 5DAXA 2L01A 5CFDB 3BR0A 1RUD2 3BPSA 2LTPA 5EFUA 2V79A 4WXHA 5DCMB 4RD7A 4UFMA 5F6LB 5F6KA 3I3BA 2PHUA 4DXTA 3N7LA 3OOPA 2M1BA 2WYFA 2NVQJ 1MS3A 1XNAA 2A70A 3AXEA 4JZRA 3OYEA 1WCMJ 3FWEA 1E3HA 1VQPI 1D4M2 3I55I 1V4RA 4TLFA 2ORXA 3UESA 3ZOIA 4J6GA 5CG9A 4WVWA 1UHWA 2BY3A 2XAJA 4XKVA 4MGTA 2VW1A 3WNNA 3SDBA 2I74A 3H1MA 4LIUA 5JSPA 3RI8A 1Y7BA 3I59A 2EFNA 3WUDA 3NMBA 1K5MB 3N9PA 1NQDA 4BE2A 2HWC1 1UCXA 1VFCA 1N75A 4B44A 2IXLA 1B6AA 4BXUA 3VSLA 4JGYB 1Y6IA 4SBVA 3DEWA 4QQ2A 5JZGC 2KISA 2CTVA 2QJVA 3KB5A 1MEC2 3VBSB 2WY7Q 2XLAA 1ND2C 1WCKA 1JKRC 1Q8PA 2ZSIB 2EZHA 4PHZA 2DMPA 1JU3A 1VI0A 2XC7A 2YHJA 2WFPA 2QENA 4JP0A 2BTVC 4F52A 3ZCOA 1RUC2 1YW9A 2YUSA 3OYMA 2DTZA 2DU0A 4DQ2A 4EM2A 2JJ7A 1S9HA 2LP0A 2A1XA 3GX4X 1PUFA 3FJSA 3VZLA 1AHSA 1R22A 1LOAA 1CAUB 2F4OB 1FOXA 1SFKA 4B8EA 2CY6A 4XHBA 1H0MA 3EO6A 1B9NA 1O3RA 2M4KA 3VODA 3AMPA 4CEWA 2E19A 1LE8B 4P9XA 2P5KA 4NHJA 2VNGA 1WKMA 4ZHNA 4NAOA 2GC2A 2M30A 1E5IA 3CNAA 1TMF1 4UUSB 1VQ8I 5LA2A 3TEWA 5KXBA 2VQGA 3AX4A 1H8VA 3IDAA 5L19A 2JKBA 2R92J 4HK8A 3OYNA 1UAIA 1UYYA 3HM5A 1NTCA 1NA1B 4HBNA 2B39A 2DDBA 4MXWA 3ZFFC 5EZWA 4KI5M 3V0AB 2E5ZA 1Z7S1 3J8F2 5M3FJ 2GWRA 4HONA 3S0MA 4LLLA 1QNWA 4XNFA 3BTZA 1RHI1 4AI8A 4CPBA 3MUY1 3WG3A 3NKTA 5JXGA 5T5LA 3LFKA 5FMCA 3LQRA 3B5LB 4P14A 2VZTA 2NZ9A 4YGEA 3LA3A 3R0RA 2VO5A 1SLBA 5LEKA 3OEBA 2V72A 4EQVA 5L9RA 5LGUA 4CYCA 3AMMA 4FOQA 1U78A 5FKKA 5JMCA 2H1KA 1PIV3 3S3OA 3N35A 1D3YA 2F5CA 1JOJA 1G86A 1CIWA 2GN3A 2DURA 5DD8A 1J84A 4HETA 2EA2A 1HA8A 3HRUA 4YG2F 1QVTA 3U21A 2WR9A 4QKNA 2ZFWA 2BVMA 1BBT2 4MQ9F 5K7FA 3S14J 4S2FA 1FPN2 2FMYA 1ZZ8A 4XF1A 2HEVF 2DXIA 1NE4A 2VLAA 2Q8OA 4XQWA 1R4MB 5F7UA 2NNYA 4GWNA 2K9NA 4KBZA 1MH4A 2P4WA 5FXZA 4XURA 3FXUA 4UOJA 4AFBA 2E5NA 1WSUA 2FNAA 1NLQA 1OLTA 1Z78A 4XBNA 4Q4Y2 5IVFA 4HOBA 1C8NA 4D6RA 1T2KA 4QX3A 1SD7A 5ICEA 4Q4X3 2RS31 3EB7A 2EQRA 2WAQN 4KT5C 2DV9A 3SYTA 2ISYA 4YZ2A 2Y6GA 4MHRA 4XPVA 3QYFA 2P37A 1LOEA 1AYM1 3C18A 5FLMJ 1H2MA 2VQ0A 4IEJA 3LB9A 4KG8A 5CA6A 1JGGA 4WF2A 3CCRI 1S72I 5A3WA 1PVC2 2WT2A 1HKSA 5JZGA 3KFWX 2K46A 4GWJA 1Y56A 3MPBA 4J1XA 3K46A 5C4WA 3GJBA 2Q2EA 3K9TA 5FPXA 1KXGA 2MHFA 3O0XA 5JIUA 5LW9A 1ERDA 2WWUA 3MIDA 4AVSA 4JGZA 5DAPA 2JB8A 5C8CC 3WSOA 4EROA 3RSJA 5LA9A 1S29A 2JG8B 1X1AA 4MGIE 2IBDA 1IN6A 5EJZB 5HDGA 5KCMA 4XC9A 1FATA 4LBQD 2VQCA 3C7HA 4AYBN 4JKMA 2DLLA 2OF7A 5CKTA 5CFCB 2EIBA 1W39A 2BRTA 5FZ7A 3WF0A 1R9TJ 1X7NA 1DQ4A 3A22A 3ZXAC 3VKMA 3HJEA 4RSUA 5FLHA 1CQ9A 1RKTA 2YBSA 1G4DA 5A7QA 4WCGA 3HKZA 4YVWA 4RQPB 5DEQA 2KR2A 2IVJA 2R061 4YIRX 3FHQA 3PU8A 1H2KA 2NPIA 3AL5A 4M4RA 5A32A 1WI9A 3NV3A 3LSKA 2M9HA 4A2UA 3HOWJ 4PI0A 5L7OB 1JYWA 3JD72 4PSXA 1COV1 3ZFFA 1ZRRA 2UWAA 2DVGA 4QSHA 1LGNA 1W2NA 3N7MA 2YROA 4A3FJ 5FPLA 1WW7A 4I6ZA 2DU1A 2MLKA 1EV11 3NJZA 5L9BA 3OBAA 1TWHJ 2B42B 1LESA 5C44J 2A5WA 4L92A 2F17A 2FUG2 1U5TB 2ZEXA 1A3KA 1HXS3 1YG2A 2QTWB 3MZHA 3I97A 3EDPA 5FFZA 3DPRC 3CCJI 5FY0A 5FO5A 4BWOA 1O57A 4IE5A 1FC3A 1T38A 3CO2A 2X53S 3ACLA 3JRIA 3GFJA 3K1NA 3LIGA 1SLLA 2H0VA 3D1NI 4BQYA 1QQP1 1V6KA 4L11A 3ZYFA 2E71A 3MN2A 5GTHC 4QB2A 2VJJA 5JI7A 3J81K 3QU6A 5A3LA 5FPAA 5EP9A 5CFDC 5T5OA 3CCSI 4DY3A 2VG9A 2O6GE 5K9YA 4L0PA 2DQRA 3DYOA 5A33B 3MFKA 5FJKA 4KBBA 5FO9B 3GWZA 1QJX2 4R8HA 4FOYA 4WV8A 3RPUD 2EICA 3Q8CA 1UB9A 2Y6KA 2HQAA 3VUOA 2CSOA 1N1SA