2HLEA

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
188
Chain Sequence
AGHHHHHHEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-B receptor 4
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
total genus 31
structure length 188
sequence length 188
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hleA00
2VJXA 5F7UA 4QPWA 5LCWL 2WQ8A 2Y6LA 3U37A 3AC0A 1KGYA 2VC9A 4P02B 2WDBA 3UESA 3W5NA 4L0PA 4BDVB 2RV9A 2DCKA 4QB1A 4OUEA 4CUBA 2Y6GA 2YB7A 1K42A 1PMHX 3WF2A 3HNYM 2VMDA 2VMEA 2VZRA 4QB2A 1IQDC 3MV01 3HEIA 4QX0A 3DYOA 2BGPA 3VD5A 2ORZA 5G05L 3C8XA 2YC4A 4IUGA 1SDDB 4QX1A 3DYMA 2LS6A 2J7MA 4BK5A 3WNMA 2VMFA 2W92A 4A6OA 5DN2A 3T09A 2VR4A 4MOAA 5B4XA 5JUVA 4LQRA 4D8MA 3OG2A 5JXGA 2J1TA 2XONA 4DUVA 1JYNA 4M4PA 3GDBA 3T2QA 2J1EA 2LW8A 1NAEA 3K77A 1XNAA 1TG7A 2WN2A 4XURA 3HNBM 3P6BA 2WZ8A 3HPNA 4KI5M 3SKVA 1XPWA 3NJXA 1DLCA 3CDZB 5I0DA 3VD9A 3NRUA 1K45A 2B4KA 3I2GA 1W8NA 3FL7A 3WNOA 2VZQA 3A7QA 1JZ4A 2BERA 1JU4A 1WCQA 1UXXX 2ID4A 3MO4A 4DEVA 5JXIA 1JZ7A 3IIIA 4CUCA 3VD3A 3VDCA 2W94A 3T0BA 4PF1A 3WNLA 5HXMA 2JD9A 2V4VA 1OD3A 1GQPA 3OGVA 5IJRA 5HPOA 2ZEZA 4BJ0A 4A4AA 5IHRA 2VL4A 3WF0A 3BN6A 2VZUA 2X10A 3C7FA 3HN3A 3FHQA 1WKYA 2PQSA 4YPJA 4ZZ8A 2W91A 2JKXA 5EJZB 3THDA 1CX1A 4DXRA 1UZ0A 3VD4A 3CQOA 3VD7A 2J1RA 4FI9A 1GNYA 5C70A 2QQMA 2YC2A 2KD7A 3ZM8A 2JE8A 3OGSA 2QQLA 4ET7A 1LNSA 3I3BA 4ZY9A 3UNPA 1UWWA 1JYVA 1I5PA 3IDAA 5JMOA 2OKXA 4ARXA 3MUY1 2XHNA 3WNPA 3IAQA 2Y6HA 3WQBA 4ARYA 5JXJA 3PUIA 1GOHA 2VZTA 4LPLA 3HOBA 4XZUG 2V72A 3I2HA 5C71A 3J7HA 2JDAA 3P1IA 3MUZ1 4QX2A 5JR2A 3I2FA 1JYWA 2W47A 1W9SA 1W99A 3K4ZA 4DEQA 3K46A 3WNKA 4MGSA 2W1UA 4AAXA 4XUQA 1PX3A 2QQIA 3LE0A 2VMCA 4QDQA 4P00B 2VOTA 3THCA 2YFUA 1GUIA 1O59A 1XC6A 3LEIA 4QDSA 5IYYA 4CU8A 5CYYA 1UXZA 1NX9A 2ZXQA 4ZXEA 2EIBA 4XUTA 3CKHA 1R64A 1UY1A 3E1F1 1GMMA 4JKKA 5LA0A 4A45A 1OH4A 1YQ2A 4RYDA 1L7QA 2ZEWA 2WN3A 3FHAA 3NQHA 3T0AA 2QQJA 4E8DA 2QQKA 4MO3M 3I2IA 2W87A 1CIYA 1OF3A 3VDAA 3WEZA 4CU9A 4KMQA 3CZJA 4XUOA 2CDPA 1UX7A 1KEXA 1UYZA 1DP0A 3WF4A 3A22A 3SEEA 3MV11 2VM9A 1L7RA 1UY3A 3D3AA 4QAWA 3K4DA 2HLEA 1EUTA 4QDRA 2WZEA 3I2JA 3GM8A 4JX0A 2CDOA 4UAPA 2BBAA 4JHZA 2WAOA 1RYYA 2R7EB 1ULOA 4W8JA 3I97A 1SHWB 4GZ9A 3LPFA 3I3DA 1JZ3A 3FN9A 2J1AA 2Y6KA 2E31A 3IAPA 3GGLA 5LA2A 4JKMA 1UMHA 3HNMA 3ACFA 3NNGA 5FUIA 3IB3A 2QQOA 2W46A 2J1UA 2VZPA 3LPGA 3CIHA 2XQXA 3NJVA 1W9TA 4QX3A 3A23A 3ETPA 3PUHA 1PMJX 1US3A 3ABZA 1US2A 5IFPA 4A3ZA 1CZSA 1W8OA 2VQUA 1W0NA 1H6YA 1HN1A 2Z4FA 4E8CA 1O8SA 3F2ZA 2L9LA 4LKSA 2W3JA 5A1AA 2C4XA 2WAAA 1F4AA 4CVUA 1UY2A 1OF4A 1K3IA 1XNTA 3LEKA 3W5MA 1JYXA 4MGQA 4BK4A 3I2KA 1ULPA 3JXSA 4P08A 2VTFA 3T08A 2BGOA 2VO5A 4CU6A 4QB6A 4CU7A 5DMYA 2QQNA 1JU3A 2E26A 2ORXA 3MBWA 3VDBA 2DCJA 1MPXA 1JI6A 1JZ5A 2Y8KA 4DUXA 5C7GA 3OBAA 2X05A 2C26A 5LA1A 2WABA 3WF3A 1J84A 2EIEA 4OMCA 2B9VA 3K4AA 1T2XA 4TXWA 4DXSA 3ACGA 2C9KA 1OT5A 3CZUA 2DDUA 3EB7A 2VZ3A 1K12A 4GWJA 3DECA 3GXUA 2Y64A 5IFTA 2J1SA 5DPNA 2VCAA 1P8JA 1NKGA 2WO3A 2W1SA 1GOGA 1UMIA 1NUKA 2W1QA 4OZOA 3ECQA 4Z2AA 2E32A 2W5FA 3HJRA 3OEAA 3C7OA 2V5DA 2HYXA 2XOMA 4XVHA 5B4NA 2BZDA 4M4RA 3WSOA 3OEBA 2W95A 4TTGA 4JKLA 2ZEXA 2W9XA 1BHGA 2VCCA 1DYOA 2VQTA 4OMDA 2J22A 3BGAA 3SEPA 2E33A 4A41A 1EUUA 1TVGA 4DUWA 2WO1A 2RVAA 3OGRA 4GWIA 4W4ZA 1F4HA 4UI9L 3T0DA 3WF1A 2Y6JA 4KWUA 1O8PA 4DXTA 5DQ0A 1GOFA 4MADA 1JZ6A 3C7HA 4RN5A 4AG4A 4BXSV 1JZ8A 3DYPA 3OB8A 3SKJE 2WBKA 1D7PM 4XUNA 4A42A 2WUHA 3ACHA 1J83A 1GU3A 1JHJA 4W50A 2WYSA 1UY0A 4D0QA 3T2PA 1W9WA 4HG6B 4UOJA 3C7GA 1H6XA 3K75B 2VZSA 2VCBA 4XUPA 3T2OA 2VZVA 2ZEYA 2QBXA 5JXHA 1UYXA 3UETA 2W1WA 3C7EA 4PQQA 3ACIA 2EIDA 2EICA 2J1VA 2YFZA 3EYPA 2VZ1A 2YG0A 4LHSA 2VZOA 5CZKA 2X09A 3LQCA 4CUAA 4PT6A 3CMGA 3WNNA 5EIYB 3LEGA 4OYUA 4P5YA 2WO2A 1UYYA 5EJ1B 3A21A 3I3EA 1UY4A 1JZ2A 1CZTA 4A44A 1SG3A 5J1XA 1PX4A 4ZZ5A 5G04L 2RJ2A 1CZVA
chains in the Genus database with same CATH superfamily
2A5ZA 5C3PA 5JSPA 5CKNA 3NVCA 1AR83 3FWEA 1UOFA 5FY0A 3B9CA 2VJXA 3JBG2 3V64A 1NCQC 4D94A 3UL2A 3N9LA 3MHZA 3KMHA 3CO2A 2IXHA 5E89A 4QKBA 3PUQA 5FZ0A 1QJZA 4YVWC 4QGMA 3NAPC 4K20A 4TLFA 1NA1C 1WW5A 1Q8QA 2N7GA 2WQ8A 4AEJA 3FUOA 1SPPA 2JG9A 1SDWA 2CHHA 2VC9A 1HB4A 4IXLA 5FXVA 1PO22 1O3QA 3W5NA 4OUSA 1SLLA 4TWTA 2HWF3 2X8KA 4BMBA 4C1XA 1XE8A 4BZ4A 5L7OA 2DCKA 4ES9A 5BUVA 1FPN1 1K5MA 1XE7A 5GLZA 5T5JA 3ZN5A 3ZYHA 5T55A 2YPJA 2Y6GA 1WMEA 3LAGA 4NRPA 3SC7X 4CA9A 2Q1ZB 2VVDA 3K51A 3WF2A 3GJBA 2VMDA 2VZRA 1QGLA 4RFT0 5CFDA 3R05A 5FJHA 4MGKE 4YZ2A 3CL1A 4JGYC 4DB5A 1ZNPA 1UD1A 2BYVE 4HFSA 3HEIA 5LA9A 2BGPA 2YC4A 1RUD1 3DL3A 1AR62 1ZRFA 3NKTA 4D3WA 5CKQA 2YROA 3DYMA 2VVEA 1S1AA 1VBC3 2VPVA 3UGFA 1QF3A 4BK5A 3U78A 1YC61 1LHOA 1SBDA 2OX0A 1HQWA 4QMAA 1EV13 2VR4A 4LHNA 1UU5A 2RM21 4YW1A 5FFOC 4LQRA 2D40A 4KBBA 4LTAA 4LHKA 5EJ3A 1YO8A 5JXGA 3AP4A 1FMD3 1LRHA 2BNNA 1IS3A 4AEKA 3AZZA 4L9BA 2D3SA 4MVTA 4NROA 3T2QA 1VBB1 3PVBB 4CEWB 3ZO0B 4LT5A 4AF9A 1YFWA 3H3LA 3OF1A 2WWUA 4P9YA 2WKKA 2EAKA 2VUCA 2VBBA 4UW5A 4D7SA 2WRAA 1S0BA 4IDZA 2OUJA 2E63A 2YMZA 4LUMA 5FZDA 1TMF1 2HWB3 2I74A 2Q4SA 4FCAA 4BIOA 1E57A 3FE5A 2WSVA 3AXDA 5I0DA 4XF3A 1QH7A 1ZX5A 2OT7A 4INDA 1W6OB 3NRUA 4CDWC 1W8NA 2R32A 3FL7A 4BQWA 5ISLA 3NV1A 4XQDA 2VOWA 3VBFC 4QXBA 1JOJA 1QIQA 4UF0B 3I49A 4QHBA 2VXJA 2XLAA 4S2GA 1URXA 1NXMA 4V1PA 3SISA 3RYRA 2JB4A 1PIV2 2ID4A 1NQJA 4CCEA 3KQRA 1C5IA 1O5LA 4DEVA 1JZ7A 1JH5A 2LROA 3VB9A 5J7MA 4LO5B 3ETQA 4GMP3 4MHRA 5FZIA 3T0BA 5HXMA 1IS4A 2VNOA 1EAH2 3ILFA 2XDVA 5JIAA 1WMFA 4XJWA 4CDXC 4BJ0A 1S0CA 4FOWA 1XU1A 3ORJA 4A4AA 4CCDA 3J7NA 3UYJA 1R081 1WW6A 3DUIA 2FDIA 2CSGA 3MPBA 5DABA 4EWDA 2ADEA 3WY6A 1LTEA 3WHTA 3WF0A 1UOJA 3VZKA 4H55A 3RI8A 2RG4A 1HRI2 3N9OA 4PHZA 3UV9A 3HN3A 3LFIA 1RUH3 4EV0A 2UU8A 4H7LA 4XFIA 5FYCA 4TYSA 3VZLA 3WDTA 2PQSA 5CADA 2WLPA 4ZZ8A 2Y33A 5C33A 2W91A 1CX1A 4DXRA 1UZ0A 3CQOA 5B2GB 4YGEA 4Y5SA 3ZM8A 1IS6A 3OUHA 2MHFA 1VB4A 3JBG1 1H2MA 4RS5A 1CAVB 4XFFA 1RUF3 3ZIXA 5FYMA 1LNSA 4Q4V2 5CFCB 2YU1A 1KDMA 2VH9A 3IDAA 1WWYA 1UNBA 2Y26A 2ZA9A 4ARXA 2IXLA 4N43A 4Q4X3 5FYZA 1MS9A 1IPKA 3BKZA 4JQTA 5HV0A 2RJKA 3WQBA 1RUC2 5KHKA 3VBHC 1H1MA 2CY6A 3V56A 5FQ0A 3AK0A 2V5YA 2PAKA 1C8M3 3GHNA 5FTTC 1VAKA 2XJRA 1TNFA 4LBMA 1OKOA 3D6EA 3MDPA 4GWMA 2V72A 1IOAA 4CDQC 5C71A 3GHMA 4WVVA 2JDUA 1V6OA 4L11A 1U5YA 1LEMA 4RQPA 3N9QA 1N3PA 3P1IA 5DDJ2 5A3NA 5JR2A 1JYWA 1YFUA 1DCSA 3BU7A 3SCFA 4A6SA 3WNKA 5IVEA 1WLCA 1RUG3 4LOTA 3TBDA 3N36A 1MQTC 3H7JA 3ST7A 1U12A 1O4ZA 1Z78A 4LO6B 2DURA 4RHV1 3ZFGA 4BQ1A 4O65A 3GZUC 1OC1A 1BEV2 1BVP1 2WZR2 2VMCA 5FYBA 5JDBA 3GCWA 3AL6A 4GB31 5LY2A 2VOTA 4QGNA 4IQPA 3THCA 1ND3B 3LIGA 1PO13 2GC2A 1RUNA 1W39A 1GZWA 1QJY2 1HRV2 1W06A 4QDSA 1VBE2 4DY3A 1MS3A 2JXAA 5HCAA 4YG6A 2DVDA 3J4UH 1LULA 5CYYA 2A3XA 1RUI1 3MW2A 2KR2A 2PXJA 2OQ7A 1BKZA 1UXZA 4YSFA 2WFF2 3FC0A 1J1TA 3R4UA 1PGW1 2P6CA 2RMU3 1GANA 4KWJA 1DFQA 4DMIA 1R64A 1O91A 4JQRA 3H1WA 1DQ1A 3ZFEC 3O1OA 5IVBA 3NMBA 3S5AA 4NHMA 5FK7A 2AZ5A 1R1A2 3SHRA 4XXPA 4AL9A 4KU8A 2BVBA 1DZRA 4LKFA 4FFHA 1OQ1A 3WDWA 1XYOA 5CEHA 1MZ5A 2YDEA 2DF7A 3T0AA 2QQWA 5KHJA 1I6XA 3E5XA 1W8UA 2XBO1 3I2IA 3HVDA 4FOQA 4Q4W3 4WZFA 4XPVA 3WEZA 5K7PA 4ZPIA 4XABA 5IT6A 2IXIA 4XXAA 4YWAA 4MSVA 4YM3A 1G9DA 4CYDA 4NPMA 3LDRA 2SLIA 1Q5OA 3KF5A 3WF4A 3A22A 3OD4A 4AFCA 2R1DA 3BI3A 1PVC3 1O3RA 1W9FA 3BPSA 1X82A 2MPFA 3ZYFA 4AHXA 1PVXA 1UU6A 4CZSA 2DUOA 1LU1A 4C8DA 4PDWA 4HVRA 1LOEA 1YCIA 1Q43A 3GM8A 4JX0A 1RINA 2BFUL 4YW6A 1Q8VA 3OCPA 1REFA 4QKFA 5JWPA 1LODA 1JHNA 2A6WA 1AYN3 2AR6A 1PZ8A 3NNLA 4LMFA 5FMOL 2P37A 4GZ9A 3LPFA 2IVIB 5A7WB 4R4ZA 3ZYGA 1IPSA 3H3ZA 2DTYA 4IW3A 1CWPA 3RZKA 4MH0E 1XSRA 1LAJA 3IKWA 5IK4A 3WW4A 3UJOA 2EVXA 2X5IA 1V70A 4HLTA 4JKMA 1CX4A 2QQOA 1O6UA 3BOPA 3MIEA 4UW4A 5FYVA 4AVAA 1GZ9A 5D8AB 5FZ8A 3KHCA 3N7JA 2Q8DA 3ROUA 4A7KA 3KF3A 1PO23 3A23A 4CDUC 5FWJA 2AENA 2WLQA 1V6LA 5DAXA 3ABZA 4DRVA 3N35A 5FZCA 5ABJB 1W8OA 3IDEA 3C2UA 4BIFA 2VVFA 4H2AA 1ULEA 5FZGA 3KV4A 5FLIA 4LKSA 3F2ZA 4R52A 5FCCA 3RWNA 5J98B 3WG2A 2RS31 1XYPA 4LIVA 1JN2P 2WAAA 4QPYA 3ZYBA 4LITA 4EN6B 5J37A 2FCTA 2FMYA 2VNGA 1K3IA 4YLZA 4AI8A 2DBIA 3POIA 2ZX4A 3W5MA 2D44A 1RUC1 4BA6A 1KRIA 4MGQA 2DYCA 3WUCA 5J3UA 4YGCA 1AR63 3JXSA 1Y9GA 1AUYA 3PUAA 2VTFA 4P08A 5CIRA 3URFA 4R8HA 4GIQA 4GJZA 1X9TA 3JD71 1OFNA 2E26A 2ORXA 3MBWA 4AVBA 1ZZ7A 3WLUA 4FPEA 1ND2B 1N3QA 3FBMA 1NZCA 2JG8B 3AVRA 2PAMA 4WVMB 3S0MA 3AP6A 2D6KA 2Y8KA 3FMGA 3GBGA 4A7YA 5DUXA 5C7GA 4OHVA 4NO4A 1RGSA 5LWBA 5LA1A 2YBPA 3IPVA 4FAHA 2P1BA 2B39A 2WABA 1W2OA 2I45A 2ZX0A 3WF3A 2VW2A 2ZHMA 5J96B 3WCRA 1AJKA 3AMMA 2Q30A 3GZAA 4ZKTB 2FZ2A 1T2XA 2HJIA 5SV8A 5FZEA 2HEYF 5A3WA 1U5ZA 3B5LB 4EE2A 1QDCA 5FAXA 1SPPB 2JG9B 3POSA 4P9XA 2CAVA 4OHZA 2NYYA 3WG4A 2XVKA 1OHFA 4XIKA 4MGIE 3OPTA 3WG3A 2C9AA 2D97A 5GZEA 4D69A 1AR82 1GWLA 3B02A 5JR7B 3AFKA 3IZOA 3KZ4C 3I7DA 5L7OB 1GFF2 1SQ4A 1YUDA 2AGSA 1K5MB 3EB7A 2XWBB 1VAMA 2WO7A 1GNZA 2R042 4XFCA 4Y3OA 3M2MA 1OD5A 3OPZA 1KJLA 3CEWA 3H0OA 4NRQA 4OCTA 2PHWA 5ACA1 5CFDB 5DPNA 4JHTA 5KHHA 4FFIA 1NKGA 2HWF2 5IVJA 4IV3A 3WZ1A 4BLJA 2W1SA 2PMWB 4RR3A 2DUQA 1B35A 1NUKA 1RJ8A 3GYDA 4R9CA 2XXZA 1PIV3 4QQPA 4QX7A 5F32A 2E32A 1RUE1 4XOGA 2W5FA 3U10A 1QQP1 2XOMA 1D4M2 1COV3 2WT0A 3G7DA 5I0SA 4N53A 4XVHA 1W3XA 4J6GA 2OYZA 1EAH3 2E7AA 2DCYA 4Q29A 2W95A 4TTGA 4X6RB 4JKLA 5FYIA 5FMBA 4B7EA 2JDMA 2W9XA 4IEVA 5C5UA 1XYNA 2VCCA 4AI1A 3VUOA 1ODNA 4XQWA 3P3PA 5GLTA 4Z2WA 1DYOA 5CG9A 2QVSB 1IKQA 4FO9A 3ZXFA 1HRI3 1NLSA 2GAUA 4SLIA 4QD2A 4CEWC 2E33A 4A41A 1LGBA 1HXS1 1LOFA 4QT6A 4LNVA 5A3LA 1RXGA 4GH4A 2CYFA 2R30A 4NWVA 1S2BA 2WO1A 1UOGA 2DFBA 1VMHA 5L9BA 1Z7S3 1V9U1 2EXKA 1F4HA 1HJFA 1SBFA 1H9WA 1ZM1A 4X6QB 3RYPA 1RTVA 2WNOA 4NAOA 4CCOA 2QQPA 1FMD2 1MVEA 2C6SA 1IG0A 1S0JA 2XKPA 2ZGRA 4IGQA 4XHBA 1ZBE1 4EYUA 2ZX3A 1JZ8A 3PL0A 4BXSV 3RS6A 2K2SA 3S5QA 2ZGKA 3OB8A 4N90A 1ALYA 4YGDA 5FZKA 2VG9A 2WUHA 4IL7A 4XFHA 2LUWA 3ACHA 4Q4V3 2H6CA 1GU3A 1SBEA 1VLNA 4LKEA 4R9AA 4FPFA 3BCWA 4NIGA 2W08A 3OOXA 4YM2A 5DG1A 4D0QA 1UPSA 1W3VA 2PFWA 4IGOA 5FXZA 4BU2A 2YGMA 1S0GA 3HN1A 3K75B 3K3NA 4AQ6A 3WW2A 2D6NA 4E4SA 2BBVA 1W6MA 3WQ0A 2LTNA 2XWJB 3ZSJA 2UWBA 2UURA 5HI0A 3D82A 2D6MA 2DUPA 3MIHA 4RGGA 3UETA 3PHMA 2XJTA 5H9PA 3RJ2X 4PQQA 2ZKLA 2G9GA 2EIDA 1HB1A 5DDJ3 1LHUA 1OXCA 3ES1A 5EV7A 2YG0A 4LHSA 2VZOA 2VQ0A 2X09A 2BOIA 4YG0A 4OQ8A 1MZEA 4OVEA 5DZFA 3MFAA 5GZDA 4P5YA 3NV3A 2D93A 5A33A 3HWJA 4UW3A 1UY4A 2LALA 4KWLA 1CZTA 1SG3A 1BEV3 1UIJA 2KXLA 1PNGA 2VNVA 2WQZC 2WZR3 3AFGA 2PELA 2ET1A 2RJ2A 3AM2A 4Y20A 5G04L 2DWRA 1NLRA 3E5QA 2A73B 5D2AA 2PAEA 2A7AA 1QJY3 2R0FA 4FPCA 4XF4A 1HRV3 1VBE3 3SITA 2J42A 4BHPA 5F7UA 3ZR5A 3ZXLA 1D2SA 5KXCA 3HIFA 5CFCC 1FATA 2AREA 2WFF3 5FYSA 2HWD3 4Y33A 5LCWL 4GWNA 5BXXA 2Q5TA 2Y6LA 4RS5B 4B7KA 1KGYA 3HQXA 1LCLA 2WDBA 3UESA 3PU3A 3MF9A 3WP4A 2WIIB 4L0PA 5DUVA 1LHNA 1POV3 3VBSA 2ZPXA 2RV9A 4QB1A 1UOBA 1SMVA 4N43B 1R1A3 4CXYA 2YB7A 1K42A 5CISA 3NWKA 5FZOA 5FQ0B 2DVGA 2ZAAA 1BK1A 1RUF2 2B7YA 2ZHNA 4FVVA 4HOOA 3WP5A 2JICA 2CU5A 2WNEA 4NOTA 5IWFA 2ZGLA 4QX0A 1WCKA 3ILNA 4RQPB 3E6CC 1HIXA 3VD5A 2ORZA 2O0OA 5G05L 3VHPA 1STMA 2ZACA 1SDDB 1XRUA 2HWF1 2Q8EA 4CP0A 4QX1A 5FR3A 1S0IA 4JVAA 3O1UA 2LS6A 2YXSA 3POEA 5FZ6A 1KS4A 4OZXA 3WNMA 3KQ4B 5JZGA 3E6DA 2QJVA 3ZFGB 1QHDA 2GH2A 2GMEA 3T09A 1ND3C 2Z5WA 3OGJA 5B4XA 1JOBA 4D8MA 4NR1A 2QFEA 1YFXA 1WZXA 2ZGPA 5LBFA 5C4WA 3TOJA 3QD6A 4XBNA 4DQAA 1RUG2 1GZWB 3WCSA 4KG8A 3TEZA 3KGLA 4O9GA 1JYNA 2MNGA 4M4PA 1SCSA 3B93A 5H9QA 4XW3A 1VBC1 1WD4A 3VLBB 3BTXA 4Y1YA 5D1IA 5BNOA 1NAEA 1PZ7A 1Q8OA 2RDRA 2BW8A 3DGTA 1APNA 1EV11 3OBZA 1PGSA 1S2EA 1VIWB 4CCMA 4N8MA 4BYYA 5FP8A 1W8WA 2DTWA 3SKVA 2R072 4XZPA 1FMD1 1AX1A 4QKNA 1DLCA 1OLME 1DGWA 5T54A 2IXJA 3POJA 2RMU2 2XJPA 4JC1A 4NRMA 1XBFA 2EXHA 3WV6A 1NE6A 2YZ4A 2Y0IA 2WC2A 3AJZA 2VUJA 4JTNA 1JW6A 5C3QA 1H8TA 1UZWA 3WNOA 3A7QA 5FZ7A 5DAWA 5IAVA 3JQXA 1MVQA 1SFYA 1MACA 5I0TA 3AYAA 3ZVXA 1TEIA 2OXBA 3VDDA 1DQ2A 5EWSA 2HWB1 3VD3A 3VDCA 4E2QA 5J48A 2GNMA 2W94A 5A32A 5FLJA 4B4PA 3CJIA 5A3PA 2R062 5A6ZA 5LK5A 2JD9A 1AR72 4LJHA 2OVUA 3RZZA 4M3CA 1GQPA 3OGVA 4PDWB 5HCFA 5HPOA 1W03A 5K4LA 4R4XA 4BCUA 3BTYA 5AVAA 5IHRA 4GMP0 2JJ6A 4Q0QA 2XLFA 1Y9MA 4BPZA 3VKLA 3DF0A 5LB6A 2W52A 3AYEA 1WCSA 2VZUA 1ZRIA 3VKNA 1YLLA 1FAYA 1YEWA 4R9DA 1GQHA 5DAPA 3MF6A 3ZFFA 1KXGA 1AJOA 2HEVF 4GMP1 2BFUS 2YY1A 2ZCWA 5EJZB 3THDA 1S4CA 1X7NA 4J25A 5D8AC 3VD4A 3I8TA 2X5IB 2WJSA 3VD7A 1G7YA 1YFYA 1A34A 4FI9A 4LBJA 1GNYA 2MEV3 2EALA 2YC2A 4ZHNA 1U0AA 4IEPA 2DV9A 2JE8A 5EHDA 2ZGTA 4J1WA 5ABJC 1PM4A 4KBZA 3RGBA 4OULA 3TB0A 1RUH1 3T3YA 3I3BA 4ZY9A 3WQ1A 2JX9A 1SZBA 5FXXA 4D7TA 2GU9A 4QGLA 3U75A 1RJ7A 3AP5A 1E5IA 5JMOA 2OKXA 4NHLA 2R043 4BXFA 4ITCA 4LK7A 4UFJA 1X8MA 5IAXA 1LOCA 1SLIA 3MUY1 4X8PA 2XHNA 3SQOA 3T4HB 3WNPA 4A3XA 5LZ6A 3H8RA 4CCLA 3IAQA 2WINB 5JOXA 3VV1A 2DVAA 2ZGQA 4YW3A 3POFA 4IERA 5A70A 1GOHA 3DEMA 4YW5A 1TME2 2RS13 4XJZA 4CP9A 1DGWX 1CGPA 5CAZA 1FYUA 3A0KA 1RUF1 2RE9A 5L73A 5HCHA 2JDAA 5A1LA 3I2FA 3USUA 1ND2C 4Y4YA 1W99A 1ZYBA 2IC1A 2JG8C 4DEQA 1D4M3 5F6LB 4NHKA 2PHLA 3RFRA 4YVSC 4Q4X1 2ZABA 1VBA2 3Q9OA 1PM7A 3KVBA 1J58A 3O7OA 1C8M1 4WV8A 4XUQA 3U4XA 5C9AA 3IPVB 1C28A 2QE3A 1AZDA 1GP4A 2YFUA 1GUIA 5A7QA 3IN9A 1HJGA 5JLVA 1UZYA 2JG9C 3RZHA 4AEDA 4COZA 4CU8A 5FY8A 2BVVA 3N9MA 1RUG1 4LHLA 4ASKA 3LA3A 5L7OC 3N9NA 3MW3A 5F6KA 3CHXA 2EIBA 4AI0A 1OBNA 2NMNA 2BUKA 3VBUA 1CJDA 3LSEA 4RL7A 1YI7A 4JKKA 3LIHA 3ZYRA 5T52A 5CFDC 1OA3A 4U36A 1PO11 1ULCA 3CLPA 4RYDA 3FLPA 2XVLA 5FXWA 5CVRA 3LDKA 4H14A 4NMIA 4NIDA 4F8AA 2ZEWA 4IE6A 2XL9A 2WN3A 1CIWA 3ASIA 3DPRA 5A3UA 3NQHA 4IV3B 4MX3A 2QQJA 3ZXAC 3M8LA 4RR3B 1B35B 3K48A 4E9KA 4E8DA 2RMU1 1PGL2 2W87A 2D3RA 1OF3A 1BLZA 3VDAA 4YM1A 5LATA 1UX7A 2BGCA 1UX6A 2Z42A 3PTYA 3WNXA 2OQ6A 4G4FA 4K1YA 3W9AA 2JEMA 4N53B 2G4IA 4LORA 1Q8PA 2EAAA 3MV11 4P9IA 4AFAA 2VM9A 2I07B 3DV8A 1FI2A 2JB8A 1L7RA 1F5FA 1UY3A 4CDXA 1ZRCA 2EXJA 4ATFA 1F31A 2HWE2 3K4DA 4I09A 1GP5A 3RJRA 3T1LA 1FOD3 1VR3A 1XQNA 2WZEA 4XJAA 1S0DA 2VCMA 5FYTA 3OY8A 3B01A 1COV2 4Q4W1 3RMYA 4QWNA 4TLGA 3TEWA 4GH4B 4FQZA 2WAOA 1DDLA 1W04A 1RYYA 2R7EB 4YW7A 1ULOA 4M3CF 3I97A 4FXGB 1PVC1 1W2AX 4L99A 3TNQA 2ZTNA 4RGAA 4P9WA 4PIZA 2A6XA 1JZ3A 4Y5Z0 4ZXKA 2CGNA 3FN9A 4Z07A 5I91A 5BNPA 4HK9A 1XXNA 2GNBA 2Y6KA 3PMSA 4ZU7A 1Q3EA 2TUNA 5FUIA 3HNMA 4BH9A 3ITQA 2W46A 2J1UA 3BPZA 4L97A 3NNJA 2VZPA 3IM0A 5F2SA 1J59A 4XF1A 3NSTA 3LPGA 5FRAA 1Z7S2 3CIHA 5E16A 2PHTA 1LOAA 2VY0A 3CBNA 3S30A 4XAEA 5FO9B 3PVEA 2W0XA 1AYN1 1PMJX 3O14A 4EROA 1US2A 4JAAA 4A3ZA 2AEYA 2PHRA 2ERFA 4YM0A 4NE9A 2XH6A 1NT0A 4OI4A 4D6RA 2QDRA 1YHFA 2WNVA 1W0NA 2OPKA 4QU1A 1W6MB 3A4UA 5M0TA 1QJFA 3VBHA 1W8HA 2L9LA 4PBPA 3ZIWA 4AEMA 4E8CA 1RMU2 1LEDA 1ONAA 4AGRA 1RITA 2C4XA 4B4RA 3WP6A 1DLLA 3AZYA 5A80A 1YQCA 2ZX2A 2WZPP 1PO21 2XLGA 4HKWA 4E2GA 3VHNA 3VZMA 5DUUA 4Z8BA 4BOWA 2V4AA 1BBT2 2VOVA 1BCXA 1A8DA 4BQ3A 2DCZA 1YJLA 1IQAA 1RVF2 5KHIA 5LBEA 2BGOA 1CVNA 2VO5A 2K46A 4CU6A 4QB6A 4CU7A 5DMYA 1LU2A 4QQLA 1JU3A 5A33B 3VDBA 4UFIA 2GC3A 4URAA 1S2KA 3BU0A 2DCJA 2BNOA 1MPXA 1OSGA 1YQ8A 2ZHLA 3KT1A 3M3EA 1YQ5A 5A7NA 4LBOA 4IE5A 4LO7A 1AXYA 3LB9A 4Y20B 4NPLA 5FZLA 4DUXA 2C26A 1W8ZA 3ATGA 3RSJA 4F3JA 3X29B 1VBD3 4KG0A 1AR61 2XQRA 5I8TA 3L9JT 4R9BA 2Y6FA 3UT0A 1G9CA 5LBBA 5FZHA 3ACGA 2B46X 3AYDA 3JQWA 3N3HA 5FYYA 1ZBA2 2JECA 3H1MA 1KFUL 3AVSA 5DG2A 3W58A 1H8VA 2PHDA 4E2SA 2X29A 2P2KA 4N43C 3U11A 4MG2A 1E5SA 5DAVA 1HKDA 3I3QA 4M0HA 3RWKX 3NV2A 3BIEA 1QH6A 3VBSB 2R073 1WA6X 3RMXA 4GQ7A 1JTZX 2VZ3A 2QUOA 3QLQA 2HWD2 2P6HA 3GJAA 4GWJA 4PLNA 5FZOB 5AC92 3RZLA 1KDKA 2E51A 1GLHA 4IE4A 3WX5A 4CCNA 3ZSKA 4S2HA 2P3YA 4CRQA 5A7SA 2VCAA 5JOWA 4YZ1A 2IXCA 4JTOA 3POYA 3H8OA 4Y1VA 1VRH3 1YI9A 2RHPA 4B8EA 2CV6A 1UMIA 1H9PA 2WS92 4NJ4A 2OUHA 5FP4A 4Z2AA 3R6SA 1F8VA 5LY1A 3O0XA 1OKQA 4LUKA 2PHXA 3ZFGC 2WSUA 3DKWA 2UY8A 2Y34A 2R063 1ENSA 4FP2A 5F5IA 5JZGB 1W2TA 1AR73 5B4NA 2BZDA 3HR9A 3IMMA 4M4RA 4TN7A 5FREA 2CTVA 3WSOA 1YWKA 3ZPOA 2FD8A 3C3VA 4Y4RA 3FHIB 4P14A 2Y38A 3TAYA 3ILRA 2G19A 1NYWA 3IWZA 1BHGA 4GKYA 4V2VA 5C4WB 1VAVA 4CP1A 3EMRA 5LASA 2VQTA 3QOPA 1PIV1 1KFXL 2J22A 1Y3TA 2IFWA 4CPBA 1C57A 1WBLA 2F4PA 4AVVA 4COYA 2NP0A 4ZS2A 3CF6E 5GZGA 3POBA 5FLHA 1COV1 2RVAA 3OGRA 5BNOB 4CP2A 4GWIA 5IK8A 4NHXA 1Q56A 2DVBA 5EYXA 1EAH1 2EA7A 2ZMNA 4DY5A 2AACA 4LR4A 1OOPA 1NQDA 1O8PA 3BVCA 4W6XA 2WQ4A 2E7TA 5DQ0A 5DUWA 1O4TA 3KV9A 1GOFA 4Q4Y3 2CAUA 4HZFA 5L9RA 1NLQA 3AP9A 5F3IA 4BQ4A 1WW7A 1W2NA 1WUVA 3J7MA 1QJU3 2AH2A 2LM3A 1HRI1 2P34A 1RIRA 2WBKA 1DG6A 1RL3A 4GALA 4HK8A 1D7PM 1FNZA 2UWCA 3Q8FA 4K6BA 2RS53 5LEJA 1BMV2 1EYBA 2BTVC 2GP3A 5T50A 1H8TB 1PNFA 2BOJA 4O7XA 2BPA2 1Z7S1 4HL0A 1LOBA 2JDPA 3AMQA 2I2SA 3HAGA 3POGA 4HG6B 4QQ2A 3TRSB 4NHYA 3AMNA 3WDYA 4LBLA 5F3EA 5F5CA 4AK3A 4AAPA 3AJYA 3VDDB 3T2OA 1C8NA 4EJRA 2QBXA 1TME3 3MIGA 1UYXA 2ZS6B 5A32B 1UKRA 2F4LA 4PDWC 3CJIB 3VKMA 1JXNA 1QXJA 3BALA 2W1WA 2V09A 1H1AA 4M3CB 4PIXA 1MS8A 4Q4V1 3RYKA 3EYPA 1JOPA 4PI2A 1Y43B 5FY5A 1C4RA 1LHVA 1RC6A 5F2WA 4JDMA 4WZCA 5JCTA 1GV9A 1L7LA 1IHMA 4Q26A 3WNNA 2C0ZA 4FT8A 4JDNA 4OYUA 1VBA3 2RDNA 4XFBA 1AL23 4COVA 4O9EA 1OA4A 2Y0OA 3I3EA 4UWDA 1IG3A 3ZFFB 4A44A 3KS7A 4PI0A 2X5IC 2YV8A 1W6PA 1F15A 3I2DA 3MGUA 3BUCA 1BK0A 1WGPA 1SFNA 2WNUA 2A6YA 5DDJ1 5FYUA 4MXWA 2ZKNA 5KHGA 4FPKA 2XJSA 4XAAA 3ZYJB 2W2IA 5C3RA 2PHUA 4EN9B 4XTPA 4MYEA 4MZUA 4QPWA 3JB8A 4Y24A 3KHBA 3U37A 4BQXA 3TNPB 3ME2A 2DCTA 1GZCA 4Y1ZA 3I59A 4P02B 3AKRA 4B1LA 1BEV1 2WZR1 5K0UA 1RUJ2 5FZBA 2MEV2 4LXLA 5JMCA 2JDNA 4CSWA 4CUBA 4MGTA 2NLRA 4XBQA 1QJY1 1HRV1 1VBE1 4BQ2A 4FTBA 1WLWA 2R49A 3VZNA 1QDOA 4JGZA 5APAA 1POV0 4QB2A 4WVWA 1IQDC 2GMMA 1SLTA 2HKXA 2WFF1 4CP9B 2HWD1 3MV01 3VBRA 4QPGA 1S55A 5A1FA 2D6LX 1IS5A 2RDSA 3DYOA 4E4ZA 3SXWA 3C8XA 3USUB 3V0AA 4IUGA 2E7QA 3ZXEA 1CAWA 1S0FA 4OI2A 1POV1 4WM7A 1R1A1 2ZHKA 4HONA 5F5AA 4KWKA 2RS12 1ACCA 1ZZ9A 4XYXA 5HCBA 3WP3A 2IFRA 4AI9A 2BEOA 2W92A 4FQ4A 2FQPA 1ST8A 4NVPA 5DN2A 3M4FA 2HWE3 3N7KA 4A6OA 1Y4WA 2VNRA 3WW1A 1GYKA 2WT1A 2DU0A 3QH6A 5C9AB 2ZAHA 5KXEA 2VMIA 2H0VA 5GLVA 4BMEA 5JPMB 5L36A 1G9BA 1RB8G 4OHYA 5FZ9A 2UWAA 2ZOEB 2XONA 3EO6A 4JCKA 4Z1VA 2NQYA 3DCQA 5JOZA 4AEDB 1R093 1ZRRA 5IVCA 3VHOA 3GDBA 5C6CA 2PLV2 3KV5A 4MHUA 2J1EA 1JYCA 2UYBA 4WBBA 4AHWA 2HWC2 3K77A 3ZSLA 2GH8A 1HW5A 4Q0SA 3OBTA 4QX8A 3HNBM 2FDFA 1AYM2 2WZ8A 2FDJA 2GNDA 2YUEA 3HPNA 4ISRA 5A7PA 3VBUB 3VKOA 2ZZJA 4KI5M 1AVBA 2D5HA 4EQVA 5A6QA 1YYNA 2CGOA 3KD4A 1XPWA 3NJXA 3PVOA 3E5UA 3CDZB 5IW0A 5DZGA 4RR3C 3ZOIA 1B35C 3VL9A 4QU2A 3DPRB 1JBCA 1K45A 3I2GA 3ZKYA 5I93A 1DBNA 5FDBA 3V0BA 2VZQA 1OPOA 3W21A 3D8CA 2BERA 5CG8A 4LOSA 4WM8A 1IPJA 4N53C 1JU4A 1LR5A 4N9IA 4BQYA 4FPOB 2A71A 2B8MA 5BNNA 4E27A 1RMU3 1UXXX 5F1RA 2Q8OA 1FNYA 5F39A 5FZAA 4IEYA 5A3TA 2G9ZA 3KT7A 3O0WA 4YG3A 3THPA 5FZFA 4CUCA 5LW9A 2XHKA 3LEMA 2TBVA 4JRAA 1UCXA 3T4VA 1BBT3 3WQ7A 4CDXB 4LBQA 1X33A 2V4VA 1OD3A 1RVF3 3LOIA 2ZEZA 1VP6A 1LOFC 3SH5A 4GH4C 1MEC3 3OY8B 3O1MA 5F37A 1NZIA 1CAXA 1XOYA 1N1TA 3BN6A 3DXUA 3D0SA 4FFGA 3SKJE 1XNBA 2SBAA 2VMGA 1QMJA 3FHQA 4RD7A 2XUMA 1WKYA 3ZYPA 4PQ9A 4QM8A 1FOD2 4NWWA 3OBRA 4QPIA 4AE2A 4XJ8A 4A2UA 1SEFA 4RGKA 5IATA 1ASJ2 2JKXA 1UKGA 3FZ3A 4YYOA 5BNPB 4H7MA 3GZTB 3T2TA 3O1VA 3WUDA 3M3IA 1OMIA 1TNRA 2J1RA 4YNIA 1ZBA3 5C8CA 1I1EA 5F8PA 1NY72 2VECA 3APBA 3OD0A 2DU1A 5C70A 2AUYA 2ZMLA 3ENRA 4LA3A 1X9PA 1H0BA 3KCXA 2BDRA 1UU4A 3FUQA 3LFMA 3T30A 1MZ6A 2DVFA 4NAMA 4RFRB 1BZWA 1BJQA 3H3UA 5FO7B 3UNPA 1OLRA 1UWWA 3OSDA 4OHWA 4CEYA 2OZJA 2WNVB 1NOVA 5AC93 5A6XA 1DGRA 1VPHA 3UKNA 3VBHB 1GSLA 5FP7A 3O1TA 5JXJA 5E8AA 5FUPA 4IE0A 2MEV1 3WD5A 5KC5A 2XJVA 2VZTA 5LRRA 1DF0A 4HN1A 5GLWA 4LA2A 2WS93 3I2HA 1AR81 1BYHA 2RR12 4XACA 2E9QA 5BV6A 1H1IA 3MUZ1 2A6VA 3LDBA 2ARAA 3USSA 3SNMA 4CPBD 2ZMKA 4UFLA 2YHJA 3K4ZA 3LZZA 3VBOA 2R041 3MPPG 1F5JA 1PK6A 4MGSA 1CPNA 2VTXJ 3EBRA 3S7EA 2W1UA 4XC9A 5C8WA 4OLLA 1W28A 3EQEA 5H9SA 3CU7A 3O12A 2BNMA 2RS11 1PMIA 2QQIA 3IIAA 3LE0A 2WFPA 4JZRA 5E1RA 5FK8A 2ENRA 4P00B 5H9RA 3AB0A 1AR93 4FOYA 2QDNA 1FPN2 2NZ9A 4KH9A 5FY9A 1LB2A 3RG0A 3ZX7A 4EZHA 4IEQA 5EXOA 1D4M1 2XL7A 2VW1A 3CNAA 3POWA 3FLTA 3ZXKA 4XF9A 3TEYA 3QH7A 4FPGA 2ZXQA 3N4MA 1V00A 3NNMA 4ZXEA 2RDQA 1VBD2 4XCBA 1J3QA 4XUTA 2XUEA 4M01A 4IEWA 4C90A 3I2OA 2KM2A 1I3HA 4BWOA 1T6BX 3WXPA 5ANNA 2C5DA 3TN93 5IK7A 4LULA 4P9GA 3FHAA 4XMAA 1HQNA 4CUGA 5DAQA 2RM22 1DYKA 1MS1A 4TSVA 5TSWA 5FYHA 1E5RA 2NM1A 2QQKA 4O61A 5CKMA 1NCRA 1CIYA 4EZ4A 2ARBA 3AP7A 3AKSA 4XUOA 2CDPA 5JZGC 4G9SB 1TZOA 2ZBJA 3HBKA 1ENRA 2X53S 4V2WA 2ZX1A 3U1XA 4P5HA 1CN1A 1CPMA 1UYZA 2A6ZA 1DP0A 4BE3A 1L3JA 5KR7A 2QKDA 3SEEA 2A1XA 4UBGA 1VRH2 5C4WC 5D21A 5K8SA 4AI3A 3IDBB 1VALA 1WCDJ 3GNEA 1UL9A 4QAWA 2HBUA 2Z69A 4L2NA 4NIIA 3R4SA 5FZ4A 3AKTA 3F95A 4QDRA 3I2JA 3P5BA 2NPIA 1OQDA 1QJEA 1UIKA 2VTXA 4H3WA 1TMF2 4UBHA 1V6KA 4MLOA 5BNOC 1RXFA 2BBAA 1CR7A 1ULGA 2C1FA 1ZZCA 4Y26A 5FPXA 1OVPA 1D0HA 2A3YA 2QCSB 3M3CA 4W8JA 1SHWB 1MR5A 4XBLA 3FLRA 2JE7A 3I3DA 4IV1A 1OOPB 4META 1QNWA 4AVTA 3BTZA 1ENQA 1LKNA 3WW3A 2J1AA 3WDUA 5LA2A 1UMHA 3NNGA 1REDA 2D43A 1FOD1 3KCCA 5K9YA 3WR0A 1H8TC 4NUBA 3ZR6A 4QX3A 1OLMA 3NJVA 4ES8A 1NCQA 2IZWA 3PUHA 4SBVA 1RUJ3 5IFPA 3MEPA 4YVWA 5FMOS 3NAPA 4Q4Y2 3VDDC 1NA1A 2CWSA 3I54A 1N47A 5EZWA 1R082 4GAZA 2Z4FA 1QJU2 3MLLA 3CJIC 1QOSA 1O8SA 2PA7A 2BU9A 1N1VA 2QTWB 1T6GC 2RS52 1QKQA 2VOKA 1CAUA 2D98A 4XE9A 4CVUA 3UGGA 3VZOA 1OF4A 2D5FA 3PMEA 1XNTA 3SH4A 4K9SA 1JYXA 4CCJA 1GR3A 3I2KA 1ULPA 3ZN6A 3T08A 1KITA 4JGYA 5FY1A 3EJKA 3B3QE 2TEPA 4YVSA 4ATEA 3RPQA 4XHXA 4MGYE 1W2UA 2QQNA 4OHXA 1JYIA 1K5JA 1TE1B 2PQQA 4ASLA 1G9FA 2A75A 3RRDA 3ZXJA 3ZDVA 5L9VA 4AW7A 1H30A 4FP3A 1KS5A 1XNDA 1YNAA 1JZ5A 3AL5A 4CE8A 1W6PB 4K7JA 3RNSA 2PTMA 3B69A 4JDOA 5FP3A 2YYOA 3RZJA 4LE3A 3OBAA 1SLCA 2WNUB 4XDQA 5FUNA 4MXWB 3NJYA 5IK5A 2OW4A 3FJSA 1XNKA 2EIEA 3P3NA 2B42B 1AL22 2GC0A 3QCWA 4OMCA 4AYUA 3J8F3 4F83A 2ZGMA 2QZ3A 1FV2A 1TQ5A 1EP0A 2PLV3 3UKVA 4DXSA 3MIFA 5GALA 4S2DA 3UKTA 1BVVA 2WL1A 2HWC3 2YBSA 1O3TA 1W6NA 1F9KA 1OT5A 3I59B 4U2AA 2H6BA 5AVPA 1AYM3 5GZFA 2O8OA 3O1PA 4HKLA 5K0UB 5LK7B 4YW4A 3CZUA 4XF0A 3CJXA 3RZMA 1REEA 4UFMA 2W39A 4PF5A 2VW0A 1VBD1 1K5MC 3AZXA 3DECA 3KSCA 4AGGA 1EPWA 2Y64A 1N3OA 2WT2A 3HT2A 4JGZB 4QHZA 5IFTA 1QJX3 4LBQD 1AHSA 4RHV2 3VBRB 5KXDA 1P8JA 4QPGB 5GJ6A 2WA4A 1XSQA 4QX5A 2A70A 2WO3A 3Q8BA 3SH3A 1UZZA 4K40A 4PBOA 3W59A 2XVGA 4GB32 1PHMA 3V0AB 3ECQA 3RDIA 4CDWA 3KWVA 1CAWB 3GBFA 2R071 3HJRA 4WM7B 4GULA 2JDHA 3VBFA 3H42B 5FZ1A 3PJQA 3OEAA 3C7OA 2V5DA 2HYXA 4UW6A 5CNAA 5C9AC 4LKDA 2VD7A 4PJYA 1RUI2 5SV5A 3PURA 4B3NA 3FFQA 3U07A 4QQOA 3NV4A 4DIQA 1PGW2 1GP6A 2ZEXA 2VE1A 3PIJA 1YQ6A 3IT8A 4HBNA 4AEDC 4K8RB 2JDYA 1VRH1 4B29A 3J9SA 4IETA 1F35A 1LECA 4BLIA 4DZGA 1FX5A 1RHI3 3SEPA 3V65A 1EUUA 1VMFA 3T1MA 2RJLA 1WMXA 1AXKA 1Q8SA 2AC1A 4DUWA 4DFSA 3VBUC 1GBGA 2FZ1A 2R061 3WDXA 3D5OA 1AR71 1ASJ3 2UYAA 3T0DA 1G9AA 2BWCA 2Y6JA 1CESA 2XBO2 4FXKB 4J1XA 2DBNA 4KL1A 4FPJA 4KWUA 1UYPA 4I3GA 1R092 4XMIA 4MADA 1JZ6A 3DPRC 3C7HA 4AG4A 2R16A 1LOGA 3DYPA 3QACA 4YFZA 2Y60A 4XUNA 4YZ3A 3WDVA 4DINB 4A7ZA 3V0BB 3IMNA 3JB4C 2JENA 4W50A 1KQRA 5FV3A 3PUSA 4LO8A 2YC0A 2OA2A 4OFGA 4WM8B 3L2HA 1H6XA 1U5IA 3ZN4A 2VZSA 3ZSMA 5BNNB 5A3MA 1O5UA 4Q4Y1 3I3MA 4XUPA 1CONA 4PCRA 2VZVA 5F5QA 5LEKA 4HANA 5FBJA 5JXHA 3ON7A 2VOXA 1DGRN 1W9YA 1QJU1 3ZSEA 4BQ5A 3C7EA 3SLIA 2RR13 2GZWA 4LBQB 4ASMB 2RS51 5L19A 1ZZ8A 2J1VA 1MZFA 4FPHA 5CZKA 5HV4A 4Q0PA 3LQCA 4GD4A 1OVSA 5FKBA 4CUAA 1CAXB 3LSDA 4CDQA 5EIYB 2WO2A 1WLTA 1ODMA 1V6NA 2P3KA 1JZ2A 1MS0A 4FTEA 2VGDA 5BNPC 3GZEA 1TME1 4OQ9A 3LF7A 3OYWA 4Z82A 4QPIB 1Z0HA 1PX4A 3AMPA 2AYHA 2IXKA 4ZZ5A 1DZTA 4EWAA 5F3CA 1GKBA 1MEC2 4CXXA 3PLQA 1MQTA 1OUSA 1FPN3 4LLOA 4XCAA 4URTA 4Y22A 4TZDA 1F2NA 2YPDA 2G1MA 3UK9A 1FXZA 5C8CB 1G6NA 2JDKA 3EHKA 3HMYA 3K2OA 3OGGA 4G3YC 2ET7A 3VN4A 2A3WA 2RS32 4W6YA 1VBA1 4Q8KA 1W6QA 3U14A 1AL21 1M4WA 1OFSA 4GKXA 4L8QA 3AC0A 2WNVC 1WA4A 4DRRA 1V6MA 3FFZA 1X50A 3NO8A 5T5LA 4HPKA 4RS5C 1VMJA 4CEYB 1RUD3 2XPJA 4D6QA 2XB6C 4YZ4A 4BDVB 3H1YA 4OUEA 2JIGA 3HBZA 2GP5A 1OA2A 2HH9A 1VRBA 2WA3A 1HB3A 4Q2FA 4XETA 3JD72 5FKCA 1O4YA 1PMHX 4PLMA 2CGPA 1C1LA 1CJPA 1LENA 4IEOA 3HNYM 4LE4A 2VMEA 3VKFC 4QHOA 3HQUA 2RM23 3N7LA 3NKGA 2OIIA 3ZFEA 3AKPA 4JRLA 1O3SA 5T3NA 5FPBA 4IGPA 5FZMA 4HVOA 3H8XA 3LA2A 4GJYA 2TNFA 2NMOA 4RQPC 3E97A 3VBOB 4ORFA 1YRZA 2P3JA 4N7IA 1PK6B 2Q1FA 5C3OA 2VMHA 5FOJB 1VBB3 4Q1PA 2J7MA 4AQSA 4HVQA 2VMFA 1V6IA 1MS5A 1WCUA 2VBDA 3MLJA 1ZVFA 4MOAA 5JUVA 5DZEA 4MUVA 3TEXA 1GZTA 3ZKUA 1PGL1 3Q8EA 2E53A 3PDQA 3OG2A 1A78A 4YW2A 1TMF3 4I0WB 3M1HA 4KQ7A 2D6OX 3KVAA 3ZPYA 2J1TA 3IDCB 4DUVA 2G9FA 2D7FA 1O7FA 3PTRB 5ACA2 1M06G 4Y1UA 3IBMA 1OUXA 2LW8A 1IKPA 1R1ZA 3R4DB 5FWEA 4W6WA 3S7IA 2LRPA 1NXD1 1XNAA 1TG7A 2HWE1 1AR92 1SFPA 2WN2A 4XURA 2BWAA 3P6BA 2ZGUA 4ISQA 5A7OA 1WW4A 4B4QA 4MXVA 1RUE2 4XDOA 1J1LA 1AX0A 3OUIA 3ZXDA 1C1FA 2JWPA 1QQP2 4GA9A 3KB5A 5A3OA 5J09A 1X36A 5J36A 1XNCA 5A6YA 3VD9A 1R091 4YZ5A 4BB3A 2YBKA 4UFHA 2B4KA 4ZU4A 4XDPA 4QXCA 3OUJA 3KLSA 1AX2A 5ERLA 5I8YA 3H7YA 1V0AA 4XJUA 5JI9A 1POQA 4IEXA 1R083 1NCRB 1JZ4A 3QBQA 4IEZA 4Q0VA 4CDUA 2GC1A 2C24A 4UT5A 4AZZA 4I3PA 1WCQA 1SLBA 2K9ZA 3VZJA 3AXEA 3AMHA 4YFWA 3MO4A 3TN92 5JXIA 1HXS2 4UYBA 4CCCA 3JU9A 3IIIA 4YRDA 5IVFA 4D7YA 3KGZA 3MFCA 4IEUA 1DQ0A 4PF1A 5EPAA 1NG0A 3WNLA 5BY5A 1N1YA 1V9U2 3PNAA 3RVHA 1YIPA 3RQ0A 5EYYA 2GN3A 5IJRA 5FP9A 1QXRA 2ES3A 2XG3A 1N1SA 4K1ZA 1ZBE2 4XJ9A 2YU2A 1GICA 4YARA 2VL4A 3LCPA 4XFAA 4C0BA 3B94A 3JBG3 1RMU1 2OS2A 2X10A 3C7FA 3GCXA 3KV6A 3Q8AA 1UAIA 3SCHA 3WINE 1OOPC 2E6VA 2ARCA 5I0RA 3O1SA 1UO9A 3N7MA 4AVSA 4AI2A 4I02A 4P9JA 4YPJA 4IV1B 3LKJA 1BBT1 1YIFA 2Z79A 4AQ2A 4AR2A 4I30A 4AVCA 1RVF1 1JS9A 5HBAA 4K3UA 2QQVA 1W90A 5F3GA 1NE4A 1ULDA 2DFCA 2VUDA 2VAUA 1MEC1 3B00A 2QQMA 2KD7A 2B5HA 5FPLA 1Y9QA 3HT1A 3OGSA 4GXLA 1NCQB 5JI7A 2QQLA 4ET7A 1YXWA 4N9HA 4YVWB 3NAPB 2UY9A 1NA1B 3ACLA 1JYVA 1I5PA 2VBPA 2VXRA 4X8NA 4XIOA 3BIWE 2GSYA 3AKQA 5CA6A 4AFMA 4FSJA 2QZ2A 1CAUB 2Y6HA 4ARYA 5FBZA 1ZBA1 1ENXA 1JUHA 4Q0UA 4RHV3 4RSUA 3PUIA 1W8FA 5AFBA 3ZMOA 5JSRA 2H0BA 4DXZA 4LPLA 5JPNB 1XE0A 2BRTA 3HOBA 2B9UA 4KNCA 1J3PA 4L92A 4GB33 4XZUG 4Q27A 1JUIA 3J7HA 5KWRA 4E4DX 4C1WA 3ZN6B 5FOBB 2GDFA 4JGYB 4QX2A 3WG1A 4I2OA 2W47A 1W9SA 4YVSB 1YJKA 2GN7A 1WBFA 4IE7A 3ZLIA 3K46A 1B09A 5AC91 1RUI3 3S6PA 3VHRA 1MS4A 2WNUC 4AAXA 3FX3A 5FJKA 1HX6A 1W0PA 4N7UA 1SCRA 1FV3A 5LBCA 3D4KA 2BQPA 1S0EA 1PX3A 2IWGB 2P3IA 4LLFA 1C5HA 3O0VA 1AXZA 4QDQA 3DXTA 4M0NA 4AGVA 3UJQA 2WS91 1ZZBA 1H2LA 3BTAA 1G8WA 3RI9A 1O59A 1XC6A 4I01A 2XGXA 2ATFA 3DKQA 1V6JA 3LEIA 1XU2A 1I9RA 2P4EA 5IYYA 2ZGNA 2W68A 1W6NB 1HLCA 2QNKA 1E5HA 4I0BA 5K0UC 3RZGA 1NX9A 2ZZQA 4MV2A 2OPWA 2CL2A 3M70A 4KGGA 4CEWA 4EWEA 2XBO3 4AWDA 1H2KA 4AHZA 1LGNA 2ZGOA 3CKHA 3J8F2 1UY1A 3E1F1 4C91A 1GMMA 4JGZC 5LA0A 1OI6A 4HT1T 4A45A 1JMUB 3LOBA 1OH4A 1AR91 1YQ2A 3VBRC 4QPGC 4S2FA 5GLUA 5DXDA 1L7QA 5T5OA 3TYJA 2FMDA 5IVYA 5CB7A 1W6OA 3OTFA 3Q8CA 4P9LA 1UPIA 4Q1RA 4XFGA 4WM7C 4XQ4A 4MO3M 4XEZA 4IV3C 1D2QA 4CDWB 3O1RA 2HYKA 4UF0A 4CU9A 4KMQA 3CZJA 1OURA 2D6PA 1OLQA 2XMLA 1KEXA 1IZ3A 3VBFB 4F7ZA 1HQLA 4HN0A 1QJX2 4HMZA 2IVJA 4Z92B 3W20A 1VBC2 3BOWA 4KU7A 4HXCA 4OUMA 4FTSA 1BMV1 3TN91 2FCUA 3FBYA 4HSJA 3D3AA 4W65A 3VGIA 1EV12 1QEXA 1QY4A 3H50A 2HLEA 1DQ6A 1EUTA 4FOVA 1D4VB 4UXAA 1ZREA 2BJSA 2CDOA 3TWIA 2NN8A 4UAPA 4NN0A 1EPZA 1ZZ6A 1DIWA 2XJUA 3H8UA 4B1MA 3NL1A 4JHZA 5FPUA 1DU3D 4FPLA 1H2NA 2ADDA 1A6CA 3DN7A 4D6SA 5I8SA 5EP9A 4BM8A 3ES4A 1I5ZA 2JDZA 2Z2SB 2HBTA 1ZA7A 1LJ7A 3KM5A 3BB6A 1RHI2 2E31A 1UMZA 3IAPA 3GGLA 4WVZA 4M00A 3ACFA 4BISA 1KJRA 2RS33 2JE9A 3IB3A 5CBLA 1GWKA 4AOCA 4FBFA 3MI8A 2HWB2 2XQXA 1W9TA 1EY2A 4XILA 5JVVA 4WM8C 2Q8CA 1RUC3 3PVNA 3ZMNA 2ZJCA 3ETPA 2K0GA 4LEJA 5FPVA 1UN1A 1CAVA 1US3A 2WYFA 4PIYA 5BNNC 1BQPA 5CFCA 3L2YA 3M7AA 4EN0A 5BPXA 5AFEA 3U0ZA 2FDGA 2BV4A 1CZSA 5FPZA 1QWRA 2VQUA 3MIDA 1ULFA 1H6YA 2ILMA 1HN1A 2OZ6A 3JD73 4RA0A 1A3KA 1HB2A 1PZ9A 3LD8A 2GMPA 2W3JA 3ZYIB 4DO0A 3AZWA 5A1AA 1F4AA 3PJYA 2FCVA 1UY2A 1KD7A 3INAA 4LBKA 1J3RA 2R1BA 4C0HA 1W0OA 1GWMA 3LEKA 4QQHA 5FPAA 4BK4A 3UGHA 2AEZA 5BYNA 1HN0A 1A8MA 5EFUA 1RUJ1 4I0AA 4KGQA 3THTA 1X8EA 1HDKA 4CDQB 4UFKA 4HSLA 4XTMA 4DPNA 4QPIC 4COUA 2PYTA 5E6HA 3G6JB 4FPYA 3AZVA 1VJ2A 1JI6A 3BODA 3OYWB 1CD3G 1RUH2 3LGRA 3KT4A 2JD4A 3D0JA 5C8CC 1MQTB 2XKOA 3J7LA 1W8TA 3GALA 4Y22B 2X05A 3ZXGA 1WMDA 4AHYA 4QKDA 1J84A 2ARXA 5C5TA 1ND3A 1BXHA 2B9VA 2XJQA 3K4AA 4K21A 5F9TA 3PU8A 3ZDSA 3WVJA 4K8FA 3JUUA 1DQ4A 4TXWA 2Q0AA 4LIUA 3OPWA 4Y1XA 2C9KA 4YGBA 1W6QB 5ACA3 4LO4B 1OPMA 4Q8LA 3WT3A 1LESA 4CEYC 1RUOA 3GF6A 1FT9A 2JKBA 3H9AA 3R0RA 1ZRDA 3OJBA 3NJZA 3K3OA 5C3SA 4HPKB 4ZS3A 4ONUA 4E4HA 1RUE3 4AFBA 2CWMA 4HETA 2B45X 4AQTA 5IVVA 2DDUA 2QQUA 1QQP3 5FO8B 1K12A 3VBSC 1D0GA 3WOGA 1WD3A 2P17A 4Q5OA 2VQAA 3J8F1 5KBFA 4MGZE 3WHUA 2CNAA 3GXUA 4Q4X2 1UF2C 2KA3A 2J1SA 2PLV1 5ANQA 2O1QA 2Q1MA 3ZFEB 2VULA 2EF6A 1RUD2 2HWC1 1C8M2 5FY4A 4QXHA 5JOYA 1LHWA 3VBOC 2FHRA 1H4GA 5I0UA 1C3HA 1AYM1 1GOGA 1PK6C 2W1QA 4OZOA 4DOUA 1DZQA 4Y5TA 2FBEA 2WR9A 2PN5A 5JAXA 5FIXA 1HXS3 3N9PA 2FDHA 3AYCA 5GKAC 4HKOA 1QNYA 5JSOA 1V9U3 1H4HA 1LGCA 4QM9A 3NW4A 3OEBA 1QJX1 4M3CE 3BYWA 2F6BA 3U4SA 3LA7A 2BP6A 2F17A 1QOTA 4AXOA 4AFDA 5FY7A 1ZBE3 3ALQA 2EIGA 5IUQA 3I4IA 1VBB2 4OMDA 3MW4A 2ETEA 3MYXA 2O8QA 1UZVA 1AL0G 1GNHA 1GQGA 1PO12 1UQXA 3BGAA 3HQRA 3KCYA 3MLKA 1ZA4A 1TVGA 2IUWA 5LRSA 5FMDA 3GBWA 5KXBA 1QU0A 2VU9A 3B9IA 3MIBA 2V73A 4W4ZA 3MZHA 4UI9L 5CU1A 2WWJA 5A7WA 1QXPA 2HEWF 4NIHA 1DGLA 3WF1A 1OQEA 3JCIA 4CXWA 1JYTA 2ZGSA 4DXTA 1SACA 1IGOA 2GALA 3AX4A 3JZVA 5EQUA 2GNTA 2VUAA 3SCGA 3NNFA 4QXKA 4RN5A 5T5PA 4COWA 5KC6A 1DHKB 4FAGA 1JODA 2PHFA 1DYPA 5D8AA 4DS0A 1RHI1 2EXIA 3LWCA 4A42A 5GM0A 1NCRC 2O14A 5E88A 4PLOA 1J83A 1JHJA 2WYSA 1UY0A 1OH3A 1CQ9A 3O5SA 3T2PA 1ASJ1 3S57A 1W9WA 4LK6A 5GZCA 1AF9A 5BNQA 4UOJA 4CDUB 3C7GA 1UW8A 5ABJA 4OI0A 2VCBA 1Y7BA 4Q4W2 4OI1A 2D3PA 1NY71 2ZEYA 3M3OA 4ZU5A 1WLDA 4CCKA 3E6BA 4EN7B 3ELNA 1XB9A 2R6QA 3SMHA 2R0HA 1PVC2 3ACIA 1U5XA 3VL8A 2YGLA 2EICA 2YFZA 3B7MA 4NPRA 2VZ1A 2WWSA 4FFFA 5FZ3A 4DNYA 1HV0A 1W05A 3EXUA 5HXVA 1G86A 5JIUA 5FMCA 3A0NA 1XJAA 2JIJA 3HD8B 1SLAA 3J26N 1DQ5A 3CMGA 4PT6A 1QOOA 3LEGA 4ZONA 4LBNA 4CTEA 1UYYA 2XR4A 3A21A 5EJ1B 4EN8B 4IV1C 4IESA 1HV1A 1ND2A 2FDKA 2JG8A 4NIAA 1VE0A 4WVMA 5J1XA 2P5BA 1AYN2 4JV4A 3PIGA 3ZFFC 3M3QA 1VB2A 2RR11 1CZVA 3MICA
chains in the Genus database with same CATH topology
2VJXA 5F7UA 4QPWA 5LCWL 2WQ8A 2Y6LA 3U37A 3AC0A 1KGYA 2VC9A 4P02B 2WDBA 3UESA 3W5NA 4L0PA 4BDVB 2RV9A 2DCKA 4QB1A 4OUEA 4CUBA 2Y6GA 2YB7A 1K42A 1PMHX 3WF2A 3HNYM 2VMDA 2VMEA 2VZRA 4QB2A 1IQDC 3MV01 3HEIA 4QX0A 3DYOA 2BGPA 3VD5A 2ORZA 5G05L 3C8XA 2YC4A 4IUGA 1SDDB 4QX1A 3DYMA 2LS6A 2J7MA 4BK5A 3WNMA 2VMFA 2W92A 4A6OA 5DN2A 3T09A 2VR4A 4MOAA 5B4XA 5JUVA 4LQRA 4D8MA 3OG2A 5JXGA 2J1TA 2XONA 4DUVA 1JYNA 4M4PA 3GDBA 3T2QA 2J1EA 2LW8A 1NAEA 3K77A 1XNAA 1TG7A 2WN2A 4XURA 3HNBM 3P6BA 2WZ8A 3HPNA 4KI5M 3SKVA 1XPWA 3NJXA 1DLCA 3CDZB 5I0DA 3VD9A 3NRUA 1K45A 2B4KA 3I2GA 1W8NA 3FL7A 3WNOA 2VZQA 3A7QA 1JZ4A 2BERA 1JU4A 1WCQA 1UXXX 2ID4A 3MO4A 4DEVA 5JXIA 1JZ7A 3IIIA 4CUCA 3VD3A 3VDCA 2W94A 3T0BA 4PF1A 3WNLA 5HXMA 2JD9A 2V4VA 1OD3A 1GQPA 3OGVA 5IJRA 5HPOA 2ZEZA 4BJ0A 4A4AA 5IHRA 2VL4A 3WF0A 3BN6A 2VZUA 2X10A 3C7FA 3HN3A 3FHQA 1WKYA 2PQSA 4YPJA 4ZZ8A 2W91A 2JKXA 5EJZB 3THDA 1CX1A 4DXRA 1UZ0A 3VD4A 3CQOA 3VD7A 2J1RA 4FI9A 1GNYA 5C70A 2QQMA 2YC2A 2KD7A 3ZM8A 2JE8A 3OGSA 2QQLA 4ET7A 1LNSA 3I3BA 4ZY9A 3UNPA 1UWWA 1JYVA 1I5PA 3IDAA 5JMOA 2OKXA 4ARXA 3MUY1 2XHNA 3WNPA 3IAQA 2Y6HA 3WQBA 4ARYA 5JXJA 3PUIA 1GOHA 2VZTA 4LPLA 3HOBA 4XZUG 2V72A 3I2HA 5C71A 3J7HA 2JDAA 3P1IA 3MUZ1 4QX2A 5JR2A 3I2FA 1JYWA 2W47A 1W9SA 1W99A 3K4ZA 4DEQA 3K46A 3WNKA 4MGSA 2W1UA 4AAXA 4XUQA 1PX3A 2QQIA 3LE0A 2VMCA 4QDQA 4P00B 2VOTA 3THCA 2YFUA 1GUIA 1O59A 1XC6A 3LEIA 4QDSA 5IYYA 4CU8A 5CYYA 1UXZA 1NX9A 2ZXQA 4ZXEA 2EIBA 4XUTA 3CKHA 1R64A 1UY1A 3E1F1 1GMMA 4JKKA 5LA0A 4A45A 1OH4A 1YQ2A 4RYDA 1L7QA 2ZEWA 2WN3A 3FHAA 3NQHA 3T0AA 2QQJA 4E8DA 2QQKA 4MO3M 3I2IA 2W87A 1CIYA 1OF3A 3VDAA 3WEZA 4CU9A 4KMQA 3CZJA 4XUOA 2CDPA 1UX7A 1KEXA 1UYZA 1DP0A 3WF4A 3A22A 3SEEA 3MV11 2VM9A 1L7RA 1UY3A 3D3AA 4QAWA 3K4DA 2HLEA 1EUTA 4QDRA 2WZEA 3I2JA 3GM8A 4JX0A 2CDOA 4UAPA 2BBAA 4JHZA 2WAOA 1RYYA 2R7EB 1ULOA 4W8JA 3I97A 1SHWB 4GZ9A 3LPFA 3I3DA 1JZ3A 3FN9A 2J1AA 2Y6KA 2E31A 3IAPA 3GGLA 5LA2A 4JKMA 1UMHA 3HNMA 3ACFA 3NNGA 5FUIA 3IB3A 2QQOA 2W46A 2J1UA 2VZPA 3LPGA 3CIHA 2XQXA 3NJVA 1W9TA 4QX3A 3A23A 3ETPA 3PUHA 1PMJX 1US3A 3ABZA 1US2A 5IFPA 4A3ZA 1CZSA 1W8OA 2VQUA 1W0NA 1H6YA 1HN1A 2Z4FA 4E8CA 1O8SA 3F2ZA 2L9LA 4LKSA 2W3JA 5A1AA 2C4XA 2WAAA 1F4AA 4CVUA 1UY2A 1OF4A 1K3IA 1XNTA 3LEKA 3W5MA 1JYXA 4MGQA 4BK4A 3I2KA 1ULPA 3JXSA 4P08A 2VTFA 3T08A 2BGOA 2VO5A 4CU6A 4QB6A 4CU7A 5DMYA 2QQNA 1JU3A 2E26A 2ORXA 3MBWA 3VDBA 2DCJA 1MPXA 1JI6A 1JZ5A 2Y8KA 4DUXA 5C7GA 3OBAA 2X05A 2C26A 5LA1A 2WABA 3WF3A 1J84A 2EIEA 4OMCA 2B9VA 3K4AA 1T2XA 4TXWA 4DXSA 3ACGA 2C9KA 1OT5A 3CZUA 2DDUA 3EB7A 2VZ3A 1K12A 4GWJA 3DECA 3GXUA 2Y64A 5IFTA 2J1SA 5DPNA 2VCAA 1P8JA 1NKGA 2WO3A 2W1SA 1GOGA 1UMIA 1NUKA 2W1QA 4OZOA 3ECQA 4Z2AA 2E32A 2W5FA 3HJRA 3OEAA 3C7OA 2V5DA 2HYXA 2XOMA 4XVHA 5B4NA 2BZDA 4M4RA 3WSOA 3OEBA 2W95A 4TTGA 4JKLA 2ZEXA 2W9XA 1BHGA 2VCCA 1DYOA 2VQTA 4OMDA 2J22A 3BGAA 3SEPA 2E33A 4A41A 1EUUA 1TVGA 4DUWA 2WO1A 2RVAA 3OGRA 4GWIA 4W4ZA 1F4HA 4UI9L 3T0DA 3WF1A 2Y6JA 4KWUA 1O8PA 4DXTA 5DQ0A 1GOFA 4MADA 1JZ6A 3C7HA 4RN5A 4AG4A 4BXSV 1JZ8A 3DYPA 3OB8A 3SKJE 2WBKA 1D7PM 4XUNA 4A42A 2WUHA 3ACHA 1J83A 1GU3A 1JHJA 4W50A 2WYSA 1UY0A 4D0QA 3T2PA 1W9WA 4HG6B 4UOJA 3C7GA 1H6XA 3K75B 2VZSA 2VCBA 4XUPA 3T2OA 2VZVA 2ZEYA 2QBXA 5JXHA 1UYXA 3UETA 2W1WA 3C7EA 4PQQA 3ACIA 2EIDA 2EICA 2J1VA 2YFZA 3EYPA 2VZ1A 2YG0A 4LHSA 2VZOA 5CZKA 2X09A 3LQCA 4CUAA 4PT6A 3CMGA 3WNNA 5EIYB 3LEGA 4OYUA 4P5YA 2WO2A 1UYYA 5EJ1B 3A21A 3I3EA 1UY4A 1JZ2A 1CZTA 4A44A 1SG3A 5J1XA 1PX4A 4ZZ5A 5G04L 2RJ2A 1CZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJX A;  5F7U A;  4QPW A;  5LCW L;  2WQ8 A;  2Y6L A;  3U37 A;  3AC0 A;  1KGY A;  2VC9 A;  4P02 B;  2WDB A;  3UES A;  3W5N A;  4L0P A;  4BDV B;  2RV9 A;  2DCK A;  4QB1 A;  4OUE A;  4CUB A;  2Y6G A;  2YB7 A;  1K42 A;  1PMH X;  3WF2 A;  3HNY M;  2VMD A;  2VME A;  2VZR A;  4QB2 A;  1IQD C;  3MV0 1;  3HEI A;  4QX0 A;  3DYO A;  2BGP A;  3VD5 A;  2ORZ A;  5G05 L;  3C8X A;  2YC4 A;  4IUG A;  1SDD B;  4QX1 A;  3DYM A;  2LS6 A;  2J7M A;  4BK5 A;  3WNM A;  2VMF A;  2W92 A;  4A6O A;  5DN2 A;  3T09 A;  2VR4 A;  4MOA A;  5B4X A;  5JUV A;  4LQR A;  4D8M A;  3OG2 A;  5JXG A;  2J1T A;  2XON A;  4DUV A;  1JYN A;  4M4P A;  3GDB A;  3T2Q A;  2J1E A;  2LW8 A;  1NAE A;  3K77 A;  1XNA A;  1TG7 A;  2WN2 A;  4XUR A;  3HNB M;  3P6B A;  2WZ8 A;  3HPN A;  4KI5 M;  3SKV A;  1XPW A;  3NJX A;  1DLC A;  3CDZ B;  5I0D A;  3VD9 A;  3NRU A;  1K45 A;  2B4K A;  3I2G A;  1W8N A;  3FL7 A;  3WNO A;  2VZQ A;  3A7Q A;  1JZ4 A;  2BER A;  1JU4 A;  1WCQ A;  1UXX X;  2ID4 A;  3MO4 A;  4DEV A;  5JXI A;  1JZ7 A;  3III A;  4CUC A;  3VD3 A;  3VDC A;  2W94 A;  3T0B A;  4PF1 A;  3WNL A;  5HXM A;  2JD9 A;  2V4V A;  1OD3 A;  1GQP A;  3OGV A;  5IJR A;  5HPO A;  2ZEZ A;  4BJ0 A;  4A4A A;  5IHR A;  2VL4 A;  3WF0 A;  3BN6 A;  2VZU A;  2X10 A;  3C7F A;  3HN3 A;  3FHQ A;  1WKY A;  2PQS A;  4YPJ A;  4ZZ8 A;  2W91 A;  2JKX A;  5EJZ B;  3THD A;  1CX1 A;  4DXR A;  1UZ0 A;  3VD4 A;  3CQO A;  3VD7 A;  2J1R A;  4FI9 A;  1GNY A;  5C70 A;  2QQM A;  2YC2 A;  2KD7 A;  3ZM8 A;  2JE8 A;  3OGS A;  2QQL A;  4ET7 A;  1LNS A;  3I3B A;  4ZY9 A;  3UNP A;  1UWW A;  1JYV A;  1I5P A;  3IDA A;  5JMO A;  2OKX A;  4ARX A;  3MUY 1;  2XHN A;  3WNP A;  3IAQ A;  2Y6H A;  3WQB A;  4ARY A;  5JXJ A;  3PUI A;  1GOH A;  2VZT A;  4LPL A;  3HOB A;  4XZU G;  2V72 A;  3I2H A;  5C71 A;  3J7H A;  2JDA A;  3P1I A;  3MUZ 1;  4QX2 A;  5JR2 A;  3I2F A;  1JYW A;  2W47 A;  1W9S A;  1W99 A;  3K4Z A;  4DEQ A;  3K46 A;  3WNK A;  4MGS A;  2W1U A;  4AAX A;  4XUQ A;  1PX3 A;  2QQI A;  3LE0 A;  2VMC A;  4QDQ A;  4P00 B;  2VOT A;  3THC A;  2YFU A;  1GUI A;  1O59 A;  1XC6 A;  3LEI A;  4QDS A;  5IYY A;  4CU8 A;  5CYY A;  1UXZ A;  1NX9 A;  2ZXQ A;  4ZXE A;  2EIB A;  4XUT A;  3CKH A;  1R64 A;  1UY1 A;  3E1F 1;  1GMM A;  4JKK A;  5LA0 A;  4A45 A;  1OH4 A;  1YQ2 A;  4RYD A;  1L7Q A;  2ZEW A;  2WN3 A;  3FHA A;  3NQH A;  3T0A A;  2QQJ A;  4E8D A;  2QQK A;  4MO3 M;  3I2I A;  2W87 A;  1CIY A;  1OF3 A;  3VDA A;  3WEZ A;  4CU9 A;  4KMQ A;  3CZJ A;  4XUO A;  2CDP A;  1UX7 A;  1KEX A;  1UYZ A;  1DP0 A;  3WF4 A;  3A22 A;  3SEE A;  3MV1 1;  2VM9 A;  1L7R A;  1UY3 A;  3D3A A;  4QAW A;  3K4D A;  2HLE A;  1EUT A;  4QDR A;  2WZE A;  3I2J A;  3GM8 A;  4JX0 A;  2CDO A;  4UAP A;  2BBA A;  4JHZ A;  2WAO A;  1RYY A;  2R7E B;  1ULO A;  4W8J A;  3I97 A;  1SHW B;  4GZ9 A;  3LPF A;  3I3D A;  1JZ3 A;  3FN9 A;  2J1A A;  2Y6K A;  2E31 A;  3IAP A;  3GGL A;  5LA2 A;  4JKM A;  1UMH A;  3HNM A;  3ACF A;  3NNG A;  5FUI A;  3IB3 A;  2QQO A;  2W46 A;  2J1U A;  2VZP A;  3LPG A;  3CIH A;  2XQX A;  3NJV A;  1W9T A;  4QX3 A;  3A23 A;  3ETP A;  3PUH A;  1PMJ X;  1US3 A;  3ABZ A;  1US2 A;  5IFP A;  4A3Z A;  1CZS A;  1W8O A;  2VQU A;  1W0N A;  1H6Y A;  1HN1 A;  2Z4F A;  4E8C A;  1O8S A;  3F2Z A;  2L9L A;  4LKS A;  2W3J A;  5A1A A;  2C4X A;  2WAA A;  1F4A A;  4CVU A;  1UY2 A;  1OF4 A;  1K3I A;  1XNT A;  3LEK A;  3W5M A;  1JYX A;  4MGQ A;  4BK4 A;  3I2K A;  1ULP A;  3JXS A;  4P08 A;  2VTF A;  3T08 A;  2BGO A;  2VO5 A;  4CU6 A;  4QB6 A;  4CU7 A;  5DMY A;  2QQN A;  1JU3 A;  2E26 A;  2ORX A;  3MBW A;  3VDB A;  2DCJ A;  1MPX A;  1JI6 A;  1JZ5 A;  2Y8K A;  4DUX A;  5C7G A;  3OBA A;  2X05 A;  2C26 A;  5LA1 A;  2WAB A;  3WF3 A;  1J84 A;  2EIE A;  4OMC A;  2B9V A;  3K4A A;  1T2X A;  4TXW A;  4DXS A;  3ACG A;  2C9K A;  1OT5 A;  3CZU A;  2DDU A;  3EB7 A;  2VZ3 A;  1K12 A;  4GWJ A;  3DEC A;  3GXU A;  2Y64 A;  5IFT A;  2J1S A;  5DPN A;  2VCA A;  1P8J A;  1NKG A;  2WO3 A;  2W1S A;  1GOG A;  1UMI A;  1NUK A;  2W1Q A;  4OZO A;  3ECQ A;  4Z2A A;  2E32 A;  2W5F A;  3HJR A;  3OEA A;  3C7O A;  2V5D A;  2HYX A;  2XOM A;  4XVH A;  5B4N A;  2BZD A;  4M4R A;  3WSO A;  3OEB A;  2W95 A;  4TTG A;  4JKL A;  2ZEX A;  2W9X A;  1BHG A;  2VCC A;  1DYO A;  2VQT A;  4OMD A;  2J22 A;  3BGA A;  3SEP A;  2E33 A;  4A41 A;  1EUU A;  1TVG A;  4DUW A;  2WO1 A;  2RVA A;  3OGR A;  4GWI A;  4W4Z A;  1F4H A;  4UI9 L;  3T0D A;  3WF1 A;  2Y6J A;  4KWU A;  1O8P A;  4DXT A;  5DQ0 A;  1GOF A;  4MAD A;  1JZ6 A;  3C7H A;  4RN5 A;  4AG4 A;  4BXS V;  1JZ8 A;  3DYP A;  3OB8 A;  3SKJ E;  2WBK A;  1D7P M;  4XUN A;  4A42 A;  2WUH A;  3ACH A;  1J83 A;  1GU3 A;  1JHJ A;  4W50 A;  2WYS A;  1UY0 A;  4D0Q A;  3T2P A;  1W9W A;  4HG6 B;  4UOJ A;  3C7G A;  1H6X A;  3K75 B;  2VZS A;  2VCB A;  4XUP A;  3T2O A;  2VZV A;  2ZEY A;  2QBX A;  5JXH A;  1UYX A;  3UET A;  2W1W A;  3C7E A;  4PQQ A;  3ACI A;  2EID A;  2EIC A;  2J1V A;  2YFZ A;  3EYP A;  2VZ1 A;  2YG0 A;  4LHS A;  2VZO A;  5CZK A;  2X09 A;  3LQC A;  4CUA A;  4PT6 A;  3CMG A;  3WNN A;  5EIY B;  3LEG A;  4OYU A;  4P5Y A;  2WO2 A;  1UYY A;  5EJ1 B;  3A21 A;  3I3E A;  1UY4 A;  1JZ2 A;  1CZT A;  4A44 A;  1SG3 A;  5J1X A;  1PX4 A;  4ZZ5 A;  5G04 L;  2RJ2 A;  1CZV A; 
#chains in the Genus database with same CATH topology
 2A5Z A;  5C3P A;  5JSP A;  5CKN A;  3NVC A;  1AR8 3;  3FWE A;  1UOF A;  5FY0 A;  3B9C A;  2VJX A;  3JBG 2;  3V64 A;  1NCQ C;  4D94 A;  3UL2 A;  3N9L A;  3MHZ A;  3KMH A;  3CO2 A;  2IXH A;  5E89 A;  4QKB A;  3PUQ A;  5FZ0 A;  1QJZ A;  4YVW C;  4QGM A;  3NAP C;  4K20 A;  4TLF A;  1NA1 C;  1WW5 A;  1Q8Q A;  2N7G A;  2WQ8 A;  4AEJ A;  3FUO A;  1SPP A;  2JG9 A;  1SDW A;  2CHH A;  2VC9 A;  1HB4 A;  4IXL A;  5FXV A;  1PO2 2;  1O3Q A;  3W5N A;  4OUS A;  1SLL A;  4TWT A;  2HWF 3;  2X8K A;  4BMB A;  4C1X A;  1XE8 A;  4BZ4 A;  5L7O A;  2DCK A;  4ES9 A;  5BUV A;  1FPN 1;  1K5M A;  1XE7 A;  5GLZ A;  5T5J A;  3ZN5 A;  3ZYH A;  5T55 A;  2YPJ A;  2Y6G A;  1WME A;  3LAG A;  4NRP A;  3SC7 X;  4CA9 A;  2Q1Z B;  2VVD A;  3K51 A;  3WF2 A;  3GJB A;  2VMD A;  2VZR A;  1QGL A;  4RFT 0;  5CFD A;  3R05 A;  5FJH A;  4MGK E;  4YZ2 A;  3CL1 A;  4JGY C;  4DB5 A;  1ZNP A;  1UD1 A;  2BYV E;  4HFS A;  3HEI A;  5LA9 A;  2BGP A;  2YC4 A;  1RUD 1;  3DL3 A;  1AR6 2;  1ZRF A;  3NKT A;  4D3W A;  5CKQ A;  2YRO A;  3DYM A;  2VVE A;  1S1A A;  1VBC 3;  2VPV A;  3UGF A;  1QF3 A;  4BK5 A;  3U78 A;  1YC6 1;  1LHO A;  1SBD A;  2OX0 A;  1HQW A;  4QMA A;  1EV1 3;  2VR4 A;  4LHN A;  1UU5 A;  2RM2 1;  4YW1 A;  5FFO C;  4LQR A;  2D40 A;  4KBB A;  4LTA A;  4LHK A;  5EJ3 A;  1YO8 A;  5JXG A;  3AP4 A;  1FMD 3;  1LRH A;  2BNN A;  1IS3 A;  4AEK A;  3AZZ A;  4L9B A;  2D3S A;  4MVT A;  4NRO A;  3T2Q A;  1VBB 1;  3PVB B;  4CEW B;  3ZO0 B;  4LT5 A;  4AF9 A;  1YFW A;  3H3L A;  3OF1 A;  2WWU A;  4P9Y A;  2WKK A;  2EAK A;  2VUC A;  2VBB A;  4UW5 A;  4D7S A;  2WRA A;  1S0B A;  4IDZ A;  2OUJ A;  2E63 A;  2YMZ A;  4LUM A;  5FZD A;  1TMF 1;  2HWB 3;  2I74 A;  2Q4S A;  4FCA A;  4BIO A;  1E57 A;  3FE5 A;  2WSV A;  3AXD A;  5I0D A;  4XF3 A;  1QH7 A;  1ZX5 A;  2OT7 A;  4IND A;  1W6O B;  3NRU A;  4CDW C;  1W8N A;  2R32 A;  3FL7 A;  4BQW A;  5ISL A;  3NV1 A;  4XQD A;  2VOW A;  3VBF C;  4QXB A;  1JOJ A;  1QIQ A;  4UF0 B;  3I49 A;  4QHB A;  2VXJ A;  2XLA A;  4S2G A;  1URX A;  1NXM A;  4V1P A;  3SIS A;  3RYR A;  2JB4 A;  1PIV 2;  2ID4 A;  1NQJ A;  4CCE A;  3KQR A;  1C5I A;  1O5L A;  4DEV A;  1JZ7 A;  1JH5 A;  2LRO A;  3VB9 A;  5J7M A;  4LO5 B;  3ETQ A;  4GMP 3;  4MHR A;  5FZI A;  3T0B A;  5HXM A;  1IS4 A;  2VNO A;  1EAH 2;  3ILF A;  2XDV A;  5JIA A;  1WMF A;  4XJW A;  4CDX C;  4BJ0 A;  1S0C A;  4FOW A;  1XU1 A;  3ORJ A;  4A4A A;  4CCD A;  3J7N A;  3UYJ A;  1R08 1;  1WW6 A;  3DUI A;  2FDI A;  2CSG A;  3MPB A;  5DAB A;  4EWD A;  2ADE A;  3WY6 A;  1LTE A;  3WHT A;  3WF0 A;  1UOJ A;  3VZK A;  4H55 A;  3RI8 A;  2RG4 A;  1HRI 2;  3N9O A;  4PHZ A;  3UV9 A;  3HN3 A;  3LFI A;  1RUH 3;  4EV0 A;  2UU8 A;  4H7L A;  4XFI A;  5FYC A;  4TYS A;  3VZL A;  3WDT A;  2PQS A;  5CAD A;  2WLP A;  4ZZ8 A;  2Y33 A;  5C33 A;  2W91 A;  1CX1 A;  4DXR A;  1UZ0 A;  3CQO A;  5B2G B;  4YGE A;  4Y5S A;  3ZM8 A;  1IS6 A;  3OUH A;  2MHF A;  1VB4 A;  3JBG 1;  1H2M A;  4RS5 A;  1CAV B;  4XFF A;  1RUF 3;  3ZIX A;  5FYM A;  1LNS A;  4Q4V 2;  5CFC B;  2YU1 A;  1KDM A;  2VH9 A;  3IDA A;  1WWY A;  1UNB A;  2Y26 A;  2ZA9 A;  4ARX A;  2IXL A;  4N43 A;  4Q4X 3;  5FYZ A;  1MS9 A;  1IPK A;  3BKZ A;  4JQT A;  5HV0 A;  2RJK A;  3WQB A;  1RUC 2;  5KHK A;  3VBH C;  1H1M A;  2CY6 A;  3V56 A;  5FQ0 A;  3AK0 A;  2V5Y A;  2PAK A;  1C8M 3;  3GHN A;  5FTT C;  1VAK A;  2XJR A;  1TNF A;  4LBM A;  1OKO A;  3D6E A;  3MDP A;  4GWM A;  2V72 A;  1IOA A;  4CDQ C;  5C71 A;  3GHM A;  4WVV A;  2JDU A;  1V6O A;  4L11 A;  1U5Y A;  1LEM A;  4RQP A;  3N9Q A;  1N3P A;  3P1I A;  5DDJ 2;  5A3N A;  5JR2 A;  1JYW A;  1YFU A;  1DCS A;  3BU7 A;  3SCF A;  4A6S A;  3WNK A;  5IVE A;  1WLC A;  1RUG 3;  4LOT A;  3TBD A;  3N36 A;  1MQT C;  3H7J A;  3ST7 A;  1U12 A;  1O4Z A;  1Z78 A;  4LO6 B;  2DUR A;  4RHV 1;  3ZFG A;  4BQ1 A;  4O65 A;  3GZU C;  1OC1 A;  1BEV 2;  1BVP 1;  2WZR 2;  2VMC A;  5FYB A;  5JDB A;  3GCW A;  3AL6 A;  4GB3 1;  5LY2 A;  2VOT A;  4QGN A;  4IQP A;  3THC A;  1ND3 B;  3LIG A;  1PO1 3;  2GC2 A;  1RUN A;  1W39 A;  1GZW A;  1QJY 2;  1HRV 2;  1W06 A;  4QDS A;  1VBE 2;  4DY3 A;  1MS3 A;  2JXA A;  5HCA A;  4YG6 A;  2DVD A;  3J4U H;  1LUL A;  5CYY A;  2A3X A;  1RUI 1;  3MW2 A;  2KR2 A;  2PXJ A;  2OQ7 A;  1BKZ A;  1UXZ A;  4YSF A;  2WFF 2;  3FC0 A;  1J1T A;  3R4U A;  1PGW 1;  2P6C A;  2RMU 3;  1GAN A;  4KWJ A;  1DFQ A;  4DMI A;  1R64 A;  1O91 A;  4JQR A;  3H1W A;  1DQ1 A;  3ZFE C;  3O1O A;  5IVB A;  3NMB A;  3S5A A;  4NHM A;  5FK7 A;  2AZ5 A;  1R1A 2;  3SHR A;  4XXP A;  4AL9 A;  4KU8 A;  2BVB A;  1DZR A;  4LKF A;  4FFH A;  1OQ1 A;  3WDW A;  1XYO A;  5CEH A;  1MZ5 A;  2YDE A;  2DF7 A;  3T0A A;  2QQW A;  5KHJ A;  1I6X A;  3E5X A;  1W8U A;  2XBO 1;  3I2I A;  3HVD A;  4FOQ A;  4Q4W 3;  4WZF A;  4XPV A;  3WEZ A;  5K7P A;  4ZPI A;  4XAB A;  5IT6 A;  2IXI A;  4XXA A;  4YWA A;  4MSV A;  4YM3 A;  1G9D A;  4CYD A;  4NPM A;  3LDR A;  2SLI A;  1Q5O A;  3KF5 A;  3WF4 A;  3A22 A;  3OD4 A;  4AFC A;  2R1D A;  3BI3 A;  1PVC 3;  1O3R A;  1W9F A;  3BPS A;  1X82 A;  2MPF A;  3ZYF A;  4AHX A;  1PVX A;  1UU6 A;  4CZS A;  2DUO A;  1LU1 A;  4C8D A;  4PDW A;  4HVR A;  1LOE A;  1YCI A;  1Q43 A;  3GM8 A;  4JX0 A;  1RIN A;  2BFU L;  4YW6 A;  1Q8V A;  3OCP A;  1REF A;  4QKF A;  5JWP A;  1LOD A;  1JHN A;  2A6W A;  1AYN 3;  2AR6 A;  1PZ8 A;  3NNL A;  4LMF A;  5FMO L;  2P37 A;  4GZ9 A;  3LPF A;  2IVI B;  5A7W B;  4R4Z A;  3ZYG A;  1IPS A;  3H3Z A;  2DTY A;  4IW3 A;  1CWP A;  3RZK A;  4MH0 E;  1XSR A;  1LAJ A;  3IKW A;  5IK4 A;  3WW4 A;  3UJO A;  2EVX A;  2X5I A;  1V70 A;  4HLT A;  4JKM A;  1CX4 A;  2QQO A;  1O6U A;  3BOP A;  3MIE A;  4UW4 A;  5FYV A;  4AVA A;  1GZ9 A;  5D8A B;  5FZ8 A;  3KHC A;  3N7J A;  2Q8D A;  3ROU A;  4A7K A;  3KF3 A;  1PO2 3;  3A23 A;  4CDU C;  5FWJ A;  2AEN A;  2WLQ A;  1V6L A;  5DAX A;  3ABZ A;  4DRV A;  3N35 A;  5FZC A;  5ABJ B;  1W8O A;  3IDE A;  3C2U A;  4BIF A;  2VVF A;  4H2A A;  1ULE A;  5FZG A;  3KV4 A;  5FLI A;  4LKS A;  3F2Z A;  4R52 A;  5FCC A;  3RWN A;  5J98 B;  3WG2 A;  2RS3 1;  1XYP A;  4LIV A;  1JN2 P;  2WAA A;  4QPY A;  3ZYB A;  4LIT A;  4EN6 B;  5J37 A;  2FCT A;  2FMY A;  2VNG A;  1K3I A;  4YLZ A;  4AI8 A;  2DBI A;  3POI A;  2ZX4 A;  3W5M A;  2D44 A;  1RUC 1;  4BA6 A;  1KRI A;  4MGQ A;  2DYC A;  3WUC A;  5J3U A;  4YGC A;  1AR6 3;  3JXS A;  1Y9G A;  1AUY A;  3PUA A;  2VTF A;  4P08 A;  5CIR A;  3URF A;  4R8H A;  4GIQ A;  4GJZ A;  1X9T A;  3JD7 1;  1OFN A;  2E26 A;  2ORX A;  3MBW A;  4AVB A;  1ZZ7 A;  3WLU A;  4FPE A;  1ND2 B;  1N3Q A;  3FBM A;  1NZC A;  2JG8 B;  3AVR A;  2PAM A;  4WVM B;  3S0M A;  3AP6 A;  2D6K A;  2Y8K A;  3FMG A;  3GBG A;  4A7Y A;  5DUX A;  5C7G A;  4OHV A;  4NO4 A;  1RGS A;  5LWB A;  5LA1 A;  2YBP A;  3IPV A;  4FAH A;  2P1B A;  2B39 A;  2WAB A;  1W2O A;  2I45 A;  2ZX0 A;  3WF3 A;  2VW2 A;  2ZHM A;  5J96 B;  3WCR A;  1AJK A;  3AMM A;  2Q30 A;  3GZA A;  4ZKT B;  2FZ2 A;  1T2X A;  2HJI A;  5SV8 A;  5FZE A;  2HEY F;  5A3W A;  1U5Z A;  3B5L B;  4EE2 A;  1QDC A;  5FAX A;  1SPP B;  2JG9 B;  3POS A;  4P9X A;  2CAV A;  4OHZ A;  2NYY A;  3WG4 A;  2XVK A;  1OHF A;  4XIK A;  4MGI E;  3OPT A;  3WG3 A;  2C9A A;  2D97 A;  5GZE A;  4D69 A;  1AR8 2;  1GWL A;  3B02 A;  5JR7 B;  3AFK A;  3IZO A;  3KZ4 C;  3I7D A;  5L7O B;  1GFF 2;  1SQ4 A;  1YUD A;  2AGS A;  1K5M B;  3EB7 A;  2XWB B;  1VAM A;  2WO7 A;  1GNZ A;  2R04 2;  4XFC A;  4Y3O A;  3M2M A;  1OD5 A;  3OPZ A;  1KJL A;  3CEW A;  3H0O A;  4NRQ A;  4OCT A;  2PHW A;  5ACA 1;  5CFD B;  5DPN A;  4JHT A;  5KHH A;  4FFI A;  1NKG A;  2HWF 2;  5IVJ A;  4IV3 A;  3WZ1 A;  4BLJ A;  2W1S A;  2PMW B;  4RR3 A;  2DUQ A;  1B35 A;  1NUK A;  1RJ8 A;  3GYD A;  4R9C A;  2XXZ A;  1PIV 3;  4QQP A;  4QX7 A;  5F32 A;  2E32 A;  1RUE 1;  4XOG A;  2W5F A;  3U10 A;  1QQP 1;  2XOM A;  1D4M 2;  1COV 3;  2WT0 A;  3G7D A;  5I0S A;  4N53 A;  4XVH A;  1W3X A;  4J6G A;  2OYZ A;  1EAH 3;  2E7A A;  2DCY A;  4Q29 A;  2W95 A;  4TTG A;  4X6R B;  4JKL A;  5FYI A;  5FMB A;  4B7E A;  2JDM A;  2W9X A;  4IEV A;  5C5U A;  1XYN A;  2VCC A;  4AI1 A;  3VUO A;  1ODN A;  4XQW A;  3P3P A;  5GLT A;  4Z2W A;  1DYO A;  5CG9 A;  2QVS B;  1IKQ A;  4FO9 A;  3ZXF A;  1HRI 3;  1NLS A;  2GAU A;  4SLI A;  4QD2 A;  4CEW C;  2E33 A;  4A41 A;  1LGB A;  1HXS 1;  1LOF A;  4QT6 A;  4LNV A;  5A3L A;  1RXG A;  4GH4 A;  2CYF A;  2R30 A;  4NWV A;  1S2B A;  2WO1 A;  1UOG A;  2DFB A;  1VMH A;  5L9B A;  1Z7S 3;  1V9U 1;  2EXK A;  1F4H A;  1HJF A;  1SBF A;  1H9W A;  1ZM1 A;  4X6Q B;  3RYP A;  1RTV A;  2WNO A;  4NAO A;  4CCO A;  2QQP A;  1FMD 2;  1MVE A;  2C6S A;  1IG0 A;  1S0J A;  2XKP A;  2ZGR A;  4IGQ A;  4XHB A;  1ZBE 1;  4EYU A;  2ZX3 A;  1JZ8 A;  3PL0 A;  4BXS V;  3RS6 A;  2K2S A;  3S5Q A;  2ZGK A;  3OB8 A;  4N90 A;  1ALY A;  4YGD A;  5FZK A;  2VG9 A;  2WUH A;  4IL7 A;  4XFH A;  2LUW A;  3ACH A;  4Q4V 3;  2H6C A;  1GU3 A;  1SBE A;  1VLN A;  4LKE A;  4R9A A;  4FPF A;  3BCW A;  4NIG A;  2W08 A;  3OOX A;  4YM2 A;  5DG1 A;  4D0Q A;  1UPS A;  1W3V A;  2PFW A;  4IGO A;  5FXZ A;  4BU2 A;  2YGM A;  1S0G A;  3HN1 A;  3K75 B;  3K3N A;  4AQ6 A;  3WW2 A;  2D6N A;  4E4S A;  2BBV A;  1W6M A;  3WQ0 A;  2LTN A;  2XWJ B;  3ZSJ A;  2UWB A;  2UUR A;  5HI0 A;  3D82 A;  2D6M A;  2DUP A;  3MIH A;  4RGG A;  3UET A;  3PHM A;  2XJT A;  5H9P A;  3RJ2 X;  4PQQ A;  2ZKL A;  2G9G A;  2EID A;  1HB1 A;  5DDJ 3;  1LHU A;  1OXC A;  3ES1 A;  5EV7 A;  2YG0 A;  4LHS A;  2VZO A;  2VQ0 A;  2X09 A;  2BOI A;  4YG0 A;  4OQ8 A;  1MZE A;  4OVE A;  5DZF A;  3MFA A;  5GZD A;  4P5Y A;  3NV3 A;  2D93 A;  5A33 A;  3HWJ A;  4UW3 A;  1UY4 A;  2LAL A;  4KWL A;  1CZT A;  1SG3 A;  1BEV 3;  1UIJ A;  2KXL A;  1PNG A;  2VNV A;  2WQZ C;  2WZR 3;  3AFG A;  2PEL A;  2ET1 A;  2RJ2 A;  3AM2 A;  4Y20 A;  5G04 L;  2DWR A;  1NLR A;  3E5Q A;  2A73 B;  5D2A A;  2PAE A;  2A7A A;  1QJY 3;  2R0F A;  4FPC A;  4XF4 A;  1HRV 3;  1VBE 3;  3SIT A;  2J42 A;  4BHP A;  5F7U A;  3ZR5 A;  3ZXL A;  1D2S A;  5KXC A;  3HIF A;  5CFC C;  1FAT A;  2ARE A;  2WFF 3;  5FYS A;  2HWD 3;  4Y33 A;  5LCW L;  4GWN A;  5BXX A;  2Q5T A;  2Y6L A;  4RS5 B;  4B7K A;  1KGY A;  3HQX A;  1LCL A;  2WDB A;  3UES A;  3PU3 A;  3MF9 A;  3WP4 A;  2WII B;  4L0P A;  5DUV A;  1LHN A;  1POV 3;  3VBS A;  2ZPX A;  2RV9 A;  4QB1 A;  1UOB A;  1SMV A;  4N43 B;  1R1A 3;  4CXY A;  2YB7 A;  1K42 A;  5CIS A;  3NWK A;  5FZO A;  5FQ0 B;  2DVG A;  2ZAA A;  1BK1 A;  1RUF 2;  2B7Y A;  2ZHN A;  4FVV A;  4HOO A;  3WP5 A;  2JIC A;  2CU5 A;  2WNE A;  4NOT A;  5IWF A;  2ZGL A;  4QX0 A;  1WCK A;  3ILN A;  4RQP B;  3E6C C;  1HIX A;  3VD5 A;  2ORZ A;  2O0O A;  5G05 L;  3VHP A;  1STM A;  2ZAC A;  1SDD B;  1XRU A;  2HWF 1;  2Q8E A;  4CP0 A;  4QX1 A;  5FR3 A;  1S0I A;  4JVA A;  3O1U A;  2LS6 A;  2YXS A;  3POE A;  5FZ6 A;  1KS4 A;  4OZX A;  3WNM A;  3KQ4 B;  5JZG A;  3E6D A;  2QJV A;  3ZFG B;  1QHD A;  2GH2 A;  2GME A;  3T09 A;  1ND3 C;  2Z5W A;  3OGJ A;  5B4X A;  1JOB A;  4D8M A;  4NR1 A;  2QFE A;  1YFX A;  1WZX A;  2ZGP A;  5LBF A;  5C4W A;  3TOJ A;  3QD6 A;  4XBN A;  4DQA A;  1RUG 2;  1GZW B;  3WCS A;  4KG8 A;  3TEZ A;  3KGL A;  4O9G A;  1JYN A;  2MNG A;  4M4P A;  1SCS A;  3B93 A;  5H9Q A;  4XW3 A;  1VBC 1;  1WD4 A;  3VLB B;  3BTX A;  4Y1Y A;  5D1I A;  5BNO A;  1NAE A;  1PZ7 A;  1Q8O A;  2RDR A;  2BW8 A;  3DGT A;  1APN A;  1EV1 1;  3OBZ A;  1PGS A;  1S2E A;  1VIW B;  4CCM A;  4N8M A;  4BYY A;  5FP8 A;  1W8W A;  2DTW A;  3SKV A;  2R07 2;  4XZP A;  1FMD 1;  1AX1 A;  4QKN A;  1DLC A;  1OLM E;  1DGW A;  5T54 A;  2IXJ A;  3POJ A;  2RMU 2;  2XJP A;  4JC1 A;  4NRM A;  1XBF A;  2EXH A;  3WV6 A;  1NE6 A;  2YZ4 A;  2Y0I A;  2WC2 A;  3AJZ A;  2VUJ A;  4JTN A;  1JW6 A;  5C3Q A;  1H8T A;  1UZW A;  3WNO A;  3A7Q A;  5FZ7 A;  5DAW A;  5IAV A;  3JQX A;  1MVQ A;  1SFY A;  1MAC A;  5I0T A;  3AYA A;  3ZVX A;  1TEI A;  2OXB A;  3VDD A;  1DQ2 A;  5EWS A;  2HWB 1;  3VD3 A;  3VDC A;  4E2Q A;  5J48 A;  2GNM A;  2W94 A;  5A32 A;  5FLJ A;  4B4P A;  3CJI A;  5A3P A;  2R06 2;  5A6Z A;  5LK5 A;  2JD9 A;  1AR7 2;  4LJH A;  2OVU A;  3RZZ A;  4M3C A;  1GQP A;  3OGV A;  4PDW B;  5HCF A;  5HPO A;  1W03 A;  5K4L A;  4R4X A;  4BCU A;  3BTY A;  5AVA A;  5IHR A;  4GMP 0;  2JJ6 A;  4Q0Q A;  2XLF A;  1Y9M A;  4BPZ A;  3VKL A;  3DF0 A;  5LB6 A;  2W52 A;  3AYE A;  1WCS A;  2VZU A;  1ZRI A;  3VKN A;  1YLL A;  1FAY A;  1YEW A;  4R9D A;  1GQH A;  5DAP A;  3MF6 A;  3ZFF A;  1KXG A;  1AJO A;  2HEV F;  4GMP 1;  2BFU S;  2YY1 A;  2ZCW A;  5EJZ B;  3THD A;  1S4C A;  1X7N A;  4J25 A;  5D8A C;  3VD4 A;  3I8T A;  2X5I B;  2WJS A;  3VD7 A;  1G7Y A;  1YFY A;  1A34 A;  4FI9 A;  4LBJ A;  1GNY A;  2MEV 3;  2EAL A;  2YC2 A;  4ZHN A;  1U0A A;  4IEP A;  2DV9 A;  2JE8 A;  5EHD A;  2ZGT A;  4J1W A;  5ABJ C;  1PM4 A;  4KBZ A;  3RGB A;  4OUL A;  3TB0 A;  1RUH 1;  3T3Y A;  3I3B A;  4ZY9 A;  3WQ1 A;  2JX9 A;  1SZB A;  5FXX A;  4D7T A;  2GU9 A;  4QGL A;  3U75 A;  1RJ7 A;  3AP5 A;  1E5I A;  5JMO A;  2OKX A;  4NHL A;  2R04 3;  4BXF A;  4ITC A;  4LK7 A;  4UFJ A;  1X8M A;  5IAX A;  1LOC A;  1SLI A;  3MUY 1;  4X8P A;  2XHN A;  3SQO A;  3T4H B;  3WNP A;  4A3X A;  5LZ6 A;  3H8R A;  4CCL A;  3IAQ A;  2WIN B;  5JOX A;  3VV1 A;  2DVA A;  2ZGQ A;  4YW3 A;  3POF A;  4IER A;  5A70 A;  1GOH A;  3DEM A;  4YW5 A;  1TME 2;  2RS1 3;  4XJZ A;  4CP9 A;  1DGW X;  1CGP A;  5CAZ A;  1FYU A;  3A0K A;  1RUF 1;  2RE9 A;  5L73 A;  5HCH A;  2JDA A;  5A1L A;  3I2F A;  3USU A;  1ND2 C;  4Y4Y A;  1W99 A;  1ZYB A;  2IC1 A;  2JG8 C;  4DEQ A;  1D4M 3;  5F6L B;  4NHK A;  2PHL A;  3RFR A;  4YVS C;  4Q4X 1;  2ZAB A;  1VBA 2;  3Q9O A;  1PM7 A;  3KVB A;  1J58 A;  3O7O A;  1C8M 1;  4WV8 A;  4XUQ A;  3U4X A;  5C9A A;  3IPV B;  1C28 A;  2QE3 A;  1AZD A;  1GP4 A;  2YFU A;  1GUI A;  5A7Q A;  3IN9 A;  1HJG A;  5JLV A;  1UZY A;  2JG9 C;  3RZH A;  4AED A;  4COZ A;  4CU8 A;  5FY8 A;  2BVV A;  3N9M A;  1RUG 1;  4LHL A;  4ASK A;  3LA3 A;  5L7O C;  3N9N A;  3MW3 A;  5F6K A;  3CHX A;  2EIB A;  4AI0 A;  1OBN A;  2NMN A;  2BUK A;  3VBU A;  1CJD A;  3LSE A;  4RL7 A;  1YI7 A;  4JKK A;  3LIH A;  3ZYR A;  5T52 A;  5CFD C;  1OA3 A;  4U36 A;  1PO1 1;  1ULC A;  3CLP A;  4RYD A;  3FLP A;  2XVL A;  5FXW A;  5CVR A;  3LDK A;  4H14 A;  4NMI A;  4NID A;  4F8A A;  2ZEW A;  4IE6 A;  2XL9 A;  2WN3 A;  1CIW A;  3ASI A;  3DPR A;  5A3U A;  3NQH A;  4IV3 B;  4MX3 A;  2QQJ A;  3ZXA C;  3M8L A;  4RR3 B;  1B35 B;  3K48 A;  4E9K A;  4E8D A;  2RMU 1;  1PGL 2;  2W87 A;  2D3R A;  1OF3 A;  1BLZ A;  3VDA A;  4YM1 A;  5LAT A;  1UX7 A;  2BGC A;  1UX6 A;  2Z42 A;  3PTY A;  3WNX A;  2OQ6 A;  4G4F A;  4K1Y A;  3W9A A;  2JEM A;  4N53 B;  2G4I A;  4LOR A;  1Q8P A;  2EAA A;  3MV1 1;  4P9I A;  4AFA A;  2VM9 A;  2I07 B;  3DV8 A;  1FI2 A;  2JB8 A;  1L7R A;  1F5F A;  1UY3 A;  4CDX A;  1ZRC A;  2EXJ A;  4ATF A;  1F31 A;  2HWE 2;  3K4D A;  4I09 A;  1GP5 A;  3RJR A;  3T1L A;  1FOD 3;  1VR3 A;  1XQN A;  2WZE A;  4XJA A;  1S0D A;  2VCM A;  5FYT A;  3OY8 A;  3B01 A;  1COV 2;  4Q4W 1;  3RMY A;  4QWN A;  4TLG A;  3TEW A;  4GH4 B;  4FQZ A;  2WAO A;  1DDL A;  1W04 A;  1RYY A;  2R7E B;  4YW7 A;  1ULO A;  4M3C F;  3I97 A;  4FXG B;  1PVC 1;  1W2A X;  4L99 A;  3TNQ A;  2ZTN A;  4RGA A;  4P9W A;  4PIZ A;  2A6X A;  1JZ3 A;  4Y5Z 0;  4ZXK A;  2CGN A;  3FN9 A;  4Z07 A;  5I91 A;  5BNP A;  4HK9 A;  1XXN A;  2GNB A;  2Y6K A;  3PMS A;  4ZU7 A;  1Q3E A;  2TUN A;  5FUI A;  3HNM A;  4BH9 A;  3ITQ A;  2W46 A;  2J1U A;  3BPZ A;  4L97 A;  3NNJ A;  2VZP A;  3IM0 A;  5F2S A;  1J59 A;  4XF1 A;  3NST A;  3LPG A;  5FRA A;  1Z7S 2;  3CIH A;  5E16 A;  2PHT A;  1LOA A;  2VY0 A;  3CBN A;  3S30 A;  4XAE A;  5FO9 B;  3PVE A;  2W0X A;  1AYN 1;  1PMJ X;  3O14 A;  4ERO A;  1US2 A;  4JAA A;  4A3Z A;  2AEY A;  2PHR A;  2ERF A;  4YM0 A;  4NE9 A;  2XH6 A;  1NT0 A;  4OI4 A;  4D6R A;  2QDR A;  1YHF A;  2WNV A;  1W0N A;  2OPK A;  4QU1 A;  1W6M B;  3A4U A;  5M0T A;  1QJF A;  3VBH A;  1W8H A;  2L9L A;  4PBP A;  3ZIW A;  4AEM A;  4E8C A;  1RMU 2;  1LED A;  1ONA A;  4AGR A;  1RIT A;  2C4X A;  4B4R A;  3WP6 A;  1DLL A;  3AZY A;  5A80 A;  1YQC A;  2ZX2 A;  2WZP P;  1PO2 1;  2XLG A;  4HKW A;  4E2G A;  3VHN A;  3VZM A;  5DUU A;  4Z8B A;  4BOW A;  2V4A A;  1BBT 2;  2VOV A;  1BCX A;  1A8D A;  4BQ3 A;  2DCZ A;  1YJL A;  1IQA A;  1RVF 2;  5KHI A;  5LBE A;  2BGO A;  1CVN A;  2VO5 A;  2K46 A;  4CU6 A;  4QB6 A;  4CU7 A;  5DMY A;  1LU2 A;  4QQL A;  1JU3 A;  5A33 B;  3VDB A;  4UFI A;  2GC3 A;  4URA A;  1S2K A;  3BU0 A;  2DCJ A;  2BNO A;  1MPX A;  1OSG A;  1YQ8 A;  2ZHL A;  3KT1 A;  3M3E A;  1YQ5 A;  5A7N A;  4LBO A;  4IE5 A;  4LO7 A;  1AXY A;  3LB9 A;  4Y20 B;  4NPL A;  5FZL A;  4DUX A;  2C26 A;  1W8Z A;  3ATG A;  3RSJ A;  4F3J A;  3X29 B;  1VBD 3;  4KG0 A;  1AR6 1;  2XQR A;  5I8T A;  3L9J T;  4R9B A;  2Y6F A;  3UT0 A;  1G9C A;  5LBB A;  5FZH A;  3ACG A;  2B46 X;  3AYD A;  3JQW A;  3N3H A;  5FYY A;  1ZBA 2;  2JEC A;  3H1M A;  1KFU L;  3AVS A;  5DG2 A;  3W58 A;  1H8V A;  2PHD A;  4E2S A;  2X29 A;  2P2K A;  4N43 C;  3U11 A;  4MG2 A;  1E5S A;  5DAV A;  1HKD A;  3I3Q A;  4M0H A;  3RWK X;  3NV2 A;  3BIE A;  1QH6 A;  3VBS B;  2R07 3;  1WA6 X;  3RMX A;  4GQ7 A;  1JTZ X;  2VZ3 A;  2QUO A;  3QLQ A;  2HWD 2;  2P6H A;  3GJA A;  4GWJ A;  4PLN A;  5FZO B;  5AC9 2;  3RZL A;  1KDK A;  2E51 A;  1GLH A;  4IE4 A;  3WX5 A;  4CCN A;  3ZSK A;  4S2H A;  2P3Y A;  4CRQ A;  5A7S A;  2VCA A;  5JOW A;  4YZ1 A;  2IXC A;  4JTO A;  3POY A;  3H8O A;  4Y1V A;  1VRH 3;  1YI9 A;  2RHP A;  4B8E A;  2CV6 A;  1UMI A;  1H9P A;  2WS9 2;  4NJ4 A;  2OUH A;  5FP4 A;  4Z2A A;  3R6S A;  1F8V A;  5LY1 A;  3O0X A;  1OKQ A;  4LUK A;  2PHX A;  3ZFG C;  2WSU A;  3DKW A;  2UY8 A;  2Y34 A;  2R06 3;  1ENS A;  4FP2 A;  5F5I A;  5JZG B;  1W2T A;  1AR7 3;  5B4N A;  2BZD A;  3HR9 A;  3IMM A;  4M4R A;  4TN7 A;  5FRE A;  2CTV A;  3WSO A;  1YWK A;  3ZPO A;  2FD8 A;  3C3V A;  4Y4R A;  3FHI B;  4P14 A;  2Y38 A;  3TAY A;  3ILR A;  2G19 A;  1NYW A;  3IWZ A;  1BHG A;  4GKY A;  4V2V A;  5C4W B;  1VAV A;  4CP1 A;  3EMR A;  5LAS A;  2VQT A;  3QOP A;  1PIV 1;  1KFX L;  2J22 A;  1Y3T A;  2IFW A;  4CPB A;  1C57 A;  1WBL A;  2F4P A;  4AVV A;  4COY A;  2NP0 A;  4ZS2 A;  3CF6 E;  5GZG A;  3POB A;  5FLH A;  1COV 1;  2RVA A;  3OGR A;  5BNO B;  4CP2 A;  4GWI A;  5IK8 A;  4NHX A;  1Q56 A;  2DVB A;  5EYX A;  1EAH 1;  2EA7 A;  2ZMN A;  4DY5 A;  2AAC A;  4LR4 A;  1OOP A;  1NQD A;  1O8P A;  3BVC A;  4W6X A;  2WQ4 A;  2E7T A;  5DQ0 A;  5DUW A;  1O4T A;  3KV9 A;  1GOF A;  4Q4Y 3;  2CAU A;  4HZF A;  5L9R A;  1NLQ A;  3AP9 A;  5F3I A;  4BQ4 A;  1WW7 A;  1W2N A;  1WUV A;  3J7M A;  1QJU 3;  2AH2 A;  2LM3 A;  1HRI 1;  2P34 A;  1RIR A;  2WBK A;  1DG6 A;  1RL3 A;  4GAL A;  4HK8 A;  1D7P M;  1FNZ A;  2UWC A;  3Q8F A;  4K6B A;  2RS5 3;  5LEJ A;  1BMV 2;  1EYB A;  2BTV C;  2GP3 A;  5T50 A;  1H8T B;  1PNF A;  2BOJ A;  4O7X A;  2BPA 2;  1Z7S 1;  4HL0 A;  1LOB A;  2JDP A;  3AMQ A;  2I2S A;  3HAG A;  3POG A;  4HG6 B;  4QQ2 A;  3TRS B;  4NHY A;  3AMN A;  3WDY A;  4LBL A;  5F3E A;  5F5C A;  4AK3 A;  4AAP A;  3AJY A;  3VDD B;  3T2O A;  1C8N A;  4EJR A;  2QBX A;  1TME 3;  3MIG A;  1UYX A;  2ZS6 B;  5A32 B;  1UKR A;  2F4L A;  4PDW C;  3CJI B;  3VKM A;  1JXN A;  1QXJ A;  3BAL A;  2W1W A;  2V09 A;  1H1A A;  4M3C B;  4PIX A;  1MS8 A;  4Q4V 1;  3RYK A;  3EYP A;  1JOP A;  4PI2 A;  1Y43 B;  5FY5 A;  1C4R A;  1LHV A;  1RC6 A;  5F2W A;  4JDM A;  4WZC A;  5JCT A;  1GV9 A;  1L7L A;  1IHM A;  4Q26 A;  3WNN A;  2C0Z A;  4FT8 A;  4JDN A;  4OYU A;  1VBA 3;  2RDN A;  4XFB A;  1AL2 3;  4COV A;  4O9E A;  1OA4 A;  2Y0O A;  3I3E A;  4UWD A;  1IG3 A;  3ZFF B;  4A44 A;  3KS7 A;  4PI0 A;  2X5I C;  2YV8 A;  1W6P A;  1F15 A;  3I2D A;  3MGU A;  3BUC A;  1BK0 A;  1WGP A;  1SFN A;  2WNU A;  2A6Y A;  5DDJ 1;  5FYU A;  4MXW A;  2ZKN A;  5KHG A;  4FPK A;  2XJS A;  4XAA A;  3ZYJ B;  2W2I A;  5C3R A;  2PHU A;  4EN9 B;  4XTP A;  4MYE A;  4MZU A;  4QPW A;  3JB8 A;  4Y24 A;  3KHB A;  3U37 A;  4BQX A;  3TNP B;  3ME2 A;  2DCT A;  1GZC A;  4Y1Z A;  3I59 A;  4P02 B;  3AKR A;  4B1L A;  1BEV 1;  2WZR 1;  5K0U A;  1RUJ 2;  5FZB A;  2MEV 2;  4LXL A;  5JMC A;  2JDN A;  4CSW A;  4CUB A;  4MGT A;  2NLR A;  4XBQ A;  1QJY 1;  1HRV 1;  1VBE 1;  4BQ2 A;  4FTB A;  1WLW A;  2R49 A;  3VZN A;  1QDO A;  4JGZ A;  5APA A;  1POV 0;  4QB2 A;  4WVW A;  1IQD C;  2GMM A;  1SLT A;  2HKX A;  2WFF 1;  4CP9 B;  2HWD 1;  3MV0 1;  3VBR A;  4QPG A;  1S55 A;  5A1F A;  2D6L X;  1IS5 A;  2RDS A;  3DYO A;  4E4Z A;  3SXW A;  3C8X A;  3USU B;  3V0A A;  4IUG A;  2E7Q A;  3ZXE A;  1CAW A;  1S0F A;  4OI2 A;  1POV 1;  4WM7 A;  1R1A 1;  2ZHK A;  4HON A;  5F5A A;  4KWK A;  2RS1 2;  1ACC A;  1ZZ9 A;  4XYX A;  5HCB A;  3WP3 A;  2IFR A;  4AI9 A;  2BEO A;  2W92 A;  4FQ4 A;  2FQP A;  1ST8 A;  4NVP A;  5DN2 A;  3M4F A;  2HWE 3;  3N7K A;  4A6O A;  1Y4W A;  2VNR A;  3WW1 A;  1GYK A;  2WT1 A;  2DU0 A;  3QH6 A;  5C9A B;  2ZAH A;  5KXE A;  2VMI A;  2H0V A;  5GLV A;  4BME A;  5JPM B;  5L36 A;  1G9B A;  1RB8 G;  4OHY A;  5FZ9 A;  2UWA A;  2ZOE B;  2XON A;  3EO6 A;  4JCK A;  4Z1V A;  2NQY A;  3DCQ A;  5JOZ A;  4AED B;  1R09 3;  1ZRR A;  5IVC A;  3VHO A;  3GDB A;  5C6C A;  2PLV 2;  3KV5 A;  4MHU A;  2J1E A;  1JYC A;  2UYB A;  4WBB A;  4AHW A;  2HWC 2;  3K77 A;  3ZSL A;  2GH8 A;  1HW5 A;  4Q0S A;  3OBT A;  4QX8 A;  3HNB M;  2FDF A;  1AYM 2;  2WZ8 A;  2FDJ A;  2GND A;  2YUE A;  3HPN A;  4ISR A;  5A7P A;  3VBU B;  3VKO A;  2ZZJ A;  4KI5 M;  1AVB A;  2D5H A;  4EQV A;  5A6Q A;  1YYN A;  2CGO A;  3KD4 A;  1XPW A;  3NJX A;  3PVO A;  3E5U A;  3CDZ B;  5IW0 A;  5DZG A;  4RR3 C;  3ZOI A;  1B35 C;  3VL9 A;  4QU2 A;  3DPR B;  1JBC A;  1K45 A;  3I2G A;  3ZKY A;  5I93 A;  1DBN A;  5FDB A;  3V0B A;  2VZQ A;  1OPO A;  3W21 A;  3D8C A;  2BER A;  5CG8 A;  4LOS A;  4WM8 A;  1IPJ A;  4N53 C;  1JU4 A;  1LR5 A;  4N9I A;  4BQY A;  4FPO B;  2A71 A;  2B8M A;  5BNN A;  4E27 A;  1RMU 3;  1UXX X;  5F1R A;  2Q8O A;  1FNY A;  5F39 A;  5FZA A;  4IEY A;  5A3T A;  2G9Z A;  3KT7 A;  3O0W A;  4YG3 A;  3THP A;  5FZF A;  4CUC A;  5LW9 A;  2XHK A;  3LEM A;  2TBV A;  4JRA A;  1UCX A;  3T4V A;  1BBT 3;  3WQ7 A;  4CDX B;  4LBQ A;  1X33 A;  2V4V A;  1OD3 A;  1RVF 3;  3LOI A;  2ZEZ A;  1VP6 A;  1LOF C;  3SH5 A;  4GH4 C;  1MEC 3;  3OY8 B;  3O1M A;  5F37 A;  1NZI A;  1CAX A;  1XOY A;  1N1T A;  3BN6 A;  3DXU A;  3D0S A;  4FFG A;  3SKJ E;  1XNB A;  2SBA A;  2VMG A;  1QMJ A;  3FHQ A;  4RD7 A;  2XUM A;  1WKY A;  3ZYP A;  4PQ9 A;  4QM8 A;  1FOD 2;  4NWW A;  3OBR A;  4QPI A;  4AE2 A;  4XJ8 A;  4A2U A;  1SEF A;  4RGK A;  5IAT A;  1ASJ 2;  2JKX A;  1UKG A;  3FZ3 A;  4YYO A;  5BNP B;  4H7M A;  3GZT B;  3T2T A;  3O1V A;  3WUD A;  3M3I A;  1OMI A;  1TNR A;  2J1R A;  4YNI A;  1ZBA 3;  5C8C A;  1I1E A;  5F8P A;  1NY7 2;  2VEC A;  3APB A;  3OD0 A;  2DU1 A;  5C70 A;  2AUY A;  2ZML A;  3ENR A;  4LA3 A;  1X9P A;  1H0B A;  3KCX A;  2BDR A;  1UU4 A;  3FUQ A;  3LFM A;  3T30 A;  1MZ6 A;  2DVF A;  4NAM A;  4RFR B;  1BZW A;  1BJQ A;  3H3U A;  5FO7 B;  3UNP A;  1OLR A;  1UWW A;  3OSD A;  4OHW A;  4CEY A;  2OZJ A;  2WNV B;  1NOV A;  5AC9 3;  5A6X A;  1DGR A;  1VPH A;  3UKN A;  3VBH B;  1GSL A;  5FP7 A;  3O1T A;  5JXJ A;  5E8A A;  5FUP A;  4IE0 A;  2MEV 1;  3WD5 A;  5KC5 A;  2XJV A;  2VZT A;  5LRR A;  1DF0 A;  4HN1 A;  5GLW A;  4LA2 A;  2WS9 3;  3I2H A;  1AR8 1;  1BYH A;  2RR1 2;  4XAC A;  2E9Q A;  5BV6 A;  1H1I A;  3MUZ 1;  2A6V A;  3LDB A;  2ARA A;  3USS A;  3SNM A;  4CPB D;  2ZMK A;  4UFL A;  2YHJ A;  3K4Z A;  3LZZ A;  3VBO A;  2R04 1;  3MPP G;  1F5J A;  1PK6 A;  4MGS A;  1CPN A;  2VTX J;  3EBR A;  3S7E A;  2W1U A;  4XC9 A;  5C8W A;  4OLL A;  1W28 A;  3EQE A;  5H9S A;  3CU7 A;  3O12 A;  2BNM A;  2RS1 1;  1PMI A;  2QQI A;  3IIA A;  3LE0 A;  2WFP A;  4JZR A;  5E1R A;  5FK8 A;  2ENR A;  4P00 B;  5H9R A;  3AB0 A;  1AR9 3;  4FOY A;  2QDN A;  1FPN 2;  2NZ9 A;  4KH9 A;  5FY9 A;  1LB2 A;  3RG0 A;  3ZX7 A;  4EZH A;  4IEQ A;  5EXO A;  1D4M 1;  2XL7 A;  2VW1 A;  3CNA A;  3POW A;  3FLT A;  3ZXK A;  4XF9 A;  3TEY A;  3QH7 A;  4FPG A;  2ZXQ A;  3N4M A;  1V00 A;  3NNM A;  4ZXE A;  2RDQ A;  1VBD 2;  4XCB A;  1J3Q A;  4XUT A;  2XUE A;  4M01 A;  4IEW A;  4C90 A;  3I2O A;  2KM2 A;  1I3H A;  4BWO A;  1T6B X;  3WXP A;  5ANN A;  2C5D A;  3TN9 3;  5IK7 A;  4LUL A;  4P9G A;  3FHA A;  4XMA A;  1HQN A;  4CUG A;  5DAQ A;  2RM2 2;  1DYK A;  1MS1 A;  4TSV A;  5TSW A;  5FYH A;  1E5R A;  2NM1 A;  2QQK A;  4O61 A;  5CKM A;  1NCR A;  1CIY A;  4EZ4 A;  2ARB A;  3AP7 A;  3AKS A;  4XUO A;  2CDP A;  5JZG C;  4G9S B;  1TZO A;  2ZBJ A;  3HBK A;  1ENR A;  2X53 S;  4V2W A;  2ZX1 A;  3U1X A;  4P5H A;  1CN1 A;  1CPM A;  1UYZ A;  2A6Z A;  1DP0 A;  4BE3 A;  1L3J A;  5KR7 A;  2QKD A;  3SEE A;  2A1X A;  4UBG A;  1VRH 2;  5C4W C;  5D21 A;  5K8S A;  4AI3 A;  3IDB B;  1VAL A;  1WCD J;  3GNE A;  1UL9 A;  4QAW A;  2HBU A;  2Z69 A;  4L2N A;  4NII A;  3R4S A;  5FZ4 A;  3AKT A;  3F95 A;  4QDR A;  3I2J A;  3P5B A;  2NPI A;  1OQD A;  1QJE A;  1UIK A;  2VTX A;  4H3W A;  1TMF 2;  4UBH A;  1V6K A;  4MLO A;  5BNO C;  1RXF A;  2BBA A;  1CR7 A;  1ULG A;  2C1F A;  1ZZC A;  4Y26 A;  5FPX A;  1OVP A;  1D0H A;  2A3Y A;  2QCS B;  3M3C A;  4W8J A;  1SHW B;  1MR5 A;  4XBL A;  3FLR A;  2JE7 A;  3I3D A;  4IV1 A;  1OOP B;  4MET A;  1QNW A;  4AVT A;  3BTZ A;  1ENQ A;  1LKN A;  3WW3 A;  2J1A A;  3WDU A;  5LA2 A;  1UMH A;  3NNG A;  1RED A;  2D43 A;  1FOD 1;  3KCC A;  5K9Y A;  3WR0 A;  1H8T C;  4NUB A;  3ZR6 A;  4QX3 A;  1OLM A;  3NJV A;  4ES8 A;  1NCQ A;  2IZW A;  3PUH A;  4SBV A;  1RUJ 3;  5IFP A;  3MEP A;  4YVW A;  5FMO S;  3NAP A;  4Q4Y 2;  3VDD C;  1NA1 A;  2CWS A;  3I54 A;  1N47 A;  5EZW A;  1R08 2;  4GAZ A;  2Z4F A;  1QJU 2;  3MLL A;  3CJI C;  1QOS A;  1O8S A;  2PA7 A;  2BU9 A;  1N1V A;  2QTW B;  1T6G C;  2RS5 2;  1QKQ A;  2VOK A;  1CAU A;  2D98 A;  4XE9 A;  4CVU A;  3UGG A;  3VZO A;  1OF4 A;  2D5F A;  3PME A;  1XNT A;  3SH4 A;  4K9S A;  1JYX A;  4CCJ A;  1GR3 A;  3I2K A;  1ULP A;  3ZN6 A;  3T08 A;  1KIT A;  4JGY A;  5FY1 A;  3EJK A;  3B3Q E;  2TEP A;  4YVS A;  4ATE A;  3RPQ A;  4XHX A;  4MGY E;  1W2U A;  2QQN A;  4OHX A;  1JYI A;  1K5J A;  1TE1 B;  2PQQ A;  4ASL A;  1G9F A;  2A75 A;  3RRD A;  3ZXJ A;  3ZDV A;  5L9V A;  4AW7 A;  1H30 A;  4FP3 A;  1KS5 A;  1XND A;  1YNA A;  1JZ5 A;  3AL5 A;  4CE8 A;  1W6P B;  4K7J A;  3RNS A;  2PTM A;  3B69 A;  4JDO A;  5FP3 A;  2YYO A;  3RZJ A;  4LE3 A;  3OBA A;  1SLC A;  2WNU B;  4XDQ A;  5FUN A;  4MXW B;  3NJY A;  5IK5 A;  2OW4 A;  3FJS A;  1XNK A;  2EIE A;  3P3N A;  2B42 B;  1AL2 2;  2GC0 A;  3QCW A;  4OMC A;  4AYU A;  3J8F 3;  4F83 A;  2ZGM A;  2QZ3 A;  1FV2 A;  1TQ5 A;  1EP0 A;  2PLV 3;  3UKV A;  4DXS A;  3MIF A;  5GAL A;  4S2D A;  3UKT A;  1BVV A;  2WL1 A;  2HWC 3;  2YBS A;  1O3T A;  1W6N A;  1F9K A;  1OT5 A;  3I59 B;  4U2A A;  2H6B A;  5AVP A;  1AYM 3;  5GZF A;  2O8O A;  3O1P A;  4HKL A;  5K0U B;  5LK7 B;  4YW4 A;  3CZU A;  4XF0 A;  3CJX A;  3RZM A;  1REE A;  4UFM A;  2W39 A;  4PF5 A;  2VW0 A;  1VBD 1;  1K5M C;  3AZX A;  3DEC A;  3KSC A;  4AGG A;  1EPW A;  2Y64 A;  1N3O A;  2WT2 A;  3HT2 A;  4JGZ B;  4QHZ A;  5IFT A;  1QJX 3;  4LBQ D;  1AHS A;  4RHV 2;  3VBR B;  5KXD A;  1P8J A;  4QPG B;  5GJ6 A;  2WA4 A;  1XSQ A;  4QX5 A;  2A70 A;  2WO3 A;  3Q8B A;  3SH3 A;  1UZZ A;  4K40 A;  4PBO A;  3W59 A;  2XVG A;  4GB3 2;  1PHM A;  3V0A B;  3ECQ A;  3RDI A;  4CDW A;  3KWV A;  1CAW B;  3GBF A;  2R07 1;  3HJR A;  4WM7 B;  4GUL A;  2JDH A;  3VBF A;  3H42 B;  5FZ1 A;  3PJQ A;  3OEA A;  3C7O A;  2V5D A;  2HYX A;  4UW6 A;  5CNA A;  5C9A C;  4LKD A;  2VD7 A;  4PJY A;  1RUI 2;  5SV5 A;  3PUR A;  4B3N A;  3FFQ A;  3U07 A;  4QQO A;  3NV4 A;  4DIQ A;  1PGW 2;  1GP6 A;  2ZEX A;  2VE1 A;  3PIJ A;  1YQ6 A;  3IT8 A;  4HBN A;  4AED C;  4K8R B;  2JDY A;  1VRH 1;  4B29 A;  3J9S A;  4IET A;  1F35 A;  1LEC A;  4BLI A;  4DZG A;  1FX5 A;  1RHI 3;  3SEP A;  3V65 A;  1EUU A;  1VMF A;  3T1M A;  2RJL A;  1WMX A;  1AXK A;  1Q8S A;  2AC1 A;  4DUW A;  4DFS A;  3VBU C;  1GBG A;  2FZ1 A;  2R06 1;  3WDX A;  3D5O A;  1AR7 1;  1ASJ 3;  2UYA A;  3T0D A;  1G9A A;  2BWC A;  2Y6J A;  1CES A;  2XBO 2;  4FXK B;  4J1X A;  2DBN A;  4KL1 A;  4FPJ A;  4KWU A;  1UYP A;  4I3G A;  1R09 2;  4XMI A;  4MAD A;  1JZ6 A;  3DPR C;  3C7H A;  4AG4 A;  2R16 A;  1LOG A;  3DYP A;  3QAC A;  4YFZ A;  2Y60 A;  4XUN A;  4YZ3 A;  3WDV A;  4DIN B;  4A7Z A;  3V0B B;  3IMN A;  3JB4 C;  2JEN A;  4W50 A;  1KQR A;  5FV3 A;  3PUS A;  4LO8 A;  2YC0 A;  2OA2 A;  4OFG A;  4WM8 B;  3L2H A;  1H6X A;  1U5I A;  3ZN4 A;  2VZS A;  3ZSM A;  5BNN B;  5A3M A;  1O5U A;  4Q4Y 1;  3I3M A;  4XUP A;  1CON A;  4PCR A;  2VZV A;  5F5Q A;  5LEK A;  4HAN A;  5FBJ A;  5JXH A;  3ON7 A;  2VOX A;  1DGR N;  1W9Y A;  1QJU 1;  3ZSE A;  4BQ5 A;  3C7E A;  3SLI A;  2RR1 3;  2GZW A;  4LBQ B;  4ASM B;  2RS5 1;  5L19 A;  1ZZ8 A;  2J1V A;  1MZF A;  4FPH A;  5CZK A;  5HV4 A;  4Q0P A;  3LQC A;  4GD4 A;  1OVS A;  5FKB A;  4CUA A;  1CAX B;  3LSD A;  4CDQ A;  5EIY B;  2WO2 A;  1WLT A;  1ODM A;  1V6N A;  2P3K A;  1JZ2 A;  1MS0 A;  4FTE A;  2VGD A;  5BNP C;  3GZE A;  1TME 1;  4OQ9 A;  3LF7 A;  3OYW A;  4Z82 A;  4QPI B;  1Z0H A;  1PX4 A;  3AMP A;  2AYH A;  2IXK A;  4ZZ5 A;  1DZT A;  4EWA A;  5F3C A;  1GKB A;  1MEC 2;  4CXX A;  3PLQ A;  1MQT A;  1OUS A;  1FPN 3;  4LLO A;  4XCA A;  4URT A;  4Y22 A;  4TZD A;  1F2N A;  2YPD A;  2G1M A;  3UK9 A;  1FXZ A;  5C8C B;  1G6N A;  2JDK A;  3EHK A;  3HMY A;  3K2O A;  3OGG A;  4G3Y C;  2ET7 A;  3VN4 A;  2A3W A;  2RS3 2;  4W6Y A;  1VBA 1;  4Q8K A;  1W6Q A;  3U14 A;  1AL2 1;  1M4W A;  1OFS A;  4GKX A;  4L8Q A;  3AC0 A;  2WNV C;  1WA4 A;  4DRR A;  1V6M A;  3FFZ A;  1X50 A;  3NO8 A;  5T5L A;  4HPK A;  4RS5 C;  1VMJ A;  4CEY B;  1RUD 3;  2XPJ A;  4D6Q A;  2XB6 C;  4YZ4 A;  4BDV B;  3H1Y A;  4OUE A;  2JIG A;  3HBZ A;  2GP5 A;  1OA2 A;  2HH9 A;  1VRB A;  2WA3 A;  1HB3 A;  4Q2F A;  4XET A;  3JD7 2;  5FKC A;  1O4Y A;  1PMH X;  4PLM A;  2CGP A;  1C1L A;  1CJP A;  1LEN A;  4IEO A;  3HNY M;  4LE4 A;  2VME A;  3VKF C;  4QHO A;  3HQU A;  2RM2 3;  3N7L A;  3NKG A;  2OII A;  3ZFE A;  3AKP A;  4JRL A;  1O3S A;  5T3N A;  5FPB A;  4IGP A;  5FZM A;  4HVO A;  3H8X A;  3LA2 A;  4GJY A;  2TNF A;  2NMO A;  4RQP C;  3E97 A;  3VBO B;  4ORF A;  1YRZ A;  2P3J A;  4N7I A;  1PK6 B;  2Q1F A;  5C3O A;  2VMH A;  5FOJ B;  1VBB 3;  4Q1P A;  2J7M A;  4AQS A;  4HVQ A;  2VMF A;  1V6I A;  1MS5 A;  1WCU A;  2VBD A;  3MLJ A;  1ZVF A;  4MOA A;  5JUV A;  5DZE A;  4MUV A;  3TEX A;  1GZT A;  3ZKU A;  1PGL 1;  3Q8E A;  2E53 A;  3PDQ A;  3OG2 A;  1A78 A;  4YW2 A;  1TMF 3;  4I0W B;  3M1H A;  4KQ7 A;  2D6O X;  3KVA A;  3ZPY A;  2J1T A;  3IDC B;  4DUV A;  2G9F A;  2D7F A;  1O7F A;  3PTR B;  5ACA 2;  1M06 G;  4Y1U A;  3IBM A;  1OUX A;  2LW8 A;  1IKP A;  1R1Z A;  3R4D B;  5FWE A;  4W6W A;  3S7I A;  2LRP A;  1NXD 1;  1XNA A;  1TG7 A;  2HWE 1;  1AR9 2;  1SFP A;  2WN2 A;  4XUR A;  2BWA A;  3P6B A;  2ZGU A;  4ISQ A;  5A7O A;  1WW4 A;  4B4Q A;  4MXV A;  1RUE 2;  4XDO A;  1J1L A;  1AX0 A;  3OUI A;  3ZXD A;  1C1F A;  2JWP A;  1QQP 2;  4GA9 A;  3KB5 A;  5A3O A;  5J09 A;  1X36 A;  5J36 A;  1XNC A;  5A6Y A;  3VD9 A;  1R09 1;  4YZ5 A;  4BB3 A;  2YBK A;  4UFH A;  2B4K A;  4ZU4 A;  4XDP A;  4QXC A;  3OUJ A;  3KLS A;  1AX2 A;  5ERL A;  5I8Y A;  3H7Y A;  1V0A A;  4XJU A;  5JI9 A;  1POQ A;  4IEX A;  1R08 3;  1NCR B;  1JZ4 A;  3QBQ A;  4IEZ A;  4Q0V A;  4CDU A;  2GC1 A;  2C24 A;  4UT5 A;  4AZZ A;  4I3P A;  1WCQ A;  1SLB A;  2K9Z A;  3VZJ A;  3AXE A;  3AMH A;  4YFW A;  3MO4 A;  3TN9 2;  5JXI A;  1HXS 2;  4UYB A;  4CCC A;  3JU9 A;  3III A;  4YRD A;  5IVF A;  4D7Y A;  3KGZ A;  3MFC A;  4IEU A;  1DQ0 A;  4PF1 A;  5EPA A;  1NG0 A;  3WNL A;  5BY5 A;  1N1Y A;  1V9U 2;  3PNA A;  3RVH A;  1YIP A;  3RQ0 A;  5EYY A;  2GN3 A;  5IJR A;  5FP9 A;  1QXR A;  2ES3 A;  2XG3 A;  1N1S A;  4K1Z A;  1ZBE 2;  4XJ9 A;  2YU2 A;  1GIC A;  4YAR A;  2VL4 A;  3LCP A;  4XFA A;  4C0B A;  3B94 A;  3JBG 3;  1RMU 1;  2OS2 A;  2X10 A;  3C7F A;  3GCX A;  3KV6 A;  3Q8A A;  1UAI A;  3SCH A;  3WIN E;  1OOP C;  2E6V A;  2ARC A;  5I0R A;  3O1S A;  1UO9 A;  3N7M A;  4AVS A;  4AI2 A;  4I02 A;  4P9J A;  4YPJ A;  4IV1 B;  3LKJ A;  1BBT 1;  1YIF A;  2Z79 A;  4AQ2 A;  4AR2 A;  4I30 A;  4AVC A;  1RVF 1;  1JS9 A;  5HBA A;  4K3U A;  2QQV A;  1W90 A;  5F3G A;  1NE4 A;  1ULD A;  2DFC A;  2VUD A;  2VAU A;  1MEC 1;  3B00 A;  2QQM A;  2KD7 A;  2B5H A;  5FPL A;  1Y9Q A;  3HT1 A;  3OGS A;  4GXL A;  1NCQ B;  5JI7 A;  2QQL A;  4ET7 A;  1YXW A;  4N9H A;  4YVW B;  3NAP B;  2UY9 A;  1NA1 B;  3ACL A;  1JYV A;  1I5P A;  2VBP A;  2VXR A;  4X8N A;  4XIO A;  3BIW E;  2GSY A;  3AKQ A;  5CA6 A;  4AFM A;  4FSJ A;  2QZ2 A;  1CAU B;  2Y6H A;  4ARY A;  5FBZ A;  1ZBA 1;  1ENX A;  1JUH A;  4Q0U A;  4RHV 3;  4RSU A;  3PUI A;  1W8F A;  5AFB A;  3ZMO A;  5JSR A;  2H0B A;  4DXZ A;  4LPL A;  5JPN B;  1XE0 A;  2BRT A;  3HOB A;  2B9U A;  4KNC A;  1J3P A;  4L92 A;  4GB3 3;  4XZU G;  4Q27 A;  1JUI A;  3J7H A;  5KWR A;  4E4D X;  4C1W A;  3ZN6 B;  5FOB B;  2GDF A;  4JGY B;  4QX2 A;  3WG1 A;  4I2O A;  2W47 A;  1W9S A;  4YVS B;  1YJK A;  2GN7 A;  1WBF A;  4IE7 A;  3ZLI A;  3K46 A;  1B09 A;  5AC9 1;  1RUI 3;  3S6P A;  3VHR A;  1MS4 A;  2WNU C;  4AAX A;  3FX3 A;  5FJK A;  1HX6 A;  1W0P A;  4N7U A;  1SCR A;  1FV3 A;  5LBC A;  3D4K A;  2BQP A;  1S0E A;  1PX3 A;  2IWG B;  2P3I A;  4LLF A;  1C5H A;  3O0V A;  1AXZ A;  4QDQ A;  3DXT A;  4M0N A;  4AGV A;  3UJQ A;  2WS9 1;  1ZZB A;  1H2L A;  3BTA A;  1G8W A;  3RI9 A;  1O59 A;  1XC6 A;  4I01 A;  2XGX A;  2ATF A;  3DKQ A;  1V6J A;  3LEI A;  1XU2 A;  1I9R A;  2P4E A;  5IYY A;  2ZGN A;  2W68 A;  1W6N B;  1HLC A;  2QNK A;  1E5H A;  4I0B A;  5K0U C;  3RZG A;  1NX9 A;  2ZZQ A;  4MV2 A;  2OPW A;  2CL2 A;  3M70 A;  4KGG A;  4CEW A;  4EWE A;  2XBO 3;  4AWD A;  1H2K A;  4AHZ A;  1LGN A;  2ZGO A;  3CKH A;  3J8F 2;  1UY1 A;  3E1F 1;  4C91 A;  1GMM A;  4JGZ C;  5LA0 A;  1OI6 A;  4HT1 T;  4A45 A;  1JMU B;  3LOB A;  1OH4 A;  1AR9 1;  1YQ2 A;  3VBR C;  4QPG C;  4S2F A;  5GLU A;  5DXD A;  1L7Q A;  5T5O A;  3TYJ A;  2FMD A;  5IVY A;  5CB7 A;  1W6O A;  3OTF A;  3Q8C A;  4P9L A;  1UPI A;  4Q1R A;  4XFG A;  4WM7 C;  4XQ4 A;  4MO3 M;  4XEZ A;  4IV3 C;  1D2Q A;  4CDW B;  3O1R A;  2HYK A;  4UF0 A;  4CU9 A;  4KMQ A;  3CZJ A;  1OUR A;  2D6P A;  1OLQ A;  2XML A;  1KEX A;  1IZ3 A;  3VBF B;  4F7Z A;  1HQL A;  4HN0 A;  1QJX 2;  4HMZ A;  2IVJ A;  4Z92 B;  3W20 A;  1VBC 2;  3BOW A;  4KU7 A;  4HXC A;  4OUM A;  4FTS A;  1BMV 1;  3TN9 1;  2FCU A;  3FBY A;  4HSJ A;  3D3A A;  4W65 A;  3VGI A;  1EV1 2;  1QEX A;  1QY4 A;  3H50 A;  2HLE A;  1DQ6 A;  1EUT A;  4FOV A;  1D4V B;  4UXA A;  1ZRE A;  2BJS A;  2CDO A;  3TWI A;  2NN8 A;  4UAP A;  4NN0 A;  1EPZ A;  1ZZ6 A;  1DIW A;  2XJU A;  3H8U A;  4B1M A;  3NL1 A;  4JHZ A;  5FPU A;  1DU3 D;  4FPL A;  1H2N A;  2ADD A;  1A6C A;  3DN7 A;  4D6S A;  5I8S A;  5EP9 A;  4BM8 A;  3ES4 A;  1I5Z A;  2JDZ A;  2Z2S B;  2HBT A;  1ZA7 A;  1LJ7 A;  3KM5 A;  3BB6 A;  1RHI 2;  2E31 A;  1UMZ A;  3IAP A;  3GGL A;  4WVZ A;  4M00 A;  3ACF A;  4BIS A;  1KJR A;  2RS3 3;  2JE9 A;  3IB3 A;  5CBL A;  1GWK A;  4AOC A;  4FBF A;  3MI8 A;  2HWB 2;  2XQX A;  1W9T A;  1EY2 A;  4XIL A;  5JVV A;  4WM8 C;  2Q8C A;  1RUC 3;  3PVN A;  3ZMN A;  2ZJC A;  3ETP A;  2K0G A;  4LEJ A;  5FPV A;  1UN1 A;  1CAV A;  1US3 A;  2WYF A;  4PIY A;  5BNN C;  1BQP A;  5CFC A;  3L2Y A;  3M7A A;  4EN0 A;  5BPX A;  5AFE A;  3U0Z A;  2FDG A;  2BV4 A;  1CZS A;  5FPZ A;  1QWR A;  2VQU A;  3MID A;  1ULF A;  1H6Y A;  2ILM A;  1HN1 A;  2OZ6 A;  3JD7 3;  4RA0 A;  1A3K A;  1HB2 A;  1PZ9 A;  3LD8 A;  2GMP A;  2W3J A;  3ZYI B;  4DO0 A;  3AZW A;  5A1A A;  1F4A A;  3PJY A;  2FCV A;  1UY2 A;  1KD7 A;  3INA A;  4LBK A;  1J3R A;  2R1B A;  4C0H A;  1W0O A;  1GWM A;  3LEK A;  4QQH A;  5FPA A;  4BK4 A;  3UGH A;  2AEZ A;  5BYN A;  1HN0 A;  1A8M A;  5EFU A;  1RUJ 1;  4I0A A;  4KGQ A;  3THT A;  1X8E A;  1HDK A;  4CDQ B;  4UFK A;  4HSL A;  4XTM A;  4DPN A;  4QPI C;  4COU A;  2PYT A;  5E6H A;  3G6J B;  4FPY A;  3AZV A;  1VJ2 A;  1JI6 A;  3BOD A;  3OYW B;  1CD3 G;  1RUH 2;  3LGR A;  3KT4 A;  2JD4 A;  3D0J A;  5C8C C;  1MQT B;  2XKO A;  3J7L A;  1W8T A;  3GAL A;  4Y22 B;  2X05 A;  3ZXG A;  1WMD A;  4AHY A;  4QKD A;  1J84 A;  2ARX A;  5C5T A;  1ND3 A;  1BXH A;  2B9V A;  2XJQ A;  3K4A A;  4K21 A;  5F9T A;  3PU8 A;  3ZDS A;  3WVJ A;  4K8F A;  3JUU A;  1DQ4 A;  4TXW A;  2Q0A A;  4LIU A;  3OPW A;  4Y1X A;  2C9K A;  4YGB A;  1W6Q B;  5ACA 3;  4LO4 B;  1OPM A;  4Q8L A;  3WT3 A;  1LES A;  4CEY C;  1RUO A;  3GF6 A;  1FT9 A;  2JKB A;  3H9A A;  3R0R A;  1ZRD A;  3OJB A;  3NJZ A;  3K3O A;  5C3S A;  4HPK B;  4ZS3 A;  4ONU A;  4E4H A;  1RUE 3;  4AFB A;  2CWM A;  4HET A;  2B45 X;  4AQT A;  5IVV A;  2DDU A;  2QQU A;  1QQP 3;  5FO8 B;  1K12 A;  3VBS C;  1D0G A;  3WOG A;  1WD3 A;  2P17 A;  4Q5O A;  2VQA A;  3J8F 1;  5KBF A;  4MGZ E;  3WHU A;  2CNA A;  3GXU A;  4Q4X 2;  1UF2 C;  2KA3 A;  2J1S A;  2PLV 1;  5ANQ A;  2O1Q A;  2Q1M A;  3ZFE B;  2VUL A;  2EF6 A;  1RUD 2;  2HWC 1;  1C8M 2;  5FY4 A;  4QXH A;  5JOY A;  1LHW A;  3VBO C;  2FHR A;  1H4G A;  5I0U A;  1C3H A;  1AYM 1;  1GOG A;  1PK6 C;  2W1Q A;  4OZO A;  4DOU A;  1DZQ A;  4Y5T A;  2FBE A;  2WR9 A;  2PN5 A;  5JAX A;  5FIX A;  1HXS 3;  3N9P A;  2FDH A;  3AYC A;  5GKA C;  4HKO A;  1QNY A;  5JSO A;  1V9U 3;  1H4H A;  1LGC A;  4QM9 A;  3NW4 A;  3OEB A;  1QJX 1;  4M3C E;  3BYW A;  2F6B A;  3U4S A;  3LA7 A;  2BP6 A;  2F17 A;  1QOT A;  4AXO A;  4AFD A;  5FY7 A;  1ZBE 3;  3ALQ A;  2EIG A;  5IUQ A;  3I4I A;  1VBB 2;  4OMD A;  3MW4 A;  2ETE A;  3MYX A;  2O8Q A;  1UZV A;  1AL0 G;  1GNH A;  1GQG A;  1PO1 2;  1UQX A;  3BGA A;  3HQR A;  3KCY A;  3MLK A;  1ZA4 A;  1TVG A;  2IUW A;  5LRS A;  5FMD A;  3GBW A;  5KXB A;  1QU0 A;  2VU9 A;  3B9I A;  3MIB A;  2V73 A;  4W4Z A;  3MZH A;  4UI9 L;  5CU1 A;  2WWJ A;  5A7W A;  1QXP A;  2HEW F;  4NIH A;  1DGL A;  3WF1 A;  1OQE A;  3JCI A;  4CXW A;  1JYT A;  2ZGS A;  4DXT A;  1SAC A;  1IGO A;  2GAL A;  3AX4 A;  3JZV A;  5EQU A;  2GNT A;  2VUA A;  3SCG A;  3NNF A;  4QXK A;  4RN5 A;  5T5P A;  4COW A;  5KC6 A;  1DHK B;  4FAG A;  1JOD A;  2PHF A;  1DYP A;  5D8A A;  4DS0 A;  1RHI 1;  2EXI A;  3LWC A;  4A42 A;  5GM0 A;  1NCR C;  2O14 A;  5E88 A;  4PLO A;  1J83 A;  1JHJ A;  2WYS A;  1UY0 A;  1OH3 A;  1CQ9 A;  3O5S A;  3T2P A;  1ASJ 1;  3S57 A;  1W9W A;  4LK6 A;  5GZC A;  1AF9 A;  5BNQ A;  4UOJ A;  4CDU B;  3C7G A;  1UW8 A;  5ABJ A;  4OI0 A;  2VCB A;  1Y7B A;  4Q4W 2;  4OI1 A;  2D3P A;  1NY7 1;  2ZEY A;  3M3O A;  4ZU5 A;  1WLD A;  4CCK A;  3E6B A;  4EN7 B;  3ELN A;  1XB9 A;  2R6Q A;  3SMH A;  2R0H A;  1PVC 2;  3ACI A;  1U5X A;  3VL8 A;  2YGL A;  2EIC A;  2YFZ A;  3B7M A;  4NPR A;  2VZ1 A;  2WWS A;  4FFF A;  5FZ3 A;  4DNY A;  1HV0 A;  1W05 A;  3EXU A;  5HXV A;  1G86 A;  5JIU A;  5FMC A;  3A0N A;  1XJA A;  2JIJ A;  3HD8 B;  1SLA A;  3J26 N;  1DQ5 A;  3CMG A;  4PT6 A;  1QOO A;  3LEG A;  4ZON A;  4LBN A;  4CTE A;  1UYY A;  2XR4 A;  3A21 A;  5EJ1 B;  4EN8 B;  4IV1 C;  4IES A;  1HV1 A;  1ND2 A;  2FDK A;  2JG8 A;  4NIA A;  1VE0 A;  4WVM A;  5J1X A;  2P5B A;  1AYN 2;  4JV4 A;  3PIG A;  3ZFF C;  3M3Q A;  1VB2 A;  2RR1 1;  1CZV A;  3MIC A; 
#chains in the Genus database with same CATH homology
 2VJX A;  5F7U A;  4QPW A;  5LCW L;  2WQ8 A;  2Y6L A;  3U37 A;  3AC0 A;  1KGY A;  2VC9 A;  4P02 B;  2WDB A;  3UES A;  3W5N A;  4L0P A;  4BDV B;  2RV9 A;  2DCK A;  4QB1 A;  4OUE A;  4CUB A;  2Y6G A;  2YB7 A;  1K42 A;  1PMH X;  3WF2 A;  3HNY M;  2VMD A;  2VME A;  2VZR A;  4QB2 A;  1IQD C;  3MV0 1;  3HEI A;  4QX0 A;  3DYO A;  2BGP A;  3VD5 A;  2ORZ A;  5G05 L;  3C8X A;  2YC4 A;  4IUG A;  1SDD B;  4QX1 A;  3DYM A;  2LS6 A;  2J7M A;  4BK5 A;  3WNM A;  2VMF A;  2W92 A;  4A6O A;  5DN2 A;  3T09 A;  2VR4 A;  4MOA A;  5B4X A;  5JUV A;  4LQR A;  4D8M A;  3OG2 A;  5JXG A;  2J1T A;  2XON A;  4DUV A;  1JYN A;  4M4P A;  3GDB A;  3T2Q A;  2J1E A;  2LW8 A;  1NAE A;  3K77 A;  1XNA A;  1TG7 A;  2WN2 A;  4XUR A;  3HNB M;  3P6B A;  2WZ8 A;  3HPN A;  4KI5 M;  3SKV A;  1XPW A;  3NJX A;  1DLC A;  3CDZ B;  5I0D A;  3VD9 A;  3NRU A;  1K45 A;  2B4K A;  3I2G A;  1W8N A;  3FL7 A;  3WNO A;  2VZQ A;  3A7Q A;  1JZ4 A;  2BER A;  1JU4 A;  1WCQ A;  1UXX X;  2ID4 A;  3MO4 A;  4DEV A;  5JXI A;  1JZ7 A;  3III A;  4CUC A;  3VD3 A;  3VDC A;  2W94 A;  3T0B A;  4PF1 A;  3WNL A;  5HXM A;  2JD9 A;  2V4V A;  1OD3 A;  1GQP A;  3OGV A;  5IJR A;  5HPO A;  2ZEZ A;  4BJ0 A;  4A4A A;  5IHR A;  2VL4 A;  3WF0 A;  3BN6 A;  2VZU A;  2X10 A;  3C7F A;  3HN3 A;  3FHQ A;  1WKY A;  2PQS A;  4YPJ A;  4ZZ8 A;  2W91 A;  2JKX A;  5EJZ B;  3THD A;  1CX1 A;  4DXR A;  1UZ0 A;  3VD4 A;  3CQO A;  3VD7 A;  2J1R A;  4FI9 A;  1GNY A;  5C70 A;  2QQM A;  2YC2 A;  2KD7 A;  3ZM8 A;  2JE8 A;  3OGS A;  2QQL A;  4ET7 A;  1LNS A;  3I3B A;  4ZY9 A;  3UNP A;  1UWW A;  1JYV A;  1I5P A;  3IDA A;  5JMO A;  2OKX A;  4ARX A;  3MUY 1;  2XHN A;  3WNP A;  3IAQ A;  2Y6H A;  3WQB A;  4ARY A;  5JXJ A;  3PUI A;  1GOH A;  2VZT A;  4LPL A;  3HOB A;  4XZU G;  2V72 A;  3I2H A;  5C71 A;  3J7H A;  2JDA A;  3P1I A;  3MUZ 1;  4QX2 A;  5JR2 A;  3I2F A;  1JYW A;  2W47 A;  1W9S A;  1W99 A;  3K4Z A;  4DEQ A;  3K46 A;  3WNK A;  4MGS A;  2W1U A;  4AAX A;  4XUQ A;  1PX3 A;  2QQI A;  3LE0 A;  2VMC A;  4QDQ A;  4P00 B;  2VOT A;  3THC A;  2YFU A;  1GUI A;  1O59 A;  1XC6 A;  3LEI A;  4QDS A;  5IYY A;  4CU8 A;  5CYY A;  1UXZ A;  1NX9 A;  2ZXQ A;  4ZXE A;  2EIB A;  4XUT A;  3CKH A;  1R64 A;  1UY1 A;  3E1F 1;  1GMM A;  4JKK A;  5LA0 A;  4A45 A;  1OH4 A;  1YQ2 A;  4RYD A;  1L7Q A;  2ZEW A;  2WN3 A;  3FHA A;  3NQH A;  3T0A A;  2QQJ A;  4E8D A;  2QQK A;  4MO3 M;  3I2I A;  2W87 A;  1CIY A;  1OF3 A;  3VDA A;  3WEZ A;  4CU9 A;  4KMQ A;  3CZJ A;  4XUO A;  2CDP A;  1UX7 A;  1KEX A;  1UYZ A;  1DP0 A;  3WF4 A;  3A22 A;  3SEE A;  3MV1 1;  2VM9 A;  1L7R A;  1UY3 A;  3D3A A;  4QAW A;  3K4D A;  2HLE A;  1EUT A;  4QDR A;  2WZE A;  3I2J A;  3GM8 A;  4JX0 A;  2CDO A;  4UAP A;  2BBA A;  4JHZ A;  2WAO A;  1RYY A;  2R7E B;  1ULO A;  4W8J A;  3I97 A;  1SHW B;  4GZ9 A;  3LPF A;  3I3D A;  1JZ3 A;  3FN9 A;  2J1A A;  2Y6K A;  2E31 A;  3IAP A;  3GGL A;  5LA2 A;  4JKM A;  1UMH A;  3HNM A;  3ACF A;  3NNG A;  5FUI A;  3IB3 A;  2QQO A;  2W46 A;  2J1U A;  2VZP A;  3LPG A;  3CIH A;  2XQX A;  3NJV A;  1W9T A;  4QX3 A;  3A23 A;  3ETP A;  3PUH A;  1PMJ X;  1US3 A;  3ABZ A;  1US2 A;  5IFP A;  4A3Z A;  1CZS A;  1W8O A;  2VQU A;  1W0N A;  1H6Y A;  1HN1 A;  2Z4F A;  4E8C A;  1O8S A;  3F2Z A;  2L9L A;  4LKS A;  2W3J A;  5A1A A;  2C4X A;  2WAA A;  1F4A A;  4CVU A;  1UY2 A;  1OF4 A;  1K3I A;  1XNT A;  3LEK A;  3W5M A;  1JYX A;  4MGQ A;  4BK4 A;  3I2K A;  1ULP A;  3JXS A;  4P08 A;  2VTF A;  3T08 A;  2BGO A;  2VO5 A;  4CU6 A;  4QB6 A;  4CU7 A;  5DMY A;  2QQN A;  1JU3 A;  2E26 A;  2ORX A;  3MBW A;  3VDB A;  2DCJ A;  1MPX A;  1JI6 A;  1JZ5 A;  2Y8K A;  4DUX A;  5C7G A;  3OBA A;  2X05 A;  2C26 A;  5LA1 A;  2WAB A;  3WF3 A;  1J84 A;  2EIE A;  4OMC A;  2B9V A;  3K4A A;  1T2X A;  4TXW A;  4DXS A;  3ACG A;  2C9K A;  1OT5 A;  3CZU A;  2DDU A;  3EB7 A;  2VZ3 A;  1K12 A;  4GWJ A;  3DEC A;  3GXU A;  2Y64 A;  5IFT A;  2J1S A;  5DPN A;  2VCA A;  1P8J A;  1NKG A;  2WO3 A;  2W1S A;  1GOG A;  1UMI A;  1NUK A;  2W1Q A;  4OZO A;  3ECQ A;  4Z2A A;  2E32 A;  2W5F A;  3HJR A;  3OEA A;  3C7O A;  2V5D A;  2HYX A;  2XOM A;  4XVH A;  5B4N A;  2BZD A;  4M4R A;  3WSO A;  3OEB A;  2W95 A;  4TTG A;  4JKL A;  2ZEX A;  2W9X A;  1BHG A;  2VCC A;  1DYO A;  2VQT A;  4OMD A;  2J22 A;  3BGA A;  3SEP A;  2E33 A;  4A41 A;  1EUU A;  1TVG A;  4DUW A;  2WO1 A;  2RVA A;  3OGR A;  4GWI A;  4W4Z A;  1F4H A;  4UI9 L;  3T0D A;  3WF1 A;  2Y6J A;  4KWU A;  1O8P A;  4DXT A;  5DQ0 A;  1GOF A;  4MAD A;  1JZ6 A;  3C7H A;  4RN5 A;  4AG4 A;  4BXS V;  1JZ8 A;  3DYP A;  3OB8 A;  3SKJ E;  2WBK A;  1D7P M;  4XUN A;  4A42 A;  2WUH A;  3ACH A;  1J83 A;  1GU3 A;  1JHJ A;  4W50 A;  2WYS A;  1UY0 A;  4D0Q A;  3T2P A;  1W9W A;  4HG6 B;  4UOJ A;  3C7G A;  1H6X A;  3K75 B;  2VZS A;  2VCB A;  4XUP A;  3T2O A;  2VZV A;  2ZEY A;  2QBX A;  5JXH A;  1UYX A;  3UET A;  2W1W A;  3C7E A;  4PQQ A;  3ACI A;  2EID A;  2EIC A;  2J1V A;  2YFZ A;  3EYP A;  2VZ1 A;  2YG0 A;  4LHS A;  2VZO A;  5CZK A;  2X09 A;  3LQC A;  4CUA A;  4PT6 A;  3CMG A;  3WNN A;  5EIY B;  3LEG A;  4OYU A;  4P5Y A;  2WO2 A;  1UYY A;  5EJ1 B;  3A21 A;  3I3E A;  1UY4 A;  1JZ2 A;  1CZT A;  4A44 A;  1SG3 A;  5J1X A;  1PX4 A;  4ZZ5 A;  5G04 L;  2RJ2 A;  1CZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...