2HKXA

Structure of cooa mutant (n127l/s128l) from carboxydothermus hydrogenoformans
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
218
structure length
218
Chain Sequence
ATQMRLTDTNLLEVLNSEEYSGVLKEFREQRYSKKAILYTPNTERNLVFLVKSGRVRVYLAYEDKEFTLAILEAGDIFCTHTRAFIQAMEDTTILYTDIRNFQNIVVEFPAFSLNMVKVLGDLLKLLLTIINGLVFKDARLRLAEFLVQAAMDTGLKVPQGIKLELGLNTEEIALMLGTTRQTVSVLLNDFKKMGILERVNQRTLLLKDLQKLKEFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon monoxide oxidation system transcription regulator Coo
publication title Structure-based hypothesis on the activation of the CO-sensing transcription factor CooA.
pubmed doi rcsb
source organism Carboxydothermus hydrogenoformans
molecule tags Transcription regulator
total genus 62
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2hkxA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hkxA01
2YSRA 4MQVA 1CAXA 3R0AA 4YG2F 2GAUA 5BPIA 2ZMEA 4YNIA 3KZYA 3NEUA 3GFLA 2XROA 4LG0A 4XLNF 3O2PE 5H6RA 2W57A 4IRIA 2VOPA 3WTXC 2OA2A 1YYVA 1QZYA 5BPXA 3IHUA 2IXCA 3EHKA 3FXUA 1HQCA 3QU6A 1FZPB 2G7UA 2JT1A 2H6BA 3FMRA 2WV0A 2Z9OA 2GA1A 3CLPA 3ETQA 5HLHA 1U78A 2ETEA 1XDUA 4XF1A 2MBFA 2HQNA 1UCXA 2GC3A 1W7PB 5KK1A 3L2CA 2HJIA 3GFJA 3ZMVA 4BQAA 1R36A 3E6CC 1ZYRF 4AVCA 5E8IA 4M9ZA 3NSTA 1YIOA 1HKQA 2BEOA 4HX7A 2FBHA 5KHKA 2OD5A 1QXRA 4OMZA 5AONA 2HTJA 5I8TA 2FSWA 2Q8KA 4RB1A 4EJOA 2RKHA 3SZTA 2F4PA 1W5SA 4YIFA 4A0XA 5CU1A 4AWXB 1SFUA 1MGTA 4JTOA 2DAOA 4XSZF 1SMYF 1Z1DA 3MPBA 2XLGA 4XFIA 5J8CA 4KIFA 1TLHB 1QQIA 1OYWA 3N97A 4K8FA 1FWZA 2GC1A 2W85A 4HOBA 3WGHA 2Q4SA 2VT3A 5JR3A 3IWZA 2O8XA 1F9NA 1RTVA 3G3ZA 3CJXA 2ZKLA 4WVZA 3TNPB 4U88A 3GF2A 3MFKA 3K69A 4M74A 2QNKA 3FHIB 3H3ZA 4LLLA 4Q0SA 1R58A 1UCRA 3BALA 3IIAA 1ZREA 1L3JA 2EV5A 3V8JA 1SMTA 1ZG1A 3FMSA 3ES4A 1J3RA 1CAVB 4XF4A 3KZZA 1IXSB 4Q47A 3DP7A 1WWXA 2IA0A 2ELHA 3SFZA 1R5GA 2J5OA 3P9KA 1FLIA 5I0SA 2FQ3A 3HSFA 2QVOA 1AWCA 1K78A 5D6FA 1U5TB 1QO0D 3L09A 4HAMA 2FMYA 3JZVA 1KYZA 2FMLA 3TDUC 3RPQA 2OZ6A 1GQGA 4Y13A 5I0RA 3KE2A 3GYDA 2CAVA 1YLFA 3CF6E 3QP6A 2DW4A 2W84A 3UKVA 2LSOA 2CAUA 1CF7B 2HEOA 1ZH5A 1E17A 3H3UA 4ORFA 5DUIA 2VODA 2Z69A 2Y75A 3HSEA 3GVAA 4UUVA 4Q29A 4P9GA 5HDGA 3K2ZA 3F22A 1NE6A 1EV7A 1STZA 2EFPA 1O5UA 2VE8A 1R00A 1J3QA 2CYYA 1O7FA 2ISZA 4JBAA 4KWJA 2P7CB 2OA4A 2CSOA 3M1EA 2H09A 2OPKA 3U2RA 3ZQ7A 3U10A 1B9NA 4TV7A 2W24A 3RYRA 5HLGA 4Q4ZF 3H1MA 3REOA 5FB2A 1XD7A 2VECA 2G7HA 3F8CA 3CDHA 2PG4A 2PAEA 2RNJA 3FM3A 1HW2A 4MUVA 5FLXK 3K1NA 5LRSA 1DDNA 3ULQB 1SD7A 2HS5A 1NZCA 5D5XB 2R7DA 3VOEA 1KU3A 1J5YA 4AIJA 4LLGF 2YX4A 3P9IA 4LGWA 3HHHA 1WA4A 4ESFA 3QPTA 5L3BA 2QQBA 1I1GA 4P5OA 3JSPA 1BIBA 5BOXA 4H0EA 5BV6A 1T6SA 4OU0A 2CWEA 2XUBA 3ELKA 4PGGA 2CW0F 4BAYA 2HDCA 1SAXA 2STTA 4TLFA 2F5FA 4RS8A 1J1LA 4EGYA 1FBUA 3KETA 3HT1A 5E1RA 2PQ8A 1LDDA 4HQMA 3H1YA 1ZZBA 3IKTA 2GZWA 2IA2A 2BNOA 4ZZLA 5I0TA 1Q3EA 2HFHA 2VONA 3E5UA 2WTEA 5DD8A 2VBYA 1QXJA 5D5VB 4ENJA 1FY7A 3LQQA 2D45A 1WGPA 2EA4A 5BMZA 2PYTA 5ICCA 2LF7A 4N9HA 2VE9A 1ZN2A 3SHFA 4MV2A 1FPQA 1ULYA 3KGZA 1C0WA 1KYWA 1SD6A 4AVPA 3SCGA 1JUHA 1R1VA 2L4MA 4M72A 3SQNA 2K86A 3FXRA 3V7RA 4AVAA 1EPZA 3TQNA 4FX4A 4NVPA 1Z9CA 1U2WA 3TOBA 3BROA 2Q0OA 4YSFA 5KHGA 4O9EA 5LRRA 5HLIA 5HS7A 1LDJA 3DFGA 1R1UA 2X4HA 2MPFA 3OF1A 2HKOA 2RN7A 4I98B 4PJYA 3M8EA 2VBZA 1TTYA 2M30A 3MAJA 3J7AO 2M5WA 1FSHA 4MH0E 4N9IA 4RGUA 1J9IA 4XBFA 3M7GA 1LDKB 1V70A 2VC0A 3J81K 4D0PA 4MEYF 3EDPA 4MGRA 4R1HA 2EB7A 5LLQA 3DF8A 2DTRA 3KLNA 4DINB 4YIIA 5E1ZB 4KA4A 3L2HA 4IEUA 2RDPA 4G6DA 1ZHFA 4MZUA 4B09A 5EFUA 3MZHA 5A2QK 3LOIA 5CLSA 1Z91A 1LEAA 3CO2A 1OPCA 3I5UA 4XF0A 1S29A 3E97A 2PA7A 5F6FA 4LUKA 4OINF 1RZ4A 3GX4X 4AVBA 1YLLA 2FBIA 5HI0A 1QPMA 5DYMA 2J5PA 4UV8A 1Q5OA 1P4AA 3HOSA 1CAUA 3RZZA 3GZ6A 4NHJA 5BUVA 2G9WA 4XFAA 4ESJA 4XETA 2P17A 4EJWA 3HRSA 4IVNA 3TOAA 3DKWA 5LHHA 5DD4A 1F5TA 2NNNA 1LEBA 4OIRF 5CVIA 4OMYA 2DBBA 3WW2A 3HIFA 3DEUA 3N4MA 4MTEA 3CTAA 5DV5A 1XSVA 4LLNA 2D5HA 2H94A 5FLHA 3F8MA 3EJKA 5IT9K 3KEQA 4YFXF 1NXMA 3ISPA 3WE2A 2Z33A 4XFFA 1BBYA 2L3DA 5I0UA 4HMZA 3J81Z 4EM0B 4IEWA 1OYYA 1ZRDA 5CVVA 4RGSA 1GQHA 1MDMA 5KHJA 4UV9A 2O03A 1ZARA 1XGOA 4ASNA 2O0YA 5CVRA 2L01A 1O7LA 2DI3A 3JSOA 5L3DA 5J6XA 5K5RA 1FC3A 4UNOA 1E2XA 1CAWA 1FBSA 4DNCA 1LJ9A 3G7DA 2ET1A 1IPKA 1BN5A 3ZMTA 4FHTA 3DV8A 3IC7A 4XFCA 5F64A 4LEJA 3QACA 4MGIE 3LA2A 1QZZA 3WTYC 1X8MA 1MD0A 4IEOA 5CJ9A 3ECOA 1XGMA 1ZGAA 1YUDA 2GIVA 1SQ4A 1S3JA 4A6DA 1TW3A 3BZ6A 4KN7X 1YFWA 1FYLA 3E6BA 2HGCA 2GH2A 3NL1A 4I0AA 3EBRA 5FD6A 3PFIA 4OFGA 3GZ5A 2YX7A 3NVCA 1REPC 2V09A 2XRNA 1B4AA 2YPRA 4AQ6A 2H6CA 2F5DA 5D8KB 2MNGA 2VBWA 2D5FA 2Q0AA 1EH7A 4PIZA 1IN7A 4ENNA 1XCBA 1O3SA 2Z5UA 3OCPA 4YARA 4LB5A 4EROA 1WSUA 2EFQA 2XASA 2Q2EA 4WZCA 1DP7P 4UHTA 4Q48A 2BBYA 3B73A 4XEZA 2K7LA 3F23A 2DT5A 1X7NA 4Q0QA 5E17F 3LFKA 3FWEA 1H1IA 4A2UA 1K6OA 2RGVA 2P8TA 3HSRA 3T8TA 4HLYA 5BS6A 1T39A 3R6SA 3MZYA 2OBPA 2QLZA 1O3TA 1YO5C 4L18B 2VQAA 3KP4A 2FQPA 5E1WA 1ZAOA 4LA3A 4KMUX 2GU9A 4BHPA 1FT9A 2MH2A 3Q9SA 4KICA 1S7OA 2KIUA 4XFBA 5J7MA 4L9VA 4HVRA 1G3TA 1UHWA 2FBKA 3WG9A 5ILVA 3WTTC 3I54A 4HN0A 3I59B 2DK8A 4IRGA 4UXAA 2M87A 1J3PA 4CHUA 3CLOA 1ZX5A 4O9GA 3T8RA 4ZYEA 3RJPA 1LNWA 4Z82A 4BXUA 5JSRA 4YFNF 3V7SA 1O5LA 1UD1A 4Z2YA 3FHZA 2LDUA 5K5QA 1WRJA 1Z6TA 4ON0A 5TJJA 3LA7A 3GEZA 5FQ0A 2PQQA 3WU1B 3SXWA 4EWAA 3BY6A 2VPVA 3BP8A 5DCFA 5J48A 2P5LC 1UIKA 1UIJA 5K8SA 2EJRA 3BJ6A 1DZRA 1VR3A 2IXIA 3VFZA 2O6GE 3BPZA 4LB6B 1IUYA 4OOIA 2Q1ZB 2EK5A 3CUQA 5KVRA 2ESHA 4P9UA 3HHGA 3C1DA 3M9AA 4P55A 2KXLA 1IXCA 4HW0A 4MQ9F 5DCMA 1JGSA 3WTWC 2XGXA 3K0LA 2EFOA 1ZZCA 2OU2A 4O3MA 4O6JA 2PFBA 5LHIA 1J0RA 1ZRCA 2A3SA 2P4WA 1DGRA 4XF3A 2ZO4A 4HQEA 3MEXA 2MA3A 2IP2A 1X3UA 2NS0A 4META 1UHMA 1YW8A 1RIOH 1X8EA 2ETHA 4HF2A 1TBXA 2FE3A 2GQQA 4PZJA 1FOKA 2P6SA 1UPIA 1GXPA 2A6EF 4FBFA 4CICA 4LJZF 2DPDA 1EYBA 1YQAA 4Q0PA 3ROUA 5JHUA 3D0SA 2Z2SB 4KWLA 3HRUA 4UBGA 2AXLA 2F5EA 4B8XA 4KFCA 4CGZA 1RNLA 1UW8A 2KRFA 1FX7A 1KU2A 4BNCA 4L9NA 2BYVE 2PEXA 5AIQA 3L7WA 4D7SA 4G6QA 3SCFA 4PGHA 1VTNC 2FU4A 2ZJ2A 1ZLKA 3S7IA 4R79A 1WLTA 5FPZA 2XAQA 4MEXF 3RKXA 1O3RA 1OMIA 4QLCU 5L3GA 2NNYA 2DLLA 1OYIA 4HV5A 3EUHA 3DXJF 3CL1A 1XE7A 2XL9A 1P92A 3GXOA 5D8LB 1HKTA 5HS8A 3DN7A 4GXOA 1YFHA 2KIFA 3EETA 4RAZA 1K79A 2QVSB 3JW4A 1IN6A 3EQLF 1G3YA 3VB2A 2QQ9A 4CZZA 1JHHA 1I27A 2COMA 5JFRA 3BPVA 1HXDA 2VOOA 2XV4S 4LD5A 3JAMZ 3RKYA 5E16A 3M8FA 4PIYA 1W7PA 3O3KA 3WTZA 4KYWA 6PAXA 2D93A 4ZU4A 3O6BB 4AIKA 1ZZ8A 2BNMA 4G7HF 3DL3A 1CGPA 4HSLA 1LQ1A 4MGZE 2XAJA 2D40A 3RNSA 1NHAA 2OQGA 4G9YA 1Y3TA 2CFXA 4EJUA 2ACJA 4D7TA 4WXHA 3H7JA 4G94A 3ECHA 4KIGA 2XAHA 4S04A 2A6HF 2VT2A 1DPRA 1Z05A 4U0WA 3F6OA 1ODDA 2HOEA 2DCTA 4Y17A 3C18A 3WW1A 3UKNA 1BC8C 2IXKA 1Z7UA 4O5VA 1S7AA 2CGPA 3D0JA 3RTRA 2LKPA 4MTDA 2HQRA 1T38A 5EEHA 2MLGA 4QM8A 1EH8A 4KWKA 4HX4A 1RUNA 2RC4A 4WK8F 1SFEA 5I91A 1WKMA 4G7OF 5FFXA 1J75A 1NE4A 4QGNA 3LA3A 1MDMB 4HDVA 2EV0A 1L3LA 4E2SA 3CUQC 3I64A 2ESNA 2Y48A 3TO7A 5K1YA 5I8YA 2FEZA 4IESA 4JVAA 4WBBA 4HV6A 4R52A 1XB4A 2Q30A 2DQLA 5ICFA 1TQ5A 1H9TA 3USSA 4WF2A 2ET7A 2CG4A 2VC1A 2O61A 4P96A 2PN6A 5HOOA 2IVMA 4U0YA 1KQ9A 3T0YA 5FPXA 5BY5A 1CAVA 3B02A 2NAZA 3HYIA 2B5HA 2EWNA 3KCCA 1IN4A 3ZP5A 1I6XA 4LULA 4U0VA 2N7GA 5ED4A 4XFGA 1G3WA 2RV8A 1J58A 4KU8A 1DZTA 3TO9A 4I01A 5E8GA 1FNNA 2R7FA 3HT2A 2JPBA 1YFXA 3H9AA 4EJVA 4HF0A 4Q0VA 1U5TA 3NW4A 5AIPA 3PNAA 3QAHA 2QBYB 1T98A 2OZJA 2STWA 5ICEA 5FD5A 1R7JA 4HZFA 1BI2A 1TNSA 3WODF 3GYHX 1X82A 2I45A 1MJBA 4QX5A 1CF7A 2DO7A 1CAXB 4ZYGA 2IXJA 2ADUA 4L0YB 2ZMEB 3F8BA 1BI0A 1HSTA 1D5VA 4LG0B 1RC6A 3F6VA 1R5HA 3R60A 1USSA 4DQ2A 4WXDA 4EWEA 2V9VA 1A04A 5JI6A 1ZGJA 1OR7A 4KUMA 1AOYA 4FAGA 1USTA 4PCQA 1XE8A 3I4PA 2EV6A 3P9CA 1YW7A 4I02A 4A6EA 3HRTA 1FP2A 2CO5A 3HOTA 1I1SA 2IC1A 3FZVA 2CV6A 4MGYE 1R23A 3KMHA 3GBFA 2V1XA 1U8RA 4HVQA 3EYYA 3HRMA 2EFWA 5C6CA 1YHFA 4CXFA 1ZZ9A 4EV0A 4E2GA 1IAWA 2FRHA 1ON1A 1V3FA 1KQ8A 4ZH4F 4QMAA 3BOQA 2MH9A 3K1MA 3MDPA 3L9FA 5FLJA 4NB5A 1O4TA 4HBLA 2Y0MA 1DGWA 5D4RA 1TW2A 3O14A 5KHHA 2QM3A 5BQTA 4A0ZA 3IDBB 3BB6A 4ZU7A 1SFXA 3MQ0A 3E5QA 3PLQA 1F4KA 1IPJA 1V4RA 3U1DA 1QWRA 2UXNA 4Q5SF 1MJAA 1ZRFA 3WTUC 4HVOA 2K0GA 1FSEA 1B1BA 1YS6A 3RDIA 2V6CA 3TGNA 2F5CA 4GO1A 4H7LA 4FX0A 2K4BA 5HS9A 2DFIA 3LSTA 3TNQA 4HDUA 1IN8A 3I58A 4YRDA 2P5KA 1WI9A 4GULA 3COAC 2IPQX 3BPXA 4XF9A 4A12A 5JCTA 3FXQA 4GCVA 4N0BA 2O8QA 5CYVA 2EFNA 2ZNZA 4NQWA 3PQKA 4XSXF 4FAHA 2ZNYA 1DUXC 4RB0A 2JPCA 5IT3A 5DCMB 1PM7A 2ATFA 2HZTA 3HTSB 4HF1A 2KJCA 4L9TA 3G73A 3RYKA 3H8UA 1UFMA 5J3UA 4HA8A 1TQPA 3CJNA 3IKVA 4IHTA 1EH6A 5LGTA 4YFKF 2FNAA 2E7XA 3FMQA 2NRAC 4P9FA 3HQXA 4U7DA 4WX9A 2HYFA 3M3IA 2M1BA 4L5IA 2GA2A 5L3EA 4EMSA 4WCGA 4FT8A 5DDGA 3LWFA 4QGMA 3V7CA 3RPUA 3GFIA 3U11A 4M9SA 1J59A 4I09A 1W4MA 3DQVC 3R61A 3DPLC 3H7YA 2ZCWA 1K78B 2XL7A 1YFYA 4MX3A 2B8MA 3U0ZA 5DUKA 4CYDA 2EAAA 1ZRRA 2O1QA 3BWGA 3IBMA 4LUMA 4L0ZB 3PVBB 4QWQA 1U5TC 2GC0A 3BU7A 2KJBA 1O3QA 2PBIA 1Y0UA 3KP6A 4EM1A 1RUOA 1QY4A 4XLPF 2C6YA 4AD9A 5L3CA 2HWVA 4HLTA 5CVUA 1FBQA 2RVCA 1GVJA 1XMKA 1HKSA 3V8LA 4ENKA 2QJVA 3FF5A 3RI4A 1D8JA 5FDBA 2IXHA 4XRFA 3KLOA 2P7VB 1FI2A 1EY2A 3KP7A 3F21A 1PMIA 1EP0A 3C3WA 1VP6A 3LZZA 4LK0F 2W25A 2ISYA 1P6RA 2FNPA 2DU9A 1JXSA 5CADA 3SZPA 2A69F 3GWZA 1XMAA 2UZKA 2K02A 1Y9QA 4QM9A 4R8HA 2E9QA 3K9TA 3EYIA 4UVAA 2GXGA 2MD5A 1XSXA 1YW9A 2ZKZA 3S2WA 4KU7A 1ZNPA 4RGRA 2GWRA 4EGZA 3H92A 1IRGA 3ABTA 2IRFG 2VBXA 4IHSA 3ZMZA 3E5XA 3I0TA 3MCZA 3PQJA 1ZG3A 4OIQF 1QGPA 2BV6A 2DQRA 1ZVFA 4MGKE 3KP2A 1HW5A 2UWMA 3W6KB 1O57A 2D2WA 1KU7A 3ZDSA 2JTVA 1BI1A 4BYYA 1QBJA 4JTNA 4IEVA 2LNBA 5CVJA 4EJTA 2V79A 3EQEA 2OZUA 4KMFA 4HYEA 4G8XA 3D82A 3WGIA 3R0JA 2YR2A 5FFZA 1XCVA 5LHGA 1J7KA 2GXBA 2PMHA 3KP5A 2B0LA 1PP8F 2PLYA 4L5JA 4I3PA 4QXKA 1TNTA 4EM2A 2HR3A 1OI6A 5HDKA 3NQOA 1UB9A 2K4JA 4L9JA 5EZWA 2PI0A 3R4KA 2ZXJA 1LB2A 1RL3A 4M6YA 1IF1A 2K9ZA 3C3VA 3F8NA 4IJAA 3W6JB 2QENA 3ELNA 4LA2A 3P7NA 3GO5A 3JAMK 4IRHA 5HDNA 3Q9VA 4BHCA 2VN2A 2XIGA 3KP3A 1S8NA 4Q0UA 5FLIA 1R1TA 3DPTA 2PAKA 2DK5A 3I7DA 3QPHA 4CO8A 5LGNA 4EWDA 3WW4A 2H0VA 1VJ2A 5EEGA 1YFUA 4EQQA 5ICGA 5I8SA 1P4WA 4IEZA 5ILUA 3ZMUA 2DPUA 2XKPA 2MC3A 3QRFF 4I7HA 2UY8A 3AAFA 1LKNA 2XHKA 2PHLA 1BIAA 1J2XA 1XDSA 1XGNA 3D5LA 3SXYA 3LAPA 1LRHA 2BNNA 2A5YB 5JVTA 1JE8A 5BXXA 4LTAA 3F72A 1G6NA 3V4GA 4MHGA 4IERA 3FFQA 4UBHA 4U7BA 1RI7A 5E20A 1G3SA 1LVAA 3ACLA 2Z3YA 3ZN1A 2QWWA 2XAGA 1ONVA 4BIFA 3SHRA 1LR5A 2IJLA 3QOPA 4AIHA 4ZZDA 1T0FA 4M73A 1U6GA 4ESBA 4MNUA 1FYKA 2JZYA 3KFWX 1P2FA 4RB2C 4ENMA 3ZPLA 3H1WA 1Q1HA 2O3FA 1DPUA 1KQ0A 2IW5A 3KGLA 1SD5A 2WFPA 1P4XA 4I0BA 3NRVA 2XVCA 4M71A 2QQAA 3S7EA 3F3XA 3U9GA 4AQ2A 5D4SA 1K7AA 3LAGA 2BGCA 2EA7A 1KGSA 5HVQC 1B59A 5T3NA 2FF4A 3OTFA 3QU3A 1IW7F 5LBQA 1BM9A 4KL1A 1CAUB 3NJZA 3I59A 4OIPF 1ZLJA 2IA1A 2MHFA 3IRRA 4IXAA 3Q5FA 2QZ8A 5D1IA 1U3EM 3ML6A 5D5WB 4L2NA 3ZMSA 5H20A 1OKRA 4OLLA 3BDDA 4ONUA 4M9XA 2TDXA 4KT5C 3KSCA 4HSJA 4B29A 4X6QB 5L3FA 1G4DA 4Y15A 2L54A 2IXLA 1R22A 2JRTA 2D1HA 4RD7A 2FA5A 4JQFA 1FXZA 1XSDA 2D1VA 4IEQA 3CO6C 4RAYA 3OGJA 1IRFA 4IEPA 1RGSA 4GYGA 3WW3A 1H1MA 2XLFA 5I93A 1OD5A 2H27A 4QGLA 3MWMA 3FX3A 1NYWA 1H9GA 5LEJA 1CAWB 1XGSA 4X6RB 2PHDA 4HX8A 4UVBA 3CUOA 1ZZ7A 3SMHA 2A07F 3FM5A 5DEQA 1ZZ6A 4UVCA 3CO7C 1PP7U 4ETSA 1F1ZA 1D3YA 4ZU5A 2UY9A 1T2KA 3C7JA 3TKYA 5LGUA 3VODA 3T5XA 1BOAA 2V1UA 2ZFWA 5KHIA 4WXCA 3LQRA 2R3SA 3L00A 5JR7B 4LLOA 4F7ZA 3UKTA 2XLAA 1GHCA 2UYBA 2EVXA 3IDCB 1YG2A 5FLXZ 4A5MA 5JSOA 2KIMA 4J1WA 3OOPA 4A5NA 1XN7A 2XKOA 2QYOA 2NYXA 4IEXA 4LMYA 4JV4A 3RYPA 4I2OA 4JK1X 3FZ3A 1OFNA 5ERIA 3RKWA 1TQMA 3VEPA 2RQPA 5F1RA 1ON2A 1KU9A 2WC2A 3HUGA 3HTUA 4Z07A 2VXZA 4S05A 4PDKA 1XRUA 2OAZA 4L11A 3IRQA 3ES1A 3S0MA 3MYXA 2HYGD 2HKXA 3FJSA 5AVPA 3GFMA 4A0YA 1MJ9A 3IL2A 2X0LA 2GC2A 3ZN0A 1MZBA 2PAMA 3LAJA 2QCSB 4IETA 2MLKA 3ST7A 2OYZA 3TDZC 3OD0A 3T1BA 3BJOA 2E7WA 4IEYA 2L4AA 1HSJA 2QUFA 3ERED 2M8EA 4LK1F 3J80K 4BHBA 2Y0OA 1S6LA 2UXXA 4GYIA 3ABUA 1IXRC 3WTVC 4OIOF 1IZ1A 2JSCA 4WWCA 1PUEE 2A61A 1SEFA 2KKOA 4EVIA 3I71A 4LFUA 1HBXG 2PFWA 1ZG5A 3JTHA 1MKMA 4KIBA 2CQKA 4IPAA 2YU3A 1FP1D 5TRDA 5FO5A 2BE5F 1Q43A 5ILSA 4J1XA 5K5OA 3BJAA 1YS7A 3FE5A 3WTSC 1H0MA 5C8WA 2IT0A 2E1CA 3WE3A 4BH9A 4F8AA 3E3VA 3V8KA 1Z6RA 5H6QA 2V1DA 2B9UA 5FQ0B 3OV8A 3E6MA 2UYAA 3RIRA 3BCWA 5BPDA 1W7PD 2EA2A 1I5ZA 1IN5A 1B6AA 1PDNC 3TO6A 1QNTA 4RB3C 5FGMA 5FCCA 4YYOA 4AXOA 2HTSA 1BC7C 5JAXA 2C0ZA 3CUQB 2QDRA 2P5VA 2FOKA 5KBFA 1WQ2A 1TQIA 4XFHA 4RGXA 5J8FA 2K27A 2E1NA 5E1XA 1W5TA 3K1PA 4HN1A 4E70A 4ZYHA 4HLXA 2P6TA 4K2EA 3CEWA 3F8FA 2FXAA 5A2QZ 1CX4A 2A68F 2WWYA 5LEKA 3E6DA 4G7ZF 2L02A 3J80Z 3GLXA 2M45A 1BJAA 5E18F 4M6XA 2AS5F 4IF4A 1SFNA 4UXNA 1B9MA 3GW2A 1YTYA 4KNYA 3VHRA 1JHFA 4HBNA 3IWFA 1U12A 1GXQA 2F2EA 3ZMDA 4PIXA 3M70A 3EO6A 5JSPA 1BI3A 3JTGA 3WU0A 2PJPA 3GUDA 2PTMA 3QP5A 3LWCA 1FYMA 2XAFA 2OQRA 1YWKA 3SCHA 3NKTA 2PMUA 4CDGA 4GGGA 1D8KA 5D6EA 1SD4A 1L0OC 4KN4X 3KEOA 2ZBKA 4KDPA 1HW1A 2QBYA 5D5UB 3H50A 3WGGA 2LF8A 3I53A 4E2QA 1KA8A 5IT9Z 4ZYDA 2Z99A
chains in the Genus database with same CATH superfamily
2YSRA 5IY5H 2Z79A 3FK6A 1P8JA 3R0AA 2ZX1A 3B01A 4IE0A 3T2PA 3AL0B 3H8OA 3IT8A 1LFPA 5H6RA 3BYWA 1LHWA 4IRIA 3HBLA 2XH6A 4FOWA 3WTXC 4PFOA 4TSVA 3C2GA 4LITA 1TT5B 5BPXA 4XN3A 2IXCA 4MGQA 2AREA 1RUD2 3FXUA 3HPHA 2JT1A 3G1LA 4DXSA 1HLCA 3U07A 4DY5A 2YDEA 3ETQA 4RBOA 2WWSA 1U78A 3I3MA 4KI5M 1UJ8A 3K4AA 5KK1A 3UKGA 2VZ1A 5GLUA 5ANQA 2Y38A 2BGPA 1ZYRF 5E8IA 3H9JA 4M9ZA 1HKQA 2E36A 2ZKNA 2FBHA 4IGQA 1WJFA 2XJTA 1QXRA 2ARBA 2FDGA 1QJFA 3L2YA 5AONA 2WQ4A 2HTJA 5I8TA 2Q8KA 1ULGA 3FXMA 4JC1A 4BEHB 2RKHA 3IH2A 2NMNA 4DOUA 3ZSMA 1YJNI 5LZ6A 5AC93 5GALA 1NY72 4MYEA 1UL9A 3NWSA 2QGUA 1SFKA 3QCWA 5J8CA 5AVAA 1H2MA 3OSGA 4KIFA 5LA2A 2BFUL 4XW3A 3T1MA 3RKQA 1RKWA 3N97A 3DEWA 3WGHA 3MEPA 2XWBB 2VT3A 4XMYA 4JGYA 1YITI 2VG9A 4ES8A 2EXIA 5F08A 1RTVA 1SLTA 3G3ZA 2JK3A 3I56I 1RVF1 2RR13 4WVZA 4BMEA 2VZTA 2QNKA 1BK1A 2DDAA 1R58A 2LROA 2BOJA 1BHGA 1L3JA 3V8JA 1B09A 1ZG1A 1VALA 2ZAHA 2ZHNA 3CJIA 3ES4A 3CF2A 1IXSB 4Q47A 3Q8BA 4AF9A 3WHCA 1WWXA 2M7AA 1LOAA 2FZ1A 1U9NA 2ELHA 3PMEA 2QDNA 5EQUA 1OHFA 1AXZA 5EJZB 3ENRA 1OH3A 4XILA 3L09A 4HAMA 4YZ5A 1UZZA 1SCRA 2JIGA 2I8DA 1T56A 3RPQA 1GQGA 2PX9A 1YLFA 1JZ6A 5E79C 2HWF1 3UR3C 1CF7B 4YG3A 1ZH5A 1E17A 2WO1A 5DUVA 1QNWA 3JD72 2Y2ZA 5FZDA 4XLFA 3HSEA 3ZYJB 5F2SA 2B39A 4P9GA 3ZN5A 5DN2A 4JYKA 2VOWA 4Q4Y2 5CAZA 2ZMEC 1OQDA 4Y5TA 2HWE2 3D5OA 4I99C 2CYYA 1UY1A 1O7FA 3HKZN 2ISZA 4GH4A 2H09A 1VAMA 3U2RA 2E2IJ 5A6YA 2VI6A 3MIDA 4XIOA 2W24A 2VECA 2G7HA 1Z3XA 1AA7A 2HVQA 4B4QA 3FM3A 1WW4A 5FLXK 1YQCA 1S0BA 4CP9B 1JYWA 2PHUA 2JA8J 3ULQB 3O1SA 1W6MB 2CW7A 2WAOA 3ACIA 5D5XB 1BYHA 1WCQA 4BDZA 4AIJA 1LOFC 1HXS3 3HHHA 3VKFC 1LU1A 2LR8A 4A3KJ 2V5YA 3QPTA 4XM3A 5L3BA 2MYSA 5BOXA 4B7EA 2R16A 1H9WA 1T6SA 2CWEA 5FLVA 3RWNA 4CDWA 3MLLA 4IHXA 4MXWA 2CUJA 3AMQA 4EGYA 3KETA 3HT1A 5FMCA 3WF2A 4DY3A 4H14A 2LTNA 4FQ4A 3AJYA 2VZRA 4WVWA 3GMEA 2OJED 1I1EA 5TISC 4ZZLA 3I2KA 1H0BA 5L9BA 1Q3EA 3CF5F 3LSGA 1O4YA 3E5UA 3VUOA 4AW7A 1FMWA 2VBYA 3CDIA 2NM1A 3H3LA 2JWPA 5LCWL 4ENJA 1FY7A 3VDDA 3LQQA 1WGPA 2PYTA 5GZEA 3C7FA 2Z16A 2JMWA 3VBHA 3DBHB 3FBNB 1FPQA 3PVNA 1DQ4A 3KGZA 4QX1A 5AFBA 1W9FA 2QF7A 1RC9A 1SD6A 2IGMA 1W8WA 4M72A 4AI2A 1P7IA 2YXSA 1R64A 2D44A 3A0KA 1MS1A 2WIIB 5A3OA 5LRRA 3NRUA 1RUE1 1W6QA 4XCAA 2JQ7A 2P37A 5HS7A 1ACCA 1W39A 2ZZQA 1LDJA 1MS5A 3RRDA 3AYCA 1CPNA 3USUA 2X4HA 2MPFA 3OF1A 2HKOA 2RN7A 3LMMA 4LKFA 5DTDA 2M30A 2DCJA 5L73A 3MAJA 3J7AO 3O7OA 4RGUA 1I9RA 3M7GA 1J09A 4MG2A 3J81K 2G9ZA 2Z5WA 2VKHA 1WCUA 4MGRA 1SVMA 4R1HA 5LLQA 2DTRA 1K45A 3I3LA 2P4EA 4IL6C 4E27A 2GOXB 1B72A 4Y22B 2W52A 3HN3A 4LO4B 1POV0 4MZUA 5EFUA 4B09A 3OL4A 1BMV1 3CO2A 1OPCA 4QDSA 5IK8A 5FROA 2VQHA 4AI1A 5EDNA 3OIOA 2RMU1 3ZOIA 2E1OA 3HEFA 5FY8A 2J1AA 1QPMA 3OGSA 4XOPA 2WS91 5EEAA 1AL21 5KC6A 3HOSA 2JDKA 5K9YA 3BIWE 3RZZA 4NHJA 3S1QJ 3B9CA 4MIMA 3MGUA 2G9WA 4ESJA 1MS0A 1C8M1 2P17A 4EJWA 1Z7LA 1IGNA 2XONA 3PIGA 5A6XA 5DD4A 3I3DA 1TWCJ 4OMYA 4P9LA 2A6VA 3BR5A 3N4MA 1PVC3 2W91A 2VE1A 5DV5A 4FPHA 3W59A 3EJKA 1QMJA 4UUSB 2DTWA 1BBYA 2JJ6A 5I0UA 5ACA1 3DYMA 3J81Z 1S0IA 3J7AY 4LHSA 1ETQA 1REEA 4IEWA 1NQDA 5FRNA 1F9KA 4LIUA 3AYDA 4OZXA 4UV9A 3D3AA 3PHMA 3ZOBA 2L01A 3JSOA 5L3DA 4UNOA 1ENRA 2ECCA 2JUGA 2AQFA 4XORA 5EG0B 3G7DA 2JB8A 4ZXKA 4FQZA 3DV8A 3OY8B 5F64A 1Q1VA 3IZOA 2FCVA 4GRIA 4JRLA 3WTYC 1SPPB 1XNBA 2XHNA 3FHQA 1NT0A 4XLCA 4MFEA 1PVXA 1UY0A 1GOHA 3CZUA 2XQRA 3LSRA 1YUDA 5EWSA 2Y30A 2WWUA 4RGAA 2R0HA 3N7KA 2F4OB 4B7KA 3HC7A 1FYLA 4Q4W1 3B94A 5FY4A 2VUMJ 2HGCA 1MSEC 2GH2A 2RDQA 2MEV1 5FD6A 3OGVA 3PFIA 4W97A 2OQ7A 4CCKA 2V09A 2YPRA 4XUNA 1JYTA 4AQ6A 3K48A 3ZXGA 2F5DA 5C71A 2ORXA 1UYPA 4PIZA 4ISRA 4ENNA 2Z5UA 5J1YA 5E3NA 5F32A 1WSUA 4OI0A 5GTIC 2XASA 2Q2EA 3JCUC 3THTA 4WZCA 3OYFA 1DP7P 4UHTA 1CIYA 3OB8A 3OUHA 4Q48A 5BNOC 4RFT0 2BBYA 2DJNA 3B73A 4HEA2 1Y0NA 4Q0QA 3LFKA 4OYUA 1H1IA 5F9TA 3SYTA 4HFSA 4LO7A 2W7NA 1UOJA 5HCHA 1UZYA 3MZYA 2XPVA 3HJEA 1O3TA 1A34A 2R7RA 2DU1A 2JSPA 2K9NA 1C8NA 4JX4A 2VBDA 4GH4B 5IJRA 3FC0A 1ZAOA 1RINA 4KMUX 3MKWB 3ZXKA 4BHPA 4G9SB 4LQRA 1NA1A 3U37A 2BY3A 3W2WA 4XFBA 4NIIA 4L9VA 4W8JA 2FBKA 3A1YA 2TUNA 5ILVA 3TN93 3I59B 4INDA 4IRGA 3ZXJA 5H9QA 4CHUA 5CEHA 4O9GA 4C3HJ 2Y9ZA 1LNWA 5IT6A 4YFNF 1H8AC 1VQ4I 3LSEA 3MIEA 4NRMA 1Z6TA 4ON0A 3QYBA 5F04A 1V0AA 2V1NA 4P08A 1GUUA 2PQQA 3SXWA 3BY6A 2VPVA 3BP8A 3H5NA 4RA0A 2D6NA 3E0JB 5DDJ3 2EXHA 3BJ6A 1DZRA 4A3JJ 4EEFG 4EN6B 4QKFA 4OOIA 5G04L 2VO5A 2ADEA 3POGA 2A70A 2VVFA 1WJEA 1D5YA 4FISA 2LRPA 5CQGA 3Q8CA 5C4XJ 3NV3A 1AXKA 4MQ9F 4YW1A 3IN9A 1JGSA 1FX5A 1MZFA 4AEMA 1GNHA 3K0LA 5BNPA 1ZZCA 2OU2A 3S8PA 3PSIA 1LODA 5BNQA 4O6JA 5LHIA 4CEWC 1IS5A 5C5TA 4D5FA 1YC61 4HQEA 2PMWB 2RS51 5CFDC 1X3UA 3V42A 2QQVA 1PIV1 2ETHA 1LVKA 3BG9A 4HF2A 1Y8QB 1Y7BA 2FE3A 2GQQA 1UXXX 4LR4A 4OHVA 1JZ5A 1GXPA 2QTWB 4AFDA 1XB9A 4QHZA 4CICA 4LJZF 1EYBA 4Q0PA 2KDOA 3D0SA 4FP3A 3IAS2 4WZFA 3RZDJ 4A7KA 2VCAA 3M4FA 5CIRA 3ZIXA 1CD3G 2BYVE 4GJYA 3L7WA 2HPMA 4G6QA 1UNBA 3VYRB 1OF4A 5FZCA 1T08B 4MEXF 2DURA 5ABJC 1O3RA 1QU0A 1US3A 2CQQA 3HUGB 1V6IA 3MBWA 5M5YJ 1R092 3DXJF 3VZOA 3PJRA 1XE7A 2XL9A 3O1TA 2KA3A 1F43A 3DEEA 1F31A 5D8LB 1L7RA 2H0BA 3DN7A 2HQ5A 2KIFA 5GP9A 4KJZA 4YZ3A 2A75A 5IVFA 2RVAA 5CKMA 1I27A 4V1PA 1TME3 1V5GA 2VOOA 2BVVA 1CZVA 1XSQA 2X48A 3M8FA 4PIYA 6PAXA 3ATGA 1WMDA 2EIMH 4AIKA 3FLRA 2BNMA 4N7UA 3DL3A 3DPUA 3AVRA 2B9SA 2D40A 1NHAA 2NQYA 3LL7A 4YPJA 1Y3TA 3POJA 1V6NA 1TZLA 4L0PA 1DF0A 4AHZA 1G8XA 2CV2A 2XAHA 1AR63 3EPZA 2GMMA 4Q4V2 5CA6A 2DCTA 2VGDA 2WO2A 1UAIA 4L5EA 1S7EA 3UT0A 3VBSB 4O5VA 3AKQA 5I0DA 3GBWA 3D0JA 3PVEA 2ZXQA 4MTDA 4TLGA 4YW3A 1R1A1 5FUNA 1EH8A 4KWKA 3TWIA 1RUNA 3UNGC 4LK7A 5D8AB 5FK7A 3ALQA 2RS13 1WKMA 2B4KA 1J75A 1NE4A 3LA3A 3DWLE 4HDVA 1IS6A 2YROA 2EV0A 1L3LA 3CUQC 1SC7A 3TO7A 5K1YA 2ES3A 1RUF2 4IQ4A 5FZ0A 4B48A 2FEZA 5HCAA 4IESA 2J1UA 2DQLA 1MMDA 3KHCA 3USSA 4YFZA 4JGYC 3MLKA 1VBB3 1OCTC 2O61A 1PK6B 5BNGA 2WDBA 3M2MA 5F39A 1M06G 3T0YA 5BY5A 5F5CA 2YS9A 4F3JA 2EWNA 2R7QA 4GB32 2Y34A 2LVSA 5EP9A 1UWWA 1VAKA 4XFGA 4NNJA 5JPMB 1PMHX 3CJIC 3TO9A 1YFXA 3H9AA 2YY1A 1MMGA 1JKQC 3A01B 4Q0VA 3PNAA 3QAHA 2F6BA 2CUZA 3SZGA 2OZJA 1APLC 2XB0X 2WQZC 3DCFA 2STWA 5ICEA 4RMNA 3B69A 4HONA 1HQNA 2CQ7A 4HZFA 1S0CA 3T30A 2W3JA 2I45A 2VD7A 3Q0VA 5JLWA 2NVQJ 1WBFA 1WH5A 4B4PA 4L0YB 2NS7A 3LFUA 1XS9A 1EAH3 1LEDA 2ZMEB 4QIWN 3SQOA 1HSTA 5FJHA 3WNPA 1RC6A 2Y26A 5FY0A 2NN8A 1MACA 4IL7A 1USSA 2WAQN 2V9VA 4LBJA 1ZGJA 1OR7A 4KUMA 1JZ2A 2ZHLA 1DQUA 3P9CA 1A6QA 2D6OX 1OCPA 1FPN2 2A6YA 3WVJA 2R1BA 5FKCA 1WD4A 3OR2C 3VDCA 2X1CA 1FP2A 2IC1A 3ZQHA 1WCDJ 3FXLA 5C3OA 2BZTA 1R23A 3KMHA 3GBFA 4Y7NJ 4HVQA 4BQXA 3LIHA 5C6CA 3AKPA 4JKLA 4CXFA 2AR6A 4YVWB 2YU9J 1V9U3 4EV0A 1ON1A 1RUJ2 4ZH4F 1NLQA 3BOQA 5FLJA 4NB5A 1O4TA 1TW2A 2VKEA 3HOZJ 2BWAA 1H88C 1OC1A 4JCKA 5A70A 4CDXC 3E5QA 3WF4A 3JRFA 4IHVA 2ZJCA 3LSJA 3A02A 3O1MA 4DMIA 2O8KA 2UXNA 4Q5SF 3WTUC 3ASNH 4M6VA 1YQ2A 2GNDA 1FSEA 2WZR1 4IE5A 3VL8A 1ULPA 3RDIA 1VBD1 1CZSA 4HKLA 4RHV1 3OS2A 2QKDA 4CDWC 2D6LX 3J7HA 5GTHC 4RR3C 4AI9A 2AEYA 4BQ1A 2XVKA 4RLFA 5GZFA 2P5KA 1WI9A 1U9OA 2WFF2 2LM3A 3EYPA 2IPQX 1ZELA 3I2GA 4EN7B 3UV9A 4XONA 5CYVA 2ZNZA 3PQKA 2OS2A 1HRI1 1UYYA 3OUJA 1PM7A 2ATFA 3PTRB 2E7QA 3KCXA 1BL0A 3VWBA 1HQLA 3VDDC 4LKDA 2EIJH 5J3UA 1MBGA 2PLV2 3VBHC 2A7AA 4IHTA 1EH6A 2WJSA 2NRAC 3S3OA 4U7DA 1IRZA 3M3IA 4ZS2A 2M1BA 4L5IA 2VTFA 4JX5A 1UAAA 4CCDA 2D5VA 2ILMA 2IGOA 3WF1A 4QGMA 5DG1A 3V7CA 1D0HA 1ULDA 1FMD3 1FTZA 4C30A 5KNLA 1CZTA 3SEQA 3H5AA 1K78B 2O0OA 3DGTA 1WMXA 3BIEA 3PVBB 3BG5A 3EXUA 5KXCA 1O3QA 2KPMA 2B9VA 3KP6A 3JRBA 1QY4A 4MFDA 1TWAJ 2RS33 3O0VA 3TEZA 2RVCA 1GVJA 4U87A 3N7LA 1RMU1 1QJX3 3RI4A 1D8JA 3ZFGA 2XGEA 4XRFA 4FASD 1RUH1 5J98B 2R5YA 1PMIA 1EP0A 3MO4A 3LZZA 3IDEA 4GJZA 3P5BA 5CADA 1MVEA 1TG7A 5FWJA 2J1EA 4LE3A 3WQ7A 1W0NA 5FYHA 4YM2A 2UZKA 1YXWA 2GLOA 1YIFA 3NAUA 4G12A 1Y9QA 4XDOA 2E9QA 1WPKA 2MD5A 1Z0HA 4M3EA 3FUQA 3WLUA 2ZKZA 2BOLA 5A1FA 3AM2A 4KU7A 2VMCA 4RGRA 2J1RA 2UURA 4ZONA 1MQTB 4FPGA 4P9IA 1AR93 1JODA 4R4XA 4L92A 1Z7S1 4XYXA 2LD5A 1UMHA 3K2AA 1ZG3A 2RJ2A 3UL2A 5IVYA 2Y6HA 1ZVFA 3OPTA 3OY9A 2EIGA 5EF6A 1HW5A 4RLQA 1O57A 1KU7A 1F2NA 1XNCA 2VL4A 2ZEZA 4IV1A 1BI1A 4BYYA 3MZ8A 2F4LA 4NUBA 3SKVA 3AMMA 3N3HA 3EQEA 4M3FA 2OZUA 2HWC1 5BYNA 5K0UA 4G8XA 1V54H 3SEPA 4B3XA 1W90A 1YI9A 2GXBA 2PMHA 4HG2A 5DABA 2R5ZA 1ERDA 4L5JA 1WCMJ 1TNTA 3ZGKA 3WP5A 2HR3A 3VD9A 5HDKA 2NVYJ 2ZB9A 1QQP3 1GLHA 2K4JA 4N43A 2PI0A 3R4KA 4M6YA 3MFCA 1EV13 1IF1A 4E7JA 2QENA 4IJAA 3W6JB 1B8IA 4PLMA 3VD3A 3Q9VA 4LT5A 5B1BH 4Q0UA 4PLOA 1F15A 4COWA 3GNEA 4CO8A 5LGNA 4CXYA 4EWDA 3JUUA 5FYUA 1W3VA 1DYPA 2M4KA 4IEZA 2HLEA 4BB3A 2HOSA 2XKPA 2MC3A 3LOBA 3TP3A 4NAOA 1VBA3 2ZJQF 1YQ5A 3ZKYA 2R6QA 4JX6A 1BIAA 1XGNA 1X3WB 3LAPA 1DP0A 3WSOA 2BNNA 1OOPC 4QPIB 5JVTA 4DBRA 1W05A 1RUC3 2I2SA 3V4GA 3PUSA 4IERA 3AFKA 2W4SA 4U7BA 1RI7A 4B44A 1LVAA 3ACLA 2DYCA 5IVCA 5FY7A 4RFRB 1AYN2 4Y26A 2XAGA 2F6CA 4K20A 4BU2A 2HWD1 5IK7A 2HYKA 2QQWA 5A7QA 1MZ5A 4M73A 3HDDA 3SLIA 1WKYA 2L7FP 5HLTA 1KS5A 3HG9A 3LOCA 1ND3A 1FYKA 2JZYA 5FREA 1P2FA 4LPLA 1RHI3 1KQ0A 2IW5A 4XBLA 5IK5A 5FZ4A 2W94A 4XIDA 4WM8B 2XVCA 4M71A 3QBQA 4QX0A 3S7EA 3OYMA 3U9GA 1BKZA 5D4SA 2SLIA 3BTJA 3G6JB 2J7MA 1WZ2A 3QU3A 1IW7F 3VBFB 1VFCA 1CAUB 4GQ7A 3ZXSA 2N8GA 1ZLJA 3WDYA 1WMFA 2QZ8A 5D1IA 4RA2A 1NA1C 3MKLA 1HA8A 4L2NA 3ZYRA 5DAPA 1MEC1 4ONUA 1S2BA 3NNMA 3KSCA 3AZVA 4ZDLA 3AG2H 5F8PA 4JQFA 1FXZA 3F2ZA 4QTRA 2ARAA 1D7PM 1H6XA 1XSDA 4XL9A 1W04A 4RAYA 3OGJA 1D4M2 1WW5A 5LD2C 5IYYA 3WUDA 2VTXA 1OD5A 4QGLA 2QCOA 1HJGA 1YQ8A 1WW6A 2R7TA 4DGWB 1NYWA 4CUGA 5FZ8A 4CEWB 4UVBA 1W6OB 1ZZ7A 4UVCA 5JVVA 4ETSA 3G1MA 5FZMA 4RAGA 5FYZA 1DP3A 3T2TA 1XBFA 3BVCA 4M3GA 3X2QH 1T2KA 5LFAA 3L1PA 5E88A 2VAUA 5IVEA 1OQ1A 2E53A 1BOAA 2V1UA 2ZFWA 5KHIA 3S1NJ 2WR9A 2XLAA 4PI2A 3H5RA 4DYQA 2EVXA 1ZBA2 2PHFA 3IDCB 1VBC1 1WMEA 1KRIA 1H4HA 5JSOA 2B7EA 4MLOA 1IUFA 2LP0A 2HOAA 2BFUS 2ZGQA 4AGVA 3RZKA 4LMYA 4JV4A 4JRAA 4WM7B 4A3XA 3GTKJ 3A0NA 5ABJB 5ERIA 3BODA 5A33A 3L2VA 5F1RA 4RM2A 1PGW1 3VHPA 3G71I 4BE2A 1EUTA 3ZFFA 4S05A 4PDKA 4L11A 2ICWG 3IRQA 3TEWA 1RUD3 5JIUA 1QA6A 3S0MA 4NWVA 3ETPA 4ZZ8A 1LFUP 1PZ7A 1W8TA 4A0YA 2PAMA 1JYCA 4YZ2A 4ARYA 2P6HA 3MMYB 4XPVA 2OYZA 4OHYA 3WQ1A 2E2HJ 3D1NI 1Y9MA 3AG4H 4WVMA 1W36D 4NOTA 1VQ8I 4BBSJ 4GYIA 1WJAA 5GM0A 3VD5A 1ZRIA 4GWIA 4P5YA 1HF0A 4CP2A 1OLME 3R05A 4QKDA 1D0XA 1JI6A 3ZRGA 3I71A 5H9RA 1GVDA 2K85A 4YWAA 3V0BB 3JTHA 1DGRM 4IPAA 1FP1D 5TRDA 5FO5A 2NVTJ 3NAPA 5E3MA 1X19A 1JU3A 3OWTA 3WTSC 3VPRA 4QQOA 2IT0A 1RXGA 2RG4A 3SKJE 1GICA 4BH9A 4PQQA 3B5LB 2ZSIB 4ZC3A 5H6QA 4IKFA 4C2MJ 5FQ0B 4JP0A 3E6MA 3NJYA 2H8RA 1W8NA 2YUSA 5AC91 1UOFA 2EA2A 1MH4A 1A6CA 3JQWA 3TO6A 3O1VA 1IQDC 5FGMA 4AXOA 1VRBA 4XJAA 1BC7C 4BCUA 1VRH3 3CUQB 5FYIA 1JZ3A 2P5VA 1TQIA 3K4LA 4XFHA 3T08A 5M3MJ 3H35A 3WF3A 2AQEA 2IS6A 1FTTA 1C57A 2JB4A 2Y6LA 4UYBA 2ME0A 4P9WA 2VCMA 4UI9L 2WWYA 5A7PA 1N47A 2L02A 4AYBA 1KD7A 4IF4A 3CESA 2Y60A 1VQMI 2FQ4A 5F37A 4COZA 1YTYA 1OUXA 2VLAA 1SLIA 1QRYA 2PHWA 3C7OA 1B8IB 1BI3A 2BVMA 1UKRA 3JTGA 2PJPA 3QP5A 2L9VA 4CEYA 3SCHA 3OIQA 1SDDB 2BW3A 2L2OA 3W20A 1W8UA 4KDPA 3LSKA 2PMZA 2W92A 2LF8A 3OBAA 2YBPA 3BZCA 3POBA 4E2QA 3JBG2 1NCRA 4TZDA 4IX7A 1KA8A 1J83A 3QOEA 3JD73 1ZBE3 1CAXA 4NIAA 1M4WA 3B7MA 3VYSB 2DMNA 3ZQCA 1W6PA 3NJXA 2ZEXA 4YNIA 3NEUA 1AHDP 3O0WA 4Q4Y3 1K83J 1WLCA 4CCMA 2XROA 4LG0A 3GJBA 5C9AB 4H4KC 2HWE3 2WL1A 4BXXJ 3O2PE 5JI7A 4E7LA 4IV3A 3U21A 4ABZA 2DVFA 2IBDA 3U4XA 4QX8A 1HQCA 5FJ8J 4KITB 1LGNA 1W3XA 5EPAA 2DA1A 3RQIA 1OR7C 2Z9OA 3ACFA 3CLPA 2DA4A 3ZR8X 4ZY9A 4C2UA 5HLHA 2Q8OA 4K1ZA 4Z2WA 2WQ8A 2ETEA 4CU7A 1GT0C 1MS3A 1OLTA 3W3CA 4GFBA 4XF1A 2HQNA 3UGGA 1YJ9I 1ND2C 1OCOH 1QHHD 4M0HA 2HJIA 3GFJA 1QNYA 3ZMVA 4BQAA 1R36A 3E6CC 3BTLA 1HXS1 4AVCA 4CDXB 4AYUA 2HVRA 3NSTA 4YGCA 2JDYA 2BEOA 2HOTA 2EQRA 4OMZA 2BHZA 1YIJI 3O12A 3MHZA 2ZHKA 2R92J 4CYCB 1VQPI 2C6SA 5IYDJ 4F91B 4YIFA 4AWXB 5FWEA 3CCQI 3OYWA 2EAKA 4RR3B 5A7WA 4ASMB 4JTOA 2ZABA 4EZ4A 2CNAA 3GZNB 1PVC2 1SMYF 1TC3C 1Z1DA 3UYJA 3OEAA 2PELA 1NAEA 5JXGA 1BW6A 2BVLA 1CQ9A 3KIOA 4DYCA 3WU2C 1OYWA 4K8FA 3IAPA 1FOXA 3ASOH 4HOBA 1W0PA 3M3QA 3CCVI 5JR3A 4G4FA 1F9NA 3RZHA 2ZMNA 1DLLA 3VZJA 1YOVB 1OCRH 1UO9A 2HNHA 3GF2A 2E19A 4LLLA 4Q0SA 4A3DJ 4C3IJ 2KRCA 1LHVA 3OYEA 5F0FA 3MVPA 3FMSA 1HLVA 2E6VA 4B3AA 3E7LA 4YG0A 3KZZA 5FPBA 3CQOA 3MIHA 3HR9A 2YFUA 2Q5TA 5B5EC 1X2NA 3CIHA 3SH4A 3ZN6A 5I0SA 3VD7A 4A93J 3OEBA 4A44A 2VOVA 2HXOA 1ASJ2 2GBYA 2FMYA 4CDUC 5HCBA 3JZVA 2FMLA 3K2OA 3GTQJ 1VF9A 5JZGC 4V2FA 1ETWA 3H0GJ 2HEVF 2CAVA 3CF6E 5DAVA 5A33B 1E3HA 2C9KA 3GXUA 2UWAA 4D6QA 2LSOA 2P3YA 2HEOA 1YJLA 1V5EA 2VODA 1Q56A 3GVAA 3CP2A 1X1CA 3VZKA 5EZHA 3LB9A 4QB6A 3F22A 1HKDA 1NE6A 4RQPA 2M7BA 3ZFGC 1WJ5A 4KWJA 2CSOA 3M1EA 4HOOA 1JZ4A 2OPKA 4EYUA 1VQKI 3U10A 4TV7A 2OQ6A 5HLGA 3REOA 5FB2A 1XD7A 3CDHA 4K3UA 1DU6A 2ZXHA 1HW2A 1MS4A 5FZOA 3A4CA 2WSVA 1SD7A 1NZCA 2R7DA 5K4LA 2JUCA 3VOEA 1KU3A 1J5YA 4LLGF 1WJBA 4AI3A 3FFZA 4ESFA 4P5OA 4PDWB 1BIBA 2LBFB 3ILRA 2LLKA 2XUBA 3B93A 3QYFA 1LAJA 2W48A 3RQ4A 1SAXA 4TLFA 4DS0A 2F5FA 5E1RA 2PQ8A 3SISA 4IV1C 4HQMA 3H1YA 1ZZBA 2GZWA 1RUI2 1MMNA 2BNOA 2CUEA 4KNCA 1SFOJ 5I0TA 3SH3A 2EZHA 2HFHA 5K0UC 4HANA 2VONA 3FKIJ 5DD8A 2JG8C 2DOFA 3PNYA 1F35A 1T33A 4XUQA 3H36A 1IKPA 1ULYA 3OYIA 2WABA 1PGL1 1KYWA 3S30A 3GBGA 3SCGA 1JUHA 1U0AA 2K86A 1D1BA 3V7RA 1BK0A 3O1PA 4NVPA 1Z9CA 1U2WA 3TOBA 4KGGA 4AAPA 5T5OA 1TMF2 3BROA 4A7YA 4Y5Z0 2Q0OA 4F83A 2Y6KA 4YSFA 1N1YA 1OOPB 4C90A 4ZKTB 2JX9A 3MW3A 5HLIA 3P1IA 2VZVA 3DFGA 5C4WB 1QIQA 3M8EA 1A36A 2CWMA 4A42A 1FSHA 1C5HA 4ITCA 1WGXA 1J9IA 1AR72 1QHGA 5FY1A 2ZAAA 5HPOA 4BBRJ 4N53A 1AYM1 3EMRA 5FAXA 2CS3A 5EJCA 2EB7A 3ZVXA 1W6NA 1CWPA 3KLNA 2CJJA 5E1ZB 3HPNA 4E4HA 4IEUA 1FV2A 2RDPA 4G6DA 5HXMA 3MZHA 1A8MA 4F52A 1Z91A 1XOYA 4AFAA 3HBKA 5L19A 1RMU2 4JHTA 4XF0A 1S29A 4IV3B 1G2HA 1ND3C 5CISA 1MS8A 4LUKA 1IS3A 1KDKA 4AVBA 3DLLF 4CA9A 4Q8LA 3IPVB 5DYMA 3CCSI 2LMDA 2W1WA 3FK7A 2J5PA 1Q5OA 1P4AA 1NK3P 3TN91 3JQXA 2SBAA 5BUVA 1VNDA 4XETA 2VQUA 4IVNA 3SEZA 2RV9A 5FZ1A 2VY0A 5LHHA 4GIQA 3CMYA 1LEBA 5FZAA 2JE8A 5F6KA 4J00A 4FVVA 1TWFJ 5CVIA 4L99A 3WW2A 3DEUA 4PF5A 1SVOA 2AH2A 3CTAA 3LPGA 5IAXA 4LLNA 2WUHA 5DDJ1 5FLHA 1R6RA 2X10A 3F8MA 5IT9K 3VBRA 4BMBA 3WE2A 4BK5A 3BCAA 4XFFA 4XQWA 2JRMA 4UW6A 3VKOA 5E3OA 4EM0B 2YZ4A 3S57A 1UF2C 3NNLA 3PU3A 3T1LA 3PDQA 4ASNA 1XGOA 4NPMA 2O0YA 4YW5A 5CVRA 1O7LA 3O0XA 1S0GA 1RUG1 5J6XA 1FC3A 4CVUA 2X8KA 1RPWA 1FBSA 4DNCA 2VULA 3ZMTA 2Q8CA 5JXHA 4XFCA 2L5QA 4XDPA 3QACA 3LA2A 5CKQA 2J22A 3CMEI 4H55A 1LESA 2HYJA 4YFWA 3ECOA 2MD0A 1HN0A 4JDOA 1SQ4A 1S3JA 2JDAA 1S0DA 1RJ8A 3ZMNA 2MSYA 1C4RA 2CTVA 5FKKA 1XPXA 2XBO2 4FI9A 3DPRC 5LBBA 4K7JA 4TYSA 3SITA 5J37A 4ZPIA 3NL1A 4D94A 3GZ5A 2YX7A 2XRNA 4D9JA 1B4AA 1BJQA 2DV9A 4ZXEA 1RR8C 2H6CA 1WLDA 3VBOA 5D8KB 1I3QJ 4EN8B 2O5RA 1VB2A 4FPFA 3CD6I 3ZFEA 4HETA 1R093 1BVVA 4EROA 5C7GA 1LECA 4BY7J 2W1QA 3HM5A 2ECBA 1JS9A 3N9OA 3OYKA 2JG9A 2K46A 3KVBA 1W99A 4M3BA 1X7NA 5E17F 5JXJA 4I30A 4GMP3 3K7AJ 4AIDA 4AVVA 3T8TA 4HLYA 1COV3 1UU5A 3R6SA 2OBPA 1EAH2 1XSRA 1TME1 4UW4A 1YO5C 4L18B 1VBE2 2FQPA 3FMGA 4AUXA 2K9LA 1FT9A 5LBEA 2MH2A 1NTCA 3PNTA 1ZR2A 4CU9A 3Q9SA 4IGOA 5A3NA 5J7MA 1FJLA 2FDKA 4C91A 2OTLI 3WNNA 4HN0A 1NZIA 1AU7A 2M87A 3CCJI 4KGQA 3CLOA 2B42B 4Q4V3 4AHYA 3NKGA 2AACA 2X05A 4L97A 4QB2A 4B1MA 3SEEA 1AR61 5JSRA 1X4OA 3K70C 3V7SA 4DJAA 4AYBN 1CJDA 1B35A 4PJMA 3GEZA 4AEKA 3WU1B 4DZPA 3OYJA 3JRDA 5J48A 2P5LC 3IH4A 1K12A 1UIKA 4BISA 5K8SA 3W6VA 2IXIA 2BW8A 4LB6B 1IUYA 3HKZA 5CPRB 5T50A 5KVRA 4AWDA 1ULFA 1LHOA 3C1DA 5GLZA 3FUOA 1IC8A 2KXLA 1RKTA 1RUF3 1ULEA 4NR1A 2JA2A 3WTWC 2PMZN 3ZYBA 4TXWA 4JKMA 4NHLA 4HPQA 2WT1A 1PX4A 4UF0A 2R0QC 2AZ5A 4LKSA 2OVUA 3CJRB 1VBB1 2TBVA 4B1LA 5FPAA 1J0RA 3H9GA 1ZRCA 2P4WA 2W1SA 4OZOA 3KF5A 4XF3A 2XJVA 4GB33 1A35A 2IP2A 2O9LA 1X8EA 4COVA 4BQYA 2E26A 3PNVA 1FOKA 4N4OB 1UPIA 5EGOB 2D6KA 2QQLA 4FBFA 3AP7A 4I76A 4IO9F 3MF6A 4MO7A 2Z2SB 1HJFA 4CEYC 4CGZA 5FMOL 4O65A 1KU2A 4NO4A 4BNCA 4KG8A 5FZIA 1QJU2 4FSJA 2KMUA 4NDLA 5M0TA 4PGHA 2XF5A 2ARCA 3S7IA 4R79A 1WLTA 5FPZA 1BEV2 4N7IA 3U4SA 1BBT2 1NCRC 3V64A 2NS8A 1FMD2 5L3GA 4FPEA 4DNYA 3BT9A 3CL1A 1P92A 1JH5A 3G2BA 1FPN3 1DYKA 1JJ6C 3G4SI 1OCZH 1VMJA 3S3NA 3VDBA 4FPYA 5EIYB 1IN6A 4CXWA 3N7MA 1BA5A 4QQLA 1OPOA 1VQLI 1JHHA 3BTZA 1ND2B 2J1TA 2C24A 4DZJA 2P3JA 5FR3A 1SBDA 5GAGJ 1V9U1 5FYBA 2DA7A 1WW7A 2HBUA 2W08A 5FO8B 2E7AA 1ZZ8A 4ZYAA 2ZPXA 2W47A 5LK5A 4ZTJA 1LQ1A 2VQTA 3RNSA 5CYYA 4G9YA 1WCSA 4D0QA 2A6TA 4D7TA 5K7PA 3H7JA 1SEUA 4CXXA 4G94A 3ECHA 5GLTA 4KIGA 2LW8A 5L7OC 2F17A 4PJNA 2WNVB 3HOWJ 3FBIB 4BEHA 3ZQGA 4V19K 4U0WA 1NXD1 2XJRA 3S5QA 4XVHA 3UKNA 1Z7UA 4XR6A 2DTYA 5FZEA 1UXZA 3RTRA 1R082 2LKPA 2WFF3 3MN2A 4ITVA 2JD4A 2RC4A 2RDRA 1SFEA 2E34A 2LUWA 1SBFA 5FFXA 2EH3A 1RJ7A 4M4RA 4E2SA 2Y48A 4PSXA 3R0RA 3W21A 4A3IJ 2PLV3 2GNTA 2DCYA 1SLCA 4JVAA 4DFSA 4BKXA 3GCWA 1RVF3 2CMPA 3BTAA 4WF2A 4HXCA 2ZGNA 2CG4A 2Q8DA 3N9QA 2PN6A 5HOOA 5DMYA 2IFWA 1LJ7A 1AXYA 2PXJA 1GZCA 5FPXA 2B5HA 5CFCB 2DA6A 4PF1A 1I6XA 4HK8A 1WJCA 1EV12 1GOFA 4U0VA 5F1JA 1G3WA 2GNMA 1J58A 3K4KA 3ZR6A 3WCSA 4I01A 2VL8A 3HT2A 4COYA 2XMLA 5FLMJ 4HF0A 3JCIA 3W9AA 2HYXA 3LIGA 1JXNA 4HNVA 3AP9A 3O8HA 1T98A 2XQXA 1W1WE 2YC0A 1KQRA 1QHDA 4QPOA 1R7JA 3OIPA 1IRXA 4U2AA 1V5FA 3WODF 3GYHX 1MJBA 4CE8A 4QX5A 2RS31 1CF7A 2DO7A 1VBA2 3ZFEB 3QODA 3IIIA 2DMPA 2KZGA 1QJX1 3KZIC 3N9MA 2DFBA 4WXDA 4EWEA 1A04A 3NMBA 3HB9A 4PCQA 4YM0A 2V26A 2VB6A 1UX6A 3T2OA 3QH7A 4RQPC 1YYNA 3ACGA 1URXA 3GLLA 4A6EA 1GYKA 4ZDOA 2EPFA 3FZVA 2CV6A 2R7SA 1Y6IA 4XURA 1U8RA 2XUEA 2KIQA 4OI1A 5JOXA 3EYYA 3G6EI 4CP9A 1BCXA 1W6MA 2WAAA 1IAWA 2FRHA 1AR91 1V3FA 1KQ8A 1UZVA 4CSWA 5FZGA 2E1MB 2MH9A 3K1MA 2D3SA 3L9FA 3R4SA 2Y0MA 3PU8A 1H8TC 2EILH 3O14A 5KHHA 2UUZA 1CONA 1I3HA 2QM3A 3MKZA 3FLTA 2BQPA 2YFZA 3IDBB 1G8WA 3BB6A 4ZU7A 1XE0A 5HNFA 4UFMA 1UX7A 4B43A 3MQ0A 1TVGA 5IFTA 1IOAA 1IPJA 3ZSJA 3U1DA 4ZHNA 1QWRA 4HVOA 2LS6A 3BTYA 2XF7A 2CSGA 1HQWA 3WINE 4H7LA 4QHBA 2JG8B 4FX0A 5A6ZA 1GBGA 1IN8A 3I58A 1F5FA 3COAC 3BPXA 4A12A 1X50A 5JCTA 4NWWA 1DUXC 2ERFA 5CG9A 4F92B 2JPCA 4BQNA 3UGHA 3WR0A 3B6AA 1XNAA 4GWMA 5IWFA 4R9BA 4L9TA 3RYKA 3PFYA 4XIKA 1ZK8A 4CH7A 3J26N 1IQAA 1WWYA 1H1AA 3V0AB 1AJKA 3WF0A 2CGNA 2E7XA 4PI0A 3FMQA 2KD7A 4AFCA 3JRHA 2M9HA 4WX9A 1T2XA 2YMZA 3J4UH 5KXDA 4SLIA 5L3EA 1Y56A 1ALYA 4K9SA 2WNUC 3U11A 3RS6A 4FETA 4M9SA 1RUC1 1D0ZA 1W4MA 1BR4A 3R61A 1AYN3 3W58A 2X5IB 4R9DA 3WV6A 2XL7A 4LK6A 3THPA 1U0JA 3GCXA 2EAAA 3ZYGA 1ZRRA 2O1QA 1F4AA 4LUMA 4L0ZB 4QWQA 1U5TC 2GN3A 3DBRB 4UW5A 2DU0A 1Y0UA 4EM1A 1GZWB 4XLPF 3INAA 4HLTA 4LOTA 1HKSA 2DOEA 4ENKA 4Y22A 4UUTA 2BJSA 1RHI1 3CNAA 1RITA 5FDBA 1NQJA 4NIGA 1BR2A 1NH3A 3O5SA 3KP7A 2YYOA 4YZ1A 1VP6A 4LK0F 2W25A 3VZLA 2ISYA 3CDZB 4GWNA 5B2GB 2FNPA 3S3MA 1V6JA 4BQQA 4F3QA 4CRQA 4XABA 4KWUA 5A3MA 2VMHA 5DUUA 4I3GA 2K02A 2WLQA 2WS93 3C7HA 5DM6F 1PGSA 4R8HA 2R7OA 2JN6A 1TNRA 3ZYPA 4Z6YA 3GJAA 4CA0A 2JECA 4LBLA 1QGLA 3PJQA 1IV6A 4EGZA 2HPIA 2DT6A 5H9PA 4CCCA 5TGTA 2IRFG 4IHSA 1EA3A 2GH8A 3NV2A 2UWCA 3I0TA 1UKGA 4ATFA 1AX0A 3WNKA 4UUSA 1D4M3 3I3EA 2K3PA 3JREA 2QQUA 1WJDA 4OVEA 5A7OA 4JTNA 1SDWA 4BQ2A 1R4NB 2FD8A 3VBRC 4EJTA 5A3LA 4KMFA 4HYEA 4BLIA 2JDUA 3D82A 3IDAA 3R0JA 5EV7A 5LHGA 3KHBA 2F5VA 1J84A 4NAMA 5EG0A 3QYEA 3BPSA 3KP5A 4FTHA 2A6ZA 3L2UA 4QXKA 4CCEA 4JOMA 3OY8A 4EM2A 4Y1ZA 3KT4A 1VRH2 1Z21A 4RS5A 1SPPA 5ERLA 3K4BA 3VBUB 1Z77A 3DKYA 4URAA 4YVSC 1XTAA 1ZBA3 4FQGA 3GO5A 5EXOA 3JAMK 5HDNA 3DU6A 5DZEA 4BHCA 1DQ0A 4I0WB 3DPRB 2XIGA 1QOOA 1DLCA 2VNGA 1O8SA 5FLIA 1R1TA 1PUFB 3QPHA 1PGL2 1ENXA 3GHNA 3ZXFA 3WW4A 3ON7A 5EEGA 1YFUA 4QX3A 2OF7A 5ICGA 2DPUA 3OMYA 3VZMA 2DBIA 2WAEA 5IATA 2PHLA 1XDSA 1LRHA 4KQ7A 5JXIA 1GANA 4LTAA 2LK2A 1CJPA 5BXXA 3F72A 1RYYA 4MHGA 4XZPA 3VBOC 2L7MP 4CU8A 1CX1A 1IHMA 2Y64A 2R1DA 1WH7A 2KL4A 4BLJA 3PUIA 1ONVA 4BIFA 3QOPA 4ZZDA 2XPJA 1T0FA 1DIWA 4ESBA 4MNUA 2M0MA 4CCJA 1ZBE2 1OFSA 3H1WA 4ENMA 3J9SA 2R062 3N9NA 4XKWA 1OQEA 2C9AA 4Y52J 5C8CB 1IG3A 4AR2A 4LOSA 1W9YA 4RL7A 3D6EA 2NVXJ 4JGZC 1K7AA 1NLSA 3MLJA 3TB0A 4GKXA 4FXKB 4QPGB 2FD5A 5HVQC 3TOJA 5T3NA 4BJ6C 3OTFA 3AKRA 2BZDA 5LBQA 1BM9A 2GN7A 3POSA 3CCYA 3NJZA 3I59A 4OIPF 3L2QA 1XG1A 3IRRA 3Q5FA 5A3UA 2ZX0A 1VLNA 3ML6A 1OKRA 1K5MB 3D4KA 4FTSA 4KT5C 3CMGA 1D2QA 2ZXWH 5L3FA 3UJQA 2HEYF 4HG6B 2CYFA 2D1HA 5IP6A 1VZ0A 3PUHA 5IW0A 2FA5A 1YEWA 2WAQA 3A0HC 1B35C 2VJIA 1ACIA 1S55A 2VZUA 4D5CA 3SFIA 4LBQB 3T3YA 2I07B 1IRFA 1E5HA 3WHTA 4GYGA 1OBNA 3AMHA 1H1MA 3LSPA 1O8PA 2H27A 4IEJA 3C2HA 5DAWA 3M3OA 1S5LC 3FX3A 1UU4A 3TEXA 2FZ2A 4BY1J 1H9GA 1CAWB 4A7ZA 5LA0A 4FOVA 4HX8A 3WG7H 4CUCA 1OSGA 2VMDA 5DEQA 2FOWA 1ZZ6A 5E6HA 4C1XA 5FPUA 3ITQA 5H9SA 1F1ZA 3CMMA 3DUIA 1W5CC 3DXTA 4A3EJ 3P5JA 2C1FA 1H9PA 3V65A 2UY9A 2R32A 3C7JA 3J8F2 5LGUA 3HAGA 4OQ9A 1PIV3 2WBMA 3BQZA 1VQ6I 3L00A 1NG0A 5ISLA 4F7ZA 3A7QA 3E1SA 2VNVA 1WA6X 1WI3A 3EUAA 1GHCA 2UYBA 4OUEA 5JLVA 1AR82 4Y33A 3KV9A 2CV0A 3RWKX 5KAFC 2IFRA 3HJRA 3WQ0A 5FLXZ 2AENA 4SBVA 2GNBA 4MHRA 2VZSA 2XKOA 4I6ZA 2VOTA 2JDNA 5CB7A 3JBG3 2NYXA 5IVVA 4IEXA 4XRMA 3KT1A 4OUSA 3FZ3A 1OFNA 3OYDA 3JD71 2VC9A 4GA9A 1ON2A 3GHMA 3DTEA 3HUGA 4Q4Y1 3APBA 2VXZA 3M8JA 1PHMA 2HWE1 4AGGA 1XRUA 4Z1VA 1E3PA 4AEDB 3C8XA 3AL0C 4FFIA 1I5PA 2EALA 4BPZA 1MJ9A 2WKKA 2X0LA 4XACA 2VCBA 4RDUA 4LXLA 2MLKA 1MBFA 3OYGA 3ST7A 5HODA 3FISA 3BR3A 2L4AA 1HSJA 4P1WA 1XXNA 4YIRX 4BHBA 2WZ8A 3POYA 4URTA 4GMP0 1SZBA 2P2KA 1IXRC 2D43A 1UMIA 2ZOEB 2R042 1W8ZA 5EYRA 2CRGA 2MABA 2KKOA 3HOVJ 2K5CA 1ETXA 2HWB1 4V2WA 4EVIA 2KT0A 4LFUA 1HBXG 4NHXA 3B00A 2FDIA 2PFWA 2D7FA 1ZG5A 4KIBA 1R71A 2BE5F 1PJRA 1JTZX 1QU3A 3BJAA 4P9JA 1ETOA 2GP3A 4K6BA 3FE5A 3OR1C 3N9PA 1H0MA 3RZLA 5JI9A 3ZQFA 2DUQA 3K4JA 5FZLA 1GV5A 1CN1A 2VKDA 4K8RB 2B9UA 5IVBA 3VBSA 1ZQ3P 2VMIA 4YW4A 3RIRA 1HC8A 4QPQA 1JI8A 1N3OA 3K4NA 3NNFA 2XJPA 1W7PD 1PO22 3I8TA 1I5ZA 1IN5A 4LNVA 2XVGA 1R1A3 1QNTA 5FCCA 4UAPA 2HTSA 5JVGF 1XC5A 2L0KA 3A23A 1BXHA 5D8AA 3NV4A 4HSTA 2DJIA 1DQ2A 1JT6A 2FOKA 3ZSLA 2VQLA 5KBFA 1PO12 4HN1A 4YGDA 4PFPA 4E70A 4ZYHA 4HLXA 4K2EA 3CEWA 4L9BA 2R072 1WVRA 1CX4A 3FXJA 4G7ZF 4HK9A 3MIGA 1JUSA 3GLXA 2M45A 4JQTA 1PK6A 3IV5A 2AS5F 4M6XA 5J4YA 1B9MA 2R7ZJ 3HWJA 5JOZA 4RS5B 4YM1A 4CU6A 3IWFA 3RVHA 1GXQA 3ZMDA 2ZGOA 5JSPA 2WSUA 1KITA 5GLWA 1FYMA 2XAFA 2R7WA 2EXJA 1YWKA 4AOCA 1ASJ3 4EATA 3NKTA 4CDGA 2BPA2 2QUOA 2DT7B 5D6EA 3KS7A 3A01A 2W1UA 1V6MA 4KN4X 3KEOA 1SVLA 2W82A 5FOJB 3I53A 2OC6A 1POV3 5GPAA 1DG6A 2EA4A 4MQVA 2V73A 3ABLH 4PJLA 4GWJA 3CCLI 2QA4I 4CDQB 1UG2A 4XOTA 2JIJA 5L36A 2ZMEA 3RZOJ 3WDTA 4XLNF 5L9VA 3AKSA 2VUAA 2OA2A 1YYVA 4LG3A 2K9SA 3IHUA 1FZPB 4ZZ5A 2G7UA 1PM4A 3GZAA 3BKZA 3FMRA 2WV0A 1IGOA 3WXPA 2K3FA 3JR9A 3FIWA 2GXAA 1XDUA 2WO7A 4P5HA 4YVWA 2CDPA 2MBFA 1UCXA 2GC3A 3PIPF 2G9GA 1H8TB 1W7PB 3L2CA 3RG0A 1UZCA 3J7LA 4M3CB 3CCRI 4YGBA 1YIOA 4Q26A 3HN1A 5J1XA 4CP1A 1YO8A 2LC2A 3POEA 5F0CA 3KYDB 3SZTA 1W5SA 2VASA 4FCAA 4QAWA 1U5XA 1MGTA 1RUI3 2DAOA 3SC7X 3OG2A 1AF9A 4XSZF 1VBD3 2VNOA 3MPBA 3I3QA 2V5DA 1S4CA 4B1RA 1OVSA 4DXRA 2CY6A 5AFEA 4XFIA 1JBCA 4NMIA 1Y9GA 3OL3A 3UETA 4XAEA 1TLHB 1QQIA 1UU6A 5H2FC 4J01A 1FWZA 3W2AA 2GC1A 4IE4A 2W85A 5GAEJ 2DVDA 2XJQA 3IWZA 1Q8SA 5FKMA 1HV1A 1TP4A 1KZHA 3CJXA 2ZKLA 3TNPB 4LHNA 3MFKA 3FHIB 2MFZA 1MNEA 1TMF3 3L2WA 1UY3A 1D2SA 3BR6A 5T52A 2EV5A 1SMTA 1MVQA 5J3LA 4IQPA 3MV11 4DPNA 1OLRA 3M1HA 5FUIA 1NCQC 1CAVB 2WNUB 5BNNB 1YI7A 5FZ7A 4WV8A 3BTXA 1JUMA 2W95A 4XBNA 2IA0A 4GALA 2NMOA 1R5GA 2RM22 3AP5A 3HVDA 3P9KA 1FLIA 3I2DA 2RQQA 1AR73 3HSFA 3JB8A 1MPXA 1K78A 5D6FA 5FTTC 1U5TB 1QO0D 2P6CA 1OA2A 3GDBA 3A2KA 4Y13A 4OMCA 5CNAA 4UB6C 3GALA 4V2VA 3OGRA 4XOGA 2W84A 3UKVA 2JA6J 5DUWA 4QDQA 3MW4A 3RZMA 4NIHA 3H3UA 4Q4X2 2PHRA 2I10A 3WD5A 4KBBA 1RMU3 3TBDA 2Z69A 2Y75A 4Q29A 3WG1A 2IS2A 1HRV2 5A7NA 2IS4A 2ZGRA 1RUH3 3SJMA 1EV7A 5FIXA 1R00A 2OKXA 3SDGA 3C2UA 4DRRA 1X9TA 2P7CB 2OA4A 2XVLA 3ZO0B 5HV0A 2WN2A 3KV4A 4XK4A 1GWLA 1QH7A 1U5IA 2YC4A 3RYRA 3H1MA 1AX1A 1RIRA 1COV2 2PG4A 2HQAA 2L7KA 5FP8A 2RNJA 2DWRA 3ABMH 2BVBA 1MQTA 2R49A 5LRSA 2HS5A 5FYVA 2Y6FA 4DIQA 1ZR4A 2YX4A 4LGWA 5IP7J 1DGRN 3M7AA 5FP4A 1WA4A 2NZ9A 1AUYA 1QJY2 5LY1A 3VD4A 3JSPA 2VW0A 2KP6A 1OLMA 5BV6A 4OU0A 2P1BA 4AG4A 3ELKA 3OBRA 2HDCA 4ET7A 5LA1A 2STTA 1FBUA 1OURA 2MC4A 3GTLJ 2F4IA 1LDDA 1V6LA 3IKTA 3VLBB 2KRHA 3Q9OA 4YG6A 1JTYA 1UELB 1TEIA 3K3NA 2WTEA 3NWKA 1JGGA 2BP6A 1QXJA 5FKBA 4FXGB 4NQWB 5ICCA 1SMVA 2P3IA 1ZN2A 4M00A 1BW5A 4DOZA 1C0WA 2XBO3 1H4GA 1WHUA 1R1VA 2ZJRF 3SQNA 5DZGA 4B4CA 5CKTA 2WA4A 4Y1VA 2VXJA 4C8DA 1L7LA 1YJKA 2Y0SN 1N1VA 3WNOA 1OF3A 3AL6A 3G1OA 1JHJA 2XJUA 4O9EA 3AB0A 4I98B 4PJYA 4QPIA 2BUKA 1LEMA 1PMJX 3GTOJ 1R091 2X85A 3LEGA 4N9IA 1IG0A 4BK4A 4J19A 4AI0A 2XXZA 2ADDA 1VQOI 5J36A 4CUAA 2CFOA 2VC0A 3ZXLA 1LKXA 1FV3A 4D0PA 4MEYF 2OX0A 3I4MJ 4BDVB 3HOXJ 3DF8A 5CZKA 4GMP1 4FPCA 1EJ9A 4BQ4A 2TNFA 2VNRA 3OPZA 2HEWF 1WFXA 2RAEA 5A2QK 3LEIA 4JGZB 1VBE3 2ELKA 1BZWA 3FLPA 4WM8A 1LHUA 1UG0A 3ERMA 1HB1A 4YW2A 2PA7A 5F6FA 3AYAA 4GXLA 2QQKA 3AP4A 3OBTA 5FMOS 1NK2P 4OINF 3GX4X 1FOD1 1ORKA 1YLLA 4OHZA 4Y4RA 3L9JT 2BTVC 5HI0A 1MNMC 2FDHA 1OFCX 5F2WA 3VBFA 3D8CA 4UV8A 1CAUA 4GH4C 3M1CA 1V6OA 2OCEA 1PNGA 1QEXA 4XFAA 4Y20B 5B66C 4Q4V1 1GWKA 1X58A 4XXPA 1PZ9A 2NNNA 2VR4A 2ZS6B 2DBBA 5LB6A 1FATA 2IZWA 3PMSA 4MTEA 2VZPA 1K4SA 4QHOA 3BR1A 2D5HA 1H6YA 5IOYA 3BR0A 3KM5A 1FIAA 3KEQA 2I74A 3VSLA 1AHSA 2O14A 2XG3A 4XKVA 2KQRA 5B3SH 3LFMA 3R4UA 2W2IA 2QQNA 2ID4A 1AL0G 4XQDA 3KCYA 4BE1A 3PO2J 1STMA 1OYYA 1ZRDA 4NHKA 4RGSA 1GQHA 1RUF1 2V4JC 5KHJA 1ZARA 1G9BA 5K5RA 4CEWA 1E2XA 3K75B 1S72I 4BE3A 5FRMA 2BXYA 1GP4A 1W6OA 2DVGA 3I2JA 4Y24A 2R7VA 1BN5A 4FHTA 2TRTA 3S1MJ 4BQ3A 3IC7A 4LEJA 2NVUB 4KBZA 2JDPA 2D3RA 4MGIE 1JTXA 1QOSA 1QZZA 2JKXA 4GB31 4CCOA 2XOMA 1NOVA 1TT0A 2IS1A 1VE0A 4IEOA 5CJ9A 1ENSA 3KWVA 1XGMA 2X6WA 2GIVA 3NO8A 3RCOA 1KXGA 5J40A 3BZ6A 1RVF2 4PSWA 3EBRA 2VPLA 4OFGA 5CBLA 1QJU3 3NVCA 4WM7A 1XNDA 2E63A 3FDYA 1PVEA 4UT5A 5DAQA 3Q3SA 5FMBA 2JA7J 3T0BA 5ABJA 1BEV3 2MNGA 1C5IA 1BBT3 3QD6A 2OW4A 3IAQA 2D5FA 1N77A 2E71A 2Q0AA 2WAFA 2V72A 1O3SA 5F6LB 1ZM1A 3RFRA 3M3YJ 4OAYA 4M4PA 2EFQA 2DCEA 2HZDA 1FPN1 1Y8RB 1W03A 2LG4A 1RXFA 2K7LA 2DT5A 1W8FA 3CU7A 2XSJC 1LTEA 3FWEA 3AXEA 2OUHA 4A2UA 1K6OA 2RGVA 3IM0A 1MBEA 1SHWB 1C1LA 5E3LA 2GM4A 4MOAA 1T6GC 2JD9A 1T39A 2HWF2 4XUOA 4KT6A 3H9QA 4MXVA 3NNJA 5HBAA 1RUJ1 3ZX7A 3JRAA 3ME2A 3KP4A 1S0EA 5F0HA 3CCUI 5LBFA 1E0EA 4KICA 1S7OA 3V0BA 3HBZA 1UHWA 4AL9A 3I54A 2YPJA 4UXAA 3S6PA 1H2NA 3ZSKA 2AEZA 3T8RA 2Z99A 3NARA 3RJPA 5KXEA 5JMOA 2QE3A 4E4ZA 2EBIA 4Z82A 4BXUA 2WY7Q 1O5LA 1UD1A 4Z2YA 3FHZA 1X4PA 1QDOA 2LDUA 3M3CA 1WRJA 5TJJA 3LA7A 3ZYIB 1CIWA 5FQ0A 2M34A 2FUG2 3IUOA 1R083 4EWAA 3ZQIA 4XZUG 4A69C 3ZPYA 1JYNA 1UIJA 2EJRA 2FDJA 3VHNA 4UB8C 2WFF1 3ZXAC 3VFZA 1Q8OA 2XB6C 4BOWA 1LE8B 5KWRA 3VBSC 4M3CF 4NC7A 2EK5A 3CUQA 4A45A 4P9UA 3HHGA 5GLVA 4BWOA 2QSFX 3M9AA 3N7JA 4P55A 4RN5A 2PJRB 3ABZA 4HW0A 4QKNA 5D8AC 2PLV1 1IPSA 4X8PA 4Q5OA 2YC2A 3ZDVA 4O3MA 2DCZA 1OPMA 2PFBA 4LLFA 2ZTNA 2CV1A 4XAAA 4FPOB 3BTIA 2YU2A 2NS0A 1PK6C 1FIPA 3HXLA 1YW8A 1RIOH 4AFMA 2ZX2A 5IP9J 4E7KA 1O4XA 1EKEA 4FCYA 1REFA 2QEXI 2P6SA 2V4VA 1ZGWA 3OYBA 2DPDA 4W6WA 1OCCH 1YQAA 5JHUA 1GP6A 2M2EA 5A32A 4UBGA 4B8XA 2KISA 4J6GA 1SFYA 1K6YA 4FPJA 4L9NA 2PEXA 4LJHA 5FZFA 5AIQA 4D7SA 1RUE2 4N90A 3TW7A 1UPSA 4M3DA 2Q1FA 4YW6A 1MBJA 3N05A 2XAQA 3K46A 5BNOB 1XU2A 3RKXA 2ZX3A 4QLCU 3HZJA 5C9AA 2DLLA 1OYIA 3EUHA 4S2GA 2ZSHB 3OYNA 3GXOA 3OJBA 3S2DJ 4Y3OA 4A6SA 2VQ0A 4QDRA 4FTEA 2QQMA 4A3GJ 4RAZA 2QVSB 3B3QE 5F5IA 3EQLF 1G3YA 2NYYA 4OAZA 4CZZA 3SH5A 2UWBA 1YRNB 5JFRA 3BPVA 1HXDA 3BTCA 2GDFA 1BMV2 4HNTA 4LD5A 4FFFA 3WTZA 2D93A 4ZU4A 1X1DA 3O6BB 4C9YA 2RMU2 1CGPA 2A3YA 2RJKA 4C0BA 4MGZE 2XAJA 3M4OJ 2TEPA 4CDXA 1W0OA 4YVWC 3VDAA 1HDDC 3IB3A 3FXOA 2HWB2 3AP6A 2WS92 5F3GA 4EJUA 2ACJA 1AL22 4CYCA 4S04A 2DMTA 2VT2A 3UESA 1DPRA 4IZZA 4XC9A 1C8M2 4EQVA 2HOEA 3WW1A 4RR3A 2ZA9A 4UFKA 2CGPA 2X53S 4A3LJ 2B45X 5A3TA 5IPAA 3GCMA 5EEHA 4EZHA 2V9KA 1Q8VA 4NIDA 1Z0XA 4WK8F 3CC2I 1OKQA 4IDZA 5ACA2 4QGNA 5FOBB 4OHXA 2XB5A 3M07A 2VVEA 2OCCH 5I8YA 3GM8A 3JRCA 4WBBA 2Z42A 4R52A 3RZJA 5ICFA 4IW3A 1H9TA 5CFDB 3CKHA 2ZGMA 4AHXA 2IVMA 1GP5A 1NCQB 5A1AA 1RESA 4UOJA 5GKAC 5BNPC 2BRTA 1T6BX 4IOCF 1OT5A 1KQ9A 2Q1MA 4YELA 5SV8A 3AYEA