2HLEA

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
188
Chain Sequence
AGHHHHHHEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
molecule keywords Ephrin type-B receptor 4
molecule tags Transferase/transferase receptor
source organism Homo sapiens
total genus 31
structure length 188
sequence length 188
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hleA00
1T2XA 5DQ0A 3T0DA 4ZXEA 3VD4A 2L9LA 1TG7A 1F4AA 1W0NA 3MO4A 5C71A 2VZQA 2CDOA 4MADA 1JZ3A 5EJZB 1CIYA 1EUUA 3DECA 3LEKA 5G04L 3WF3A 2W47A 2VZSA 3T2OA 3ACFA 3VD9A 4KMQA 4A6OA 1JI6A 1F4HA 1PMJX 3ECQA 1NKGA 2WN2A 1NAEA 4GZ9A 4MO3M 4XZUG 1UYZA 1K12A 2J1RA 4TXWA 2WZEA 3A23A 2BGOA 3T2QA 3WEZA 5I0DA 3LPFA 4LKSA 3PUIA 2ZEWA 3HNBM 2J1UA 4A45A 3C7GA 1DP0A 2W46A 5JXHA 4YPJA 4E8CA 4CUCA 2J1VA 3SEPA 4XVHA 1GU3A 4UOJA 2BERA 2X10A 4XURA 1GNYA 2JDAA 2DCJA 3FHAA 2VQUA 1OD3A 3OGRA 3UESA 2VZOA 2C9KA 3WNOA 2VR4A 1CZSA 1J83A 2WABA 1UMIA 3I2JA 2VM9A 4CU9A 2VCAA 5IFTA 1UY4A 2J1SA 2WYSA 1TVGA 3WNMA 3NNGA 1UYYA 4Z2AA 3OEBA 1EUTA 1JZ2A 2VQTA 1PMHX 2Y64A 4A44A 2WO1A 1JYXA 3LE0A 2Y8KA 3K4DA 4OMCA 3CKHA 3HEIA 4XUTA 1WCQA 3EYPA 3JXSA 3MBWA 5JXIA 4DEVA 5LA1A 3GM8A 1GOHA 1I5PA 3THCA 3SEEA 4DXRA 2VZPA 5CZKA 1D7PM 4CU6A 4CU7A 2W95A 1SG3A 5LCWL 4CUAA 1JZ7A 3I3DA 3WF1A 3T2PA 1OH4A 2WBKA 1BHGA 4A41A 3K4AA 1GMMA 4XUPA 3UETA 2JD9A 2BZDA 2VZRA 4DUVA 3J7HA 3LQCA 4RYDA 4ZZ8A 4JHZA 1JU4A 3WSOA 2VL4A 5FUIA 1J84A 2WAAA 2YC2A 1CZVA 2RV9A 3C7EA 1KGYA 1PX4A 4CVUA 3U37A 2KD7A 2WO3A 4PF1A 1GOFA 2W1QA 3OG2A 4BXSV 3K46A 3OGVA 3MV11 5C7GA 2VMCA 2W91A 4JKKA 1YQ2A 3IAPA 1O8PA 5JXGA 1JYVA 1OT5A 3HNMA 2HLEA 2WDBA 1W9WA 1JU3A 4A42A 1WKYA 3A7QA 1US3A 4ZZ5A 3I97A 3ACIA 4DEQA 5LA2A 3MUZ1 2VOTA 2QQNA 5B4XA 2Y6HA 2YG0A 1UWWA 3VDCA 1GQPA 4BK4A 1US2A 5IYYA 2QQMA 1JYNA 5G05L 3MUY1 2V72A 3VDBA 2QQKA 2ID4A 2X09A 4MOAA 4DUWA 1XPWA 3ABZA 3VD5A 5CYYA 1KEXA 1O8SA 2VCCA 4QB6A 3WF2A 4KWUA 3CDZB 2RVAA 4A4AA 3LEGA 3FL7A 1UMHA 2ORXA 1K3IA 1R64A 2R7EB 3T09A 3UNPA 2ORZA 2J1EA 1XNAA 3VDAA 4OYUA 2LS6A 1UY1A 3BN6A 5B4NA 1JHJA 2WUHA 2W1SA 2Y6KA 1ULPA 4BDVB 3IIIA 4W50A 2VZTA 3E1F1 1MPXA 3I2KA 1CZTA 2Z4FA 3OGSA 3K77A 4W8JA 2QQOA 5JUVA 1GUIA 3BGAA 3NQHA 1CX1A 1OF4A 3I3EA 4QDQA 1NUKA 3CIHA 1ULOA 3SKVA 4PT6A 3WNPA 5EIYB 4UI9L 1XC6A 4KI5M 3HPNA 1HN1A 1RYYA 3OB8A 2XONA 4P00B 2CDPA 2C26A 3WNKA 1NX9A 2ZEYA 5EJ1B 1JZ8A 2VO5A 2VZ1A 4QB1A 3P6BA 1PX3A 4QX0A 3ZM8A 2XOMA 3I3BA 4HG6B 4JX0A 4RN5A 3AC0A 3ETPA 2RJ2A 4QB2A 4UAPA 4FI9A 4CUBA 2ZEXA 2VMFA 3I2FA 4L0PA 2ZXQA 3CMGA 3W5MA 2J22A 2J1TA 5JR2A 1L7QA 2JKXA 2WO2A 3DYOA 4BK5A 1DYOA 2JE8A 3DYMA 4JKMA 2QQJA 4JKLA 3P1IA 2YFUA 3W5NA 3ACGA 2XHNA 3K75B 4ARXA 5HXMA 4AAXA 4A3ZA 5JXJA 2E33A 3ACHA 4P5YA 4TTGA 1P8JA 1XNTA 4QDRA 3LPGA 2E31A 2E32A 4MGSA 4OUEA 2YFZA 1JYWA 2VMDA 5LA0A 4XUNA 4CU8A 4LHSA 3CZJA 2W94A 3C8XA 4OMDA 3CQOA 4QX3A 5IFPA 2W1WA 2YB7A 4P02B 3IAQA 2W9XA 3NJVA 4QPWA 2EICA 2DDUA 4MGQA 3SKJE 4QX2A 4AG4A 5DMYA 4OZOA 2WQ8A 1UXZA 5F7UA 3WQBA 3MV01 3D3AA 2YC4A 2XQXA 3GDBA 3C7HA 4P08A 1H6YA 4D8MA 2OKXA 1GOGA 3I2IA 2WN3A 2W92A 1W9TA 2Y6JA 4D0QA 5HPOA 2B4KA 2E26A 1OF3A 2W5FA 1L7RA 1JZ5A 1UZ0A 4ZY9A 4LPLA 5IHRA 2ZEZA 4XUOA 3T0AA 2EIBA 2W87A 1H6XA 3NJXA 1JZ4A 2B9VA 4M4RA 3WF0A 2V4VA 3WNNA 1W8NA 1UY0A 1UYXA 2VTFA 3T0BA 1DLCA 2J7MA 3I2GA 1JZ6A 4M4PA 5JMOA 2Y6GA 3HNYM 5DN2A 3HJRA 3IB3A 1UY2A 2BBAA 4LQRA 2Y6LA 1O59A 4W4ZA 1K45A 3DYPA 3WNLA 3OEAA 2EIDA 3GXUA 5IJRA 3C7OA 4PQQA 1W8OA 2VZ3A 3VD7A 2QQLA 3IDAA 4XUQA 1W99A 4IUGA 4QDSA 2W3JA 1W9SA 4QAWA 2WZ8A 3CZUA 2QBXA 4DUXA 3T08A 2WAOA 2VJXA 4BJ0A 3NRUA 5C70A 5A1AA 2HYXA 1UXXX 3WF4A 5DPNA 4DXTA 5J1XA 1SHWB 3GGLA 3LEIA 4ET7A 3FHQA 3EB7A 2VCBA 2QQIA 3I2HA 4ARYA 1SDDB 3A22A 3C7FA 3THDA 2LW8A 3OBAA 1UX7A 1UY3A 3FN9A 4GWIA 2V5DA 2VZVA 3HOBA 1K42A 2VZUA 2J1AA 2X05A 2VMEA 4QX1A 1IQDC 2C4XA 2W1UA 2BGPA 3HN3A 1LNSA 3F2ZA 2DCKA 2EIEA 2PQSA 3VD3A 3K4ZA 2VC9A 4GWJA 4DXSA 3PUHA 4E8DA 3A21A
chains in the Genus database with same CATH superfamily
4FPHA 2YBSA 1PZ8A 1SLLA 4URAA 3WW3A 2CGOA 3B69A 1RHI1 1SLBA 4Q0VA 3O1PA 3B94A 1VALA 3QLQA 1XQNA 3N35A 1UD1A 5FZAA 2EIGA 1B09A 4M3CB 4PHZA 1JZ3A 5FPXA 4V2VA 3ZSMA 3GZUC 2B45X 4QD2A 1AR63 3WDVA 1MQTA 3ALQA 1J1LA 2ZAHA 1UU6A 3D0SA 3AXEA 1CAVA 3DECA 1VBB2 1ZRCA 4LIVA 2UY9A 1WMEA 2W47A 3KHCA 4MGIE 2HWD3 3RMYA 3SLIA 5BNPA 3AKPA 1QQP2 4NHXA 3UV9A 5C33A 5IK8A 4OI1A 3VZMA 2NPIA 5FWEA 2BW8A 1RUI3 3RDIA 2VD7A 2LRPA 1W6PB 3H7JA 3I59A 4FPOB 4TWTA 3KT1A 3U14A 2GN3A 1GNZA 2AEYA 3H1WA 4XHXA 1UYPA 1ENQA 1LR5A 1K12A 2J1RA 4QU2A 1WA4A 2OXBA 4N9IA 5F5QA 2WZEA 3AJZA 4XHBA 4ISRA 2WLQA 5AFBA 3GALA 1DU3D 2BGOA 2PHDA 4XW3A 1ZZ8A 1C8M3 3WEZA 3LPFA 3GF6A 1VIWB 5I0DA 4AVCA 1H8TA 3N9PA 2QZ3A 2MNGA 2ZEWA 1IS6A 4YFZA 1CJDA 3D4KA 1YFYA 1NYWA 2FZ1A 4PIYA 2RS53 3SCFA 5DDJ2 3VL8A 2JECA 3SEPA 3U1XA 4URTA 3T4VA 3ZYPA 1PO23 4AGRA 3NO8A 4CXYA 1REDA 1YEWA 3MI8A 4P5HA 4UOJA 5FZOA 3NW4A 3BIEA 3POEA 2I2SA 5FDBA 4QHBA 5BV6A 3OY8A 1JW6A 1WLCA 3DXUA 5AC92 5FZEA 2X10A 2R32A 4KGQA 3S5QA 2PTMA 1Q8VA 4XFAA 2DCJA 2RR12 3BVCA 3OGRA 4AQSA 3UESA 3ZFFB 2DVBA 4LHKA 3HN1A 3D5OA 2ZGTA 3RZGA 2JB4A 1H2KA 2Y0IA 1VBA3 2XJTA 1UPIA 1CZSA 1VBE2 1V6LA 2WABA 3I2JA 4XAEA 3E5XA 3UKTA 2VM9A 5FO8B 4ATEA 1O91A 4BA6A 1UY4A 4FBFA 4RR3C 2JKBA 5FPBA 3TEXA 2YPDA 1FAYA 1UYYA 4Z2AA 2G9GA 1FYUA 4BCUA 1BJQA 2EA7A 3QCWA 4R9CA 4HONA 2WO1A 3WXPA 4A44A 2WNEA 1AL22 2Y8KA 1VBD2 1TME1 3JUUA 3LE0A 4OFGA 4AXOA 1H9PA 2EXJA 2EXHA 3BTYA 3WG3A 1W6PA 5KHKA 3CKHA 3HEIA 4XUTA 5AVAA 4Z1VA 3EYPA 1O3TA 3MBWA 4DEVA 1H4HA 2LM3A 1RVF3 2RM23 1OKQA 2B46X 3THCA 3SEEA 4DIQA 3ZXLA 4DXRA 2VZPA 5LRRA 3WUCA 1O4YA 3OUIA 1D7PM 4AYUA 5C9AC 4DB5A 2W95A 4LE3A 3O7OA 2WNVC 3I3DA 2QDRA 4P9LA 3M1HA 3SISA 2W0XA 3T2PA 4CDQC 3LWCA 1X36A 5LW9A 3VBHC 2VXJA 1RUF1 3K4AA 1XJAA 4AVSA 4B4RA 4YVWC 5C3PA 5C8CB 1VP6A 1GQGA 4YGCA 2ZX1A 3ILRA 3HWJA 4Q27A 4E2QA 5FXVA 4D7TA 5A80A 3KB5A 4DY5A 4ZZ8A 4COYA 1JU4A 1NCQA 2IVJA 4UT5A 1OI6A 4LBKA 2WT2A 1V9U2 2A6XA 2F4PA 5F3GA 2JG8B 3BU7A 4XF0A 4FTBA 1KGYA 4OI2A 3ZR5A 2VOXA 4Q26A 2WFPA 1UQXA 1S0EA 4META 3OG2A 3ZFFA 1W28A 4NHMA 2H0BA 1MS1A 4XDPA 4BLIA 1LENA 5CKQA 1AR91 3J7NA 3TYJA 4KWLA 3RMXA 4AQ2A 3AJYA 2NP0A 2DFBA 1UU4A 2WT0A 1W9FA 3OF1A 2PLV3 2ZKNA 1F9KA 3IAPA 4GAZA 4QPIA 1KJLA 2WKKA 5FY8A 3W20A 3DKWA 1JYVA 2WZR2 3HNMA 4HMZA 3HMYA 2BEOA 4NWVA 3VHRA 4CTEA 1O3SA 1JU3A 4O9EA 1DDLA 1D4M3 3AKTA 2WLPA 3KGZA 4ZZ5A 2A3XA 1EV11 3ACIA 3GHMA 2D3PA 4FPCA 4XCAA 4DEQA 1PZ7A 3MUZ1 2JG9B 1N3OA 4AVVA 1KDKA 1Z7S1 2YU2A 4CE8A 4AI1A 1NCRC 1W8ZA 1YQ5A 2F17A 4PI0A 2ILMA 4QX7A 2BNOA 3AP7A 2QQMA 3KS7A 3VZOA 5IYYA 3JBG3 5T54A 1HN0A 1URXA 3ON7A 1COV1 1SCRA 2V72A 4M01A 5T5OA 2XJUA 2ID4A 4XIKA 4ZONA 4HSLA 3UK9A 4KWKA 2JE7A 4HOOA 1RUH3 4XBNA 3R4SA 5CYYA 3VD5A 3L2HA 3LF7A 4CCOA 2VCCA 2BWCA 4QB6A 3WF2A 2X5IC 4KWUA 2ET1A 5BNNB 1W0PA 3FUQA 5LY2A 4I0BA 4H14A 3FFZA 1SFYA 1GZWA 2R7EB 1DG6A 2JENA 4JGYB 3OTFA 3SH4A 1HW5A 1A34A 4WZFA 1XNAA 4YZ1A 3APBA 2CSGA 1YXWA 3NNMA 2W08A 2R061 2UYBA 3OGGA 1QXPA 1BEV3 3ZFGC 1UY1A 2IC1A 4COZA 2JXAA 4Y24A 3B01A 5B4NA 1YJLA 1CESA 3N7JA 2C9AA 4FPGA 5JLVA 1OUXA 2RS32 1I3HA 2GNTA 4P14A 4NPLA 3T4HB 4CDXC 2EVXA 4Y22A 4YM0A 4LLOA 1BXHA 3RJ2X 5J7MA 2BPA2 1H8VA 1LECA 1KITA 1YO8A 1QNWA 3OGSA 4R8HA 1Q5OA 3K77A 4W6WA 4W8JA 5DZEA 1R1A1 5KXDA 3AP6A 3S5AA 3LFIA 5BNOC 1G9DA 2LALA 2RHPA 1ASJ1 4XILA 5CFCB 5K8SA 5FP7A 3I3EA 4CCLA 1NLRA 2WS91 2AGSA 2VECA 1GZCA 3CIHA 3ZYIB 2UY8A 4GKXA 1PGL1 2QQUA 4K20A 5IK4A 2RMU1 5F5AA 2WJSA 5GZDA 2TBVA 4R4XA 4KI5M 3OD4A 5EIYB 4XMAA 5L19A 1H2LA 4FQ4A 4SBVA 5J98B 1RUOA 4MHUA 1RYYA 1WBLA 4GMP3 3OB8A 4IETA 2XONA 3GJBA 4K7JA 1S0GA 1IKPA 1NX9A 3E6BA 1W6MB 4HKLA 1I6XA 4XBQA 5EJ1B 1JZ8A 1AJKA 1O6UA 1HRI2 2VAUA 2AH2A 3P6BA 4QX0A 4LULA 1MS3A 1HXS3 4PDWC 3VBFA 4LBMA 2XOMA 3I3BA 5KWRA 1W03A 3BCWA 4Y5TA 1AR83 1RUE1 3MW3A 3H8RA 2D44A 3BODA 3IDEA 3LZZA 3AC0A 1DZRA 3LAGA 4Q0PA 4QB2A 3WCRA 1U5ZA 4MX3A 3ACLA 3L9JT 4CUBA 1S2KA 4JGYA 5FY1A 3T3YA 4AOCA 5FR3A 2BQPA 2JEMA 5DAQA 2DVGA 1ZBA1 1WW6A 5FY7A 2GP5A 5KR7A 3CMGA 3ZDSA 3ZXGA 1YFWA 1W8HA 3LSEA 1RUJ3 4Y1XA 3RZMA 2WO2A 3EHKA 4XXAA 4BK5A 4XXPA 4AGGA 4XPVA 1OH3A 2QQJA 5JMCA 1PVC2 1XYOA 4TLFA 1AYM3 3Q8AA 1Q8QA 3IPVB 2AYHA 3P1IA 2YFUA 5I8TA 2XDVA 4NUBA 2XHNA 4ARXA 2P37A 1IS4A 4CSWA 1C4RA 3HT1A 4LE4A 5CFDC 1BMV2 2HJIA 3H0OA 2E33A 3VBOA 5D8AA 5FWJA 1OD5A 5A33A 1CN1A 1P8JA 4EZ4A 5CFCA 1XNTA 2VXRA 1OPMA 1ZRRA 4RA0A 4P9WA 2YV8A 4S2DA 1XNBA 4IE7A 1W90A 3BOPA 4QPGA 2I45A 5DABA 5FZ8A 1DIWA 3EXUA 3E5QA 1WLTA 1VAMA 4LBQB 1UIKA 3RJRA 5FQ0B 5LA0A 1SLIA 2WO7A 4Q1PA 2R041 1HRV1 5CKNA 2AUYA 1DBNA 3W9AA 1EPZA 4AI3A 3CZJA 2QTWB 2B9UA 1WMXA 4YW2A 3CQOA 2O14A 3UT0A 3NL1A 2KR2A 4QX3A 4LBNA 4BQXA 3ELNA 5CB7A 1IGOA 2W1WA 3J7LA 4I30A 2YB7A 3VBSB 3IAQA 2ADEA 3GJAA 2EICA 3I7DA 3S6PA 2P6CA 2SBAA 3RS6A 3POJA 1VRH1 1HKDA 1LHOA 1R092 1WWYA 1CWPA 1W6QB 1C3HA 4EZHA 5F6KA 1YLLA 4I0AA 4NJ4A 3O1TA 3WY6A 4CDWA 1AYN1 1WD3A 4XAAA 4IGOA 5AVPA 3MV01 5FMBA 2YC4A 1OLQA 1A8MA 3ZYJB 3MGUA 1D2SA 3GDBA 3P3PA 4LA3A 4DPNA 3U0ZA 3J26N 1H6YA 4LLFA 4D8MA 4AEKA 2OKXA 1GOGA 2AENA 3GZAA 3BIWE 3MEPA 4ES8A 2WN3A 1DGRN 3I2DA 1K5MC 4K1ZA 1WA6X 3VZNA 5HPOA 2Y38A 4MGTA 2XL7A 5JOWA 2ENRA 5GZEA 4I01A 3FZ3A 4BQ3A 5CAZA 4HK8A 5FMCA 2OW4A 1CQ9A 3AP9A 3IPVA 1XNCA 5FXWA 4I3PA 1H6XA 1JXNA 2XHKA 3O12A 5FO9B 5KC6A 4HVOA 4DRRA 1VBB1 4CRQA 3WF0A 2V4VA 5ACA2 3PMSA 1XU1A 1VAKA 3POFA 2OZJA 3POGA 3ZMNA 4X6RB 4FFIA 1QQP1 2Q1ZB 3GBGA 1TNFA 1QJU2 2VTFA 4L9BA 1IHMA 1V6JA 1FATA 1LOEA 1W8UA 1ND2C 2QFEA 4WM8C 5FRAA 4LBQA 2P3KA 1MS9A 5JMOA 2QCSB 3HNYM 4L97A 4JDOA 3HJRA 3IB3A 3USSA 4D94A 5JOXA 4AVAA 2VTXA 3Q9OA 2PA7A 4QU1A 5E6HA 1MVEA 5FYZA 1ENXA 3MPPG 2WZPP 4ONUA 4QQHA 4NHYA 3GXUA 4G3YC 4AFCA 1J59A 3MLJA 3VD7A 2XKPA 3IMNA 3U11A 1AR62 1N3QA 2I74A 1W6QA 2ZPXA 1SLTA 2TEPA 2W3JA 1BBT3 5DDJ1 5T5PA 1CR7A 2HWD2 3N7KA 3AYDA 1QJX3 3F95A 4GMP0 1JOBA 1WLDA 2B7YA 2HH9A 4I09A 2ERFA 4RS5B 1U5XA 3T08A 2E63A 1QF3A 3GYDA 2W68A 4Q0QA 4BJ0A 5AC91 2XH6A 4MHRA 4IL7A 3ZPYA 2O8QA 4AQTA 5A1AA 4GWMA 4UWDA 4OHYA 5FZ0A 2RR11 4LBQD 3ZSKA 4DXTA 4UW5A 5J1XA 1LCLA 2PQQA 3LEIA 1Y4WA 1DQ6A 1S4CA 3R4DB 5FZ7A 3TBDA 4ASLA 1LTEA 2G4IA 2ZMKA 1TQ5A 3R05A 1VBE1 1C8M2 1RC6A 3MLKA 2FCVA 5CNAA 1J1TA 4YG0A 3V56A 1ODMA 1CAXA 3KCCA 2QQIA 3VHOA 3M3CA 5JPMB 2GC1A 2RS52 3KV6A 3M4FA 1YWKA 3PVEA 3R4UA 5F2SA 3I2HA 4OUSA 5A3PA 1SDDB 4PI2A 1O4ZA 4NIGA 1Z7S2 4SLIA 4BQ5A 3C7FA 4JDNA 3THDA 4FPKA 2LW8A 3LIHA 1RUD3 4MGKE 1X82A 1AL21 1VBD1 5DZFA 5CKMA 2AACA 4HPKB 3ZYHA 1YYNA 3I4IA 4K3UA 4Z8BA 3AKSA 4PLOA 1AXZA 1QJY3 4CCMA 2J1AA 4CP2A 5IVYA 5FY5A 2XJSA 3D82A 1JYTA 4KGGA 2BGPA 3HN3A 4QX8A 4ATFA 3ZN5A 4EJRA 1WCSA 2EIEA 2PQSA 2V5YA 4I3GA 4XJAA 1LOCA 4QWNA 3AFKA 1VBA2 2D93A 5IVFA 3PUHA 4QQOA 3WQ7A 3KQRA 4OUMA 4I2OA 1HJFA 4LOSA 2K46A 1F15A 1ZZCA 2O1QA 4NWWA 5T52A 2ZHMA 2G19A 3T0DA 1PIV3 3VD4A 2L9LA 2IXCA 4YW5A 1TG7A 1F4AA 2Q4SA 3H1MA 1XYPA 5A7NA 4MADA 2CDOA 4ZKTB 3VDDB 1HB2A 3OBTA 4RS5A 2X8KA 3N9NA 1LGBA 1WW7A 5JI9A 1LU1A 3QBQA 3LGRA 5EJZB 5ERLA 1I5ZA 4FSJA 1NQDA 1EUUA 1V9U1 1XSQA 4NO4A 5JZGB 2RDRA 3VKOA 2FDIA 1MVQA 3PNAA 5J09A 1RVF2 2VZSA 5F3IA 3IT8A 4YW4A 5A3WA 3T2OA 4B4QA 3PTRB 3LCPA 4S2HA 4KBBA 3ZDVA 1G6NA 1CVNA 2JICA 4KU8A 5FKBA 5H9PA 4XTPA 4KMQA 1XNKA 1W3VA 1Q8SA 3N9LA 1F4HA 4CCDA 1QWRA 2D6PA 5C3RA 4B1LA 4IEPA 1NAEA 5J36A 4IEXA 2YMZA 4MO3M 1EAH3 4M3CE 4YW6A 3HBZA 5FFOC 1LB2A 1Y7BA 1C57A 2WZR1 4ISQA 1PGW2 1XRUA 2WWSA 1DQ1A 4HPKA 1UNBA 4NRQA 3M2MA 2FQPA 1K5JA 3C7GA 1DP0A 2W46A 5J48A 4QQLA 4E8CA 4CUCA 1O5LA 5L9RA 1ZX5A 2Q1MA 4Y1VA 4JTOA 4UBGA 4AI8A 5A7SA 2GC2A 1ZRDA 1SDWA 4ES9A 2VH9A 4IEVA 4A2UA 4IW3A 3PUQA 3BB6A 2BWAA 2DU1A 2GDFA 1GNYA 3N9OA 1WGPA 2XJQA 1DFQA 3FHAA 2XVGA 3Q8EA 4NAOA 5LBEA 5LK7B 5KXBA 4FPYA 1PK6C 1ZBE3 2PLV2 2WNVB 5FK8A 5GM0A 5GLZA 3ATGA 5FZGA 4CDQB 1MACA 2Y34A 4QQPA 4AI0A 4BXFA 5F6LB 4CCKA 2VR4A 3VDDA 5A6ZA 4FOYA 1D4M2 2VY0A 4Y1UA 4YVWB 2VCAA 5JVVA 2Q30A 5DXDA 5BYNA 3M3QA 4Q2FA 3SMHA 5FZ6A 4YZ2A 3WNMA 4AEMA 1O4TA 1S0CA 3OEBA 4H3WA 1EUTA 2CNAA 1LOFA 4Q0UA 5A6YA 3PIJA 2Y64A 1PMHX 3W21A 1G9AA 2VBDA 2YBKA 4XZPA 3TAYA 3JBG2 1MZEA 1C5HA 5D2AA 1YQ8A 2ZGQA 1H30A 3JXSA 5J3UA 2A6ZA 1LOGA 2IWGB 2RS31 5JXIA 3VL9A 3KZ4C 1H1MA 4RHV3 1RUH2 3SITA 4E4HA 1GBGA 3FWEA 4MXWB 2Z2SB 2ZJCA 3NAPC 3AP4A 5CZKA 4CU6A 4CU7A 1MR5A 1X50A 3I59B 2QQWA 5L7OC 1SG3A 4YZ4A 1VJ2A 2OS2A 4YG3A 4DFSA 4AW7A 1SQ4A 2C1FA 4RR3A 1OH4A 2VQAA 4MZUA 3VZJA 2VUCA 1BHGA 4A41A 1FMD3 2A1XA 1YFUA 1YCIA 4PBPA 3MIBA 3UETA 1CPNA 2ZAAA 1AZDA 2ZHLA 2BZDA 3USUA 4DUVA 2RJLA 4XOGA 2PHUA 3UGGA 3MDPA 2RS13 2VOWA 3I2OA 5GZFA 4XFCA 4BWOA 4LKEA 2CL2A 2ADDA 2XUEA 1J84A 2ZX3A 5FUIA 4AVTA 3K51A 2G9ZA 3VBUB 5FYBA 3C7EA 5C9AA 5FZOB 1HRI1 3WDTA 1NA1B 3U37A 4RGKA 4CVUA 4PF1A 5HCHA 2IFRA 2W1QA 2WL1A 2CHHA 2WNVA 4DO0A 3OSDA 4JHTA 4CDQA 2FD8A 2BNNA 4OZXA 3OGVA 2DVDA 2R1DA 3VBHA 3ZN6B 2GNDA 2WFF3 3TB0A 5LATA 4YVWA 5EWSA 2W91A 1VMFA 3FBYA 3U10A 2C24A 3ZSLA 3RG0A 3GZEA 2YHJA 3UYJA 1ZZ9A 4Q8KA 4XFBA 2GH8A 4WVWA 2X5IB 1O8PA 5JXGA 2XLAA 5F8PA 4LHNA 1UZZA 3RFRA 5F2WA 5JSPA 4XF4A 4H7LA 4IGPA 1WKYA 4W6XA 3A7QA 4AHWA 4DZGA 2D6LX 2ZGNA 1N47A 3I97A 2ZTNA 3JCIA 4EWEA 5C4WC 3BU0A 1PVC1 3O0VA 4E4DX 2VOTA 1IS3A 5GLVA 5B4XA 2YG0A 3WT3A 3ZFGB 1VAVA 5FZBA 2W52A 2XUMA 1HXS2 4MXWA 1YHFA 1US2A 2R073 1OUSA 2ZX0A 1PGSA 1JYNA 1BMV1 1AR82 5EJ3A 2D5FA 3LB9A 2IVIB 4UFIA 2VW0A 1UIJA 4XETA 1N1VA 1GNHA 3SNMA 5EYYA 3ROUA 2WNOA 4RGAA 4CPBA 1DQ4A 3CJIC 1XPWA 2VUJA 3ABZA 5FREA 3AFGA 3M8LA 3NV4A 5D1IA 1O8SA 5FKCA 3Q8FA 1W6NB 2Q1FA 4K8RB 4CZSA 3CDZB 1RUJ2 4KWJA 4A4AA 4O9GA 5IK5A 4JQTA 3FE5A 5C5UA 1K3IA 1JHNA 2HWB3 1OLMA 2ZKLA 5KHHA 2GAUA 5FZ3A 3UNPA 4GXLA 3H1YA 3VBUA 1NCRA 2OQ6A 5F3CA 4L11A 2HKXA 1JN2P 1UMZA 1AYM2 1NA1A 1LEDA 4HKOA 3RYRA 1NCQB 1YJKA 4Z2WA 3N7LA 5A1FA 3AYCA 5FV3A 1MS8A 1R091 3BN6A 5I0RA 1JHJA 3ZN6A 2JDPA 4XDQA 4Y26A 5DAPA 1CONA 3SCHA 1ND3C 1B35B 1ULPA 4W50A 1ODNA 2VZTA 1MPXA 3MICA 3I2KA 2X5IA 2E9QA 2Z4FA 1S55A 2A75A 4CPBD 5BXXA 5FJHA 5T55A 4WVZA 4AL9A 4BIFA 5LBCA 1XE0A 5JUVA 3QOPA 2BBVA 3AM2A 1WCDJ 5GKAC 1ALYA 3WOGA 4B3NA 3NQHA 2JDKA 2DVFA 3ZXJA 5LEJA 4N43B 4UF0B 4NPMA 4F7ZA 4QPIB 1X8EA 2DCTA 1FNZA 4Q0SA 4C1XA 3OBZA 4GIQA 3ZFGA 4OHXA 1ULFA 2ZX2A 1ULCA 4E4SA 2JIJA 1ULGA 5FP9A 5K9YA 4LJHA 2WRAA 2CDPA 2O8OA 4JGZB 5SV8A 2C26A 2VW1A 5FOBB 4XABA 5ACA1 4E9KA 3PJYA 2ZEYA 1CX4A 2GN7A 2VO5A 2WWUA 2OZ6A 2VZ1A 1QJU1 1PX3A 1KS5A 1NQJA 1CPMA 3ZXDA 2ZGLA 3ZM8A 1X9TA 4AHYA 4CP9B 4IV1B 1TNRA 2WNUC 3N9QA 2PELA 1W6NA 3DGTA 3ST7A 1LHVA 4RN5A 2VNGA 5J37A 3ETPA 2RJ2A 4IQPA 1LU2A 3GNEA 4FI9A 3C2UA 2YGLA 4G9SB 2CWSA 4OULA 5FBJA 5A6QA 5KHGA 5FY4A 1MS4A 5FZKA 4RSUA 4RQPB 3I2FA 3KLSA 4PCRA 3VBRC 1BQPA 4H55A 2DWRA 4B8EA 4QMAA 3ILFA 2XWJB 4NE9A 1AR61 3RSJA 5F37A 3EBRA 4YGDA 1GZWB 4HVRA 3D0JA 3DYOA 4YSFA 3GBWA 3DYMA 1N1TA 2HWF3 4Q4Y3 3NNJA 2P3IA 2HWD1 3GCWA 4PDWA 5FMOS 5JI7A 5LZ6A 1B35A 1REFA 2YDEA 2ZOEB 4YLZA 1W05A 5H9SA 2XQRA 2C0ZA 3ACGA 2ATFA 2XBO3 3OPTA 3CEWA 4B29A 1MZFA 5HXMA 3P3NA 3KCXA 4A3ZA 3PUSA 4NHKA 3ZFEC 4AEJA 4BB3A 5KXEA 3ACHA 4FO9A 1C8NA 1OXCA 1LGNA 1GSLA 2BJSA 4UW3A 4N43A 2CGNA 3AZVA 4UF0A 4Y22B 5FUNA 4COUA 1YUDA 2R49A 1LESA 5LBBA 3LPGA 3THPA 4OUEA 4ZU7A 2YFZA 5A32B 3GCXA 1JYWA 5GLUA 3ORJA 3O5SA 5GLTA 1C8M1 5BNPC 1N3PA 2VNRA 4QGNA 1NLSA 5I0UA 4CU8A 4PF5A 4LHSA 4QGLA 1RUNA 1YIFA 4UFMA 3OGJA 4ZHNA 4FAGA 4ITCA 1FXZA 2RS51 4JGZA 2W94A 1UZVA 2K2SA 1BBT2 4LT5A 1OOPB 4LKDA 4OMDA 4CCJA 4GH4C 3AL5A 4Y1ZA 3Q8CA 1QJX2 4HK9A 5FPAA 3LFMA 1W3XA 3U78A 5GZCA 5DUXA 2CWMA 1XE7A 1NXD1 4P02B 2W9XA 1ZREA 4NR1A 4MGQA 3O1OA 1Y43B 1XBFA 3SKJE 4IV1A 3O14A 4CP9A 1HX6A 2D43A 4UBHA 1DGLA 1UXZA 3GBFA 2JJ6A 1H8TC 1ND2B 2ZGOA 4GQ7A 2D97A 2GMEA 2OT7A 1VBC3 4NMIA 4WM8B 4YVSB 3VBFB 2TNFA 3VGIA 1X9PA 3VLBB 4RQPA 1VBA1 2XQXA 4PIZA 3MFCA 2GZWA 2D98A 1DQ0A 4P08A 1QHDA 1FV2A 1HB4A 5FYIA 1RB8G 2D6OX 3LDKA 3G7DA 4Q4X3 1W9TA 5DG2A 4BZ4A 2E26A 3J4UH 3S30A 4MSVA 2P17A 1L7RA 1RUG3 4E4ZA 1JZ5A 1UZ0A 3IZOA 4HBNA 3S0MA 4JC1A 4DS0A 4LR4A 4JCKA 1RUD2 1W39A 2ZEZA 4XUOA 4BH9A 3POYA 3RZJA 2EIBA 2P2KA 1R1ZA 2ZX4A 1VRBA 3JQXA 3QH7A 4E27A 3BTXA 4LK7A 1JZ4A 2B9VA 1NXMA 2ZHKA 3WCSA 5FYSA 4M4RA 1QJY2 4K21A 4M3CF 2E7AA 1RVF1 2ZCWA 2ZGKA 1UYXA 4Q4V3 2DBIA 2YPJA 1KS4A 5IT6A 1F5FA 2J7MA 4AR2A 1HB1A 5A32A 3VBOB 5IWFA 5D8AB 1JZ6A 1O3RA 5FYVA 1K5MA 5A33B 4Y1YA 1MEC3 2GH2A 2QE3A 5DN2A 4FOVA 4WV8A 3PMEA 5F39A 2P3JA 4QPGB 2DU0A 1UY2A 2BBAA 1PIV2 2P1BA 4IE0A 1OOPA 3RVHA 3DYPA 3NSTA 3KQ4B 3WNLA 4NIHA 4H2AA 2EIDA 5H9RA 5FZIA 1PGW1 3C7OA 2WINB 2VZ3A 3AKQA 2ZMNA 4PQQA 2HBUA 4M0NA 3ZLIA 3DXTA 3IDAA 4ZPIA 1JUHA 2XJVA 4KH9A 1AHSA 2DCYA 1UZWA 5A7QA 2K0GA 1V6KA 1W9SA 4HZFA 1J3RA 4QAWA 3WG2A 2JIGA 4FOQA 1ND2A 3CZUA 5D21A 4NIIA 1HQLA 2RJKA 4WM8A 1D4VB 1G8WA 4YVSA 1A78A 3ZKUA 1POV1 2DUQA 3ES4A 4DMIA 3ZR6A 5C70A 3HAGA 1RUC3 4DY3A 5I0SA 4CDWB 4UFKA 2VG9A 4LBLA 3GGLA 2PLV1 4KG8A 1EAH2 1ONAA 1Q56A 4BIOA 3FHQA 3VKFC 5JDBA 1AR73 4LIUA 5JAXA 5A7OA 2VMGA 4JRLA 1QOTA 1D4M1 2RE9A 1UX6A 5FPUA 3ZFFC 3BKZA 4F8AA 1PZ9A 1VR3A 1F5JA 4LORA 4EYUA 4ZXKA 4YARA 5C3OA 4Y5Z0 4AZZA 4Y20B 3TOJA 1AL0G 4A6SA 4YW3A 4LO8A 4CXXA 2EXKA 1IS5A 1UY3A 1C28A 3CO2A 3JBG1 5I8SA 1TEIA 3UJOA 3ZX7A 1N1SA 4GWIA 4CDUB 4CXWA 2V5DA 1OMIA 2VZVA 3NV1A 5DAVA 1W2TA 4F83A 2PHLA 3EMRA 2ES3A 1DF0A 2VZUA 5GJ6A 5A7WB 1S0BA 4EE2A 4ZS2A 4UFHA 3AXDA 1RUH1 1KQRA 1SCSA 1J3PA 2P3YA 2C4XA 2X05A 1ZBE2 5ABJC 1RMU3 3T1LA 1BKZA 1QJFA 3KGLA 3NV3A 4KBZA 1X33A 2XLGA 3JD73 3VD3A 1BK1A 1R083 2CTVA 3K4ZA 4B7EA 4DXSA 3H8OA 2UURA 1GZTA 1POQA 3KM5A 1UF2C 5AC93 4D7YA 1T2XA 4OQ9A 1BK0A 4IDZA 4GB33 1S0IA 4FCAA 1SFPA 1S0FA 2PHRA 5FLIA 3PIGA 4ZXEA 3WQ0A 5IVBA 3X29B 1ULDA 3V0AB 4TZDA 1W0NA 2LROA 2V09A 4J1WA 4LKFA 1DGRA 3AMNA 4C1WA 4ASMB 2CAVA 3OPZA 4C0HA 4P9IA 1CAWB 5FYCA 1CGPA 4LUKA 5C8CC 1CIYA 3KF5A 5JCTA 5G04L 3LEKA 1JBCA 1EY2A 2Q5TA 4W65A 4XMIA 1GANA 2IFWA 3HQUA 4RHV2 3ACFA 1Q43A 3K48A 1GICA 4TN7A 5HCFA 3VD9A 1E5IA 4Z07A 3RWNA 4NROA 4A6OA 1KFUL 2JG8C 5AFEA 2VPVA 4NPRA 2YU1A 4O65A 1LJ7A 2PMWB 1PMJX 1PK6B 1UPSA 3AZYA 4FTSA 3WNXA 1Y9QA 2WN2A 1FMD2 3IDCB 3OUHA 4IEOA 4XZUG 5FXXA 2HWC3 1DGWA 1QIQA 3T30A 4TXWA 2OPKA 1EYBA 4R52A 4Y20A 3WG4A 1CAXB 2PHWA 4Z82A 2RS12 3QH6A 1KFXL 4H7MA 4GMP1 3H8XA 2A5ZA 2EAKA 4LKSA 1OPOA 4UXAA 3PUIA 4CDUA 4E2GA 1W2NA 2BFUS 3HNBM 4A45A 1RJ7A 2B5HA 2R0FA 1OC1A 3LDBA 4N53B 5EYXA 5A7WA 1G9FA 3V0BB 1F8VA 5EZWA 2Q8CA 2Y0OA 3BTZA 2VGDA 4NOTA 4YYOA 1GU3A 1HXS1 4X8PA 2RDNA 3MIDA 2DBNA 1ZRIA 4PBOA 4WZCA 2JG9C 1AR81 5E8AA 5FYHA 3ILNA 3DN7A 3ZXAC 5H9QA 2WFF2 4WM7C 4AK3A 5FP8A 1DYPA 1FPN3 5JWPA 4IEUA 4LITA 1TMF3 1V9U3 3MIGA 4LO7A 1BVP1 3MIHA 2PHTA 4NRPA 4NAMA 4GJYA 3V0AA 4QKNA 2C9KA 4AHXA 3WNOA 1J83A 1LHNA 1RUJ1 1CAWA 2CYFA 4HETA 4KU7A 5IFTA 2I07B 3MLLA 3PHMA 3POWA 4RGGA 2J1SA 2VMHA 3TEWA 3W58A 2WIIB 3U4SA 3H3UA 2WC2A 5LWBA 1G7YA 4Q4W3 4AHZA 5BNNC 1AYM1 3HQRA 1RITA 1JZ2A 4CCCA 2VQTA 4A7ZA 1RUI2 2IXIA 2R072 2XWBB 1WD4A 2MEV3 4JGYC 2QNKA 1JOJA 1AVBA 2H0VA 3VUOA 4A3XA 3INAA 5IVVA 1WLWA 4AEDB 3D6EA 4CEYB 1BVVA 1PK6A 4OQ8A 2CY6A 1JS9A 5JOZA 1YNAA 1OFSA 1GOHA 3B5LB 2VUAA 4FT8A 4S2GA 5DAXA 1M4WA 2BP6A 1UOBA 2XVLA 1XOYA 3ETQA 5LCWL 4CEWC 1W04A 4FPFA 3UKNA 1PO13 4AE2A 1IPSA 1JODA 2JX9A 1XNDA 2HWB2 4PIXA 4XJZA 4XUPA 4N53A 1PO22 4WVVA 2QQPA 2AEZA 1JMUB 2UWCA 4YWAA 5A7PA 5GALA 4HXCA 5EHDA 4MVTA 3V0BA 4AI2A 1VB4A 1RL3A 4IE4A 4EV0A 2Y60A 3RZLA 3LQCA 2PYTA 4HANA 1I1EA 3UKVA 5C4WB 3WSOA 1FOD3 5CA6A 3DPRC 3S57A 1GKBA 2D40A 2VW2A 2WAAA 2NZ9A 5LA9A 2YC2A 1CZVA 2A70A 1AX0A 3NAPA 5I91A 4BE3A 4LUMA 2KD7A 2VUDA 5C8WA 4NRMA 1QDOA 2Z5WA 4FPEA 5F32A 1S0DA 4BXSV 2NYYA 3TNPB 5FZDA 5BY5A 5CISA 3WW2A 2PHXA 3K46A 5SV5A 3LA3A 1JH5A 4BPZA 1NLQA 2NM1A 2VMCA 4C91A 3MW2A 4JKKA 3J8F3 5A3OA 3AK0A 4F3JA 2RS33 3WHUA 3LDRA 3IM0A 5FYTA 2HBTA 5CG8A 1S1AA 3HIFA 1DZTA 1KD7A 1W9WA 1ENSA 3GZTB 4A42A 2BTVC 3LSDA 1UL9A 2BNMA 4FVVA 4GULA 2BDRA 1US3A 2W39A 3L2YA 3AYEA 3NJYA 4AEDA 2RM22 4CEYA 4CA9A 3AVSA 5LA2A 4AVBA 4K8FA 4DQAA 1LEMA 1DHKB 2Y6HA 4JTNA 3U07A 1UWWA 2VOVA 4BK4A 3J9SA 3N9MA 1Z0HA 4R9BA 5JZGA 3KVBA 3I3QA 5L36A 3WZ1A 5G05L 3RPQA 5IATA 1HQWA 1QXRA 2VU9A 2QQKA 2FHRA 2GMMA 2X09A 3TEZA 1C1FA 4DUWA 2UWAA 1MZ5A 3POBA 3TN93 1IOAA 5F3EA 4LHLA 1ZA7A 2HWE3 4BQ1A 1V6IA 3WP5A 1WCKA 4RR3B 5JR7B 2N7GA 3WD5A 5IVEA 2QQVA 1HB3A 3VB9A 4L2NA 2RVAA 1OVSA 5C4WA 1AX2A 1HV1A 5KBFA 2YUEA 3FL7A 4YGBA 3AMHA 2J42A 1BBT1 2HWF2 2ORZA 4IEZA 4Q4Y2 5LBFA 2E6VA 3USUB 1OFNA 2J1EA 1QJX1 1RHI3 1I9RA 3VDAA 5CBLA 4OYUA 4IEQA 2Q8OA 3FLRA 1O5UA 3MIFA 2IXKA 2XBO2 1CIWA 4QT6A 2HEVF 2A6YA 5FCCA 5CEHA 1BCXA 1QOOA 3CJIA 5C9AB 2TUNA 3VBSC 2W1SA 1NG0A 4N8MA 4BQ2A 3KSCA 2Y6KA 3UGHA 3HR9A 2WQZC 1OQDA 1PVC3 2D6KA 3RNSA 4COWA 1LOAA 4UYBA 1CZTA 4OVEA 3VBHB 2A7AA 2QQOA 4LA2A 3EQEA 2UYAA 1NOVA 1GUIA 1LULA 3E97A 3I54A 3BGAA 4GALA 4QXKA 3ASIA 1OF4A 3VHNA 3V65A 1NUKA 1GR3A 4N9HA 4OI4A 1W9YA 3SKVA 4PT6A 2GNBA 1RUD1 2YYOA 3LOIA 1XC6A 1OVPA 1HJGA 3WW1A 3B00A 3SHRA 1RIRA 1W2OA 3HPNA 1HN1A 5ANQA 4P00B 4FFHA 5L9VA 4KNCA 4BMBA 5BNQA 2JE9A 1QJY1 4YFWA 4IXLA 3GHNA 4OLLA 2G1MA 5FJKA 1KJRA 1UW8A 2DF7A 4CCEA 1C5IA 1XU2A 4QB1A 1VBC2 3MF9A 4EN0A 4YZ5A 3ZFEB 3PL0A 4MH0E 1F2NA 3RGBA 4JQRA 4BLJA 3H8UA 4HG6B 4JAAA 1UOFA 3WUDA 4JV4A 4AGVA 2BFUL 4BMEA 2VBBA 4Q4X2 3ZYFA 1J3QA 2XJPA 2D6NA 3FJSA 1PIV1 3PLQA 2WSUA 1GV9A 2KM2A 2ZEXA 2VMFA 4FFGA 1SPPB 4XFFA 1RUG2 1PMIA 3JU9A 3OYWB 2LTNA 2PN5A 2JWPA 3CHXA 2V73A 1BEV2 1KXGA 1AXYA 3EO6A 2CV6A 3D8CA 1FX5A 2J1TA 2PHFA 2QZ2A 2VOKA 2EXIA 1L7QA 2JKXA 3IKWA 5JR2A 2F6BA 3AZWA 1DYOA 1NCRB 4R9AA 1NT0A 2FDGA 1ZYBA 4JKMA 4JKLA 4HSJA 5DG1A 5I93A 3EJKA 3I49A 1WCUA 4EN6B 5C5TA 2Y6FA 1T6BX 4QXCA 3ZPOA 3W5NA 3H42B 1AX1A 4AFAA 2A3WA 2FCUA 3RWKX 2Z69A 1TME3 2VBPA 4OHWA 1FV3A 1MEC2 4JVAA 5JXJA 5FPZA 3AL6A 3DV8A 1L3JA 4RS5C 4AFBA 3B02A 5A3TA 4XJUA 3KT7A 1IPJA 1IQAA 1EAH1 4EWDA 5C3SA 1UAIA 2E31A 2R1BA 3OJBA 4XYXA 1FNYA 1O7FA 3NJZA 1PVXA 3C3VA 3HT2A 4DXZA 1SBDA 1GLHA 1V6OA 3B9CA 3G6JB 3WR0A 1W8TA 3KV9A 3LD8A 2ARAA 1JTZX 1RUF3 3C8XA 4IV3C 1ZZBA 4A7KA 3WHTA 1L7LA 2VVDA 2W2IA 3O0WA 5JSOA 4UW6A 5FOJB 2WA3A 5EPAA 2JDYA 5K0UC 3LKJA 4QPWA 3ZFEA 1RJ8A 2DDUA 4J25A 4Y5SA 3SXWA 4CDXB 5JSRA 4ASKA 2H6BA 1RUC2 4QX2A 3FLPA 3ME2A 3N7MA 3RI9A 4GWNA 4FPJA 4OZOA 1TZOA 4WVMA 5DMYA 3I3MA 4CCNA 5IVCA 2DV9A 1ZBE1 3IBMA 3WQBA 5BNOB 1YFXA 1SPPA 1Y9GA 4XF3A 3SH3A 5CIRA 2MHFA 1NE6A 3OYWA 1AR72 4ZU5A 2A6WA 1AR93 3C7HA 4NVPA 3SQOA 3IWZA 3POIA 1QY4A 3I2IA 4N7IA 5EP9A 4GH4A 1PM4A 3MIEA 4E2SA 2Y6JA 1ST8A 4LTAA 3VZLA 2B4KA 1OF3A 2W5FA 2BU9A 2WQ4A 3I8TA 3BTAA 2YBPA 4LPLA 4INDA 5IHRA 2UWBA 4W6YA 3T0AA 1NY72 2QVSB 2W87A 1W6OB 1HV0A 4XDOA 4G4FA 3WX5A 3NJXA 2Y33A 4NIDA 3NNFA 2DTYA 1JUIA 4P9XA 4PDWB 5EV7A 4FQZA 1EV13 3VDDC 3MFAA 2ARCA 4RHV1 1QDCA 3PTYA 2R6QA 4I02A 4M0HA 1RMU2 4FXGB 3T0BA 4BQWA 1DLCA 1Z7S3 3JD72 2NN8A 1R082 2VNOA 4FFFA 1CAUB 3TRSB 3WW4A 4C8DA 5JZGC 1BYHA 2C6SA 2RG4A 1UOJA 1WMFA 3U75A 4M4PA 3T1MA 1LOFC 4D6QA 2Y6GA 4YNIA 3VKMA 1QEXA 1COV3 1FMD1 1STMA 4GB32 1QNYA 2B8MA 2D5HA 4EN8B 1LGCA 2Y6LA 1K45A 1BLZA 3BPSA 5CU1A 4AI9A 2F4LA 2NQYA 3B7MA 2WWJA 5FLHA 4B4PA 1G9CA 1W0OA 5T3NA 5TSWA 3ZYRA 5F5CA 5FY0A 1F31A 2RS11 1W8OA 4K6BA 1G86A 1GFF2 1U5YA 1SZBA 1WMDA 2P6HA 2YGMA 4RD7A 5FYYA 1VMJA 5L9BA 2EF6A 2JB8A 4M3CA 5A3UA 3FFQA 1FI2A 4XQWA 3KMHA 1W99A 3FBMA 3PUAA 4CDXA 1YRZA 4MGZE 2DURA 5CFDB 1OKOA 4P9GA 4DNYA 5BNOA 3WDXA 4KQ7A 3N36A 2R063 4IE5A 2VJXA 5IAVA 4RL7A 3PVNA 4JZRA 3NRUA 2WFF1 3P5BA 5ABJB 5FMDA 1T6GC 1UXXX 2DYCA 3KT4A 4R4ZA 5DPNA 2D6MA 3PURA 4N7UA 1LAJA 2HWC2 1QJEA 5I0TA 1S2BA 2P5BA 2VTXJ 4YW7A 5FZCA 5HXVA 4HL0A 2AR6A 3WDWA 5IK7A 5CVRA 1R1A3 1OA3A 1W6OA 4MUVA 1ASJ3 2UU8A 4XFGA 2NMOA 3MW4A 4DOUA 4NN0A 2JD4A 4XJ8A 2WS93 2XVKA 1W2AX 1WW5A 3K2OA 1VLNA 4HLTA 4OHZA 5FP3A 4D6RA 1RUI1 2R071 2RMU3 1ZRFA 4X8NA 3M70A 1H2MA 1UX7A 2WR9A 3OBAA 5FAXA 3ZMOA 1CAUA 4JDMA 5GLWA 5FP4A 2PAMA 1IG3A 3NKTA 5ANNA 1DCSA 2XG3A 3VKNA 3WP6A 2A73B 2FMDA 2ZABA 2ZZJA 3ITQA 1Y9MA 4Q8LA 1MQTC 5FBZA 1FPN2 1WW4A 1TMF2 4M00A 1IQDC 3WLUA 2FCTA 1SBFA 3F2ZA 2GP3A 4MGYE 4AFDA 1K5MB 3FLTA 4GWJA 3DUIA 2BGCA 1VB2A 4E8DA 3A21A 3LA7A 4ORFA 2WSVA 1POV3 4MG2A 4JRAA 1RUE3 2HEYF 4IESA 4D7SA 2E7QA 2E7TA 2HWB1 1O3QA 4L92A 5DQ0A 1PO21 4BQYA 5A70A 1GP4A 3BYWA 4Q4W2 2PXJA 1V0AA 1UN1A 3MO4A 4LO4B 5CFDA 5C71A 1RXFA 2VZQA 5FLJA 2VVFA 3NVCA 1YQCA 1ZBA3 2MEV2 4QM8A 1UKRA 2Q8DA 5A3MA 5A3LA 3PVBB 3PVOA 3WF3A 5ABJA 4HN0A 1ULEA 3NV2A 1KDMA 1GWKA 4LNVA 2VQ0A 4IE6A 4QGMA 4XF1A 4K9SA 4QPYA 1UKGA 4Q29A 5HCAA 2SLIA 2BVVA 4U36A 1V70A 3ZOIA 4WM7B 4HT1T 5IAXA 4QX5A 3VBUC 1JI6A 2C5DA 3O1RA 1NA1C 1PO12 3H9AA 3ECQA 4LXLA 4QKBA 1UO9A 1NKGA 2Y26A 3ZSEA 4WBBA 1SLCA 2IZWA 2EALA 2NLRA 4GZ9A 2Z79A 1GWLA 1OQ1A 4XIOA 4CP0A 1UYZA 4YM1A 2ZGSA 5FZHA 3WINE 1Z78A 4EWAA 3DEMA 4MXVA 4C0BA 4UFJA 5C8CA 1QMJA 1A3KA 1AXKA 2XL9A 3A23A 5FUPA 1FT9A 2QDNA 3T2QA 2LUWA 1PNGA 1FOD2 1OA2A 2BUKA 2R043 1HRV3 2VCMA 2J1UA 2RM21 5LY1A 2CGPA 2FDHA 3HBKA 5JXHA 4YPJA 1W06A 3SH5A 4UW4A 2J1VA 1BZWA 2JG8A 4XVHA 2MPFA 4YM3A 2ZACA 1E5SA 2BERA 3LA2A 3R0RA 1N1YA 2GMPA 4A7YA 1AJOA 5FTTC 3N4MA 1VRH3 4XURA 5L73A 2JDAA 1HQNA 4XQDA 1DQ5A 3CNAA 3VHPA 4C90A 1YIPA 3J8F2 2VQUA 1HLCA 4EROA 1OD3A 1JYIA 1CJPA 1AYN3 4AAPA 4CEWB 4ZS3A 2VZOA 4KL1A 1RTVA 3WV6A 3KCYA 3FHIB 1JYXA 4TYSA 4RFRB 1UMIA 3BPZA 4CU9A 2ZGMA 1OSGA 5FZFA 1KRIA 1V6NA 2HWF1 4Q4Y1 2WYSA 1TVGA 3NNGA 2XKOA 3O1VA 1APNA 3POSA 3KVAA 5FY9A 5LK5A 3DPRB 4CYDA 2JG9A 2XBO1 2OPWA 2BRTA 3DL3A 3OUJA 4WM7A 3K4DA 3QACA 3H7YA 4OMCA 3RZHA 1Q8OA 3IIAA 3B93A 1NCQC 1EP0A 1WCQA 1VBB3 3CLPA 3TNQA 4HVQA 3M3OA 3KD4A 5LA1A 3GM8A 1I5PA 1PHMA 2OQ7A 3TN92 1LODA 3WDUA 3ZO0B 5HCBA 1QQP3 5K7PA 3O0XA 2HWE2 4NHLA 4CUAA 1JZ7A 3PU8A 1B35C 3UGFA 3WF1A 4D69A 5CG9A 2IUWA 2B42B 5LASA 2WBKA 4OCTA 1JYCA 2ZS6B 3NNLA 4FOWA 2H6CA 5BNNA 3H3LA 1GMMA 4XJWA 3S7EA 3KWVA 1RHI2 2JD9A 1ENRA 1ZA4A 2VZRA 1SBEA 1J58A 4N43C 3J7HA 1IG0A 4RYDA 4JHZA 4QPIC 2VL4A 2D7FA 4QM9A 1YC61 4I0WB 3TWIA 2ETEA 4FAHA 4HN1A 4QQ2A 3AKRA 2RDQA 2OVUA 1PX4A 1H1IA 2RV9A 4O61A 5DDJ3 3O1UA 1MS0A 1VBC1 1CD3G 2WO3A 2WT1A 3DKQA 1E5RA 1GOFA 1XXNA 1H4GA 1U12A 4JGZC 4CP1A 4CEWA 3J7MA 4XBLA 4DINB 1M06G 2AREA 1SLAA 1S2EA 2O0OA 4Q4X1 2K9ZA 3MV11 5C7GA 5DUWA 2RR13 1YQ2A 1U0AA 3AMQA 2YROA 1RUG1 4IV1C 1OBNA 1POV0 3OPWA 4MLOA 1XYNA 3NMBA 1BEV1 4Q5OA 3OCPA 1OT5A 3DPRA 2XJRA 2HLEA 2Q8EA 2WDBA 4IEWA 1VBE3 4FPLA 3UJQA 1QU0A 2GALA 4FP3A 5A6XA 4UFLA 4RQPC 4K1YA 2DVAA 2X29A 4AQ6A 4XCBA 4EQVA 5EFUA 3KV5A 2QQNA 1NE4A 1NZCA 4FP2A 4Q4V1 4TLGA 3ZIXA 1W6MA 4PLNA 1ZZ7A 3VDCA 1GQPA 1W8WA 2FDFA 4BHPA 1AL23 1VBD3 1GP5A 1OQEA 1QXJA 2CU5A 1MEC1 5HV0A 3MUY1 3MF6A 4LO5B 4LBOA 3VDBA 3WG1A 1DLLA 1W8FA 2P4EA 5FMOL 4MOAA 1AF9A 1QJZA 3JQWA 2YY1A 1LHUA 3IMMA 3T2TA 3M3IA 1ZM1A 1WUVA 1QKQA 2GU9A 3AVRA 1KEXA 1MZ6A 4DRVA 4TSVA 3FMGA 4V2WA 1QOSA 2Q0AA 3CU7A 3LEGA 4PLMA 1UMHA 5FZ4A 2ORXA 2AZ5A 1R64A 1W2UA 2KXLA 1DYKA 3T09A 1Q3EA 2JDNA 2JDMA 3HQXA 3AX4A 4XF9A 4D6SA 1D0HA 1Y3TA 2LS6A 4AF9A 3O1SA 3LOBA 5LEKA 2JDUA 5F1RA 1OOPC 1TME2 1XE8A 3FX3A 2ZHNA 4XTMA 2G9FA 1RUC1 1IPKA 3NAPB 1SFNA 3H3ZA 5JOYA 2GNMA 2WUHA 2QJVA 5L7OB 3ZN4A 3WP3A 3HVDA 4BDVB 5I8YA 3IIIA 3E1F1 3BUCA 4K40A 1MS5A 4XFIA 2FZ2A 1AR71 2B39A 1GWMA 1QGLA 4OI0A 3VBFC 4YVSC 5FZMA 3ZXKA 1UU5A 5FQ0A 1CX1A 1VMHA 4QDQA 5KC5A 1RUF2 5HBAA 1OLRA 1ULOA 4FXKB 4HFSA 5E89A 3HD8B 3WNPA 2XLFA 4UI9L 4Y33A 1V00A 1NY71 2WZR3 5DAWA 4YW1A 3WDYA 2BYVE 3VBSA 3E6CC 3WNKA 2FBEA 4QXHA 3KHBA 4RFT0 4Q1RA 3ZSJA 1OURA 3JZVA 1LOBA 4XACA 1RMU1 4LEJA 4IEYA 3ZVXA 2OUHA 4LBJA 4PJYA 1SMVA 3JD71 5FXZA 1R081 1IKQA 3URFA 1ACCA 3AZXA 1LHWA 3BALA 1AR92 2YZ4A 3CBNA 5FZ9A 2DFCA 5DUUA 4JX0A 4QHZA 4LOTA 5FPLA 2DTWA 3OD0A 4QKDA 4UAPA 3RI8A 4AWDA 4GB31 4V1PA 1DZQA 2ZA9A 3VBOC 1H2NA 5D8AC 1VPHA 5CFCC 1VE0A 3ZYBA 3V64A 5FZ1A 4L0PA 4QPGC 3RYPA 2GC3A 2ZXQA 3CF6E 4XC9A 3W5MA 2ARXA 2J22A 4IV3B 5C6CA 2JE8A 1ZZ6A 5A1LA 3M7AA 1EV12 2XPJA 3UL2A 5L7OA 4XJ9A 3WVJA 2OIIA 5K0UB 2XXZA 4FTEA 1RGSA 4LMFA 4MV2A 2WYFA 2D3SA 5C3QA 1GQHA 3R6SA 3CJIB 3K75B 4PQ9A 4AAXA 2DCZA 3VKLA 5E88A 3RZKA 1RXGA 2DUOA 1COV2 4P5YA 4TTGA 2ZGUA 2R0HA 1SACA 2P34A 4YZ3A 2E51A 4O7XA 4QDRA 3U4XA 2HWC1 4IERA 3LEMA 3W59A 2ZBJA 4R9DA 2E32A 4MGSA 1GYKA 1EPWA 1UCXA 2R30A 5KHJA 4CDWC 3FC0A 1OLME 4QXBA 1DQ2A 1XSRA 5FZLA 5LRSA 2VMDA 1PNFA 2IXHA 3MYXA 4LO6B 4XUNA 4YG6A 5JIUA 3N3HA 2HYKA 5APAA 3THTA 2PFWA 1U5IA 1HIXA 1RINA 4KG0A 3VV1A 1D2QA 2JDZA 2XR4A 3BI3A 4Y3OA 3B3QE 5IFPA 5EXOA 3OBRA 4YM2A 1WZXA 4CUGA 2R062 3M3EA 3NJVA 2BOIA 4ZU4A 5A3NA 1ND3B 2QKDA 2PAEA 1SEFA 1ZNPA 5KXCA 4B7KA 5JIAA 2ZGRA 3RQ0A 4AG4A 1ZVFA 5FIXA 1FPN1 2E53A 4YRDA 1TMF1 2V4AA 2WQ8A 5F7UA 3ES1A 4CDUC 5GZGA 1HRI3 4P9YA 2VULA 3D3AA 4BQ4A 4GA9A 5T5JA 1IZ3A 2CAUA 3A0NA 3MPBA 1R1A2 1OA4A 2EAAA 3VN4A 5KHIA 4OHVA 2FDKA 1ASJ2 4IV3A 3FUOA 5DZGA 2W92A 2YC0A 3MHZA 3S7IA 1E5HA 3BOWA 4XE9A 4XQ4A 4D0QA 2WS92 3AMPA 2XGXA 4XEZA 2X53S 4Q4W1 1YI9A 5K0UA 1PGL2 3IDBB 4ZY9A 5ISLA 3B9IA 3E5UA 5E16A 1S0JA 2RMU2 2GC0A 5FO7B 3CJXA 2MEV1 5FYMA 1PM7A 5E1RA 4L8QA 4BU2A 3AZZA 2NMNA 4J6GA 4J1XA 2ZMLA 4S2FA 2D3RA 2DUPA 5HV4A 3NWKA 4GJZA 3AMMA 3WNNA 1W8NA 1X7NA 1UY0A 1H1AA 1UZYA 1C1LA 2KA3A 2WNUB 2ARBA 4BISA 3RZZA 5J96B 2OUJA 4BOWA 3ZXFA 1TE1B 4COVA 5F5IA 1JOPA 5DUVA 3I2GA 1PO11 3MZHA 3O1MA 1RUE2 5EQUA 5M0TA 2GSYA 2ET7A 4N90A 3VBRB 4LQRA 3DCQA 1O59A 3A4UA 4W4ZA 3ZIWA 1A8DA 3OEAA 4YGEA 1H0BA 1LKNA 1Q8PA 5IJRA 2RDSA 3SC7X 1ZBA2 3PDQA 3QD6A 3RYKA 3ZYGA 4IGQA 2BV4A 1FOD1 2QQLA 3CL1A 4B1MA 1ND3A 2FDJA 4XUQA 4HKWA 3E6DA 4IUGA 2YXSA 1LRHA 4EN7B 4QDSA 4QHOA 3ENRA 3JB8A 3RRDA 5B2GB 3NKGA 5F9TA 5IUQA 2OYZA 5BPXA 2WZ8A 3LIGA 2Z42A 1YI7A 2XMLA 2QBXA 5T5LA 3WQ1A 1E57A 1NZIA 3PJQA 3VZKA 3ZKYA 3AYAA 3AB0A 4DUXA 1QH7A 4N53C 2WAOA 2ZZQA 4GD4A 5T50A 5IW0A 1MQTB 1DGWX 4GKYA 4WVMB 2QUOA 5LB6A 2IXLA 1R093 3SCGA 1CAVB 1REEA 5BUVA 2VNVA 2ZGPA 1X8MA 2A3YA 2HEWF 2HYXA 3J8F1 3WF4A 1AUYA 4AFMA 5BNPB 1GP6A 1SHWB 5FYUA 5FK7A 4ET7A 1YQ6A 2R16A 3K3NA 3EB7A 2A6VA 2VE1A 2VCBA 2WA4A 1UOGA 3DF0A 4GH4B 5K4LA 4NIAA 5CADA 3Q8BA 2R042 1HRV2 3IN9A 4XFHA 5IVJA 1G9BA 4Z92B 4LK6A 2OA2A 1HDKA 4BM8A 3H50A 4Y4YA 3OOXA 2XB6C 1D0GA 1F35A 2JDHA 4Q4V2 2PAKA 3JB4C 3A22A 4ARYA 3AP5A 3TEYA 3ZXEA 2WNUA 1XB9A 4L99A 4P9JA 4EN9B 4QKFA 1WBFA 3PU3A 1QH6A 3FN9A 1H8TB 2BVBA 2FMYA 2VMIA 4D3WA 1VRH2 2BOJA 3HOBA 1K42A 3A0KA 1OHFA 2AC1A 4BYYA 2VVEA 3WP4A 3KF3A 5ACA3 3VBRA 1GZ9A 4Y4RA 3KV4A 2VMEA 1A6CA 4QX1A 3TN91 2A71A 2W1UA 4X6QB 1V6MA 1AYN2 3K3OA 1LNSA 1QJU3 2OX0A 2HWE1 1H9WA 2DCKA 4AEDC 4CEYC 5JPNB 5FPVA 2IXJA 2VC9A 4MYEA 3OY8B 5HI0A 4U2AA
chains in the Genus database with same CATH topology
1T2XA 5DQ0A 3T0DA 4ZXEA 3VD4A 2L9LA 1TG7A 1F4AA 1W0NA 3MO4A 5C71A 2VZQA 2CDOA 4MADA 1JZ3A 5EJZB 1CIYA 1EUUA 3DECA 3LEKA 5G04L 3WF3A 2W47A 2VZSA 3T2OA 3ACFA 3VD9A 4KMQA 4A6OA 1JI6A 1F4HA 1PMJX 3ECQA 1NKGA 2WN2A 1NAEA 4GZ9A 4MO3M 4XZUG 1UYZA 1K12A 2J1RA 4TXWA 2WZEA 3A23A 2BGOA 3T2QA 3WEZA 5I0DA 3LPFA 4LKSA 3PUIA 2ZEWA 3HNBM 2J1UA 4A45A 3C7GA 1DP0A 2W46A 5JXHA 4YPJA 4E8CA 4CUCA 2J1VA 3SEPA 4XVHA 1GU3A 4UOJA 2BERA 2X10A 4XURA 1GNYA 2JDAA 2DCJA 3FHAA 2VQUA 1OD3A 3OGRA 3UESA 2VZOA 2C9KA 3WNOA 2VR4A 1CZSA 1J83A 2WABA 1UMIA 3I2JA 2VM9A 4CU9A 2VCAA 5IFTA 1UY4A 2J1SA 2WYSA 1TVGA 3WNMA 3NNGA 1UYYA 4Z2AA 3OEBA 1EUTA 1JZ2A 2VQTA 1PMHX 2Y64A 4A44A 2WO1A 1JYXA 3LE0A 2Y8KA 3K4DA 4OMCA 3CKHA 3HEIA 4XUTA 1WCQA 3EYPA 3JXSA 3MBWA 5JXIA 4DEVA 5LA1A 3GM8A 1GOHA 1I5PA 3THCA 3SEEA 4DXRA 2VZPA 5CZKA 1D7PM 4CU6A 4CU7A 2W95A 1SG3A 5LCWL 4CUAA 1JZ7A 3I3DA 3WF1A 3T2PA 1OH4A 2WBKA 1BHGA 4A41A 3K4AA 1GMMA 4XUPA 3UETA 2JD9A 2BZDA 2VZRA 4DUVA 3J7HA 3LQCA 4RYDA 4ZZ8A 4JHZA 1JU4A 3WSOA 2VL4A 5FUIA 1J84A 2WAAA 2YC2A 1CZVA 2RV9A 3C7EA 1KGYA 1PX4A 4CVUA 3U37A 2KD7A 2WO3A 4PF1A 1GOFA 2W1QA 3OG2A 4BXSV 3K46A 3OGVA 3MV11 5C7GA 2VMCA 2W91A 4JKKA 1YQ2A 3IAPA 1O8PA 5JXGA 1JYVA 1OT5A 3HNMA 2HLEA 2WDBA 1W9WA 1JU3A 4A42A 1WKYA 3A7QA 1US3A 4ZZ5A 3I97A 3ACIA 4DEQA 5LA2A 3MUZ1 2VOTA 2QQNA 5B4XA 2Y6HA 2YG0A 1UWWA 3VDCA 1GQPA 4BK4A 1US2A 5IYYA 2QQMA 1JYNA 5G05L 3MUY1 2V72A 3VDBA 2QQKA 2ID4A 2X09A 4MOAA 4DUWA 1XPWA 3ABZA 3VD5A 5CYYA 1KEXA 1O8SA 2VCCA 4QB6A 3WF2A 4KWUA 3CDZB 2RVAA 4A4AA 3LEGA 3FL7A 1UMHA 2ORXA 1K3IA 1R64A 2R7EB 3T09A 3UNPA 2ORZA 2J1EA 1XNAA 3VDAA 4OYUA 2LS6A 1UY1A 3BN6A 5B4NA 1JHJA 2WUHA 2W1SA 2Y6KA 1ULPA 4BDVB 3IIIA 4W50A 2VZTA 3E1F1 1MPXA 3I2KA 1CZTA 2Z4FA 3OGSA 3K77A 4W8JA 2QQOA 5JUVA 1GUIA 3BGAA 3NQHA 1CX1A 1OF4A 3I3EA 4QDQA 1NUKA 3CIHA 1ULOA 3SKVA 4PT6A 3WNPA 5EIYB 4UI9L 1XC6A 4KI5M 3HPNA 1HN1A 1RYYA 3OB8A 2XONA 4P00B 2CDPA 2C26A 3WNKA 1NX9A 2ZEYA 5EJ1B 1JZ8A 2VO5A 2VZ1A 4QB1A 3P6BA 1PX3A 4QX0A 3ZM8A 2XOMA 3I3BA 4HG6B 4JX0A 4RN5A 3AC0A 3ETPA 2RJ2A 4QB2A 4UAPA 4FI9A 4CUBA 2ZEXA 2VMFA 3I2FA 4L0PA 2ZXQA 3CMGA 3W5MA 2J22A 2J1TA 5JR2A 1L7QA 2JKXA 2WO2A 3DYOA 4BK5A 1DYOA 2JE8A 3DYMA 4JKMA 2QQJA 4JKLA 3P1IA 2YFUA 3W5NA 3ACGA 2XHNA 3K75B 4ARXA 5HXMA 4AAXA 4A3ZA 5JXJA 2E33A 3ACHA 4P5YA 4TTGA 1P8JA 1XNTA 4QDRA 3LPGA 2E31A 2E32A 4MGSA 4OUEA 2YFZA 1JYWA 2VMDA 5LA0A 4XUNA 4CU8A 4LHSA 3CZJA 2W94A 3C8XA 4OMDA 3CQOA 4QX3A 5IFPA 2W1WA 2YB7A 4P02B 3IAQA 2W9XA 3NJVA 4QPWA 2EICA 2DDUA 4MGQA 3SKJE 4QX2A 4AG4A 5DMYA 4OZOA 2WQ8A 1UXZA 5F7UA 3WQBA 3MV01 3D3AA 2YC4A 2XQXA 3GDBA 3C7HA 4P08A 1H6YA 4D8MA 2OKXA 1GOGA 3I2IA 2WN3A 2W92A 1W9TA 2Y6JA 4D0QA 5HPOA 2B4KA 2E26A 1OF3A 2W5FA 1L7RA 1JZ5A 1UZ0A 4ZY9A 4LPLA 5IHRA 2ZEZA 4XUOA 3T0AA 2EIBA 2W87A 1H6XA 3NJXA 1JZ4A 2B9VA 4M4RA 3WF0A 2V4VA 3WNNA 1W8NA 1UY0A 1UYXA 2VTFA 3T0BA 1DLCA 2J7MA 3I2GA 1JZ6A 4M4PA 5JMOA 2Y6GA 3HNYM 5DN2A 3HJRA 3IB3A 1UY2A 2BBAA 4LQRA 2Y6LA 1O59A 4W4ZA 1K45A 3DYPA 3WNLA 3OEAA 2EIDA 3GXUA 5IJRA 3C7OA 4PQQA 1W8OA 2VZ3A 3VD7A 2QQLA 3IDAA 4XUQA 1W99A 4IUGA 4QDSA 2W3JA 1W9SA 4QAWA 2WZ8A 3CZUA 2QBXA 4DUXA 3T08A 2WAOA 2VJXA 4BJ0A 3NRUA 5C70A 5A1AA 2HYXA 1UXXX 3WF4A 5DPNA 4DXTA 5J1XA 1SHWB 3GGLA 3LEIA 4ET7A 3FHQA 3EB7A 2VCBA 2QQIA 3I2HA 4ARYA 1SDDB 3A22A 3C7FA 3THDA 2LW8A 3OBAA 1UX7A 1UY3A 3FN9A 4GWIA 2V5DA 2VZVA 3HOBA 1K42A 2VZUA 2J1AA 2X05A 2VMEA 4QX1A 1IQDC 2C4XA 2W1UA 2BGPA 3HN3A 1LNSA 3F2ZA 2DCKA 2EIEA 2PQSA 3VD3A 3K4ZA 2VC9A 4GWJA 4DXSA 3PUHA 4E8DA 3A21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2X A;  5DQ0 A;  3T0D A;  4ZXE A;  3VD4 A;  2L9L A;  1TG7 A;  1F4A A;  1W0N A;  3MO4 A;  5C71 A;  2VZQ A;  2CDO A;  4MAD A;  1JZ3 A;  5EJZ B;  1CIY A;  1EUU A;  3DEC A;  3LEK A;  5G04 L;  3WF3 A;  2W47 A;  2VZS A;  3T2O A;  3ACF A;  3VD9 A;  4KMQ A;  4A6O A;  1JI6 A;  1F4H A;  1PMJ X;  3ECQ A;  1NKG A;  2WN2 A;  1NAE A;  4GZ9 A;  4MO3 M;  4XZU G;  1UYZ A;  1K12 A;  2J1R A;  4TXW A;  2WZE A;  3A23 A;  2BGO A;  3T2Q A;  3WEZ A;  5I0D A;  3LPF A;  4LKS A;  3PUI A;  2ZEW A;  3HNB M;  2J1U A;  4A45 A;  3C7G A;  1DP0 A;  2W46 A;  5JXH A;  4YPJ A;  4E8C A;  4CUC A;  2J1V A;  3SEP A;  4XVH A;  1GU3 A;  4UOJ A;  2BER A;  2X10 A;  4XUR A;  1GNY A;  2JDA A;  2DCJ A;  3FHA A;  2VQU A;  1OD3 A;  3OGR A;  3UES A;  2VZO A;  2C9K A;  3WNO A;  2VR4 A;  1CZS A;  1J83 A;  2WAB A;  1UMI A;  3I2J A;  2VM9 A;  4CU9 A;  2VCA A;  5IFT A;  1UY4 A;  2J1S A;  2WYS A;  1TVG A;  3WNM A;  3NNG A;  1UYY A;  4Z2A A;  3OEB A;  1EUT A;  1JZ2 A;  2VQT A;  1PMH X;  2Y64 A;  4A44 A;  2WO1 A;  1JYX A;  3LE0 A;  2Y8K A;  3K4D A;  4OMC A;  3CKH A;  3HEI A;  4XUT A;  1WCQ A;  3EYP A;  3JXS A;  3MBW A;  5JXI A;  4DEV A;  5LA1 A;  3GM8 A;  1GOH A;  1I5P A;  3THC A;  3SEE A;  4DXR A;  2VZP A;  5CZK A;  1D7P M;  4CU6 A;  4CU7 A;  2W95 A;  1SG3 A;  5LCW L;  4CUA A;  1JZ7 A;  3I3D A;  3WF1 A;  3T2P A;  1OH4 A;  2WBK A;  1BHG A;  4A41 A;  3K4A A;  1GMM A;  4XUP A;  3UET A;  2JD9 A;  2BZD A;  2VZR A;  4DUV A;  3J7H A;  3LQC A;  4RYD A;  4ZZ8 A;  4JHZ A;  1JU4 A;  3WSO A;  2VL4 A;  5FUI A;  1J84 A;  2WAA A;  2YC2 A;  1CZV A;  2RV9 A;  3C7E A;  1KGY A;  1PX4 A;  4CVU A;  3U37 A;  2KD7 A;  2WO3 A;  4PF1 A;  1GOF A;  2W1Q A;  3OG2 A;  4BXS V;  3K46 A;  3OGV A;  3MV1 1;  5C7G A;  2VMC A;  2W91 A;  4JKK A;  1YQ2 A;  3IAP A;  1O8P A;  5JXG A;  1JYV A;  1OT5 A;  3HNM A;  2HLE A;  2WDB A;  1W9W A;  1JU3 A;  4A42 A;  1WKY A;  3A7Q A;  1US3 A;  4ZZ5 A;  3I97 A;  3ACI A;  4DEQ A;  5LA2 A;  3MUZ 1;  2VOT A;  2QQN A;  5B4X A;  2Y6H A;  2YG0 A;  1UWW A;  3VDC A;  1GQP A;  4BK4 A;  1US2 A;  5IYY A;  2QQM A;  1JYN A;  5G05 L;  3MUY 1;  2V72 A;  3VDB A;  2QQK A;  2ID4 A;  2X09 A;  4MOA A;  4DUW A;  1XPW A;  3ABZ A;  3VD5 A;  5CYY A;  1KEX A;  1O8S A;  2VCC A;  4QB6 A;  3WF2 A;  4KWU A;  3CDZ B;  2RVA A;  4A4A A;  3LEG A;  3FL7 A;  1UMH A;  2ORX A;  1K3I A;  1R64 A;  2R7E B;  3T09 A;  3UNP A;  2ORZ A;  2J1E A;  1XNA A;  3VDA A;  4OYU A;  2LS6 A;  1UY1 A;  3BN6 A;  5B4N A;  1JHJ A;  2WUH A;  2W1S A;  2Y6K A;  1ULP A;  4BDV B;  3III A;  4W50 A;  2VZT A;  3E1F 1;  1MPX A;  3I2K A;  1CZT A;  2Z4F A;  3OGS A;  3K77 A;  4W8J A;  2QQO A;  5JUV A;  1GUI A;  3BGA A;  3NQH A;  1CX1 A;  1OF4 A;  3I3E A;  4QDQ A;  1NUK A;  3CIH A;  1ULO A;  3SKV A;  4PT6 A;  3WNP A;  5EIY B;  4UI9 L;  1XC6 A;  4KI5 M;  3HPN A;  1HN1 A;  1RYY A;  3OB8 A;  2XON A;  4P00 B;  2CDP A;  2C26 A;  3WNK A;  1NX9 A;  2ZEY A;  5EJ1 B;  1JZ8 A;  2VO5 A;  2VZ1 A;  4QB1 A;  3P6B A;  1PX3 A;  4QX0 A;  3ZM8 A;  2XOM A;  3I3B A;  4HG6 B;  4JX0 A;  4RN5 A;  3AC0 A;  3ETP A;  2RJ2 A;  4QB2 A;  4UAP A;  4FI9 A;  4CUB A;  2ZEX A;  2VMF A;  3I2F A;  4L0P A;  2ZXQ A;  3CMG A;  3W5M A;  2J22 A;  2J1T A;  5JR2 A;  1L7Q A;  2JKX A;  2WO2 A;  3DYO A;  4BK5 A;  1DYO A;  2JE8 A;  3DYM A;  4JKM A;  2QQJ A;  4JKL A;  3P1I A;  2YFU A;  3W5N A;  3ACG A;  2XHN A;  3K75 B;  4ARX A;  5HXM A;  4AAX A;  4A3Z A;  5JXJ A;  2E33 A;  3ACH A;  4P5Y A;  4TTG A;  1P8J A;  1XNT A;  4QDR A;  3LPG A;  2E31 A;  2E32 A;  4MGS A;  4OUE A;  2YFZ A;  1JYW A;  2VMD A;  5LA0 A;  4XUN A;  4CU8 A;  4LHS A;  3CZJ A;  2W94 A;  3C8X A;  4OMD A;  3CQO A;  4QX3 A;  5IFP A;  2W1W A;  2YB7 A;  4P02 B;  3IAQ A;  2W9X A;  3NJV A;  4QPW A;  2EIC A;  2DDU A;  4MGQ A;  3SKJ E;  4QX2 A;  4AG4 A;  5DMY A;  4OZO A;  2WQ8 A;  1UXZ A;  5F7U A;  3WQB A;  3MV0 1;  3D3A A;  2YC4 A;  2XQX A;  3GDB A;  3C7H A;  4P08 A;  1H6Y A;  4D8M A;  2OKX A;  1GOG A;  3I2I A;  2WN3 A;  2W92 A;  1W9T A;  2Y6J A;  4D0Q A;  5HPO A;  2B4K A;  2E26 A;  1OF3 A;  2W5F A;  1L7R A;  1JZ5 A;  1UZ0 A;  4ZY9 A;  4LPL A;  5IHR A;  2ZEZ A;  4XUO A;  3T0A A;  2EIB A;  2W87 A;  1H6X A;  3NJX A;  1JZ4 A;  2B9V A;  4M4R A;  3WF0 A;  2V4V A;  3WNN A;  1W8N A;  1UY0 A;  1UYX A;  2VTF A;  3T0B A;  1DLC A;  2J7M A;  3I2G A;  1JZ6 A;  4M4P A;  5JMO A;  2Y6G A;  3HNY M;  5DN2 A;  3HJR A;  3IB3 A;  1UY2 A;  2BBA A;  4LQR A;  2Y6L A;  1O59 A;  4W4Z A;  1K45 A;  3DYP A;  3WNL A;  3OEA A;  2EID A;  3GXU A;  5IJR A;  3C7O A;  4PQQ A;  1W8O A;  2VZ3 A;  3VD7 A;  2QQL A;  3IDA A;  4XUQ A;  1W99 A;  4IUG A;  4QDS A;  2W3J A;  1W9S A;  4QAW A;  2WZ8 A;  3CZU A;  2QBX A;  4DUX A;  3T08 A;  2WAO A;  2VJX A;  4BJ0 A;  3NRU A;  5C70 A;  5A1A A;  2HYX A;  1UXX X;  3WF4 A;  5DPN A;  4DXT A;  5J1X A;  1SHW B;  3GGL A;  3LEI A;  4ET7 A;  3FHQ A;  3EB7 A;  2VCB A;  2QQI A;  3I2H A;  4ARY A;  1SDD B;  3A22 A;  3C7F A;  3THD A;  2LW8 A;  3OBA A;  1UX7 A;  1UY3 A;  3FN9 A;  4GWI A;  2V5D A;  2VZV A;  3HOB A;  1K42 A;  2VZU A;  2J1A A;  2X05 A;  2VME A;  4QX1 A;  1IQD C;  2C4X A;  2W1U A;  2BGP A;  3HN3 A;  1LNS A;  3F2Z A;  2DCK A;  2EIE A;  2PQS A;  3VD3 A;  3K4Z A;  2VC9 A;  4GWJ A;  4DXS A;  3PUH A;  4E8D A;  3A21 A; 
#chains in the Genus database with same CATH topology
 4FPH A;  2YBS A;  1PZ8 A;  1SLL A;  4URA A;  3WW3 A;  2CGO A;  3B69 A;  1RHI 1;  1SLB A;  4Q0V A;  3O1P A;  3B94 A;  1VAL A;  3QLQ A;  1XQN A;  3N35 A;  1UD1 A;  5FZA A;  2EIG A;  1B09 A;  4M3C B;  4PHZ A;  1JZ3 A;  5FPX A;  4V2V A;  3ZSM A;  3GZU C;  2B45 X;  4QD2 A;  1AR6 3;  3WDV A;  1MQT A;  3ALQ A;  1J1L A;  2ZAH A;  1UU6 A;  3D0S A;  3AXE A;  1CAV A;  3DEC A;  1VBB 2;  1ZRC A;  4LIV A;  2UY9 A;  1WME A;  2W47 A;  3KHC A;  4MGI E;  2HWD 3;  3RMY A;  3SLI A;  5BNP A;  3AKP A;  1QQP 2;  4NHX A;  3UV9 A;  5C33 A;  5IK8 A;  4OI1 A;  3VZM A;  2NPI A;  5FWE A;  2BW8 A;  1RUI 3;  3RDI A;  2VD7 A;  2LRP A;  1W6P B;  3H7J A;  3I59 A;  4FPO B;  4TWT A;  3KT1 A;  3U14 A;  2GN3 A;  1GNZ A;  2AEY A;  3H1W A;  4XHX A;  1UYP A;  1ENQ A;  1LR5 A;  1K12 A;  2J1R A;  4QU2 A;  1WA4 A;  2OXB A;  4N9I A;  5F5Q A;  2WZE A;  3AJZ A;  4XHB A;  4ISR A;  2WLQ A;  5AFB A;  3GAL A;  1DU3 D;  2BGO A;  2PHD A;  4XW3 A;  1ZZ8 A;  1C8M 3;  3WEZ A;  3LPF A;  3GF6 A;  1VIW B;  5I0D A;  4AVC A;  1H8T A;  3N9P A;  2QZ3 A;  2MNG A;  2ZEW A;  1IS6 A;  4YFZ A;  1CJD A;  3D4K A;  1YFY A;  1NYW A;  2FZ1 A;  4PIY A;  2RS5 3;  3SCF A;  5DDJ 2;  3VL8 A;  2JEC A;  3SEP A;  3U1X A;  4URT A;  3T4V A;  3ZYP A;  1PO2 3;  4AGR A;  3NO8 A;  4CXY A;  1RED A;  1YEW A;  3MI8 A;  4P5H A;  4UOJ A;  5FZO A;  3NW4 A;  3BIE A;  3POE A;  2I2S A;  5FDB A;  4QHB A;  5BV6 A;  3OY8 A;  1JW6 A;  1WLC A;  3DXU A;  5AC9 2;  5FZE A;  2X10 A;  2R32 A;  4KGQ A;  3S5Q A;  2PTM A;  1Q8V A;  4XFA A;  2DCJ A;  2RR1 2;  3BVC A;  3OGR A;  4AQS A;  3UES A;  3ZFF B;  2DVB A;  4LHK A;  3HN1 A;  3D5O A;  2ZGT A;  3RZG A;  2JB4 A;  1H2K A;  2Y0I A;  1VBA 3;  2XJT A;  1UPI A;  1CZS A;  1VBE 2;  1V6L A;  2WAB A;  3I2J A;  4XAE A;  3E5X A;  3UKT A;  2VM9 A;  5FO8 B;  4ATE A;  1O91 A;  4BA6 A;  1UY4 A;  4FBF A;  4RR3 C;  2JKB A;  5FPB A;  3TEX A;  2YPD A;  1FAY A;  1UYY A;  4Z2A A;  2G9G A;  1FYU A;  4BCU A;  1BJQ A;  2EA7 A;  3QCW A;  4R9C A;  4HON A;  2WO1 A;  3WXP A;  4A44 A;  2WNE A;  1AL2 2;  2Y8K A;  1VBD 2;  1TME 1;  3JUU A;  3LE0 A;  4OFG A;  4AXO A;  1H9P A;  2EXJ A;  2EXH A;  3BTY A;  3WG3 A;  1W6P A;  5KHK A;  3CKH A;  3HEI A;  4XUT A;  5AVA A;  4Z1V A;  3EYP A;  1O3T A;  3MBW A;  4DEV A;  1H4H A;  2LM3 A;  1RVF 3;  2RM2 3;  1OKQ A;  2B46 X;  3THC A;  3SEE A;  4DIQ A;  3ZXL A;  4DXR A;  2VZP A;  5LRR A;  3WUC A;  1O4Y A;  3OUI A;  1D7P M;  4AYU A;  5C9A C;  4DB5 A;  2W95 A;  4LE3 A;  3O7O A;  2WNV C;  3I3D A;  2QDR A;  4P9L A;  3M1H A;  3SIS A;  2W0X A;  3T2P A;  4CDQ C;  3LWC A;  1X36 A;  5LW9 A;  3VBH C;  2VXJ A;  1RUF 1;  3K4A A;  1XJA A;  4AVS A;  4B4R A;  4YVW C;  5C3P A;  5C8C B;  1VP6 A;  1GQG A;  4YGC A;  2ZX1 A;  3ILR A;  3HWJ A;  4Q27 A;  4E2Q A;  5FXV A;  4D7T A;  5A80 A;  3KB5 A;  4DY5 A;  4ZZ8 A;  4COY A;  1JU4 A;  1NCQ A;  2IVJ A;  4UT5 A;  1OI6 A;  4LBK A;  2WT2 A;  1V9U 2;  2A6X A;  2F4P A;  5F3G A;  2JG8 B;  3BU7 A;  4XF0 A;  4FTB A;  1KGY A;  4OI2 A;  3ZR5 A;  2VOX A;  4Q26 A;  2WFP A;  1UQX A;  1S0E A;  4MET A;  3OG2 A;  3ZFF A;  1W28 A;  4NHM A;  2H0B A;  1MS1 A;  4XDP A;  4BLI A;  1LEN A;  5CKQ A;  1AR9 1;  3J7N A;  3TYJ A;  4KWL A;  3RMX A;  4AQ2 A;  3AJY A;  2NP0 A;  2DFB A;  1UU4 A;  2WT0 A;  1W9F A;  3OF1 A;  2PLV 3;  2ZKN A;  1F9K A;  3IAP A;  4GAZ A;  4QPI A;  1KJL A;  2WKK A;  5FY8 A;  3W20 A;  3DKW A;  1JYV A;  2WZR 2;  3HNM A;  4HMZ A;  3HMY A;  2BEO A;  4NWV A;  3VHR A;  4CTE A;  1O3S A;  1JU3 A;  4O9E A;  1DDL A;  1D4M 3;  3AKT A;  2WLP A;  3KGZ A;  4ZZ5 A;  2A3X A;  1EV1 1;  3ACI A;  3GHM A;  2D3P A;  4FPC A;  4XCA A;  4DEQ A;  1PZ7 A;  3MUZ 1;  2JG9 B;  1N3O A;  4AVV A;  1KDK A;  1Z7S 1;  2YU2 A;  4CE8 A;  4AI1 A;  1NCR C;  1W8Z A;  1YQ5 A;  2F17 A;  4PI0 A;  2ILM A;  4QX7 A;  2BNO A;  3AP7 A;  2QQM A;  3KS7 A;  3VZO A;  5IYY A;  3JBG 3;  5T54 A;  1HN0 A;  1URX A;  3ON7 A;  1COV 1;  1SCR A;  2V72 A;  4M01 A;  5T5O A;  2XJU A;  2ID4 A;  4XIK A;  4ZON A;  4HSL A;  3UK9 A;  4KWK A;  2JE7 A;  4HOO A;  1RUH 3;  4XBN A;  3R4S A;  5CYY A;  3VD5 A;  3L2H A;  3LF7 A;  4CCO A;  2VCC A;  2BWC A;  4QB6 A;  3WF2 A;  2X5I C;  4KWU A;  2ET1 A;  5BNN B;  1W0P A;  3FUQ A;  5LY2 A;  4I0B A;  4H14 A;  3FFZ A;  1SFY A;  1GZW A;  2R7E B;  1DG6 A;  2JEN A;  4JGY B;  3OTF A;  3SH4 A;  1HW5 A;  1A34 A;  4WZF A;  1XNA A;  4YZ1 A;  3APB A;  2CSG A;  1YXW A;  3NNM A;  2W08 A;  2R06 1;  2UYB A;  3OGG A;  1QXP A;  1BEV 3;  3ZFG C;  1UY1 A;  2IC1 A;  4COZ A;  2JXA A;  4Y24 A;  3B01 A;  5B4N A;  1YJL A;  1CES A;  3N7J A;  2C9A A;  4FPG A;  5JLV A;  1OUX A;  2RS3 2;  1I3H A;  2GNT A;  4P14 A;  4NPL A;  3T4H B;  4CDX C;  2EVX A;  4Y22 A;  4YM0 A;  4LLO A;  1BXH A;  3RJ2 X;  5J7M A;  2BPA 2;  1H8V A;  1LEC A;  1KIT A;  1YO8 A;  1QNW A;  3OGS A;  4R8H A;  1Q5O A;  3K77 A;  4W6W A;  4W8J A;  5DZE A;  1R1A 1;  5KXD A;  3AP6 A;  3S5A A;  3LFI A;  5BNO C;  1G9D A;  2LAL A;  2RHP A;  1ASJ 1;  4XIL A;  5CFC B;  5K8S A;  5FP7 A;  3I3E A;  4CCL A;  1NLR A;  2WS9 1;  2AGS A;  2VEC A;  1GZC A;  3CIH A;  3ZYI B;  2UY8 A;  4GKX A;  1PGL 1;  2QQU A;  4K20 A;  5IK4 A;  2RMU 1;  5F5A A;  2WJS A;  5GZD A;  2TBV A;  4R4X A;  4KI5 M;  3OD4 A;  5EIY B;  4XMA A;  5L19 A;  1H2L A;  4FQ4 A;  4SBV A;  5J98 B;  1RUO A;  4MHU A;  1RYY A;  1WBL A;  4GMP 3;  3OB8 A;  4IET A;  2XON A;  3GJB A;  4K7J A;  1S0G A;  1IKP A;  1NX9 A;  3E6B A;  1W6M B;  4HKL A;  1I6X A;  4XBQ A;  5EJ1 B;  1JZ8 A;  1AJK A;  1O6U A;  1HRI 2;  2VAU A;  2AH2 A;  3P6B A;  4QX0 A;  4LUL A;  1MS3 A;  1HXS 3;  4PDW C;  3VBF A;  4LBM A;  2XOM A;  3I3B A;  5KWR A;  1W03 A;  3BCW A;  4Y5T A;  1AR8 3;  1RUE 1;  3MW3 A;  3H8R A;  2D44 A;  3BOD A;  3IDE A;  3LZZ A;  3AC0 A;  1DZR A;  3LAG A;  4Q0P A;  4QB2 A;  3WCR A;  1U5Z A;  4MX3 A;  3ACL A;  3L9J T;  4CUB A;  1S2K A;  4JGY A;  5FY1 A;  3T3Y A;  4AOC A;  5FR3 A;  2BQP A;  2JEM A;  5DAQ A;  2DVG A;  1ZBA 1;  1WW6 A;  5FY7 A;  2GP5 A;  5KR7 A;  3CMG A;  3ZDS A;  3ZXG A;  1YFW A;  1W8H A;  3LSE A;  1RUJ 3;  4Y1X A;  3RZM A;  2WO2 A;  3EHK A;  4XXA A;  4BK5 A;  4XXP A;  4AGG A;  4XPV A;  1OH3 A;  2QQJ A;  5JMC A;  1PVC 2;  1XYO A;  4TLF A;  1AYM 3;  3Q8A A;  1Q8Q A;  3IPV B;  2AYH A;  3P1I A;  2YFU A;  5I8T A;  2XDV A;  4NUB A;  2XHN A;  4ARX A;  2P37 A;  1IS4 A;  4CSW A;  1C4R A;  3HT1 A;  4LE4 A;  5CFD C;  1BMV 2;  2HJI A;  3H0O A;  2E33 A;  3VBO A;  5D8A A;  5FWJ A;  1OD5 A;  5A33 A;  1CN1 A;  1P8J A;  4EZ4 A;  5CFC A;  1XNT A;  2VXR A;  1OPM A;  1ZRR A;  4RA0 A;  4P9W A;  2YV8 A;  4S2D A;  1XNB A;  4IE7 A;  1W90 A;  3BOP A;  4QPG A;  2I45 A;  5DAB A;  5FZ8 A;  1DIW A;  3EXU A;  3E5Q A;  1WLT A;  1VAM A;  4LBQ B;  1UIK A;  3RJR A;  5FQ0 B;  5LA0 A;  1SLI A;  2WO7 A;  4Q1P A;  2R04 1;  1HRV 1;  5CKN A;  2AUY A;  1DBN A;  3W9A A;  1EPZ A;  4AI3 A;  3CZJ A;  2QTW B;  2B9U A;  1WMX A;  4YW2 A;  3CQO A;  2O14 A;  3UT0 A;  3NL1 A;  2KR2 A;  4QX3 A;  4LBN A;  4BQX A;  3ELN A;  5CB7 A;  1IGO A;  2W1W A;  3J7L A;  4I30 A;  2YB7 A;  3VBS B;  3IAQ A;  2ADE A;  3GJA A;  2EIC A;  3I7D A;  3S6P A;  2P6C A;  2SBA A;  3RS6 A;  3POJ A;  1VRH 1;  1HKD A;  1LHO A;  1R09 2;  1WWY A;  1CWP A;  1W6Q B;  1C3H A;  4EZH A;  5F6K A;  1YLL A;  4I0A A;  4NJ4 A;  3O1T A;  3WY6 A;  4CDW A;  1AYN 1;  1WD3 A;  4XAA A;  4IGO A;  5AVP A;  3MV0 1;  5FMB A;  2YC4 A;  1OLQ A;  1A8M A;  3ZYJ B;  3MGU A;  1D2S A;  3GDB A;  3P3P A;  4LA3 A;  4DPN A;  3U0Z A;  3J26 N;  1H6Y A;  4LLF A;  4D8M A;  4AEK A;  2OKX A;  1GOG A;  2AEN A;  3GZA A;  3BIW E;  3MEP A;  4ES8 A;  2WN3 A;  1DGR N;  3I2D A;  1K5M C;  4K1Z A;  1WA6 X;  3VZN A;  5HPO A;  2Y38 A;  4MGT A;  2XL7 A;  5JOW A;  2ENR A;  5GZE A;  4I01 A;  3FZ3 A;  4BQ3 A;  5CAZ A;  4HK8 A;  5FMC A;  2OW4 A;  1CQ9 A;  3AP9 A;  3IPV A;  1XNC A;  5FXW A;  4I3P A;  1H6X A;  1JXN A;  2XHK A;  3O12 A;  5FO9 B;  5KC6 A;  4HVO A;  4DRR A;  1VBB 1;  4CRQ A;  3WF0 A;  2V4V A;  5ACA 2;  3PMS A;  1XU1 A;  1VAK A;  3POF A;  2OZJ A;  3POG A;  3ZMN A;  4X6R B;  4FFI A;  1QQP 1;  2Q1Z B;  3GBG A;  1TNF A;  1QJU 2;  2VTF A;  4L9B A;  1IHM A;  1V6J A;  1FAT A;  1LOE A;  1W8U A;  1ND2 C;  2QFE A;  4WM8 C;  5FRA A;  4LBQ A;  2P3K A;  1MS9 A;  5JMO A;  2QCS B;  3HNY M;  4L97 A;  4JDO A;  3HJR A;  3IB3 A;  3USS A;  4D94 A;  5JOX A;  4AVA A;  2VTX A;  3Q9O A;  2PA7 A;  4QU1 A;  5E6H A;  1MVE A;  5FYZ A;  1ENX A;  3MPP G;  2WZP P;  4ONU A;  4QQH A;  4NHY A;  3GXU A;  4G3Y C;  4AFC A;  1J59 A;  3MLJ A;  3VD7 A;  2XKP A;  3IMN A;  3U11 A;  1AR6 2;  1N3Q A;  2I74 A;  1W6Q A;  2ZPX A;  1SLT A;  2TEP A;  2W3J A;  1BBT 3;  5DDJ 1;  5T5P A;  1CR7 A;  2HWD 2;  3N7K A;  3AYD A;  1QJX 3;  3F95 A;  4GMP 0;  1JOB A;  1WLD A;  2B7Y A;  2HH9 A;  4I09 A;  2ERF A;  4RS5 B;  1U5X A;  3T08 A;  2E63 A;  1QF3 A;  3GYD A;  2W68 A;  4Q0Q A;  4BJ0 A;  5AC9 1;  2XH6 A;  4MHR A;  4IL7 A;  3ZPY A;  2O8Q A;  4AQT A;  5A1A A;  4GWM A;  4UWD A;  4OHY A;  5FZ0 A;  2RR1 1;  4LBQ D;  3ZSK A;  4DXT A;  4UW5 A;  5J1X A;  1LCL A;  2PQQ A;  3LEI A;  1Y4W A;  1DQ6 A;  1S4C A;  3R4D B;  5FZ7 A;  3TBD A;  4ASL A;  1LTE A;  2G4I A;  2ZMK A;  1TQ5 A;  3R05 A;  1VBE 1;  1C8M 2;  1RC6 A;  3MLK A;  2FCV A;  5CNA A;  1J1T A;  4YG0 A;  3V56 A;  1ODM A;  1CAX A;  3KCC A;  2QQI A;  3VHO A;  3M3C A;  5JPM B;  2GC1 A;  2RS5 2;  3KV6 A;  3M4F A;  1YWK A;  3PVE A;  3R4U A;  5F2S A;  3I2H A;  4OUS A;  5A3P A;  1SDD B;  4PI2 A;  1O4Z A;  4NIG A;  1Z7S 2;  4SLI A;  4BQ5 A;  3C7F A;  4JDN A;  3THD A;  4FPK A;  2LW8 A;  3LIH A;  1RUD 3;  4MGK E;  1X82 A;  1AL2 1;  1VBD 1;  5DZF A;  5CKM A;  2AAC A;  4HPK B;  3ZYH A;  1YYN A;  3I4I A;  4K3U A;  4Z8B A;  3AKS A;  4PLO A;  1AXZ A;  1QJY 3;  4CCM A;  2J1A A;  4CP2 A;  5IVY A;  5FY5 A;  2XJS A;  3D82 A;  1JYT A;  4KGG A;  2BGP A;  3HN3 A;  4QX8 A;  4ATF A;  3ZN5 A;  4EJR A;  1WCS A;  2EIE A;  2PQS A;  2V5Y A;  4I3G A;  4XJA A;  1LOC A;  4QWN A;  3AFK A;  1VBA 2;  2D93 A;  5IVF A;  3PUH A;  4QQO A;  3WQ7 A;  3KQR A;  4OUM A;  4I2O A;  1HJF A;  4LOS A;  2K46 A;  1F15 A;  1ZZC A;  2O1Q A;  4NWW A;  5T52 A;  2ZHM A;  2G19 A;  3T0D A;  1PIV 3;  3VD4 A;  2L9L A;  2IXC A;  4YW5 A;  1TG7 A;  1F4A A;  2Q4S A;  3H1M A;  1XYP A;  5A7N A;  4MAD A;  2CDO A;  4ZKT B;  3VDD B;  1HB2 A;  3OBT A;  4RS5 A;  2X8K A;  3N9N A;  1LGB A;  1WW7 A;  5JI9 A;  1LU1 A;  3QBQ A;  3LGR A;  5EJZ B;  5ERL A;  1I5Z A;  4FSJ A;  1NQD A;  1EUU A;  1V9U 1;  1XSQ A;  4NO4 A;  5JZG B;  2RDR A;  3VKO A;  2FDI A;  1MVQ A;  3PNA A;  5J09 A;  1RVF 2;  2VZS A;  5F3I A;  3IT8 A;  4YW4 A;  5A3W A;  3T2O A;  4B4Q A;  3PTR B;  3LCP A;  4S2H A;  4KBB A;  3ZDV A;  1G6N A;  1CVN A;  2JIC A;  4KU8 A;  5FKB A;  5H9P A;  4XTP A;  4KMQ A;  1XNK A;  1W3V A;  1Q8S A;  3N9L A;  1F4H A;  4CCD A;  1QWR A;  2D6P A;  5C3R A;  4B1L A;  4IEP A;  1NAE A;  5J36 A;  4IEX A;  2YMZ A;  4MO3 M;  1EAH 3;  4M3C E;  4YW6 A;  3HBZ A;  5FFO C;  1LB2 A;  1Y7B A;  1C57 A;  2WZR 1;  4ISQ A;  1PGW 2;  1XRU A;  2WWS A;  1DQ1 A;  4HPK A;  1UNB A;  4NRQ A;  3M2M A;  2FQP A;  1K5J A;  3C7G A;  1DP0 A;  2W46 A;  5J48 A;  4QQL A;  4E8C A;  4CUC A;  1O5L A;  5L9R A;  1ZX5 A;  2Q1M A;  4Y1V A;  4JTO A;  4UBG A;  4AI8 A;  5A7S A;  2GC2 A;  1ZRD A;  1SDW A;  4ES9 A;  2VH9 A;  4IEV A;  4A2U A;  4IW3 A;  3PUQ A;  3BB6 A;  2BWA A;  2DU1 A;  2GDF A;  1GNY A;  3N9O A;  1WGP A;  2XJQ A;  1DFQ A;  3FHA A;  2XVG A;  3Q8E A;  4NAO A;  5LBE A;  5LK7 B;  5KXB A;  4FPY A;  1PK6 C;  1ZBE 3;  2PLV 2;  2WNV B;  5FK8 A;  5GM0 A;  5GLZ A;  3ATG A;  5FZG A;  4CDQ B;  1MAC A;  2Y34 A;  4QQP A;  4AI0 A;  4BXF A;  5F6L B;  4CCK A;  2VR4 A;  3VDD A;  5A6Z A;  4FOY A;  1D4M 2;  2VY0 A;  4Y1U A;  4YVW B;  2VCA A;  5JVV A;  2Q30 A;  5DXD A;  5BYN A;  3M3Q A;  4Q2F A;  3SMH A;  5FZ6 A;  4YZ2 A;  3WNM A;  4AEM A;  1O4T A;  1S0C A;  3OEB A;  4H3W A;  1EUT A;  2CNA A;  1LOF A;  4Q0U A;  5A6Y A;  3PIJ A;  2Y64 A;  1PMH X;  3W21 A;  1G9A A;  2VBD A;  2YBK A;  4XZP A;  3TAY A;  3JBG 2;  1MZE A;  1C5H A;  5D2A A;  1YQ8 A;  2ZGQ A;  1H30 A;  3JXS A;  5J3U A;  2A6Z A;  1LOG A;  2IWG B;  2RS3 1;  5JXI A;  3VL9 A;  3KZ4 C;  1H1M A;  4RHV 3;  1RUH 2;  3SIT A;  4E4H A;  1GBG A;  3FWE A;  4MXW B;  2Z2S B;  2ZJC A;  3NAP C;  3AP4 A;  5CZK A;  4CU6 A;  4CU7 A;  1MR5 A;  1X50 A;  3I59 B;  2QQW A;  5L7O C;  1SG3 A;  4YZ4 A;  1VJ2 A;  2OS2 A;  4YG3 A;  4DFS A;  4AW7 A;  1SQ4 A;  2C1F A;  4RR3 A;  1OH4 A;  2VQA A;  4MZU A;  3VZJ A;  2VUC A;  1BHG A;  4A41 A;  1FMD 3;  2A1X A;  1YFU A;  1YCI A;  4PBP A;  3MIB A;  3UET A;  1CPN A;  2ZAA A;  1AZD A;  2ZHL A;  2BZD A;  3USU A;  4DUV A;  2RJL A;  4XOG A;  2PHU A;  3UGG A;  3MDP A;  2RS1 3;  2VOW A;  3I2O A;  5GZF A;  4XFC A;  4BWO A;  4LKE A;  2CL2 A;  2ADD A;  2XUE A;  1J84 A;  2ZX3 A;  5FUI A;  4AVT A;  3K51 A;  2G9Z A;  3VBU B;  5FYB A;  3C7E A;  5C9A A;  5FZO B;  1HRI 1;  3WDT A;  1NA1 B;  3U37 A;  4RGK A;  4CVU A;  4PF1 A;  5HCH A;  2IFR A;  2W1Q A;  2WL1 A;  2CHH A;  2WNV A;  4DO0 A;  3OSD A;  4JHT A;  4CDQ A;  2FD8 A;  2BNN A;  4OZX A;  3OGV A;  2DVD A;  2R1D A;  3VBH A;  3ZN6 B;  2GND A;  2WFF 3;  3TB0 A;  5LAT A;  4YVW A;  5EWS A;  2W91 A;  1VMF A;  3FBY A;  3U10 A;  2C24 A;  3ZSL A;  3RG0 A;  3GZE A;  2YHJ A;  3UYJ A;  1ZZ9 A;  4Q8K A;  4XFB A;  2GH8 A;  4WVW A;  2X5I B;  1O8P A;  5JXG A;  2XLA A;  5F8P A;  4LHN A;  1UZZ A;  3RFR A;  5F2W A;  5JSP A;  4XF4 A;  4H7L A;  4IGP A;  1WKY A;  4W6X A;  3A7Q A;  4AHW A;  4DZG A;  2D6L X;  2ZGN A;  1N47 A;  3I97 A;  2ZTN A;  3JCI A;  4EWE A;  5C4W C;  3BU0 A;  1PVC 1;  3O0V A;  4E4D X;  2VOT A;  1IS3 A;  5GLV A;  5B4X A;  2YG0 A;  3WT3 A;  3ZFG B;  1VAV A;  5FZB A;  2W52 A;  2XUM A;  1HXS 2;  4MXW A;  1YHF A;  1US2 A;  2R07 3;  1OUS A;  2ZX0 A;  1PGS A;  1JYN A;  1BMV 1;  1AR8 2;  5EJ3 A;  2D5F A;  3LB9 A;  2IVI B;  4UFI A;  2VW0 A;  1UIJ A;  4XET A;  1N1V A;  1GNH A;  3SNM A;  5EYY A;  3ROU A;  2WNO A;  4RGA A;  4CPB A;  1DQ4 A;  3CJI C;  1XPW A;  2VUJ A;  3ABZ A;  5FRE A;  3AFG A;  3M8L A;  3NV4 A;  5D1I A;  1O8S A;  5FKC A;  3Q8F A;  1W6N B;  2Q1F A;  4K8R B;  4CZS A;  3CDZ B;  1RUJ 2;  4KWJ A;  4A4A A;  4O9G A;  5IK5 A;  4JQT A;  3FE5 A;  5C5U A;  1K3I A;  1JHN A;  2HWB 3;  1OLM A;  2ZKL A;  5KHH A;  2GAU A;  5FZ3 A;  3UNP A;  4GXL A;  3H1Y A;  3VBU A;  1NCR A;  2OQ6 A;  5F3C A;  4L11 A;  2HKX A;  1JN2 P;  1UMZ A;  1AYM 2;  1NA1 A;  1LED A;  4HKO A;  3RYR A;  1NCQ B;  1YJK A;  4Z2W A;  3N7L A;  5A1F A;  3AYC A;  5FV3 A;  1MS8 A;  1R09 1;  3BN6 A;  5I0R A;  1JHJ A;  3ZN6 A;  2JDP A;  4XDQ A;  4Y26 A;  5DAP A;  1CON A;  3SCH A;  1ND3 C;  1B35 B;  1ULP A;  4W50 A;  1ODN A;  2VZT A;  1MPX A;  3MIC A;  3I2K A;  2X5I A;  2E9Q A;  2Z4F A;  1S55 A;  2A75 A;  4CPB D;  5BXX A;  5FJH A;  5T55 A;  4WVZ A;  4AL9 A;  4BIF A;  5LBC A;  1XE0 A;  5JUV A;  3QOP A;  2BBV A;  3AM2 A;  1WCD J;  5GKA C;  1ALY A;  3WOG A;  4B3N A;  3NQH A;  2JDK A;  2DVF A;  3ZXJ A;  5LEJ A;  4N43 B;  4UF0 B;  4NPM A;  4F7Z A;  4QPI B;  1X8E A;  2DCT A;  1FNZ A;  4Q0S A;  4C1X A;  3OBZ A;  4GIQ A;  3ZFG A;  4OHX A;  1ULF A;  2ZX2 A;  1ULC A;  4E4S A;  2JIJ A;  1ULG A;  5FP9 A;  5K9Y A;  4LJH A;  2WRA A;  2CDP A;  2O8O A;  4JGZ B;  5SV8 A;  2C26 A;  2VW1 A;  5FOB B;  4XAB A;  5ACA 1;  4E9K A;  3PJY A;  2ZEY A;  1CX4 A;  2GN7 A;  2VO5 A;  2WWU A;  2OZ6 A;  2VZ1 A;  1QJU 1;  1PX3 A;  1KS5 A;  1NQJ A;  1CPM A;  3ZXD A;  2ZGL A;  3ZM8 A;  1X9T A;  4AHY A;  4CP9 B;  4IV1 B;  1TNR A;  2WNU C;  3N9Q A;  2PEL A;  1W6N A;  3DGT A;  3ST7 A;  1LHV A;  4RN5 A;  2VNG A;  5J37 A;  3ETP A;  2RJ2 A;  4IQP A;  1LU2 A;  3GNE A;  4FI9 A;  3C2U A;  2YGL A;  4G9S B;  2CWS A;  4OUL A;  5FBJ A;  5A6Q A;  5KHG A;  5FY4 A;  1MS4 A;  5FZK A;  4RSU A;  4RQP B;  3I2F A;  3KLS A;  4PCR A;  3VBR C;  1BQP A;  4H55 A;  2DWR A;  4B8E A;  4QMA A;  3ILF A;  2XWJ B;  4NE9 A;  1AR6 1;  3RSJ A;  5F37 A;  3EBR A;  4YGD A;  1GZW B;  4HVR A;  3D0J A;  3DYO A;  4YSF A;  3GBW A;  3DYM A;  1N1T A;  2HWF 3;  4Q4Y 3;  3NNJ A;  2P3I A;  2HWD 1;  3GCW A;  4PDW A;  5FMO S;  5JI7 A;  5LZ6 A;  1B35 A;  1REF A;  2YDE A;  2ZOE B;  4YLZ A;  1W05 A;  5H9S A;  2XQR A;  2C0Z A;  3ACG A;  2ATF A;  2XBO 3;  3OPT A;  3CEW A;  4B29 A;  1MZF A;  5HXM A;  3P3N A;  3KCX A;  4A3Z A;  3PUS A;  4NHK A;  3ZFE C;  4AEJ A;  4BB3 A;  5KXE A;  3ACH A;  4FO9 A;  1C8N A;  1OXC A;  1LGN A;  1GSL A;  2BJS A;  4UW3 A;  4N43 A;  2CGN A;  3AZV A;  4UF0 A;  4Y22 B;  5FUN A;  4COU A;  1YUD A;  2R49 A;  1LES A;  5LBB A;  3LPG A;  3THP A;  4OUE A;  4ZU7 A;  2YFZ A;  5A32 B;  3GCX A;  1JYW A;  5GLU A;  3ORJ A;  3O5S A;  5GLT A;  1C8M 1;  5BNP C;  1N3P A;  2VNR A;  4QGN A;  1NLS A;  5I0U A;  4CU8 A;  4PF5 A;  4LHS A;  4QGL A;  1RUN A;  1YIF A;  4UFM A;  3OGJ A;  4ZHN A;  4FAG A;  4ITC A;  1FXZ A;  2RS5 1;  4JGZ A;  2W94 A;  1UZV A;  2K2S A;  1BBT 2;  4LT5 A;  1OOP B;  4LKD A;  4OMD A;  4CCJ A;  4GH4 C;  3AL5 A;  4Y1Z A;  3Q8C A;  1QJX 2;  4HK9 A;  5FPA A;  3LFM A;  1W3X A;  3U78 A;  5GZC A;  5DUX A;  2CWM A;  1XE7 A;  1NXD 1;  4P02 B;  2W9X A;  1ZRE A;  4NR1 A;  4MGQ A;  3O1O A;  1Y43 B;  1XBF A;  3SKJ E;  4IV1 A;  3O14 A;  4CP9 A;  1HX6 A;  2D43 A;  4UBH A;  1DGL A;  1UXZ A;  3GBF A;  2JJ6 A;  1H8T C;  1ND2 B;  2ZGO A;  4GQ7 A;  2D97 A;  2GME A;  2OT7 A;  1VBC 3;  4NMI A;  4WM8 B;  4YVS B;  3VBF B;  2TNF A;  3VGI A;  1X9P A;  3VLB B;  4RQP A;  1VBA 1;  2XQX A;  4PIZ A;  3MFC A;  2GZW A;  2D98 A;  1DQ0 A;  4P08 A;  1QHD A;  1FV2 A;  1HB4 A;  5FYI A;  1RB8 G;  2D6O X;  3LDK A;  3G7D A;  4Q4X 3;  1W9T A;  5DG2 A;  4BZ4 A;  2E26 A;  3J4U H;  3S30 A;  4MSV A;  2P17 A;  1L7R A;  1RUG 3;  4E4Z A;  1JZ5 A;  1UZ0 A;  3IZO A;  4HBN A;  3S0M A;  4JC1 A;  4DS0 A;  4LR4 A;  4JCK A;  1RUD 2;  1W39 A;  2ZEZ A;  4XUO A;  4BH9 A;  3POY A;  3RZJ A;  2EIB A;  2P2K A;  1R1Z A;  2ZX4 A;  1VRB A;  3JQX A;  3QH7 A;  4E27 A;  3BTX A;  4LK7 A;  1JZ4 A;  2B9V A;  1NXM A;  2ZHK A;  3WCS A;  5FYS A;  4M4R A;  1QJY 2;  4K21 A;  4M3C F;  2E7A A;  1RVF 1;  2ZCW A;  2ZGK A;  1UYX A;  4Q4V 3;  2DBI A;  2YPJ A;  1KS4 A;  5IT6 A;  1F5F A;  2J7M A;  4AR2 A;  1HB1 A;  5A32 A;  3VBO B;  5IWF A;  5D8A B;  1JZ6 A;  1O3R A;  5FYV A;  1K5M A;  5A33 B;  4Y1Y A;  1MEC 3;  2GH2 A;  2QE3 A;  5DN2 A;  4FOV A;  4WV8 A;  3PME A;  5F39 A;  2P3J A;  4QPG B;  2DU0 A;  1UY2 A;  2BBA A;  1PIV 2;  2P1B A;  4IE0 A;  1OOP A;  3RVH A;  3DYP A;  3NST A;  3KQ4 B;  3WNL A;  4NIH A;  4H2A A;  2EID A;  5H9R A;  5FZI A;  1PGW 1;  3C7O A;  2WIN B;  2VZ3 A;  3AKQ A;  2ZMN A;  4PQQ A;  2HBU A;  4M0N A;  3ZLI A;  3DXT A;  3IDA A;  4ZPI A;  1JUH A;  2XJV A;  4KH9 A;  1AHS A;  2DCY A;  1UZW A;  5A7Q A;  2K0G A;  1V6K A;  1W9S A;  4HZF A;  1J3R A;  4QAW A;  3WG2 A;  2JIG A;  4FOQ A;  1ND2 A;  3CZU A;  5D21 A;  4NII A;  1HQL A;  2RJK A;  4WM8 A;  1D4V B;  1G8W A;  4YVS A;  1A78 A;  3ZKU A;  1POV 1;  2DUQ A;  3ES4 A;  4DMI A;  3ZR6 A;  5C70 A;  3HAG A;  1RUC 3;  4DY3 A;  5I0S A;  4CDW B;  4UFK A;  2VG9 A;  4LBL A;  3GGL A;  2PLV 1;  4KG8 A;  1EAH 2;  1ONA A;  1Q56 A;  4BIO A;  3FHQ A;  3VKF C;  5JDB A;  1AR7 3;  4LIU A;  5JAX A;  5A7O A;  2VMG A;  4JRL A;  1QOT A;  1D4M 1;  2RE9 A;  1UX6 A;  5FPU A;  3ZFF C;  3BKZ A;  4F8A A;  1PZ9 A;  1VR3 A;  1F5J A;  4LOR A;  4EYU A;  4ZXK A;  4YAR A;  5C3O A;  4Y5Z 0;  4AZZ A;  4Y20 B;  3TOJ A;  1AL0 G;  4A6S A;  4YW3 A;  4LO8 A;  4CXX A;  2EXK A;  1IS5 A;  1UY3 A;  1C28 A;  3CO2 A;  3JBG 1;  5I8S A;  1TEI A;  3UJO A;  3ZX7 A;  1N1S A;  4GWI A;  4CDU B;  4CXW A;  2V5D A;  1OMI A;  2VZV A;  3NV1 A;  5DAV A;  1W2T A;  4F83 A;  2PHL A;  3EMR A;  2ES3 A;  1DF0 A;  2VZU A;  5GJ6 A;  5A7W B;  1S0B A;  4EE2 A;  4ZS2 A;  4UFH A;  3AXD A;  1RUH 1;  1KQR A;  1SCS A;  1J3P A;  2P3Y A;  2C4X A;  2X05 A;  1ZBE 2;  5ABJ C;  1RMU 3;  3T1L A;  1BKZ A;  1QJF A;  3KGL A;  3NV3 A;  4KBZ A;  1X33 A;  2XLG A;  3JD7 3;  3VD3 A;  1BK1 A;  1R08 3;  2CTV A;  3K4Z A;  4B7E A;  4DXS A;  3H8O A;  2UUR A;  1GZT A;  1POQ A;  3KM5 A;  1UF2 C;  5AC9 3;  4D7Y A;  1T2X A;  4OQ9 A;  1BK0 A;  4IDZ A;  4GB3 3;  1S0I A;  4FCA A;  1SFP A;  1S0F A;  2PHR A;  5FLI A;  3PIG A;  4ZXE A;  3WQ0 A;  5IVB A;  3X29 B;  1ULD A;  3V0A B;  4TZD A;  1W0N A;  2LRO A;  2V09 A;  4J1W A;  4LKF A;  1DGR A;  3AMN A;  4C1W A;  4ASM B;  2CAV A;  3OPZ A;  4C0H A;  4P9I A;  1CAW B;  5FYC A;  1CGP A;  4LUK A;  5C8C C;  1CIY A;  3KF5 A;  5JCT A;  5G04 L;  3LEK A;  1JBC A;  1EY2 A;  2Q5T A;  4W65 A;  4XMI A;  1GAN A;  2IFW A;  3HQU A;  4RHV 2;  3ACF A;  1Q43 A;  3K48 A;  1GIC A;  4TN7 A;  5HCF A;  3VD9 A;  1E5I A;  4Z07 A;  3RWN A;  4NRO A;  4A6O A;  1KFU L;  2JG8 C;  5AFE A;  2VPV A;  4NPR A;  2YU1 A;  4O65 A;  1LJ7 A;  2PMW B;  1PMJ X;  1PK6 B;  1UPS A;  3AZY A;  4FTS A;  3WNX A;  1Y9Q A;  2WN2 A;  1FMD 2;  3IDC B;  3OUH A;  4IEO A;  4XZU G;  5FXX A;  2HWC 3;  1DGW A;  1QIQ A;  3T30 A;  4TXW A;  2OPK A;  1EYB A;  4R52 A;  4Y20 A;  3WG4 A;  1CAX B;  2PHW A;  4Z82 A;  2RS1 2;  3QH6 A;  1KFX L;  4H7M A;  4GMP 1;  3H8X A;  2A5Z A;  2EAK A;  4LKS A;  1OPO A;  4UXA A;  3PUI A;  4CDU A;  4E2G A;  1W2N A;  2BFU S;  3HNB M;  4A45 A;  1RJ7 A;  2B5H A;  2R0F A;  1OC1 A;  3LDB A;  4N53 B;  5EYX A;  5A7W A;  1G9F A;  3V0B B;  1F8V A;  5EZW A;  2Q8C A;  2Y0O A;  3BTZ A;  2VGD A;  4NOT A;  4YYO A;  1GU3 A;  1HXS 1;  4X8P A;  2RDN A;  3MID A;  2DBN A;  1ZRI A;  4PBO A;  4WZC A;  2JG9 C;  1AR8 1;  5E8A A;  5FYH A;  3ILN A;  3DN7 A;  3ZXA C;  5H9Q A;  2WFF 2;  4WM7 C;  4AK3 A;  5FP8 A;  1DYP A;  1FPN 3;  5JWP A;  4IEU A;  4LIT A;  1TMF 3;  1V9U 3;  3MIG A;  4LO7 A;  1BVP 1;  3MIH A;  2PHT A;  4NRP A;  4NAM A;  4GJY A;  3V0A A;  4QKN A;  2C9K A;  4AHX A;  3WNO A;  1J83 A;  1LHN A;  1RUJ 1;  1CAW A;  2CYF A;  4HET A;  4KU7 A;  5IFT A;  2I07 B;  3MLL A;  3PHM A;  3POW A;  4RGG A;  2J1S A;  2VMH A;  3TEW A;  3W58 A;  2WII B;  3U4S A;  3H3U A;  2WC2 A;  5LWB A;  1G7Y A;  4Q4W 3;  4AHZ A;  5BNN C;  1AYM 1;  3HQR A;  1RIT A;  1JZ2 A;  4CCC A;  2VQT A;  4A7Z A;  1RUI 2;  2IXI A;  2R07 2;  2XWB B;  1WD4 A;  2MEV 3;  4JGY C;  2QNK A;  1JOJ A;  1AVB A;  2H0V A;  3VUO A;  4A3X A;  3INA A;  5IVV A;  1WLW A;  4AED B;  3D6E A;  4CEY B;  1BVV A;  1PK6 A;  4OQ8 A;  2CY6 A;  1JS9 A;  5JOZ A;  1YNA A;  1OFS A;  1GOH A;  3B5L B;  2VUA A;  4FT8 A;  4S2G A;  5DAX A;  1M4W A;  2BP6 A;  1UOB A;  2XVL A;  1XOY A;  3ETQ A;  5LCW L;  4CEW C;  1W04 A;  4FPF A;  3UKN A;  1PO1 3;  4AE2 A;  1IPS A;  1JOD A;  2JX9 A;  1XND A;  2HWB 2;  4PIX A;  4XJZ A;  4XUP A;  4N53 A;  1PO2 2;  4WVV A;  2QQP A;  2AEZ A;  1JMU B;  2UWC A;  4YWA A;  5A7P A;  5GAL A;  4HXC A;  5EHD A;  4MVT A;  3V0B A;  4AI2 A;  1VB4 A;  1RL3 A;  4IE4 A;  4EV0 A;  2Y60 A;  3RZL A;  3LQC A;  2PYT A;  4HAN A;  1I1E A;  3UKV A;  5C4W B;  3WSO A;  1FOD 3;  5CA6 A;  3DPR C;  3S57 A;  1GKB A;  2D40 A;  2VW2 A;  2WAA A;  2NZ9 A;  5LA9 A;  2YC2 A;  1CZV A;  2A70 A;  1AX0 A;  3NAP A;  5I91 A;  4BE3 A;  4LUM A;  2KD7 A;  2VUD A;  5C8W A;  4NRM A;  1QDO A;  2Z5W A;  4FPE A;  5F32 A;  1S0D A;  4BXS V;  2NYY A;  3TNP B;  5FZD A;  5BY5 A;  5CIS A;  3WW2 A;  2PHX A;  3K46 A;  5SV5 A;  3LA3 A;  1JH5 A;  4BPZ A;  1NLQ A;  2NM1 A;  2VMC A;  4C91 A;  3MW2 A;  4JKK A;  3J8F 3;  5A3O A;  3AK0 A;  4F3J A;  2RS3 3;  3WHU A;  3LDR A;  3IM0 A;  5FYT A;  2HBT A;  5CG8 A;  1S1A A;  3HIF A;  1DZT A;  1KD7 A;  1W9W A;  1ENS A;  3GZT B;  4A42 A;  2BTV C;  3LSD A;  1UL9 A;  2BNM A;  4FVV A;  4GUL A;  2BDR A;  1US3 A;  2W39 A;  3L2Y A;  3AYE A;  3NJY A;  4AED A;  2RM2 2;  4CEY A;  4CA9 A;  3AVS A;  5LA2 A;  4AVB A;  4K8F A;  4DQA A;  1LEM A;  1DHK B;  2Y6H A;  4JTN A;  3U07 A;  1UWW A;  2VOV A;  4BK4 A;  3J9S A;  3N9M A;  1Z0H A;  4R9B A;  5JZG A;  3KVB A;  3I3Q A;  5L36 A;  3WZ1 A;  5G05 L;  3RPQ A;  5IAT A;  1HQW A;  1QXR A;  2VU9 A;  2QQK A;  2FHR A;  2GMM A;  2X09 A;  3TEZ A;  1C1F A;  4DUW A;  2UWA A;  1MZ5 A;  3POB A;  3TN9 3;  1IOA A;  5F3E A;  4LHL A;  1ZA7 A;  2HWE 3;  4BQ1 A;  1V6I A;  3WP5 A;  1WCK A;  4RR3 B;  5JR7 B;  2N7G A;  3WD5 A;  5IVE A;  2QQV A;  1HB3 A;  3VB9 A;  4L2N A;  2RVA A;  1OVS A;  5C4W A;  1AX2 A;  1HV1 A;  5KBF A;  2YUE A;  3FL7 A;  4YGB A;  3AMH A;  2J42 A;  1BBT 1;  2HWF 2;  2ORZ A;  4IEZ A;  4Q4Y 2;  5LBF A;  2E6V A;  3USU B;  1OFN A;  2J1E A;  1QJX 1;  1RHI 3;  1I9R A;  3VDA A;  5CBL A;  4OYU A;  4IEQ A;  2Q8O A;  3FLR A;  1O5U A;  3MIF A;  2IXK A;  2XBO 2;  1CIW A;  4QT6 A;  2HEV F;  2A6Y A;  5FCC A;  5CEH A;  1BCX A;  1QOO A;  3CJI A;  5C9A B;  2TUN A;  3VBS C;  2W1S A;  1NG0 A;  4N8M A;  4BQ2 A;  3KSC A;  2Y6K A;  3UGH A;  3HR9 A;  2WQZ C;  1OQD A;  1PVC 3;  2D6K A;  3RNS A;  4COW A;  1LOA A;  4UYB A;  1CZT A;  4OVE A;  3VBH B;  2A7A A;  2QQO A;  4LA2 A;  3EQE A;  2UYA A;  1NOV A;  1GUI A;  1LUL A;  3E97 A;  3I54 A;  3BGA A;  4GAL A;  4QXK A;  3ASI A;  1OF4 A;  3VHN A;  3V65 A;  1NUK A;  1GR3 A;  4N9H A;  4OI4 A;  1W9Y A;  3SKV A;  4PT6 A;  2GNB A;  1RUD 1;  2YYO A;  3LOI A;  1XC6 A;  1OVP A;  1HJG A;  3WW1 A;  3B00 A;  3SHR A;  1RIR A;  1W2O A;  3HPN A;  1HN1 A;  5ANQ A;  4P00 B;  4FFH A;  5L9V A;  4KNC A;  4BMB A;  5BNQ A;  2JE9 A;  1QJY 1;  4YFW A;  4IXL A;  3GHN A;  4OLL A;  2G1M A;  5FJK A;  1KJR A;  1UW8 A;  2DF7 A;  4CCE A;  1C5I A;  1XU2 A;  4QB1 A;  1VBC 2;  3MF9 A;  4EN0 A;  4YZ5 A;  3ZFE B;  3PL0 A;  4MH0 E;  1F2N A;  3RGB A;  4JQR A;  4BLJ A;  3H8U A;  4HG6 B;  4JAA A;  1UOF A;  3WUD A;  4JV4 A;  4AGV A;  2BFU L;  4BME A;  2VBB A;  4Q4X 2;  3ZYF A;  1J3Q A;  2XJP A;  2D6N A;  3FJS A;  1PIV 1;  3PLQ A;  2WSU A;  1GV9 A;  2KM2 A;  2ZEX A;  2VMF A;  4FFG A;  1SPP B;  4XFF A;  1RUG 2;  1PMI A;  3JU9 A;  3OYW B;  2LTN A;  2PN5 A;  2JWP A;  3CHX A;  2V73 A;  1BEV 2;  1KXG A;  1AXY A;  3EO6 A;  2CV6 A;  3D8C A;  1FX5 A;  2J1T A;  2PHF A;  2QZ2 A;  2VOK A;  2EXI A;  1L7Q A;  2JKX A;  3IKW A;  5JR2 A;  2F6B A;  3AZW A;  1DYO A;  1NCR B;  4R9A A;  1NT0 A;  2FDG A;  1ZYB A;  4JKM A;  4JKL A;  4HSJ A;  5DG1 A;  5I93 A;  3EJK A;  3I49 A;  1WCU A;  4EN6 B;  5C5T A;  2Y6F A;  1T6B X;  4QXC A;  3ZPO A;  3W5N A;  3H42 B;  1AX1 A;  4AFA A;  2A3W A;  2FCU A;  3RWK X;  2Z69 A;  1TME 3;  2VBP A;  4OHW A;  1FV3 A;  1MEC 2;  4JVA A;  5JXJ A;  5FPZ A;  3AL6 A;  3DV8 A;  1L3J A;  4RS5 C;  4AFB A;  3B02 A;  5A3T A;  4XJU A;  3KT7 A;  1IPJ A;  1IQA A;  1EAH 1;  4EWD A;  5C3S A;  1UAI A;  2E31 A;  2R1B A;  3OJB A;  4XYX A;  1FNY A;  1O7F A;  3NJZ A;  1PVX A;  3C3V A;  3HT2 A;  4DXZ A;  1SBD A;  1GLH A;  1V6O A;  3B9C A;  3G6J B;  3WR0 A;  1W8T A;  3KV9 A;  3LD8 A;  2ARA A;  1JTZ X;  1RUF 3;  3C8X A;  4IV3 C;  1ZZB A;  4A7K A;  3WHT A;  1L7L A;  2VVD A;  2W2I A;  3O0W A;  5JSO A;  4UW6 A;  5FOJ B;  2WA3 A;  5EPA A;  2JDY A;  5K0U C;  3LKJ A;  4QPW A;  3ZFE A;  1RJ8 A;  2DDU A;  4J25 A;  4Y5S A;  3SXW A;  4CDX B;  5JSR A;  4ASK A;  2H6B A;  1RUC 2;  4QX2 A;  3FLP A;  3ME2 A;  3N7M A;  3RI9 A;  4GWN A;  4FPJ A;  4OZO A;  1TZO A;  4WVM A;  5DMY A;  3I3M A;  4CCN A;  5IVC A;  2DV9 A;  1ZBE 1;  3IBM A;  3WQB A;  5BNO B;  1YFX A;  1SPP A;  1Y9G A;  4XF3 A;  3SH3 A;  5CIR A;  2MHF A;  1NE6 A;  3OYW A;  1AR7 2;  4ZU5 A;  2A6W A;  1AR9 3;  3C7H A;  4NVP A;  3SQO A;  3IWZ A;  3POI A;  1QY4 A;  3I2I A;  4N7I A;  5EP9 A;  4GH4 A;  1PM4 A;  3MIE A;  4E2S A;  2Y6J A;  1ST8 A;  4LTA A;  3VZL A;  2B4K A;  1OF3 A;  2W5F A;  2BU9 A;  2WQ4 A;  3I8T A;  3BTA A;  2YBP A;  4LPL A;  4IND A;  5IHR A;  2UWB A;  4W6Y A;  3T0A A;  1NY7 2;  2QVS B;  2W87 A;  1W6O B;  1HV0 A;  4XDO A;  4G4F A;  3WX5 A;  3NJX A;  2Y33 A;  4NID A;  3NNF A;  2DTY A;  1JUI A;  4P9X A;  4PDW B;  5EV7 A;  4FQZ A;  1EV1 3;  3VDD C;  3MFA A;  2ARC A;  4RHV 1;  1QDC A;  3PTY A;  2R6Q A;  4I02 A;  4M0H A;  1RMU 2;  4FXG B;  3T0B A;  4BQW A;  1DLC A;  1Z7S 3;  3JD7 2;  2NN8 A;  1R08 2;  2VNO A;  4FFF A;  1CAU B;  3TRS B;  3WW4 A;  4C8D A;  5JZG C;  1BYH A;  2C6S A;  2RG4 A;  1UOJ A;  1WMF A;  3U75 A;  4M4P A;  3T1M A;  1LOF C;  4D6Q A;  2Y6G A;  4YNI A;  3VKM A;  1QEX A;  1COV 3;  1FMD 1;  1STM A;  4GB3 2;  1QNY A;  2B8M A;  2D5H A;  4EN8 B;  1LGC A;  2Y6L A;  1K45 A;  1BLZ A;  3BPS A;  5CU1 A;  4AI9 A;  2F4L A;  2NQY A;  3B7M A;  2WWJ A;  5FLH A;  4B4P A;  1G9C A;  1W0O A;  5T3N A;  5TSW A;  3ZYR A;  5F5C A;  5FY0 A;  1F31 A;  2RS1 1;  1W8O A;  4K6B A;  1G86 A;  1GFF 2;  1U5Y A;  1SZB A;  1WMD A;  2P6H A;  2YGM A;  4RD7 A;  5FYY A;  1VMJ A;  5L9B A;  2EF6 A;  2JB8 A;  4M3C A;  5A3U A;  3FFQ A;  1FI2 A;  4XQW A;  3KMH A;  1W99 A;  3FBM A;  3PUA A;  4CDX A;  1YRZ A;  4MGZ E;  2DUR A;  5CFD B;  1OKO A;  4P9G A;  4DNY A;  5BNO A;  3WDX A;  4KQ7 A;  3N36 A;  2R06 3;  4IE5 A;  2VJX A;  5IAV A;  4RL7 A;  3PVN A;  4JZR A;  3NRU A;  2WFF 1;  3P5B A;  5ABJ B;  5FMD A;  1T6G C;  1UXX X;  2DYC A;  3KT4 A;  4R4Z A;  5DPN A;  2D6M A;  3PUR A;  4N7U A;  1LAJ A;  2HWC 2;  1QJE A;  5I0T A;  1S2B A;  2P5B A;  2VTX J;  4YW7 A;  5FZC A;  5HXV A;  4HL0 A;  2AR6 A;  3WDW A;  5IK7 A;  5CVR A;  1R1A 3;  1OA3 A;  1W6O A;  4MUV A;  1ASJ 3;  2UU8 A;  4XFG A;  2NMO A;  3MW4 A;  4DOU A;  4NN0 A;  2JD4 A;  4XJ8 A;  2WS9 3;  2XVK A;  1W2A X;  1WW5 A;  3K2O A;  1VLN A;  4HLT A;  4OHZ A;  5FP3 A;  4D6R A;  1RUI 1;  2R07 1;  2RMU 3;  1ZRF A;  4X8N A;  3M70 A;  1H2M A;  1UX7 A;  2WR9 A;  3OBA A;  5FAX A;  3ZMO A;  1CAU A;  4JDM A;  5GLW A;  5FP4 A;  2PAM A;  1IG3 A;  3NKT A;  5ANN A;  1DCS A;  2XG3 A;  3VKN A;  3WP6 A;  2A73 B;  2FMD A;  2ZAB A;  2ZZJ A;  3ITQ A;  1Y9M A;  4Q8L A;  1MQT C;  5FBZ A;  1FPN 2;  1WW4 A;  1TMF 2;  4M00 A;  1IQD C;  3WLU A;  2FCT A;  1SBF A;  3F2Z A;  2GP3 A;  4MGY E;  4AFD A;  1K5M B;  3FLT A;  4GWJ A;  3DUI A;  2BGC A;  1VB2 A;  4E8D A;  3A21 A;  3LA7 A;  4ORF A;  2WSV A;  1POV 3;  4MG2 A;  4JRA A;  1RUE 3;  2HEY F;  4IES A;  4D7S A;  2E7Q A;  2E7T A;  2HWB 1;  1O3Q A;  4L92 A;  5DQ0 A;  1PO2 1;  4BQY A;  5A70 A;  1GP4 A;  3BYW A;  4Q4W 2;  2PXJ A;  1V0A A;  1UN1 A;  3MO4 A;  4LO4 B;  5CFD A;  5C71 A;  1RXF A;  2VZQ A;  5FLJ A;  2VVF A;  3NVC A;  1YQC A;  1ZBA 3;  2MEV 2;  4QM8 A;  1UKR A;  2Q8D A;  5A3M A;  5A3L A;  3PVB B;  3PVO A;  3WF3 A;  5ABJ A;  4HN0 A;  1ULE A;  3NV2 A;  1KDM A;  1GWK A;  4LNV A;  2VQ0 A;  4IE6 A;  4QGM A;  4XF1 A;  4K9S A;  4QPY A;  1UKG A;  4Q29 A;  5HCA A;  2SLI A;  2BVV A;  4U36 A;  1V70 A;  3ZOI A;  4WM7 B;  4HT1 T;  5IAX A;  4QX5 A;  3VBU C;  1JI6 A;  2C5D A;  3O1R A;  1NA1 C;  1PO1 2;  3H9A A;  3ECQ A;  4LXL A;  4QKB A;  1UO9 A;  1NKG A;  2Y26 A;  3ZSE A;  4WBB A;  1SLC A;  2IZW A;  2EAL A;  2NLR A;  4GZ9 A;  2Z79 A;  1GWL A;  1OQ1 A;  4XIO A;  4CP0 A;  1UYZ A;  4YM1 A;  2ZGS A;  5FZH A;  3WIN E;  1Z78 A;  4EWA A;  3DEM A;  4MXV A;  4C0B A;  4UFJ A;  5C8C A;  1QMJ A;  1A3K A;  1AXK A;  2XL9 A;  3A23 A;  5FUP A;  1FT9 A;  2QDN A;  3T2Q A;  2LUW A;  1PNG A;  1FOD 2;  1OA2 A;  2BUK A;  2R04 3;  1HRV 3;  2VCM A;  2J1U A;  2RM2 1;  5LY1 A;  2CGP A;  2FDH A;  3HBK A;  5JXH A;  4YPJ A;  1W06 A;  3SH5 A;  4UW4 A;  2J1V A;  1BZW A;  2JG8 A;  4XVH A;  2MPF A;  4YM3 A;  2ZAC A;  1E5S A;  2BER A;  3LA2 A;  3R0R A;  1N1Y A;  2GMP A;  4A7Y A;  1AJO A;  5FTT C;  3N4M A;  1VRH 3;  4XUR A;  5L73 A;  2JDA A;  1HQN A;  4XQD A;  1DQ5 A;  3CNA A;  3VHP A;  4C90 A;  1YIP A;  3J8F 2;  2VQU A;  1HLC A;  4ERO A;  1OD3 A;  1JYI A;  1CJP A;  1AYN 3;  4AAP A;  4CEW B;  4ZS3 A;  2VZO A;  4KL1 A;  1RTV A;  3WV6 A;  3KCY A;  3FHI B;  1JYX A;  4TYS A;  4RFR B;  1UMI A;  3BPZ A;  4CU9 A;  2ZGM A;  1OSG A;  5FZF A;  1KRI A;  1V6N A;  2HWF 1;  4Q4Y 1;  2WYS A;  1TVG A;  3NNG A;  2XKO A;  3O1V A;  1APN A;  3POS A;  3KVA A;  5FY9 A;  5LK5 A;  3DPR B;  4CYD A;  2JG9 A;  2XBO 1;  2OPW A;  2BRT A;  3DL3 A;  3OUJ A;  4WM7 A;  3K4D A;  3QAC A;  3H7Y A;  4OMC A;  3RZH A;  1Q8O A;  3IIA A;  3B93 A;  1NCQ C;  1EP0 A;  1WCQ A;  1VBB 3;  3CLP A;  3TNQ A;  4HVQ A;  3M3O A;  3KD4 A;  5LA1 A;  3GM8 A;  1I5P A;  1PHM A;  2OQ7 A;  3TN9 2;  1LOD A;  3WDU A;  3ZO0 B;  5HCB A;  1QQP 3;  5K7P A;  3O0X A;  2HWE 2;  4NHL A;  4CUA A;  1JZ7 A;  3PU8 A;  1B35 C;  3UGF A;  3WF1 A;  4D69 A;  5CG9 A;  2IUW A;  2B42 B;  5LAS A;  2WBK A;  4OCT A;  1JYC A;  2ZS6 B;  3NNL A;  4FOW A;  2H6C A;  5BNN A;  3H3L A;  1GMM A;  4XJW A;  3S7E A;  3KWV A;  1RHI 2;  2JD9 A;  1ENR A;  1ZA4 A;  2VZR A;  1SBE A;  1J58 A;  4N43 C;  3J7H A;  1IG0 A;  4RYD A;  4JHZ A;  4QPI C;  2VL4 A;  2D7F A;  4QM9 A;  1YC6 1;  4I0W B;  3TWI A;  2ETE A;  4FAH A;  4HN1 A;  4QQ2 A;  3AKR A;  2RDQ A;  2OVU A;  1PX4 A;  1H1I A;  2RV9 A;  4O61 A;  5DDJ 3;  3O1U A;  1MS0 A;  1VBC 1;  1CD3 G;  2WO3 A;  2WT1 A;  3DKQ A;  1E5R A;  1GOF A;  1XXN A;  1H4G A;  1U12 A;  4JGZ C;  4CP1 A;  4CEW A;  3J7M A;  4XBL A;  4DIN B;  1M06 G;  2ARE A;  1SLA A;  1S2E A;  2O0O A;  4Q4X 1;  2K9Z A;  3MV1 1;  5C7G A;  5DUW A;  2RR1 3;  1YQ2 A;  1U0A A;  3AMQ A;  2YRO A;  1RUG 1;  4IV1 C;  1OBN A;  1POV 0;  3OPW A;  4MLO A;  1XYN A;  3NMB A;  1BEV 1;  4Q5O A;  3OCP A;  1OT5 A;  3DPR A;  2XJR A;  2HLE A;  2Q8E A;  2WDB A;  4IEW A;  1VBE 3;  4FPL A;  3UJQ A;  1QU0 A;  2GAL A;  4FP3 A;  5A6X A;  4UFL A;  4RQP C;  4K1Y A;  2DVA A;  2X29 A;  4AQ6 A;  4XCB A;  4EQV A;  5EFU A;  3KV5 A;  2QQN A;  1NE4 A;  1NZC A;  4FP2 A;  4Q4V 1;  4TLG A;  3ZIX A;  1W6M A;  4PLN A;  1ZZ7 A;  3VDC A;  1GQP A;  1W8W A;  2FDF A;  4BHP A;  1AL2 3;  1VBD 3;  1GP5 A;  1OQE A;  1QXJ A;  2CU5 A;  1MEC 1;  5HV0 A;  3MUY 1;  3MF6 A;  4LO5 B;  4LBO A;  3VDB A;  3WG1 A;  1DLL A;  1W8F A;  2P4E A;  5FMO L;  4MOA A;  1AF9 A;  1QJZ A;  3JQW A;  2YY1 A;  1LHU A;  3IMM A;  3T2T A;  3M3I A;  1ZM1 A;  1WUV A;  1QKQ A;  2GU9 A;  3AVR A;  1KEX A;  1MZ6 A;  4DRV A;  4TSV A;  3FMG A;  4V2W A;  1QOS A;  2Q0A A;  3CU7 A;  3LEG A;  4PLM A;  1UMH A;  5FZ4 A;  2ORX A;  2AZ5 A;  1R64 A;  1W2U A;  2KXL A;  1DYK A;  3T09 A;  1Q3E A;  2JDN A;  2JDM A;  3HQX A;  3AX4 A;  4XF9 A;  4D6S A;  1D0H A;  1Y3T A;  2LS6 A;  4AF9 A;  3O1S A;  3LOB A;  5LEK A;  2JDU A;  5F1R A;  1OOP C;  1TME 2;  1XE8 A;  3FX3 A;  2ZHN A;  4XTM A;  2G9F A;  1RUC 1;  1IPK A;  3NAP B;  1SFN A;  3H3Z A;  5JOY A;  2GNM A;  2WUH A;  2QJV A;  5L7O B;  3ZN4 A;  3WP3 A;  3HVD A;  4BDV B;  5I8Y A;  3III A;  3E1F 1;  3BUC A;  4K40 A;  1MS5 A;  4XFI A;  2FZ2 A;  1AR7 1;  2B39 A;  1GWM A;  1QGL A;  4OI0 A;  3VBF C;  4YVS C;  5FZM A;  3ZXK A;  1UU5 A;  5FQ0 A;  1CX1 A;  1VMH A;  4QDQ A;  5KC5 A;  1RUF 2;  5HBA A;  1OLR A;  1ULO A;  4FXK B;  4HFS A;  5E89 A;  3HD8 B;  3WNP A;  2XLF A;  4UI9 L;  4Y33 A;  1V00 A;  1NY7 1;  2WZR 3;  5DAW A;  4YW1 A;  3WDY A;  2BYV E;  3VBS A;  3E6C C;  3WNK A;  2FBE A;  4QXH A;  3KHB A;  4RFT 0;  4Q1R A;  3ZSJ A;  1OUR A;  3JZV A;  1LOB A;  4XAC A;  1RMU 1;  4LEJ A;  4IEY A;  3ZVX A;  2OUH A;  4LBJ A;  4PJY A;  1SMV A;  3JD7 1;  5FXZ A;  1R08 1;  1IKQ A;  3URF A;  1ACC A;  3AZX A;  1LHW A;  3BAL A;  1AR9 2;  2YZ4 A;  3CBN A;  5FZ9 A;  2DFC A;  5DUU A;  4JX0 A;  4QHZ A;  4LOT A;  5FPL A;  2DTW A;  3OD0 A;  4QKD A;  4UAP A;  3RI8 A;  4AWD A;  4GB3 1;  4V1P A;  1DZQ A;  2ZA9 A;  3VBO C;  1H2N A;  5D8A C;  1VPH A;  5CFC C;  1VE0 A;  3ZYB A;  3V64 A;  5FZ1 A;  4L0P A;  4QPG C;  3RYP A;  2GC3 A;  2ZXQ A;  3CF6 E;  4XC9 A;  3W5M A;  2ARX A;  2J22 A;  4IV3 B;  5C6C A;  2JE8 A;  1ZZ6 A;  5A1L A;  3M7A A;  1EV1 2;  2XPJ A;  3UL2 A;  5L7O A;  4XJ9 A;  3WVJ A;  2OII A;  5K0U B;  2XXZ A;  4FTE A;  1RGS A;  4LMF A;  4MV2 A;  2WYF A;  2D3S A;  5C3Q A;  1GQH A;  3R6S A;  3CJI B;  3K75 B;  4PQ9 A;  4AAX A;  2DCZ A;  3VKL A;  5E88 A;  3RZK A;  1RXG A;  2DUO A;  1COV 2;  4P5Y A;  4TTG A;  2ZGU A;  2R0H A;  1SAC A;  2P34 A;  4YZ3 A;  2E51 A;  4O7X A;  4QDR A;  3U4X A;  2HWC 1;  4IER A;  3LEM A;  3W59 A;  2ZBJ A;  4R9D A;  2E32 A;  4MGS A;  1GYK A;  1EPW A;  1UCX A;  2R30 A;  5KHJ A;  4CDW C;  3FC0 A;  1OLM E;  4QXB A;  1DQ2 A;  1XSR A;  5FZL A;  5LRS A;  2VMD A;  1PNF A;  2IXH A;  3MYX A;  4LO6 B;  4XUN A;  4YG6 A;  5JIU A;  3N3H A;  2HYK A;  5APA A;  3THT A;  2PFW A;  1U5I A;  1HIX A;  1RIN A;  4KG0 A;  3VV1 A;  1D2Q A;  2JDZ A;  2XR4 A;  3BI3 A;  4Y3O A;  3B3Q E;  5IFP A;  5EXO A;  3OBR A;  4YM2 A;  1WZX A;  4CUG A;  2R06 2;  3M3E A;  3NJV A;  2BOI A;  4ZU4 A;  5A3N A;  1ND3 B;  2QKD A;  2PAE A;  1SEF A;  1ZNP A;  5KXC A;  4B7K A;  5JIA A;  2ZGR A;  3RQ0 A;  4AG4 A;  1ZVF A;  5FIX A;  1FPN 1;  2E53 A;  4YRD A;  1TMF 1;  2V4A A;  2WQ8 A;  5F7U A;  3ES1 A;  4CDU C;  5GZG A;  1HRI 3;  4P9Y A;  2VUL A;  3D3A A;  4BQ4 A;  4GA9 A;  5T5J A;  1IZ3 A;  2CAU A;  3A0N A;  3MPB A;  1R1A 2;  1OA4 A;  2EAA A;  3VN4 A;  5KHI A;  4OHV A;  2FDK A;  1ASJ 2;  4IV3 A;  3FUO A;  5DZG A;  2W92 A;  2YC0 A;  3MHZ A;  3S7I A;  1E5H A;  3BOW A;  4XE9 A;  4XQ4 A;  4D0Q A;  2WS9 2;  3AMP A;  2XGX A;  4XEZ A;  2X53 S;  4Q4W 1;  1YI9 A;  5K0U A;  1PGL 2;  3IDB B;  4ZY9 A;  5ISL A;  3B9I A;  3E5U A;  5E16 A;  1S0J A;  2RMU 2;  2GC0 A;  5FO7 B;  3CJX A;  2MEV 1;  5FYM A;  1PM7 A;  5E1R A;  4L8Q A;  4BU2 A;  3AZZ A;  2NMN A;  4J6G A;  4J1X A;  2ZML A;  4S2F A;  2D3R A;  2DUP A;  5HV4 A;  3NWK A;  4GJZ A;  3AMM A;  3WNN A;  1W8N A;  1X7N A;  1UY0 A;  1H1A A;  1UZY A;  1C1L A;  2KA3 A;  2WNU B;  2ARB A;  4BIS A;  3RZZ A;  5J96 B;  2OUJ A;  4BOW A;  3ZXF A;  1TE1 B;  4COV A;  5F5I A;  1JOP A;  5DUV A;  3I2G A;  1PO1 1;  3MZH A;  3O1M A;  1RUE 2;  5EQU A;  5M0T A;  2GSY A;  2ET7 A;  4N90 A;  3VBR B;  4LQR A;  3DCQ A;  1O59 A;  3A4U A;  4W4Z A;  3ZIW A;  1A8D A;  3OEA A;  4YGE A;  1H0B A;  1LKN A;  1Q8P A;  5IJR A;  2RDS A;  3SC7 X;  1ZBA 2;  3PDQ A;  3QD6 A;  3RYK A;  3ZYG A;  4IGQ A;  2BV4 A;  1FOD 1;  2QQL A;  3CL1 A;  4B1M A;  1ND3 A;  2FDJ A;  4XUQ A;  4HKW A;  3E6D A;  4IUG A;  2YXS A;  1LRH A;  4EN7 B;  4QDS A;  4QHO A;  3ENR A;  3JB8 A;  3RRD A;  5B2G B;  3NKG A;  5F9T A;  5IUQ A;  2OYZ A;  5BPX A;  2WZ8 A;  3LIG A;  2Z42 A;  1YI7 A;  2XML A;  2QBX A;  5T5L A;  3WQ1 A;  1E57 A;  1NZI A;  3PJQ A;  3VZK A;  3ZKY A;  3AYA A;  3AB0 A;  4DUX A;  1QH7 A;  4N53 C;  2WAO A;  2ZZQ A;  4GD4 A;  5T50 A;  5IW0 A;  1MQT B;  1DGW X;  4GKY A;  4WVM B;  2QUO A;  5LB6 A;  2IXL A;  1R09 3;  3SCG A;  1CAV B;  1REE A;  5BUV A;  2VNV A;  2ZGP A;  1X8M A;  2A3Y A;  2HEW F;  2HYX A;  3J8F 1;  3WF4 A;  1AUY A;  4AFM A;  5BNP B;  1GP6 A;  1SHW B;  5FYU A;  5FK7 A;  4ET7 A;  1YQ6 A;  2R16 A;  3K3N A;  3EB7 A;  2A6V A;  2VE1 A;  2VCB A;  2WA4 A;  1UOG A;  3DF0 A;  4GH4 B;  5K4L A;  4NIA A;  5CAD A;  3Q8B A;  2R04 2;  1HRV 2;  3IN9 A;  4XFH A;  5IVJ A;  1G9B A;  4Z92 B;  4LK6 A;  2OA2 A;  1HDK A;  4BM8 A;  3H50 A;  4Y4Y A;  3OOX A;  2XB6 C;  1D0G A;  1F35 A;  2JDH A;  4Q4V 2;  2PAK A;  3JB4 C;  3A22 A;  4ARY A;  3AP5 A;  3TEY A;  3ZXE A;  2WNU A;  1XB9 A;  4L99 A;  4P9J A;  4EN9 B;  4QKF A;  1WBF A;  3PU3 A;  1QH6 A;  3FN9 A;  1H8T B;  2BVB A;  2FMY A;  2VMI A;  4D3W A;  1VRH 2;  2BOJ A;  3HOB A;  1K42 A;  3A0K A;  1OHF A;  2AC1 A;  4BYY A;  2VVE A;  3WP4 A;  3KF3 A;  5ACA 3;  3VBR A;  1GZ9 A;  4Y4R A;  3KV4 A;  2VME A;  1A6C A;  4QX1 A;  3TN9 1;  2A71 A;  2W1U A;  4X6Q B;  1V6M A;  1AYN 2;  3K3O A;  1LNS A;  1QJU 3;  2OX0 A;  2HWE 1;  1H9W A;  2DCK A;  4AED C;  4CEY C;  5JPN B;  5FPV A;  2IXJ A;  2VC9 A;  4MYE A;  3OY8 B;  5HI0 A;  4U2A A; 
#chains in the Genus database with same CATH homology
 1T2X A;  5DQ0 A;  3T0D A;  4ZXE A;  3VD4 A;  2L9L A;  1TG7 A;  1F4A A;  1W0N A;  3MO4 A;  5C71 A;  2VZQ A;  2CDO A;  4MAD A;  1JZ3 A;  5EJZ B;  1CIY A;  1EUU A;  3DEC A;  3LEK A;  5G04 L;  3WF3 A;  2W47 A;  2VZS A;  3T2O A;  3ACF A;  3VD9 A;  4KMQ A;  4A6O A;  1JI6 A;  1F4H A;  1PMJ X;  3ECQ A;  1NKG A;  2WN2 A;  1NAE A;  4GZ9 A;  4MO3 M;  4XZU G;  1UYZ A;  1K12 A;  2J1R A;  4TXW A;  2WZE A;  3A23 A;  2BGO A;  3T2Q A;  3WEZ A;  5I0D A;  3LPF A;  4LKS A;  3PUI A;  2ZEW A;  3HNB M;  2J1U A;  4A45 A;  3C7G A;  1DP0 A;  2W46 A;  5JXH A;  4YPJ A;  4E8C A;  4CUC A;  2J1V A;  3SEP A;  4XVH A;  1GU3 A;  4UOJ A;  2BER A;  2X10 A;  4XUR A;  1GNY A;  2JDA A;  2DCJ A;  3FHA A;  2VQU A;  1OD3 A;  3OGR A;  3UES A;  2VZO A;  2C9K A;  3WNO A;  2VR4 A;  1CZS A;  1J83 A;  2WAB A;  1UMI A;  3I2J A;  2VM9 A;  4CU9 A;  2VCA A;  5IFT A;  1UY4 A;  2J1S A;  2WYS A;  1TVG A;  3WNM A;  3NNG A;  1UYY A;  4Z2A A;  3OEB A;  1EUT A;  1JZ2 A;  2VQT A;  1PMH X;  2Y64 A;  4A44 A;  2WO1 A;  1JYX A;  3LE0 A;  2Y8K A;  3K4D A;  4OMC A;  3CKH A;  3HEI A;  4XUT A;  1WCQ A;  3EYP A;  3JXS A;  3MBW A;  5JXI A;  4DEV A;  5LA1 A;  3GM8 A;  1GOH A;  1I5P A;  3THC A;  3SEE A;  4DXR A;  2VZP A;  5CZK A;  1D7P M;  4CU6 A;  4CU7 A;  2W95 A;  1SG3 A;  5LCW L;  4CUA A;  1JZ7 A;  3I3D A;  3WF1 A;  3T2P A;  1OH4 A;  2WBK A;  1BHG A;  4A41 A;  3K4A A;  1GMM A;  4XUP A;  3UET A;  2JD9 A;  2BZD A;  2VZR A;  4DUV A;  3J7H A;  3LQC A;  4RYD A;  4ZZ8 A;  4JHZ A;  1JU4 A;  3WSO A;  2VL4 A;  5FUI A;  1J84 A;  2WAA A;  2YC2 A;  1CZV A;  2RV9 A;  3C7E A;  1KGY A;  1PX4 A;  4CVU A;  3U37 A;  2KD7 A;  2WO3 A;  4PF1 A;  1GOF A;  2W1Q A;  3OG2 A;  4BXS V;  3K46 A;  3OGV A;  3MV1 1;  5C7G A;  2VMC A;  2W91 A;  4JKK A;  1YQ2 A;  3IAP A;  1O8P A;  5JXG A;  1JYV A;  1OT5 A;  3HNM A;  2HLE A;  2WDB A;  1W9W A;  1JU3 A;  4A42 A;  1WKY A;  3A7Q A;  1US3 A;  4ZZ5 A;  3I97 A;  3ACI A;  4DEQ A;  5LA2 A;  3MUZ 1;  2VOT A;  2QQN A;  5B4X A;  2Y6H A;  2YG0 A;  1UWW A;  3VDC A;  1GQP A;  4BK4 A;  1US2 A;  5IYY A;  2QQM A;  1JYN A;  5G05 L;  3MUY 1;  2V72 A;  3VDB A;  2QQK A;  2ID4 A;  2X09 A;  4MOA A;  4DUW A;  1XPW A;  3ABZ A;  3VD5 A;  5CYY A;  1KEX A;  1O8S A;  2VCC A;  4QB6 A;  3WF2 A;  4KWU A;  3CDZ B;  2RVA A;  4A4A A;  3LEG A;  3FL7 A;  1UMH A;  2ORX A;  1K3I A;  1R64 A;  2R7E B;  3T09 A;  3UNP A;  2ORZ A;  2J1E A;  1XNA A;  3VDA A;  4OYU A;  2LS6 A;  1UY1 A;  3BN6 A;  5B4N A;  1JHJ A;  2WUH A;  2W1S A;  2Y6K A;  1ULP A;  4BDV B;  3III A;  4W50 A;  2VZT A;  3E1F 1;  1MPX A;  3I2K A;  1CZT A;  2Z4F A;  3OGS A;  3K77 A;  4W8J A;  2QQO A;  5JUV A;  1GUI A;  3BGA A;  3NQH A;  1CX1 A;  1OF4 A;  3I3E A;  4QDQ A;  1NUK A;  3CIH A;  1ULO A;  3SKV A;  4PT6 A;  3WNP A;  5EIY B;  4UI9 L;  1XC6 A;  4KI5 M;  3HPN A;  1HN1 A;  1RYY A;  3OB8 A;  2XON A;  4P00 B;  2CDP A;  2C26 A;  3WNK A;  1NX9 A;  2ZEY A;  5EJ1 B;  1JZ8 A;  2VO5 A;  2VZ1 A;  4QB1 A;  3P6B A;  1PX3 A;  4QX0 A;  3ZM8 A;  2XOM A;  3I3B A;  4HG6 B;  4JX0 A;  4RN5 A;  3AC0 A;  3ETP A;  2RJ2 A;  4QB2 A;  4UAP A;  4FI9 A;  4CUB A;  2ZEX A;  2VMF A;  3I2F A;  4L0P A;  2ZXQ A;  3CMG A;  3W5M A;  2J22 A;  2J1T A;  5JR2 A;  1L7Q A;  2JKX A;  2WO2 A;  3DYO A;  4BK5 A;  1DYO A;  2JE8 A;  3DYM A;  4JKM A;  2QQJ A;  4JKL A;  3P1I A;  2YFU A;  3W5N A;  3ACG A;  2XHN A;  3K75 B;  4ARX A;  5HXM A;  4AAX A;  4A3Z A;  5JXJ A;  2E33 A;  3ACH A;  4P5Y A;  4TTG A;  1P8J A;  1XNT A;  4QDR A;  3LPG A;  2E31 A;  2E32 A;  4MGS A;  4OUE A;  2YFZ A;  1JYW A;  2VMD A;  5LA0 A;  4XUN A;  4CU8 A;  4LHS A;  3CZJ A;  2W94 A;  3C8X A;  4OMD A;  3CQO A;  4QX3 A;  5IFP A;  2W1W A;  2YB7 A;  4P02 B;  3IAQ A;  2W9X A;  3NJV A;  4QPW A;  2EIC A;  2DDU A;  4MGQ A;  3SKJ E;  4QX2 A;  4AG4 A;  5DMY A;  4OZO A;  2WQ8 A;  1UXZ A;  5F7U A;  3WQB A;  3MV0 1;  3D3A A;  2YC4 A;  2XQX A;  3GDB A;  3C7H A;  4P08 A;  1H6Y A;  4D8M A;  2OKX A;  1GOG A;  3I2I A;  2WN3 A;  2W92 A;  1W9T A;  2Y6J A;  4D0Q A;  5HPO A;  2B4K A;  2E26 A;  1OF3 A;  2W5F A;  1L7R A;  1JZ5 A;  1UZ0 A;  4ZY9 A;  4LPL A;  5IHR A;  2ZEZ A;  4XUO A;  3T0A A;  2EIB A;  2W87 A;  1H6X A;  3NJX A;  1JZ4 A;  2B9V A;  4M4R A;  3WF0 A;  2V4V A;  3WNN A;  1W8N A;  1UY0 A;  1UYX A;  2VTF A;  3T0B A;  1DLC A;  2J7M A;  3I2G A;  1JZ6 A;  4M4P A;  5JMO A;  2Y6G A;  3HNY M;  5DN2 A;  3HJR A;  3IB3 A;  1UY2 A;  2BBA A;  4LQR A;  2Y6L A;  1O59 A;  4W4Z A;  1K45 A;  3DYP A;  3WNL A;  3OEA A;  2EID A;  3GXU A;  5IJR A;  3C7O A;  4PQQ A;  1W8O A;  2VZ3 A;  3VD7 A;  2QQL A;  3IDA A;  4XUQ A;  1W99 A;  4IUG A;  4QDS A;  2W3J A;  1W9S A;  4QAW A;  2WZ8 A;  3CZU A;  2QBX A;  4DUX A;  3T08 A;  2WAO A;  2VJX A;  4BJ0 A;  3NRU A;  5C70 A;  5A1A A;  2HYX A;  1UXX X;  3WF4 A;  5DPN A;  4DXT A;  5J1X A;  1SHW B;  3GGL A;  3LEI A;  4ET7 A;  3FHQ A;  3EB7 A;  2VCB A;  2QQI A;  3I2H A;  4ARY A;  1SDD B;  3A22 A;  3C7F A;  3THD A;  2LW8 A;  3OBA A;  1UX7 A;  1UY3 A;  3FN9 A;  4GWI A;  2V5D A;  2VZV A;  3HOB A;  1K42 A;  2VZU A;  2J1A A;  2X05 A;  2VME A;  4QX1 A;  1IQD C;  2C4X A;  2W1U A;  2BGP A;  3HN3 A;  1LNS A;  3F2Z A;  2DCK A;  2EIE A;  2PQS A;  3VD3 A;  3K4Z A;  2VC9 A;  4GWJ A;  4DXS A;  3PUH A;  4E8D A;  3A21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...