2HLEA

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
188
Chain Sequence
b'AGHHHHHHEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-B receptor 4
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
total genus 31
structure length 188
sequence length 188
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hleA00
3NNGA 1UY0A 5JXJA 1UYXA 3I97A 4JKMA 3PUHA 3THDA 1JZ8A 3I2HA 2ZEZA 5EJ1B 2V72A 1R64A 2VQUA 2VZ1A 4LQRA 3DYMA 4DXRA 4AAXA 2VM9A 2VC9A 2OKXA 5J1XA 2J1AA 2DCJA 3ACHA 3WNNA 2VMCA 1UMIA 4PT6A 4FI9A 2W1QA 3VDCA 4D0QA 5JXGA 4CUCA 5C71A 1JI6A 4CUAA 3C7EA 1DLCA 2Z4FA 2X10A 4M4RA 5C7GA 1JYVA 1JZ5A 5JMOA 1L7QA 2J1UA 3WF2A 1D7PM 3ACFA 2J1RA 1UYYA 1MPXA 1HN1A 2VTFA 3HOBA 1K12A 3IB3A 3VD3A 4BXSV 1RYYA 2YC2A 3A22A 4M4PA 3IAQA 2ID4A 3JXSA 1GQPA 3MO4A 2BGPA 3ECQA 5LA0A 2JKXA 4W8JA 3WQBA 3CMGA 2W94A 4TXWA 2DDUA 5HXMA 1W8OA 3P1IA 3VDAA 3DYOA 1UY3A 4BDVB 4XUNA 3SEEA 3GXUA 1J84A 2J1EA 5CZKA 1YQ2A 4P5YA 3CIHA 4MGSA 1CZTA 3WSOA 4DUWA 3HPNA 4OZOA 5C70A 5DN2A 4DXTA 4KMQA 2ZEWA 2WYSA 3ABZA 3UESA 2VZTA 2QQJA 4CU8A 1F4AA 5DQ0A 2WBKA 3NRUA 2HLEA 1P8JA 4GWIA 4BK4A 2VZPA 3AC0A 4P00B 4E8CA 1CIYA 3WNOA 3EYPA 2WZ8A 4DUXA 4LKSA 3K4AA 3K46A 2YG0A 1GNYA 2ZXQA 3MUY1 2WO1A 4RYDA 2WN2A 2JDAA 2WN3A 4KI5M 2VZSA 3SEPA 1UY2A 3WNLA 1CZSA 3WEZA 4OUEA 1SDDB 4XURA 2Y6LA 2W87A 1ULOA 1O8PA 3T2QA 1UMHA 2VOTA 3K75B 3W5MA 3HN3A 3U37A 4MO3M 2VZ3A 4JX0A 3SKVA 2VCCA 4MADA 3CKHA 3LEKA 5IFTA 1GMMA 4GWJA 1JU3A 4KWUA 2ZEYA 4P08A 3EB7A 3A23A 2RVAA 2XONA 4ARXA 4YPJA 3DECA 3ZM8A 4A3ZA 2C9KA 3K4DA 4P02B 4OMCA 3HEIA 5CYYA 5IYYA 1DYOA 2L9LA 2VMFA 2Y8KA 2W1WA 1UXZA 2W3JA 3VD5A 3IIIA 4CU6A 4QB2A 4OYUA 1BHGA 2VR4A 4LHSA 1J83A 2VJXA 3J7HA 4BJ0A 4ARYA 3A21A 3LEGA 4QB6A 4W4ZA 4ZZ5A 2BZDA 3W5NA 2YFZA 3LQCA 4W50A 2QQNA 5LA2A 5B4NA 2KD7A 4ZXEA 1PMJX 1T2XA 5F7UA 5FUIA 4XVHA 3CDZB 2W1UA 4XZUG 1W0NA 2ORZA 1NKGA 3FHAA 5G04L 5IJRA 2QQIA 1UY4A 4UOJA 2V5DA 3WF0A 2LS6A 2J1TA 2QQMA 4PF1A 2VQTA 4ZZ8A 4JHZA 4D8MA 3SKJE 5A1AA 4QPWA 1GOGA 1OH4A 2YC4A 2J22A 3MV11 3OB8A 2WO3A 2QQLA 4QAWA 2B9VA 4QX0A 4CU7A 2VCAA 1K42A 3OGRA 2E33A 2CDPA 2Y64A 2YB7A 1JZ6A 3GGLA 4OMDA 1H6YA 3OBAA 3T2OA 3UETA 4AG4A 5G05L 2WO2A 3E1F1 4QB1A 1UWWA 2W5FA 2VZRA 3LE0A 1JYNA 4L0PA 2ORXA 3CZJA 2JD9A 2QBXA 3UNPA 2EIBA 2VMEA 1TVGA 3MV01 2BERA 2C4XA 2VL4A 4RN5A 4UI9L 3HNMA 1TG7A 2WQ8A 4A41A 1OF4A 3T09A 1W9WA 4ZY9A 1O59A 3I3BA 2BBAA 2JE8A 2E32A 4A4AA 4CUBA 1XPWA 2WABA 3LPGA 4IUGA 2BGOA 1GOFA 5JR2A 2CDOA 3MUZ1 1US2A 3FN9A 3OEBA 4TTGA 3WNPA 1JZ2A 1LNSA 4A6OA 1JZ4A 2EIDA 3FL7A 1JZ3A 2VO5A 1US3A 1GU3A 3ACIA 3LPFA 3WF4A 2VZVA 3C7HA 2B4KA 2W91A 1SG3A 1UX7A 2Y6JA 3NJXA 3ETPA 4CVUA 2PQSA 3C7FA 2W9XA 4JKKA 4UAPA 5IFPA 1JHJA 3C8XA 3GM8A 1IQDC 2XQXA 2Y6GA 3PUIA 2WDBA 4XUOA 2LW8A 1WKYA 2J1SA 1OT5A 1CZVA 1NAEA 4QX1A 4XUPA 3K4ZA 3K77A 4ET7A 3VD7A 2W95A 1NX9A 1CX1A 1PX4A 1W99A 4BK5A 5DMYA 2HYXA 3WNMA 1EUTA 1JYXA 3VD9A 4DEQA 2WUHA 1OF3A 1EUUA 1GOHA 1NUKA 2Y6KA 4DEVA 2W46A 5JUVA 3HJRA 3IAPA 2W1SA 4PQQA 2EIEA 3LEIA 1UYZA 3I2KA 3OGSA 1KGYA 5EIYB 2VZQA 2Y6HA 1PMHX 3I3EA 2W92A 3VD4A 1PX3A 3FHQA 3HNBM 4Z2AA 3D3AA 2XHNA 3MBWA 1O8SA 3T0BA 4A42A 1GUIA 4A45A 4GZ9A 4QDRA 5LCWL 3CZUA 1OD3A 5LA1A 3WNKA 3A7QA 2R7EB 2X09A 3OG2A 3F2ZA 2V4VA 4MOAA 3I2IA 4HG6B 4MGQA 4XUTA 3OGVA 2W47A 1WCQA 3IDAA 2RJ2A 1JZ7A 1UXXX 1SHWB 1XNTA 2VMDA 3T08A 4DXSA 1KEXA 2J7MA 4QX2A 3VDBA 2X05A 3I2GA 2EICA 5JXHA 5B4XA 4E8DA 1JU4A 3WF3A 4DUVA 5DPNA 5JXIA 1XNAA 1XC6A 1H6XA 1W9SA 2J1VA 3ACGA 2RV9A 2WZEA 4JKLA 2VZOA 3C7GA 3T2PA 3OEAA 3DYPA 1UZ0A 1I5PA 2QQOA 3GDBA 2WAOA 5IHRA 2DCKA 2YFUA 3P6BA 4A44A 2ZEXA 1JYWA 2WAAA 1W8NA 5EJZB 1ULPA 1UY1A 1DP0A 1K45A 2E26A 4QX3A 3I3DA 5I0DA 3I2FA 3T0AA 2VCBA 3CQOA 4CU9A 2XOMA 3HNYM 3WF1A 3BN6A 2QQKA 2VZUA 1W9TA 1L7RA 4QDSA 3BGAA 3T0DA 4QDQA 5HPOA 1F4HA 2E31A 4XUQA 2C26A 1K3IA 4LPLA 3C7OA 3I2JA 3NQHA 3THCA 3NJVA
chains in the Genus database with same CATH superfamily
3DGTA 5FLIA 3CJIC 2ZGQA 1YUDA 3ES1A 2P5BA 1UYXA 4NHXA 2FDKA 5FY7A 2QFEA 2YZ4A 4OCTA 3THDA 3I2HA 1CD3G 1Y9GA 2ZEZA 3NW4A 5IVEA 2B39A 1QGLA 5BV6A 4XABA 2BWAA 4YM0A 1R64A 4UF0A 3KV5A 4CCKA 4TZDA 1ENSA 1PZ7A 2C6SA 2VQUA 2XGXA 5DUUA 1AL21 5FIXA 4FAHA 3W20A 2UWCA 1COV3 2BYVE 2ZKNA 3DYMA 4DXRA 1XSRA 4AK3A 1AR91 1VBC3 2R30A 4M00A 2NZ9A 3Q8EA 5ACA3 3WNNA 3ACHA 1WW7A 1SCRA 1VBB3 3KT1A 1H4HA 5GLWA 5IATA 2IC1A 4PT6A 4D0QA 1MQTC 1PVC3 1A78A 4CUCA 5C71A 1LJ7A 2CY6A 1H9WA 2XB6C 4AE2A 1NA1B 2DYCA 3C7EA 3PMEA 1DZTA 2DU1A 5KWRA 1EV13 2OPWA 3WCSA 3RWKX 4HKLA 2E9QA 5E16A 1L7QA 3UJQA 1ZZBA 3VZJA 3MF6A 2HBUA 1RMU2 2J1UA 3CHXA 1W39A 2XJRA 2ZHMA 1KD7A 4XIKA 1YQ5A 3WLUA 4AXOA 5FXWA 4WM7A 1LECA 4Y1XA 1OPOA 4R9BA 4O7XA 3N35A 2C5DA 1ENXA 3POSA 3I7DA 2PLV2 5FYIA 4BXSV 1RYYA 1HIXA 1Q8VA 4R8HA 2GC3A 4RQPC 4Q0UA 5M0TA 3MEPA 3OYWB 4J1WA 3KB5A 2Y33A 3GYDA 2QNKA 4ORFA 2VW2A 4HN0A 1NCRB 2E6VA 2RS52 2WLPA 4FPKA 2WS92 3LB9A 4LKFA 4FFGA 2RM21 1O3TA 1YYNA 2RDNA 2V4AA 3FZ3A 4D3WA 1B35C 2JKXA 2WRAA 3WQBA 4YSFA 4YZ2A 1ZVFA 4KWLA 4Q4Y1 2RDSA 4TXWA 5L7OB 2P37A 2FCUA 3H42B 3IIAA 4CCCA 4FVVA 1YNAA 2VBDA 5HXMA 4WZCA 4I30A 3BI3A 2XBO2 1CPNA 1Y3TA 1ZRCA 1BLZA 4UFKA 1H1MA 3DYOA 5FOJB 2NYYA 5CFDB 2X53S 4XXAA 1DDLA 4XUNA 2EXIA 4QX7A 5FPAA 1V70A 4PJYA 4XPVA 2IVIB 4BU2A 2ZTNA 4IESA 4OZOA 3S7IA 5C70A 3ZYRA 1OLMA 4KMQA 1REDA 5JDBA 3CJIB 1X33A 2OX0A 3ABZA 4O65A 2MHFA 5FXXA 3LSDA 2ZGNA 3SH4A 3N9MA 3JQWA 1QDOA 3MW4A 3OGJA 4CU8A 5BNPA 2A3WA 4CCEA 4XQWA 2LALA 3M1HA 1NE4A 1GKBA 4TYSA 4IEWA 4Y26A 4DB5A 1H8TB 3ZPOA 4ZXKA 3O5SA 4L9BA 3ZXFA 4CDUA 5FAXA 4Q8KA 3RZGA 3U0ZA 3SISA 2GH8A 3PURA 1CR7A 4Y22A 2EA7A 3MUY1 3TWIA 1QQP3 1RUI3 3FUOA 1MEC3 1VRH2 3NV2A 4AF9A 5GM0A 2LM3A 1C8M2 2NN8A 4PBPA 4KI5M 5FMOL 3VBUB 5IK8A 2C1FA 3WNLA 3USUB 1CZSA 5LATA 1ND2B 5IVFA 1POV0 1QJX3 1H1IA 1SDDB 1YWKA 1QH6A 1W8TA 5FZ9A 1GBGA 4XQ4A 3VBSA 1DGLA 1NOVA 4LBNA 1JW6A 4MGKE 4QHBA 2BU9A 5J98B 3U10A 1ULOA 4ZPIA 4N43A 5H9QA 1REFA 1O8PA 1QXPA 1AVBA 4RHV1 3BODA 5BUVA 1NLQA 4N9IA 5IAXA 5K8SA 4HOOA 3WUDA 3W5MA 2F17A 1REEA 4MO3M 3SCFA 5KHJA 4XILA 4FXKB 1HRV1 4JX0A 4BMBA 2R16A 2LRPA 3CKHA 3ZVXA 5IFTA 4XAEA 4AVTA 1OOPA 1ZBA1 5FLJA 4GMP3 4KBZA 2Z5WA 2IXLA 2RVAA 3AXDA 4YPJA 3RFRA 1UMZA 2AREA 2KA3A 3JUUA 1G9CA 1GANA 2CAVA 5FMCA 1K5MC 3MI8A 1WW4A 4WM8A 4IGOA 1FOD3 3K4DA 1AR62 3FWEA 2YC0A 4Q4V1 1VMHA 5KHKA 4LBQD 3VBOA 3DKWA 3E5UA 2Y8KA 3GHMA 3GZEA 1O6UA 5JZGA 2W3JA 1GWKA 1MS0A 4U2AA 4XJWA 5EPAA 3VD5A 4U36A 4I02A 3P5BA 3MIEA 1A8DA 5GLZA 2VR4A 3M3CA 5K7PA 3LA2A 3H3UA 2D5HA 3JD72 5JVVA 4Q1RA 2YU2A 4QB6A 3ZFEB 1FXZA 3J26N 4RA0A 3ASIA 1JOJA 1WLTA 5GLTA 3VHNA 4B7KA 1WUVA 3L2HA 2YFZA 4BYYA 4C0BA 4LIVA 5HI0A 3HIFA 4GJYA 5K0UC 3ILFA 3KS7A 1JYCA 1Y7BA 2DWRA 3IWZA 5FRAA 4ZXEA 1RUH3 3V56A 4CDWB 3D6EA 4V2WA 3ZDVA 2ZAAA 3SH5A 5JSPA 3URFA 4FPCA 4HPKA 1LEDA 3ZN6B 2CHHA 1COV2 1IS3A 1AYM3 1SFPA 3TOJA 4XZUG 2RS13 1W0NA 1AXYA 2D6NA 4Q4X3 5F6LB 3WHUA 2DF7A 2GMEA 2MNGA 1NKGA 3FHAA 1AJKA 1DHKB 5ACA2 5JOWA 4OI1A 3MF9A 4OHWA 4HMZA 1RGSA 3JB4C 4JQRA 4QD2A 4WVMA 1W03A 5G04L 4YZ5A 2V5DA 1EAH1 2H6CA 2QCSB 4ZZ8A 4D8MA 1O7FA 1NCRA 3BB6A 1GOGA 1TQ5A 1VBD3 3OB8A 2WO3A 3K51A 4QAWA 4QX0A 4BH9A 4CU7A 3MLLA 4N53C 4BQWA 4K21A 2NQYA 2E33A 3OGRA 4YNIA 1Q8SA 3H0OA 1IZ3A 1W90A 3GGLA 5CG9A 3SC7X 3BVCA 4LMFA 1CIWA 2SLIA 3CEWA 1H6YA 2D93A 2ZA9A 4AG4A 2BEOA 4I09A 3AFGA 4JDNA 4EN9B 5FXZA 2WO2A 4AHXA 3KCYA 3E1F1 1GNZA 3OBTA 1NY71 3Q8BA 4ISQA 4QB1A 1UOJA 3H1YA 1JYNA 4XW3A 2I45A 3CZJA 4IE0A 5LRRA 3J7LA 4HXCA 2E7QA 5DUWA 4G3YC 2BERA 2C4XA 2VL4A 1V6JA 4QPIB 1W6NB 1OLRA 4UI9L 3RVHA 3ZOIA 3P3NA 4N8MA 1CVNA 3PVOA 1TG7A 1Y9MA 3BTZA 3VHOA 4A41A 4XFBA 1MS3A 4P5HA 1OF4A 4AQ2A 1PO13 1QJY1 3Q9OA 4Q0SA 4HKWA 1RUF3 3QLQA 1LOAA 5A3TA 3I3BA 5D1IA 4PLOA 4JTNA 5FBJA 3S6PA 2XKPA 2BOJA 4GIQA 4BQ5A 2D6KA 4A4AA 4JV4A 4P9YA 3VBRA 5J3UA 1MZEA 5EYYA 3TEXA 2XLFA 2K46A 1US2A 4HL0A 2VVFA 2A5ZA 4B4PA 1DQ6A 4CEWB 2XLGA 1IS4A 1JZ2A 3I49A 3KT7A 3USUA 1WA6X 3ZPYA 2PFWA 5FYVA 4NO4A 2OUHA 1X36A 3VBHA 1UZWA 4D7SA 1SCSA 1AYN1 2D6PA 2EIDA 1Y9QA 3RRDA 5CADA 5FDBA 1CAWB 3WV6A 3ZYPA 3VZNA 3LFIA 1WGPA 2VZVA 4D7TA 4YZ1A 4TLFA 1UX7A 4XF9A 3AP7A 3NJXA 4IERA 5FPZA 2GNBA 2P3JA 3OBZA 4CVUA 1ST8A 1W2TA 1SPPB 5DG1A 5GLUA 2BFUL 4PLNA 1S2BA 2OA2A 4EYUA 1HV0A 5KXBA 1JOBA 1RHI1 1MEC2 3DV8A 4PI0A 2XL7A 1JHJA 1G8WA 1XQNA 3G7DA 4GAZA 3VBFC 3RPQA 2YMZA 1QJU1 3E6CC 2DVGA 2IXCA 2JG9C 1QJX2 2P3IA 3N7MA 2LW8A 3WP3A 4AYUA 5FMBA 2DFCA 2HWF3 3DXUA 1SEFA 2PHRA 2W08A 3MDPA 1LEMA 4LO7A 2B46X 5GZCA 4YFZA 2AEZA 4MH0E 4AQ6A 5JOZA 1XU1A 1OLQA 4BPZA 1PX4A 1XNCA 3B9CA 1GZTA 5FZ1A 3WNMA 5H9PA 1R083 4Y24A 3VD9A 4C0HA 1YJLA 2ZGMA 3OTFA 4YM3A 3PHMA 2WUHA 3ZFEA 3WDVA 1EUUA 4MXWB 4CXYA 1ONAA 1NUKA 3J8F3 4CDXA 2VMIA 1YFYA 4DEVA 1ACCA 2W46A 4S2DA 3HJRA 4Y4RA 5J7MA 2IUWA 2VTXJ 4PQQA 1BEV1 2G9GA 3FBYA 4QPGB 2Q1ZB 4YVSC 4PLMA 2ZOEB 4E4ZA 1AJOA 3I2KA 5LBEA 1KGYA 1HJGA 4NUBA 4W6YA 3WVJA 2RE9A 2H0VA 2O0OA 3M3OA 3Q8AA 3ZX7A 2RR13 4FBFA 2TUNA 3IM0A 2UWBA 3FHQA 2WO7A 3HNBM 3WX5A 5FWEA 2OIIA 4YG3A 3SCGA 4GWNA 1DQ4A 3ES4A 1A6CA 5A7QA 4FT8A 2HKXA 4YGDA 3ZYJB 2Q8DA 3O1UA 5BNQA 3EO6A 4OI2A 4NJ4A 4X8PA 1Y4WA 4OFGA 1BXHA 1AR83 1LU2A 4HANA 4KU8A 5LCWL 4SBVA 1OQ1A 2QQWA 2WJSA 4AI0A 1RUNA 3CZUA 1LULA 1YRZA 3MPPG 1F8VA 5F6KA 2R49A 1R091 2UY9A 3DEMA 5CU1A 4D6RA 4S2GA 2V4VA 1F9KA 1RUH2 2VMGA 2TBVA 2PAEA 3LA3A 1W0PA 4MOAA 1IPSA 2A1XA 2CWSA 1NCQC 5CFCB 4CDQC 2BJSA 3KV9A 1LOCA 1GICA 2NMNA 4YG0A 1IQAA 2JE9A 4Q4X2 4IEXA 4NHLA 4XETA 1VBA3 2RDRA 4IDZA 3PIGA 1RB8G 2RS33 3ON7A 1CAUB 1RL3A 1S0CA 5D8AB 5F5QA 3U1XA 1SHWB 4K1ZA 4EV0A 4YGBA 2JECA 4JVAA 4LBQB 1FNZA 4BA6A 4IE7A 4GXLA 2GNTA 4DXSA 4FFHA 3TN91 3AVRA 3VDDA 5J48A 4GD4A 4QX2A 1C1LA 1LGNA 4ISRA 1VBD2 3EBRA 2ZKLA 1WMDA 4LBOA 1HRI1 1GZWB 1PNFA 2WNVA 3ZSEA 5E6HA 3OD4A 3GZUC 2CYFA 3BYWA 1W06A 2ZGSA 3WY6A 1U0AA 2OQ6A 3BOWA 3UKNA 4ASMB 4B4RA 1XNAA 3AMNA 2ZZQA 5LASA 1XC6A 3HQRA 3DPRC 4B7EA 4LEJA 4ES9A 1GNHA 1W2UA 1KFUL 4YW1A 2PHDA 2WFF3 3C7GA 3OEAA 4QX8A 1ZA7A 1YQ6A 4NRQA 3THPA 3HMYA 3KD4A 3KV6A 4CUGA 5T3NA 1XU2A 3GDBA 4W6XA 5FMDA 5IHRA 4WM7C 1HV1A 2YDEA 4KNCA 4UBGA 4CCNA 3M8LA 4ZS2A 4ATEA 1ULPA 2A3YA 1TZOA 1UY1A 2E26A 1DP0A 1K45A 3WCRA 2DTWA 1U5YA 4AGRA 4EN7B 1AX2A 1RUC2 4CU9A 5C8WA 2XOMA 4FP2A 4R52A 1RJ7A 1XYOA 2IXKA 2HWD2 2QQKA 4RGGA 3SCHA 3W59A 5F1RA 1PO12 4AI9A 4H14A 5JMCA 1W6MB 1CAWA 1VBE2 4MGTA 1WMEA 3N3HA 5FK7A 2VVEA 3ZKYA 3FLRA 3T0DA 5BNOA 1D2SA 4QDQA 1TME1 2HEYF 2VXRA 5HPOA 1PGL1 3TNPB 1E5RA 3B01A 3MICA 5LA9A 1RUG1 1S2EA 1BJQA 4W65A 3CJXA 4O9EA 1RUOA 3NNGA 1D0HA 3PJYA 3OCPA 3I97A 5FLHA 5CVRA 2FCVA 3UGHA 1RXGA 1JZ8A 2VOVA 1T6BX 3PVBB 5A3MA 3NL1A 2V72A 3AYEA 3OPTA 3LWCA 4I2OA 5APAA 4BQXA 5F3CA 2VZ1A 4M01A 1M06G 1HLCA 2YGLA 5I8YA 2ZHLA 2RMU1 3IDBB 2PXJA 4WBBA 5E1RA 4DIQA 4M3CB 3HT2A 5LBCA 2VM9A 5FFOC 3OUIA 1DGWX 5J1XA 2BGCA 1HKDA 3I2DA 3AP5A 2RS53 2BP6A 4AEJA 5BNPC 1MS9A 1UMIA 2WWUA 5C5UA 5JXGA 1W6PA 3ZFGB 4CXXA 4MZUA 3ZFFB 1JN2P 4EN6B 3RI9A 4FAGA 5AC92 4S2HA 4FQZA 5SV8A 1VMJA 2Z4FA 2WNUC 5C7GA 4MHUA 2W0XA 5JMOA 2GN7A 2HWC3 2XBO3 2HJIA 4W6WA 4I01A 2WFPA 4GWMA 1HXS1 2CGOA 5DAXA 1WD3A 3ME2A 4V1PA 1OHFA 4E4HA 1JS9A 1YI9A 1RVF1 4QHOA 2EVXA 1UYYA 4PF5A 1MPXA 1HN1A 1RUD1 4LXLA 4LTAA 2VTFA 1LGBA 4IEQA 5CKQA 1K12A 5FZIA 2OQ7A 3VD3A 3VV1A 4FOQA 1R082 3AFKA 2BUKA 3VBSC 4M4PA 2VBBA 2KXLA 2VNRA 3WP4A 4BXFA 5C33A 2IZWA 5FZLA 5JOXA 2Z79A 3JXSA 2Q8EA 4WVVA 1T6GC 4N43C 2WT2A 1GQPA 4NAOA 3GZTB 5BPXA 4Q0PA 4FPJA 5LA0A 5F5CA 3I3MA 3VZMA 1W9YA 2W94A 3OGGA 2G9ZA 4FQ4A 1WWYA 3IT8A 3KT4A 4WV8A 2H0BA 4YVWA 2E7TA 2RR12 1OOPC 4PDWA 3VGIA 4JAAA 5F5IA 2WLQA 1E57A 3AZXA 3N7JA 2JKBA 2ZX1A 3P1IA 4SLIA 4XDOA 5HCBA 3LOIA 5FKCA 1KXGA 4QHZA 1LR5A 4NAMA 4WM8C 2MEV3 3AZWA 5FPBA 3TNQA 1LOBA 4PQ9A 2YROA 1JH5A 1VRH3 1CAUA 4RSUA 2WYFA 1AR82 1Z7S3 1JYVA 1TMF1 2YYOA 3WSOA 2JB4A 1KJLA 1VP6A 2RM22 2YBKA 1WLCA 5JZGC 4D6SA 5C9AC 4DXTA 2HEVF 2BNMA 4JGYB 4XFFA 2ZEWA 4RS5A 3UESA 2VG9A 2QQJA 1GZWA 2AUYA 3KCXA 4Q8LA 5FZ6A 4COUA 3ETQA 5DQ0A 5FZ7A 4IV3A 4DPNA 4I3PA 2K2SA 3GCXA 2FMDA 2C0ZA 1E5IA 4Q1PA 5FZGA 3D0SA 5EWSA 4E8CA 2Y26A 3JBG3 2YPDA 5C4WA 3THCA 1W9FA 2FZ1A 1BBT1 3QH7A 4Q0VA 5F2SA 5FUNA 4LKSA 2XMLA 3K4AA 1AXKA 1JYIA 3HBZA 4P9JA 1DYPA 2OXBA 5F39A 4QQLA 3UK9A 4AI8A 5JPNB 4P9WA 5A7OA 2WN2A 4ZKTB 2JDAA 5AFEA 5I91A 4O61A 3IPVB 2ZPXA 4AZZA 3AJYA 3CLPA 1WW5A 4IV1A 3WEZA 2BVVA 4GB31 2CGPA 2Q1MA 2CWMA 4QKNA 4QU1A 2ZGPA 2XJTA 3S0MA 5JCTA 2ZMKA 5C8CB 5HCHA 3LF7A 5FYHA 4FPOB 3V65A 3U37A 3O0XA 2VZ3A 2PELA 3DL3A 1KDMA 2JICA 2VCCA 5ANNA 5BNNB 3CU7A 5A7WB 2ZJCA 1SLCA 3NAPA 4FFIA 1OD5A 2XXZA 2RG4A 3B69A 5CIRA 2E51A 4GH4A 2VTXA 4XDPA 5JIAA 3WR0A 2XONA 3V0AB 3MYXA 4K40A 5FQ0A 5KBFA 2D7FA 4AI1A 4FTSA 4A3ZA 1H1AA 1STMA 1SLLA 5IYYA 1DYOA 3C2UA 1YFWA 3N9QA 2YUEA 5AVPA 3SHRA 3V64A 3ZXAC 1FT9A 1RINA 3DXTA 1ZYBA 4RHV2 1GFF2 3RYKA 3EMRA 2W1WA 4UWDA 5F37A 4A7ZA 2YY1A 1ZRRA 3PTRB 2PHTA 2NPIA 3IIIA 1W3VA 1HRV2 1PK6A 1V6MA 1EPZA 1SFNA 5FY1A 4CU6A 4CCMA 1SBEA 4QM8A 5T5JA 2PHLA 3O1TA 1AF9A 1OA3A 2UYAA 3L2YA 2UURA 1Q8OA 1V9U1 4BJ0A 5A3UA 3A21A 1KDKA 3LEGA 4Y3OA 3QBQA 1ODMA 2XR4A 1F35A 4Y1VA 3ZFGA 4ZZ5A 3ZFFA 4E9KA 1HB3A 5C9AB 5ABJB 1OUSA 3LQCA 3W5NA 2DVBA 5FREA 2X5IB 4HVOA 5B4NA 1UAIA 4D94A 5J37A 3E5XA 2HWB1 2YHJA 4Q4W1 3VBRC 1GWMA 2QZ3A 3TAYA 3N4MA 5JI9A 1D4M1 2BRTA 4XVHA 2N7GA 1QMJA 3JU9A 1W04A 1EPWA 1MVQA 1JMUB 5JR7B 2I2SA 1CONA 2ORZA 3FLPA 3O12A 5FYTA 3B9IA 3IN9A 3GALA 2DUPA 1IOAA 1ZREA 3AB0A 4L11A 3ATGA 5IJRA 4DS0A 1WCDJ 2R32A 3APBA 4XJUA 3BIEA 1YCIA 4DOUA 4CTEA 3T4VA 4MHRA 3NSTA 4ASKA 1HN0A 4NMIA 1DFQA 1QY4A 2VGDA 4JHZA 5T50A 5A1AA 5FWJA 4FP3A 3IDCB 4MV2A 1QXRA 3M2MA 5DDJ3 2B9VA 4OZXA 4CSWA 2HWC2 1MVEA 1FI2A 2VUJA 3ZXEA 4LHKA 4FTBA 3TEWA 4COYA 2Y64A 2ETEA 2ZX3A 5DUXA 4E27A 2D44A 2IXHA 5A70A 4OMDA 5A6YA 5T5LA 1I3HA 2BBVA 3OBAA 3M3QA 2EAKA 5FKBA 3T2OA 1PM7A 1RUE1 2VCMA 3UETA 4MSVA 1ASJ3 5H9RA 3BCWA 2HWE3 5G05L 1ZZCA 3RGBA 2FQPA 3MLJA 4XFAA 5FP9A 5IK5A 2ET7A 1UKRA 1OVPA 3I4IA 3IBMA 3WUCA 3H3LA 1DG6A 1ZBE1 3LDKA 5DAVA 1ND3C 2ORXA 1PIV3 4YG6A 1H8VA 3NNJA 1EYBA 3MV01 4JGYA 5L9VA 2CNAA 3BPSA 5GALA 4QU2A 2GP5A 4AHWA 3VLBB 5T52A 4R9DA 5JAXA 4JGZA 4OHYA 2ZX2A 1OSGA 3B7MA 1MS8A 3N9LA 4NWWA 1YI7A 1UO9A 3LZZA 4AL9A 5A7PA 4MVTA 1H2LA 2DFBA 4Y1YA 2KM2A 1V00A 1QXJA 2ZMNA 3IDEA 1LENA 1O59A 4BQ2A 1MQTB 4AVBA 2MEV2 4CEYC 1IPJA 2DVAA 4XFGA 2BBAA 4PBOA 1V6OA 1BKZA 1Z7S2 4QXBA 1XPWA 2G19A 2WABA 3KMHA 3LPGA 4XCAA 4P9XA 4C8DA 4CUBA 2XLAA 2AGSA 2BGOA 3NNMA 3PNAA 5FCCA 2VOWA 5IK4A 4KWJA 2GU9A 1XYNA 1DGRN 1R1A1 3OEBA 1PNGA 2O1QA 5CNAA 4F3JA 5FZ4A 3WG2A 2OS2A 1KRIA 4FPLA 4XHXA 1CAXB 5FP7A 4A6OA 2P1BA 4AFDA 4CCLA 1UN1A 3LDRA 3POIA 1JZ4A 4LORA 3U4XA 4O9GA 1LESA 3FL7A 3LCPA 4L2NA 2WSUA 1GU3A 1IGOA 5B2GB 3LPFA 1JHNA 3WF4A 3C7HA 5L36A 2W91A 2NLRA 4RQPB 1SG3A 3JBG2 2Y6JA 2R041 4M3CE 3DKQA 2IWGB 3M4FA 5SV5A 5C8CA 1DIWA 3H8RA 1KS5A 2FDFA 3ETPA 2GZWA 3Q8CA 2PQSA 3JZVA 3CO2A 2IXJA 1XB9A 4UW5A 1AUYA 1JODA 1OURA 3B5LB 1B35B 5IFPA 1FMD1 3C8XA 3VL8A 1OUXA 4RR3C 5F3IA 1FPN1 2XQXA 2R061 3PUIA 1J1TA 2DV9A 2VNVA 4XXPA 3N9OA 1IKPA 3ENRA 2JG8C 4UXAA 4AVAA 4RFT0 3H8OA 1A34A 4IETA 3GNEA 1VPHA 1MZFA 4D6QA 2ZGOA 1OT5A 1MZ5A 2P3YA 4QGMA 1O5LA 1S0DA 1YFXA 5HBAA 4LK6A 2D98A 2WNVC 3OJBA 3ILNA 3VD7A 2DU0A 4FPYA 1CX1A 3SXWA 3FMGA 5CEHA 4QQOA 3H1MA 1RHI2 4BK5A 5CA6A 5KHIA 1UZYA 3N7KA 4EJRA 1RMU1 1NA1A 1IG0A 1B09A 4DEQA 5FJKA 4Y1UA 1OF3A 4YARA 2AZ5A 2BWCA 5FJHA 3TBDA 1J58A 4IEOA 5ABJA 1O3RA 1IG3A 4IQPA 3IAPA 2W1SA 1WA4A 2PLV1 2EIEA 4DY3A 1UYZA 4AVVA 4NIHA 2IFRA 2FHRA 4Z1VA 1WBLA 1F15A 2Y6HA 1PMHX 3FLTA 3I3EA 2W92A 2JIJA 4XFHA 2YBSA 2XHNA 2WS91 3O14A 5A3OA 1POV1 4EWAA 3FBMA 5FR3A 2Q30A 2XJUA 3OYWA 4LA3A 5CAZA 2QDRA 4EN0A 4GZ9A 4XF0A 4K8FA 4Z07A 2B9UA 1UU6A 1MS5A 4QGLA 2XBO1 1F5FA 2C9AA 4GULA 5FYSA 4Y4YA 3ZXKA 5L7OA 2CU5A 2WZR3 3WNKA 5LA1A 2WZPP 2GNMA 3DUIA 3RDIA 2R0FA 2B5HA 3F2ZA 4JDOA 1OFSA 3I2IA 1RJ8A 2GC0A 4XC9A 3RQ0A 1POQA 4GKYA 4MGQA 2UU8A 1QNYA 3LSEA 5CFDA 3ZSKA 1SLIA 3GJAA 3OGVA 2BV4A 2EXJA 1OFNA 4PIXA 4AEMA 1WCQA 3IDAA 2RJ2A 3HR9A 1JZ7A 3OOXA 1UXXX 4OUMA 5KXCA 3V0BB 1ZRDA 2PAMA 2B45X 2F6BA 5HCFA 3O1PA 3CJIA 2X8KA 2R0HA 1K5MB 2ZCWA 4HFSA 3POFA 1AHSA 1R092 5FYYA 2J7MA 2PN5A 2WC2A 1GP6A 1RUC3 2PHFA 4FOYA 4XQDA 4YM2A 3I2GA 4RR3B 4EROA 5DDJ2 2HWD3 1HW5A 3A4UA 3AYDA 1JU4A 3M70A 2JG8B 1PMIA 4HKOA 2E53A 4DQAA 1VBE3 4MYEA 2R6QA 1H8TA 4EZ4A 5H9SA 5T55A 4G9SB 4NPMA 4EQVA 4IE5A 1ASJ2 3FUQA 1C8M1 1H30A 2XKOA 1H6XA 1VRBA 1SACA 2HWE2 3SLIA 5JWPA 1YQCA 3RMXA 1CJPA 2XVGA 3ACGA 3AKTA 1DZQA 2WZEA 3TN92 2QDNA 2VZOA 1PZ8A 3G6JB 3AXEA 1UZ0A 1SMVA 2PMWB 2EF6A 3VBUA 1FX5A 1RUJ2 2QQOA 4N7UA 5K0UB 2I07B 1PIV2 4BM8A 1JYWA 4A44A 1EY2A 1ND2A 4H2AA 3WXPA 1PO23 2R073 1AX1A 4KG0A 4UW6A 1W8NA 3ZYHA 1CGPA 3POGA 4Y5SA 3T1MA 5DUVA 3I2FA 1AX0A 3D8CA 5LBFA 3FFZA 3PU8A 4ES8A 1WW6A 2XVKA 4MG2A 5J96B 4JZRA 1PHMA 3PUQA 1W9TA 5ANQA 4HT1T 2D3PA 3W21A 3IMMA 1UOBA 3BGAA 5LWBA 3AL6A 1VAMA 1XJAA 2YBPA 3ELNA 5JSOA 1AR61 1J3RA 1NXMA 5IK7A 1NE6A 4AVCA 4LOSA 3OPZA 5F8PA 4AFMA 2EXHA 1QOSA 4YVWC 4XUQA 2C26A 4PDWC 5AC93 5CKNA 1HQWA 1WCUA 4YWAA 4BQ3A 3C7OA 4N53B 3NQHA 1S0GA 1V6LA 1G6NA 1CAVB 3EHKA 4LLFA 3MW3A 1UD1A 4UW4A 1OBNA 3RMYA 3BPZA 2ZMLA 1MS1A 3A0KA 1AR93 3PUHA 3JD71 4MGYE 3K3OA 4YRDA 2LTNA 5GZEA 2E63A 1NQJA 2VBPA 4LITA 4DRRA 4PHZA 3I8TA 4AEDC 4LQRA 4GQ7A 4RS5C 3KHBA 5IAVA 1ZA4A 2WNEA 4UFIA 4R9AA 4AAXA 2A3XA 5IUQA 2OKXA 3EQEA 4OHZA 1RUG2 2J1AA 2DCJA 4P9LA 4Y20B 1UF2C 2VMCA 4IV3C 3Q8FA 5A80A 4FI9A 3A0NA 3VDCA 4CP1A 4QKFA 1O3QA 4A7KA 1COV1 1JI6A 5GJ6A 4CUAA 4Q26A 4NIDA 3L9JT 3R4UA 1DLCA 1VBC1 2FDIA 5C4WC 2D97A 2X10A 3PJQA 3PIJA 1UNBA 4M4RA 3MHZA 1GLHA 2CL2A 3H50A 4QPYA 4CDWA 5ACA1 3ST7A 1QU0A 1VBB1 4C90A 5FZ3A 3T30A 3ZN6A 3D5OA 1PVC1 2RMU2 2WT0A 1O3SA 4IGQA 1XNDA 5GZFA 3ZXDA 4LO8A 3QH6A 2OUJA 2QJVA 3ACFA 1EV11 1NYWA 3WDUA 2RM23 2YU1A 2DTYA 3K3NA 2FZ2A 4IV1C 3HOBA 4XOGA 3VKFC 3IB3A 2B42B 1J3PA 4Q4Y3 4KH9A 2OYZA 1D0GA 3A22A 3IAQA 4CE8A 1UQXA 4YFWA 1BQPA 5FMOS 3MO4A 2LROA 3S5AA 4DXZA 5FZOB 5KXEA 2V5YA 3ROUA 3ZXGA 3CMGA 1LB2A 2CV6A 5LK7B 4XMAA 3THTA 3OF1A 4B1LA 2JE7A 3B00A 3HBKA 4P9IA 2DDUA 4F8AA 4D69A 3ZLIA 2QQVA 3MIDA 3WD5A 1TNRA 1ALYA 1C57A 1GSLA 2Z42A 2ZGTA 1XOYA 3NMBA 5E8AA 1NT0A 5HXVA 4BDVB 2FDHA 3WT3A 3VBFB 1J84A 2J1EA 1YQ2A 1LGCA 4ASLA 3M7AA 1BZWA 4GMP0 3PVNA 1CZTA 4MGSA 3MIBA 2Y0OA 4NHYA 2JG9B 2V09A 1ULGA 3CBNA 4QPIA 1W6NA 3VKLA 5I0TA 3RZZA 5DN2A 3SH3A 4DMIA 2WZR2 4EWDA 1PK6C 4CA9A 3I2OA 4XEZA 2ZX4A 4B4QA 2VZTA 1RC6A 5E88A 3WW4A 2GSYA 4XFCA 4GA9A 1AR72 5F32A 4ZS3A 3N36A 1F4AA 4Y5Z0 1YIPA 3AMPA 3T2TA 2XJSA 2PQQA 2YV8A 3NRUA 1W6OB 2HLEA 4AEDB 4FPEA 2VZPA 3AC0A 4LIUA 1H9PA 1E5SA 4P00B 4V2VA 3NNFA 3T3YA 2PTMA 2RJKA 3N9PA 2Q8CA 1GZ9A 1UKGA 1ZM1A 1DF0A 2WL1A 2JJ6A 3K46A 4CEWA 1W2AX 1F5JA 1GNYA 1Q8QA 5FPXA 2ZXQA 2IFWA 3LKJA 3AM2A 1JUIA 1W6QB 4CP0A 4YVSB 1WCSA 2WO1A 4RYDA 2GMPA 2WN3A 5L19A 3OY8B 2DBNA 2GC1A 2ZAHA 1N1SA 2Q0AA 2VZSA 4RHV3 1VIWB 4BOWA 1UOFA 1QKQA 4HK8A 2JDMA 5I8TA 5GKAC 5LEKA 3BKZA 3B02A 1HRV3 1QQP1 1RUI1 1MEC1 3H1WA 3OSDA 2W87A 3GBFA 1ZBA3 2CAUA 4AI2A 3BTXA 2VQAA 4H3WA 1SPPA 1WLWA 5A33B 2VW0A 2VOTA 2P3KA 1QJX1 3K75B 4FPFA 3HN3A 3UJOA 3S7EA 1OXCA 4MADA 2GAUA 5JPMB 4Q4V3 3RYRA 1S1AA 2Z69A 1GMMA 2JX9A 4GWJA 4KWUA 4AR2A 3MZHA 5CG8A 4P08A 3VZOA 3EB7A 3A23A 1PO22 2R072 4ARXA 3RZJA 3ZM8A 1VAKA 2JDHA 1YHFA 4AFBA 1JBCA 1V6NA 2XL9A 5IT6A 1NCQB 4CDQB 1H0BA 2C9KA 4OQ9A 3HEIA 5CYYA 5FY0A 4OQ8A 3CL1A 3H7JA 2KR2A 5LY2A 4XF3A 2VMFA 2D6OX 2UWAA 4GMP1 3VZKA 1UXZA 4OHXA 3O7OA 3ZO0B 3WP5A 3T4HB 4QB2A 1LCLA 3M3EA 1FOD1 1U12A 1VE0A 1C8NA 4UF0B 3VN4A 1LOFA 3J7MA 4ATFA 4MXWA 1J83A 2VJXA 3PVEA 4QMAA 1OPMA 4ARYA 3DCQA 3AKSA 3UKVA 3ZN5A 4W4ZA 1OKOA 3LIGA 4CDUC 2WNOA 1OC1A 4QPGA 1BK0A 2BOIA 4HLTA 4C1WA 1AL22 3AMMA 2JENA 2VU9A 1VLNA 5LA2A 3ORJA 1AR92 2KD7A 1G9BA 1LKNA 3VHRA 5DZEA 2Y60A 3DPRB 2JXAA 2E7AA 3SQOA 1UZZA 3QOPA 3CDZB 5FPLA 1EAH3 2W1UA 5T5OA 1OI6A 4QKBA 1V9U2 1DQ1A 1K5JA 1PM4A 1RUH1 3NVCA 2NP0A 4WM7B 4AAPA 4Y1ZA 5FO8B 5KR7A 4UFHA 1MS4A 3GZAA 2QQIA 5IVYA 1WD4A 3WF0A 4LUMA 3WP6A 5HV4A 2LS6A 1CWPA 2HBTA 1TE1B 2J1TA 1JUHA 1AYM1 1IHMA 2AACA 4PF1A 2RS11 4Q4W2 4Q4X1 4J25A 2GALA 5A1LA 2AC1A 1UCXA 2MPFA 2J22A 2YC4A 4RGAA 4YGCA 1RTVA 2F4PA 1UZVA 2ET1A 1D4M2 5CFCA 2A73B 4LLOA 4NRPA 4E2QA 1JZ6A 2CDPA 2YB7A 5LY1A 4HK9A 3O1VA 4TSVA 3ZMNA 3PU3A 1DQ0A 4XDQA 3B93A 5FZCA 4C1XA 2K0GA 4FPGA 5D8AA 5FZEA 1VBD1 1OMIA 4AW7A 3VBOC 1VB4A 4IEYA 4LBQA 3TYJA 2NMOA 1DYKA 4UFMA 4A7YA 1BCXA 2QTWB 2BFUS 3AP6A 4TWTA 4LUKA 4Q4Y2 3W9AA 1UWWA 2W5FA 1GWLA 2VZRA 1C3HA 1XE7A 3LE0A 3TEYA 1W8HA 1X8EA 4QQ2A 4QT6A 1SDWA 3AKRA 5IWFA 1QWRA 2QBXA 3T1LA 3U14A 3WINE 3AKQA 4MUVA 2VMEA 4K1YA 1DQ5A 1O4TA 3BOPA 3QACA 3I54A 2FDJA 4RN5A 4OVEA 1D4VB 2VE1A 3AL5A 2AENA 3WNXA 4R4XA 2Q5TA 1YXWA 5LZ6A 1RUE2 1NA1C 2XG3A 3AK0A 5ERLA 2A6WA 2BQPA 4Z2WA 3PUSA 5FY9A 3U78A 3T09A 1W9WA 1W6OA 3MPBA 3H7YA 2ZGRA 5BNPB 1HX6A 3RYPA 4X6QB 4ZY9A 2OPKA 2W68A 1QJFA 1RUC1 2JE8A 3OBRA 2G9FA 1A8MA 1NZIA 1GOFA 2WKKA 2WNUB 1NG0A 5FYMA 4CDUB 1PO11 1XBFA 2CDOA 2PAKA 1AYN3 1RUF1 1W6QA 3FN9A 5FZHA 1NQDA 3WNPA 4Y22B 4OULA 1L7LA 4BMEA 1LNSA 1MR5A 5JIUA 2WQ4A 3ZMOA 4GKXA 1LHVA 1NCRC 1W6MA 2WINB 4LBMA 2HYKA 5F2WA 1LHWA 3KSCA 1EP0A 4NIAA 4D7YA 1JZ3A 2VO5A 3ACIA 1U5IA 1RHI3 3LFMA 5L7OC 3VBSB 5FP3A 4BLJA 4H7LA 1S4CA 4XFIA 1QJU3 4LA2A 1IS5A 1SLTA 4N43B 4PIYA 2BTVC 3H8UA 2G4IA 2ES3A 1R1A2 3WG1A 4FFFA 5CFDC 1LTEA 5F3EA 3WOGA 2W39A 4JKKA 4LOTA 1WMXA 3LA7A 1BMV1 3UV9A 2DCZA 5FZBA 2VUCA 3POBA 1OOPB 3AZZA 3H9AA 3KGLA 2WDBA 5KC5A 1ZZ8A 4CDQA 1ULFA 2GP3A 2J1SA 3S57A 2A6ZA 1V0AA 4WM8B 3R6SA 1J59A 4M3CA 1NAEA 4QX1A 2R042 4ZHNA 1ZBA2 2XWJB 1XXNA 4J1XA 4JQTA 4XUPA 5AC91 2ILMA 3K4ZA 3K77A 3KVAA 4IXLA 4MXVA 3VBOB 2JDUA 2W95A 1NX9A 3QCWA 4KQ7A 2VQ0A 3E97A 4NROA 5JZGB 1W99A 2ZACA 3BALA 1BEV3 2HWF1 3AYAA 1FMD2 4PCRA 4YW4A 3ZSLA 5DMYA 1EUTA 5IVBA 1H8TC 1LHOA 4Q4V2 3WHTA 1XNBA 1FPN2 2R062 4B8EA 3RZLA 1LHNA 4I0AA 1GOHA 1O5UA 2OT7A 2ZGUA 3FFQA 3ITQA 5FV3A 3RSJA 4F7ZA 4QX5A 5JUVA 1G9DA 1G86A 1QJEA 5A3WA 2XVLA 1R081 4I0WB 4JC1A 4YW7A 1UPSA 4NHMA 4DRVA 2QUOA 3DPRA 2VZQA 2Y6FA 2QKDA 3VBUC 3FE5A 4ZONA 4NIIA 4L99A 3FX3A 3VD4A 1PX3A 3J8F1 1NLSA 5KXDA 1WLDA 1ND2C 4DFSA 1XE8A 2YPJA 1JOPA 4J6GA 3VBHC 4DNYA 3T0BA 4A42A 1FV2A 1UIJA 2JIGA 3O1OA 1BYHA 4QXHA 4UFLA 5FY5A 5FBZA 2G1MA 2QE3A 2UYBA 1R093 4HPKB 2ZHNA 1JTZX 1O4YA 2ARCA 4YLZA 5A32B 4L8QA 2RR11 3NKGA 3LOBA 5FY8A 2FDGA 3N9NA 1IKQA 2DCYA 5LK5A 1G9FA 2ZS6B 3CF6E 4WVMB 4LO6B 2Y38A 1W8WA 4YZ3A 5KC6A 1C4RA 2VD7A 1QEXA 3FC0A 1RXFA 3A7QA 3HQXA 2R7EB 3J4UH 5FYCA 1AR81 5JSRA 4FCAA 2CTVA 1N3QA 3MIFA 4K9SA 1F31A 4HG6B 3UGGA 4HBNA 1Y43B 1ZZ6A 3TB0A 2JDNA 3ZXJA 5FZAA 1EAH2 2ZABA 2W47A 4FO9A 3TN93 1PZ9A 1SLBA 1IS6A 3FHIB 5BXXA 4MGZE 5JOYA 4NPRA 3KLSA 1DLLA 1SZBA 1RUJ3 2XJVA 3EJKA 3GHNA 4IEPA 1HRI3 2TEPA 2P4EA 2D6MA 4AVSA 1XNTA 4AQSA 4HVRA 3T08A 4ZU5A 4X6RB 3NJYA 3PMSA 3VDBA 1UW8A 2BNOA 1VBA1 2XDVA 1AL0G 2RS31 5JXHA 3R4SA 3ZFEC 4LO5B 2R1DA 4H55A 1JXNA 3OD0A 4E8DA 4CDXC 5LB6A 1NY72 3KWVA 3ZIXA 1QNWA 4PIZA 3VZLA 2C24A 2WIIB 4DUVA 4YZ4A 3H3ZA 5C3RA 5JXIA 1KQRA 4NWVA 4XCBA 1DGWA 4DO0A 2X29A 4XE9A 2J1VA 4CDWC 2Q4SA 4Y33A 3E5QA 3PDQA 1S0JA 3WQ0A 1UIKA 2RV9A 4Y5TA 4HZFA 1SFYA 1BVP1 4JKLA 3T2PA 3WW1A 5FTTC 1PGW1 4NPLA 5LBBA 3VB9A 3JQXA 3VL9A 4DY5A 4UT5A 1I5PA 2ZBJA 1VR3A 2WNUA 3IPVA 4HSLA 4INDA 2WAOA 3VBRB 2DCKA 2YFUA 4LHLA 1QJY2 1N47A 2WAAA 5CKMA 4NRMA 2R1BA 5EJZB 1U5XA 1QF3A 1FYUA 3LEMA 4QX3A 2WFF1 2ARBA 3I3DA 5GZDA 4QKDA 5I0DA 5FOBB 2VCBA 4FTEA 1OH3A 4IL7A 4M3CF 3HNYM 1TME3 2VUDA 4TLGA 3WQ1A 3O0WA 3ZXLA 4XJ8A 3BTAA 4Z8BA 1XNKA 2CGNA 5K9YA 1RUG3 1CN1A 3ALQA 4QDSA 3VBHB 2RJLA 4MLOA 4AFCA 5A3PA 4Q5OA 3J7NA 5DAWA 5FUPA 5A3NA 3I3QA 5BNNA 5A7WA 4JRAA 3UT0A 4CZSA 3KM5A 3NJZA 5A7SA 3V0AA 4FPHA 3HQUA 3UKTA 1F4HA 2RDQA 4QXCA 2XJQA 1AYN2 2DVFA 2D43A 1SLAA 4AI3A 5KHGA 4ZU7A 3O1RA 4KGQA 1ULDA 1UY0A 1TEIA 5LW9A 1I6XA 2RMU3 3P3PA 1Q8PA 4KU7A 3D82A 3VDDC 4K3UA 5A1FA 5JXJA 2ERFA 4JKMA 3RZMA 4KWKA 3IKWA 2AYHA 3NV4A 4AGGA 3PL0A 3AVSA 5EJ1B 5F5AA 3RNSA 4QPIC 2AH2A 3WDXA 4LJHA 1F2NA 2GDFA 4QQHA 4A6SA 1ULEA 2DUQA 4BE3A 1KFXL 1QJU2 5A6QA 3HWJA 4XJZA 2VC9A 1ND3B 2OVUA 4P9GA 4YYOA 3WZ1A 1YLLA 1X8MA 4GJZA 1S2KA 4LK7A 2XWBB 4EZHA 5C9AA 1ZZ7A 4I3GA 5FZ8A 2W1QA 2X5IA 2DUOA 1R1ZA 1V6IA 2ZX0A 1HXS3 3AP9A 2VOXA 4AWDA 3N7LA 4YW3A 3LGRA 1QH7A 3HVDA 1BK1A 1RVF3 1JZ5A 4HETA 2RS51 1RUD3 2QQUA 1W05A 4CDXB 2XUMA 4CYDA 4CPBD 1S55A 3KHCA 5A3LA 4CEWC 2JD4A 2A6VA 3ZKUA 4AGVA 4CEYB 5K4LA 4XF4A 4NOTA 5IVCA 1X9PA 2FMYA 3QD6A 2WA3A 3WF2A 1UOGA 1D7PM 2AR6A 2J1RA 2WWJA 3INAA 4YGEA 4BISA 4LULA 1GR3A 2HWC1 3WG4A 1BEV2 2ARXA 3RZKA 5A32A 5F9TA 4QM9A 2YC2A 2WA4A 1G9AA 3LIHA 1VBC2 4JHTA 5BNOC 2ID4A 4Q2FA 4C91A 3NV1A 5EFUA 1VBB2 1AR73 2BGPA 2NM1A 5FY4A 3ECQA 2VAUA 1SQ4A 5JI7A 1NXD1 4JRLA 1PVC2 1OA4A 4W8JA 4FXGB 5DAQA 3ZIWA 3KZ4C 1OLME 1KITA 2VPVA 5HV0A 4CXWA 1N1VA 1EV12 2TNFA 4AOCA 1TMF3 3POEA 4DINB 2BW8A 3H8XA 2XQRA 4CCJA 1W8OA 3AZVA 5J36A 3VDAA 1QJZA 5F3GA 3FJSA 4AFAA 1I9RA 2IXIA 4LR4A 1ZZ9A 3GJBA 1UY3A 1E5HA 1KJRA 1YFUA 2A6XA 3SEEA 4BCUA 3GXUA 4K7JA 4M0NA 5CZKA 4P5YA 3CIHA 4DUWA 3LDBA 4RFRB 3HPNA 4KG8A 3LD8A 2WYSA 3E6DA 3RZHA 2MEV1 5L9RA 2GH2A 1LOFC 2W2IA 3VDDB 1VRH1 4RGKA 3ZYBA 2BVBA 2BPA2 1Z7S1 4BLIA 2Y0IA 5DG2A 1UL9A 3LAGA 1BBT3 1HJFA 2PYTA 5FZ0A 2WNVB 2WBKA 1ZRFA 2GN3A 1MQTA 3MGUA 4QPGC 5FZKA 1NLRA 1P8JA 1RITA 4GWIA 4BK4A 5J09A 2QVSB 4R4ZA 4GALA 1JYTA 2JDPA 3POWA 2VY0A 5DXDA 1DZRA 3WW2A 4K20A 1CIYA 4RD7A 3EYPA 1HRI2 1VAVA 3WNOA 4Z92B 2WZ8A 4DUXA 4BQ1A 3BUCA 2YG0A 4XAAA 4GB33 1CPMA 3AZYA 4XHBA 5D2AA 4H7MA 5FZDA 1CAXA 3MFAA 1YEWA 3BU7A 4XTMA 2DCTA 3JBG1 1X7NA 4KGGA 3SEPA 2B8MA 1UY2A 1H2KA 4MX3A 1C1FA 2A75A 3J9SA 4OUEA 1CESA 2YGMA 5JLVA 5FPVA 4CP9B 3IZOA 2K9ZA 4XURA 3OPWA 1HB4A 4RQPA 5L73A 1GQGA 5FK8A 2Y6LA 3ZDSA 4BZ4A 4OI4A 5FYBA 3KGZA 2ADDA 2IVJA 5DZFA 3POYA 3I59B 3T2QA 4E2SA 4F83A 2VMHA 5C3PA 1UMHA 1N1YA 1B35A 2J42A 5CFCC 1URXA 2AEYA 4HSJA 1QOTA 1Q5OA 5E89A 1GV9A 3HAGA 1AL23 1H2NA 1W8FA 3SKVA 3LEKA 5BNOB 3JB8A 3KQ4B 1JU3A 4YW6A 3ZN4A 4LBKA 5D8AC 2ZEYA 4LT5A 4NVPA 4COVA 3DECA 3K2OA 3PUAA 2A71A 2VH9A 1G7YA 1LOEA 2ZZJA 4HN1A 1QQP2 1O91A 1RUI2 4UBHA 3R0RA 2LUWA 4OMCA 4P02B 1RIRA 4G4FA 1TME2 2L9LA 4XYXA 4META 1PGL2 1UPIA 3SNMA 2O8OA 1V9U3 3VKMA 4AEKA 4BWOA 1HB1A 1AXZA 2F4LA 2EXKA 1MZ6A 4YW5A 5FYUA 5DABA 3AKPA 4CCOA 4OYUA 4DZGA 1BHGA 5FO7B 2FCTA 3ZSMA 4LHSA 4R9CA 1M4WA 1ND3A 4ITCA 2HWB3 3J7HA 4Q4W3 3NO8A 4OLLA 3POJA 1UYPA 1YJKA 2BZDA 1D4M3 4X8NA 4ZU4A 4B3NA 5C3OA 4NIGA 5I93A 4W50A 1KS4A 4IEUA 4N7IA 1XE0A 3VHPA 4BB3A 3R4DB 1W6PB 3U4SA 2QQNA 2W52A 2VXJA 4E4SA 1XSQA 4FOVA 4YW2A 4AHYA 5EP9A 4L92A 1S0EA 1PMJX 3M3IA 4URTA 2A70A 2XH6A 1J3QA 2O8QA 1T2XA 3MLKA 5D21A 5FUIA 4EWEA 5F7UA 4B29A 1FOD2 1H4GA 4CEYA 2VNOA 3MFCA 2XUEA 3C3VA 1I1EA 3BIWE 3GCWA 1S0IA 1D2QA 5FZFA 1N3PA 5EXOA 2SBAA 1MACA 4L97A 1W28A 1TNFA 4AHZA 4LNVA 4E4DX 3O0VA 2Z2SB 1W8ZA 1QIQA 5T54A 5BYNA 4XIOA 2ZGKA 1UY4A 4PI2A 4UOJA 4Z82A 1IPKA 1HXS2 2WSVA 4KBBA 2QQMA 4XACA 2VQTA 3SKJE 4QPWA 1RUE3 1OH4A 2HEWF 3ACLA 1DQ2A 3NAPC 1RVF2 3MV11 2ENRA 2QQLA 2D3SA 4GH4C 1CQ9A 1RUD2 4IEVA 2VCAA 1K42A 1U5ZA 1YIFA 5FO9B 4QXKA 3UYJA 1AZDA 1ZBE3 1XYPA 4Q29A 1VALA 3U07A 3V0BA 3BTYA 4TN7A 4YVWB 1N1TA 1ULCA 2GNDA 5DDJ1 4PDWB 3ZYGA 2BNNA 4B1MA 1WBFA 2V73A 4QGNA 1K5MA 1APNA 1AYM2 1YO8A 1Z78A 3GBWA 2RS12 1W0OA 2I74A 4FSJA 4RR3A 1W3XA 5A7NA 1SBDA 3NNLA 4L0PA 4NHKA 1ASJ1 1GP4A 1LODA 1PVXA 2JD9A 2EIBA 3UNPA 2HWE1 2JG8A 1V6KA 1TVGA 1C5HA 1FATA 4QQPA 1WMFA 3ZFGC 2VECA 2YXSA 3HNMA 5EHDA 3VKOA 3ZFFC 1GP5A 2D40A 3ZYIB 1LRHA 5HCAA 3TEZA 4RS5B 2A6YA 2JDYA 2XPJA 2WQ8A 1O4ZA 1TMF2 1RUJ1 1HDKA 1HQNA 2GC2A 1PIV1 5DAPA 2D3RA 3UL2A 1A3KA 3MIGA 1LU1A 1Q3EA 1R1A3 3TRSB 4IV3B 3HN1A 3OUJA 2ATFA 4Q0QA 5AVAA 5CBLA 4I0BA 3KCCA 3NKTA 4OHVA 5K0UA 3RG0A 3RS6A 1N3OA 2E32A 2OZJA 2EAAA 3WQ7A 4IUGA 4CRQA 1NZCA 5C4WB 4XBNA 5JR2A 3MUZ1 3U11A 3D4KA 4TTGA 3RJ2X 5FZMA 2VOKA 1PGSA 3O1SA 1Q43A 4KL1A 5I0RA 2R043 2FBEA 2WR9A 1GQHA 1W2OA 3KVBA 1BBT2 4BIFA 4CP9A 4URAA 4XTPA 4IV1B 3HD8B 1US3A 5L9BA 1FMD3 2B4KA 3I59A 5EV7A 4LE4A 2DURA 3MW2A 1W8UA 5IVJA 1FPN3 1ENRA 2R063 3ZR5A 4COZA 4N9HA 4N53A 1RUF2 1CAVA 3RWNA 1C5IA 3C7FA 4GB32 4UYBA 2XHKA 3KF3A 2VUAA 2W9XA 3KV4A 4NN0A 4UAPA 1WCKA 1CX4A 3WDTA 3GM8A 4BIOA 3WDYA 1ZNPA 4N90A 1IQDC 2Y6GA 3NAPB 1CJDA 2JEMA 1VB2A 2UY8A 4GH4B 1DU3D 4IE4A 4UFJA 4XUOA 5GZGA 3B3QE 5FQ0B 1WKYA 4HONA 4JGYC 1J1LA 1X50A 1RMU3 3AX4A 3VUOA 3UGFA 3JCIA 1CZVA 1W2NA 4JGZC 4LE3A 2FD8A 1OVSA 4HVQA 1FV3A 2OW4A 4ET7A 4ONUA 4Y20A 3WDWA 1VMFA 5FP8A 3VKNA 5C3SA 2CSGA 2PLV3 2HYXA 4LO4B 1PK6B 1QOOA 1Q56A 5CB7A 3S30A 1JYXA 3W58A 1BMV2 2JDZA 4IW3A 5DZGA 1UU4A 2JDKA 2D5FA 3X29B 2Y6KA 4A2UA 2WS93 3AMHA 4E2GA 4LBJA 3DN7A 4MGIE 5FYZA 1H2MA 1POV3 1ZX5A 4BQYA 4A3XA 3HT1A 3LEIA 2H6BA 3OGSA 1C28A 4P14A 5EIYB 2QZ2A 2WQZC 2ZHKA 4CCDA 4COWA 3RI8A 2JB8A 4BHPA 4Z2AA 3D3AA 2P6HA 3MBWA 3BU0A 3K48A 4YM1A 1O8SA 2DBIA 2HWF2 3KQRA 2HH9A 4XJAA 1GUIA 1FAYA 4RL7A 5A6ZA 4IE6A 4A45A 4XF1A 2HWB2 4QDRA 4LKEA 5CISA 5C8CC 1DBNA 3AYCA 5FZOA 2D6LX 1S0BA 2PA7A 1OD3A 5EYXA 1Z0HA 1LAJA 5BNNC 4LKDA 1HB2A 5LRSA 1LHUA 1OA2A 4QWNA 4XMIA 2X09A 3OG2A 5EQUA 5IVVA 4NR1A 2JWPA 2EALA 3J8F2 2A7AA 3KF5A 5A6XA 5I0SA 1GZCA 3GF6A 4WVZA 5IW0A 5I8SA 1UX6A 2Q8OA 4XUTA 1XRUA 3SMHA 1SBFA 2WZR1 3VBFA 3U75A 1FNYA 2EIGA 5AFBA 3S5QA 5C3QA 2JG9A 3USSA 2VVDA 1AR71 5EZWA 1QJY3 2OZ6A 3AMQA 1X82A 2VMDA 4IEZA 3ZSJA 2PHXA 4EE2A 4XBQA 3R05A 1OKQA 1KEXA 1QHDA 3E6BA 3CNAA 2X05A 3RJRA 5C5TA 2EICA 2P17A 3F95A 1C8M3 3GBGA 3NWKA 4LHNA 5B4XA 5ISLA 4XJ9A 2P6CA 1GYKA 2BDRA 3OUHA 4WVWA 4AEDA 5ABJC 4JCKA 2ARAA 1S0FA 2ZGLA 4K6BA 3DF0A 2X5IC 1OQEA 3WF3A 3AJZA 5BY5A 1I5ZA 5DPNA 1OQDA 3O1MA 3EXUA 1ZBE2 2P2KA 2Q1FA 4JGZB 4JTOA 3IMNA 1W9SA 2HWD1 2VNGA 2P34A 2WWSA 4UW3A 1ODNA 4CP2A 4LBLA 2VULA 5GLVA 2VW1A 2DVDA 4YVSA 1VBE1 3PTYA 4CPBA 3DYPA 3B94A 1VBA2 2PHUA 3OY8A 4NE9A 1LOGA 2RS32 5T5PA 1YC61 1QDCA 4WZFA 3P6BA 2ZEXA 1DGRA 3PLQA 4FOWA 1VJ2A 1ZRIA 3ZR6A 1X9TA 1WZXA 4M0HA 5TSWA 2XJPA 3T0AA 1AR63 3CQOA 4EN8B 4K8RB 1DCSA 5C6CA 4XBLA 2O14A 4XZPA 5A33A 3NV3A 3WG3A 1BVVA 1HQLA 3BN6A 3WF1A 4AQTA 1L3JA 4BQ4A 5EJ3A 2VZUA 1PO21 2R071 2RHPA 1L7RA 2ADEA 5FXVA 5KHHA 1PGW2 2WT1A 4IGPA 5FP4A 3ZYFA 4OI0A 3D0JA 5FPUA 3ILRA 5LEJA 2Y34A 1ENQA 2PHWA 4JDMA 2GMMA 3SITA 2E31A 3WW3A 1K3IA 3JD73 4OUSA 4Q27A 2B7YA 4LPLA 1UU5A 4S2FA 1NCQA 3I2JA 2QQPA 5I0UA 2WFF2 3AP4A 1YQ8A 3MIHA 3NJVA
chains in the Genus database with same CATH topology
3NNGA 1UY0A 5JXJA 1UYXA 3I97A 4JKMA 3PUHA 3THDA 1JZ8A 3I2HA 2ZEZA 5EJ1B 2V72A 1R64A 2VQUA 2VZ1A 4LQRA 3DYMA 4DXRA 4AAXA 2VM9A 2VC9A 2OKXA 5J1XA 2J1AA 2DCJA 3ACHA 3WNNA 2VMCA 1UMIA 4PT6A 4FI9A 2W1QA 3VDCA 4D0QA 5JXGA 4CUCA 5C71A 1JI6A 4CUAA 3C7EA 1DLCA 2Z4FA 2X10A 4M4RA 5C7GA 1JYVA 1JZ5A 5JMOA 1L7QA 2J1UA 3WF2A 1D7PM 3ACFA 2J1RA 1UYYA 1MPXA 1HN1A 2VTFA 3HOBA 1K12A 3IB3A 3VD3A 4BXSV 1RYYA 2YC2A 3A22A 4M4PA 3IAQA 2ID4A 3JXSA 1GQPA 3MO4A 2BGPA 3ECQA 5LA0A 2JKXA 4W8JA 3WQBA 3CMGA 2W94A 4TXWA 2DDUA 5HXMA 1W8OA 3P1IA 3VDAA 3DYOA 1UY3A 4BDVB 4XUNA 3SEEA 3GXUA 1J84A 2J1EA 5CZKA 1YQ2A 4P5YA 3CIHA 4MGSA 1CZTA 3WSOA 4DUWA 3HPNA 4OZOA 5C70A 5DN2A 4DXTA 4KMQA 2ZEWA 2WYSA 3ABZA 3UESA 2VZTA 2QQJA 4CU8A 1F4AA 5DQ0A 2WBKA 3NRUA 2HLEA 1P8JA 4GWIA 4BK4A 2VZPA 3AC0A 4P00B 4E8CA 1CIYA 3WNOA 3EYPA 2WZ8A 4DUXA 4LKSA 3K4AA 3K46A 2YG0A 1GNYA 2ZXQA 3MUY1 2WO1A 4RYDA 2WN2A 2JDAA 2WN3A 4KI5M 2VZSA 3SEPA 1UY2A 3WNLA 1CZSA 3WEZA 4OUEA 1SDDB 4XURA 2Y6LA 2W87A 1ULOA 1O8PA 3T2QA 1UMHA 2VOTA 3K75B 3W5MA 3HN3A 3U37A 4MO3M 2VZ3A 4JX0A 3SKVA 2VCCA 4MADA 3CKHA 3LEKA 5IFTA 1GMMA 4GWJA 1JU3A 4KWUA 2ZEYA 4P08A 3EB7A 3A23A 2RVAA 2XONA 4ARXA 4YPJA 3DECA 3ZM8A 4A3ZA 2C9KA 3K4DA 4P02B 4OMCA 3HEIA 5CYYA 5IYYA 1DYOA 2L9LA 2VMFA 2Y8KA 2W1WA 1UXZA 2W3JA 3VD5A 3IIIA 4CU6A 4QB2A 4OYUA 1BHGA 2VR4A 4LHSA 1J83A 2VJXA 3J7HA 4BJ0A 4ARYA 3A21A 3LEGA 4QB6A 4W4ZA 4ZZ5A 2BZDA 3W5NA 2YFZA 3LQCA 4W50A 2QQNA 5LA2A 5B4NA 2KD7A 4ZXEA 1PMJX 1T2XA 5F7UA 5FUIA 4XVHA 3CDZB 2W1UA 4XZUG 1W0NA 2ORZA 1NKGA 3FHAA 5G04L 5IJRA 2QQIA 1UY4A 4UOJA 2V5DA 3WF0A 2LS6A 2J1TA 2QQMA 4PF1A 2VQTA 4ZZ8A 4JHZA 4D8MA 3SKJE 5A1AA 4QPWA 1GOGA 1OH4A 2YC4A 2J22A 3MV11 3OB8A 2WO3A 2QQLA 4QAWA 2B9VA 4QX0A 4CU7A 2VCAA 1K42A 3OGRA 2E33A 2CDPA 2Y64A 2YB7A 1JZ6A 3GGLA 4OMDA 1H6YA 3OBAA 3T2OA 3UETA 4AG4A 5G05L 2WO2A 3E1F1 4QB1A 1UWWA 2W5FA 2VZRA 3LE0A 1JYNA 4L0PA 2ORXA 3CZJA 2JD9A 2QBXA 3UNPA 2EIBA 2VMEA 1TVGA 3MV01 2BERA 2C4XA 2VL4A 4RN5A 4UI9L 3HNMA 1TG7A 2WQ8A 4A41A 1OF4A 3T09A 1W9WA 4ZY9A 1O59A 3I3BA 2BBAA 2JE8A 2E32A 4A4AA 4CUBA 1XPWA 2WABA 3LPGA 4IUGA 2BGOA 1GOFA 5JR2A 2CDOA 3MUZ1 1US2A 3FN9A 3OEBA 4TTGA 3WNPA 1JZ2A 1LNSA 4A6OA 1JZ4A 2EIDA 3FL7A 1JZ3A 2VO5A 1US3A 1GU3A 3ACIA 3LPFA 3WF4A 2VZVA 3C7HA 2B4KA 2W91A 1SG3A 1UX7A 2Y6JA 3NJXA 3ETPA 4CVUA 2PQSA 3C7FA 2W9XA 4JKKA 4UAPA 5IFPA 1JHJA 3C8XA 3GM8A 1IQDC 2XQXA 2Y6GA 3PUIA 2WDBA 4XUOA 2LW8A 1WKYA 2J1SA 1OT5A 1CZVA 1NAEA 4QX1A 4XUPA 3K4ZA 3K77A 4ET7A 3VD7A 2W95A 1NX9A 1CX1A 1PX4A 1W99A 4BK5A 5DMYA 2HYXA 3WNMA 1EUTA 1JYXA 3VD9A 4DEQA 2WUHA 1OF3A 1EUUA 1GOHA 1NUKA 2Y6KA 4DEVA 2W46A 5JUVA 3HJRA 3IAPA 2W1SA 4PQQA 2EIEA 3LEIA 1UYZA 3I2KA 3OGSA 1KGYA 5EIYB 2VZQA 2Y6HA 1PMHX 3I3EA 2W92A 3VD4A 1PX3A 3FHQA 3HNBM 4Z2AA 3D3AA 2XHNA 3MBWA 1O8SA 3T0BA 4A42A 1GUIA 4A45A 4GZ9A 4QDRA 5LCWL 3CZUA 1OD3A 5LA1A 3WNKA 3A7QA 2R7EB 2X09A 3OG2A 3F2ZA 2V4VA 4MOAA 3I2IA 4HG6B 4MGQA 4XUTA 3OGVA 2W47A 1WCQA 3IDAA 2RJ2A 1JZ7A 1UXXX 1SHWB 1XNTA 2VMDA 3T08A 4DXSA 1KEXA 2J7MA 4QX2A 3VDBA 2X05A 3I2GA 2EICA 5JXHA 5B4XA 4E8DA 1JU4A 3WF3A 4DUVA 5DPNA 5JXIA 1XNAA 1XC6A 1H6XA 1W9SA 2J1VA 3ACGA 2RV9A 2WZEA 4JKLA 2VZOA 3C7GA 3T2PA 3OEAA 3DYPA 1UZ0A 1I5PA 2QQOA 3GDBA 2WAOA 5IHRA 2DCKA 2YFUA 3P6BA 4A44A 2ZEXA 1JYWA 2WAAA 1W8NA 5EJZB 1ULPA 1UY1A 1DP0A 1K45A 2E26A 4QX3A 3I3DA 5I0DA 3I2FA 3T0AA 2VCBA 3CQOA 4CU9A 2XOMA 3HNYM 3WF1A 3BN6A 2QQKA 2VZUA 1W9TA 1L7RA 4QDSA 3BGAA 3T0DA 4QDQA 5HPOA 1F4HA 2E31A 4XUQA 2C26A 1K3IA 4LPLA 3C7OA 3I2JA 3NQHA 3THCA 3NJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NNG A;  1UY0 A;  5JXJ A;  1UYX A;  3I97 A;  4JKM A;  3PUH A;  3THD A;  1JZ8 A;  3I2H A;  2ZEZ A;  5EJ1 B;  2V72 A;  1R64 A;  2VQU A;  2VZ1 A;  4LQR A;  3DYM A;  4DXR A;  4AAX A;  2VM9 A;  2VC9 A;  2OKX A;  5J1X A;  2J1A A;  2DCJ A;  3ACH A;  3WNN A;  2VMC A;  1UMI A;  4PT6 A;  4FI9 A;  2W1Q A;  3VDC A;  4D0Q A;  5JXG A;  4CUC A;  5C71 A;  1JI6 A;  4CUA A;  3C7E A;  1DLC A;  2Z4F A;  2X10 A;  4M4R A;  5C7G A;  1JYV A;  1JZ5 A;  5JMO A;  1L7Q A;  2J1U A;  3WF2 A;  1D7P M;  3ACF A;  2J1R A;  1UYY A;  1MPX A;  1HN1 A;  2VTF A;  3HOB A;  1K12 A;  3IB3 A;  3VD3 A;  4BXS V;  1RYY A;  2YC2 A;  3A22 A;  4M4P A;  3IAQ A;  2ID4 A;  3JXS A;  1GQP A;  3MO4 A;  2BGP A;  3ECQ A;  5LA0 A;  2JKX A;  4W8J A;  3WQB A;  3CMG A;  2W94 A;  4TXW A;  2DDU A;  5HXM A;  1W8O A;  3P1I A;  3VDA A;  3DYO A;  1UY3 A;  4BDV B;  4XUN A;  3SEE A;  3GXU A;  1J84 A;  2J1E A;  5CZK A;  1YQ2 A;  4P5Y A;  3CIH A;  4MGS A;  1CZT A;  3WSO A;  4DUW A;  3HPN A;  4OZO A;  5C70 A;  5DN2 A;  4DXT A;  4KMQ A;  2ZEW A;  2WYS A;  3ABZ A;  3UES A;  2VZT A;  2QQJ A;  4CU8 A;  1F4A A;  5DQ0 A;  2WBK A;  3NRU A;  2HLE A;  1P8J A;  4GWI A;  4BK4 A;  2VZP A;  3AC0 A;  4P00 B;  4E8C A;  1CIY A;  3WNO A;  3EYP A;  2WZ8 A;  4DUX A;  4LKS A;  3K4A A;  3K46 A;  2YG0 A;  1GNY A;  2ZXQ A;  3MUY 1;  2WO1 A;  4RYD A;  2WN2 A;  2JDA A;  2WN3 A;  4KI5 M;  2VZS A;  3SEP A;  1UY2 A;  3WNL A;  1CZS A;  3WEZ A;  4OUE A;  1SDD B;  4XUR A;  2Y6L A;  2W87 A;  1ULO A;  1O8P A;  3T2Q A;  1UMH A;  2VOT A;  3K75 B;  3W5M A;  3HN3 A;  3U37 A;  4MO3 M;  2VZ3 A;  4JX0 A;  3SKV A;  2VCC A;  4MAD A;  3CKH A;  3LEK A;  5IFT A;  1GMM A;  4GWJ A;  1JU3 A;  4KWU A;  2ZEY A;  4P08 A;  3EB7 A;  3A23 A;  2RVA A;  2XON A;  4ARX A;  4YPJ A;  3DEC A;  3ZM8 A;  4A3Z A;  2C9K A;  3K4D A;  4P02 B;  4OMC A;  3HEI A;  5CYY A;  5IYY A;  1DYO A;  2L9L A;  2VMF A;  2Y8K A;  2W1W A;  1UXZ A;  2W3J A;  3VD5 A;  3III A;  4CU6 A;  4QB2 A;  4OYU A;  1BHG A;  2VR4 A;  4LHS A;  1J83 A;  2VJX A;  3J7H A;  4BJ0 A;  4ARY A;  3A21 A;  3LEG A;  4QB6 A;  4W4Z A;  4ZZ5 A;  2BZD A;  3W5N A;  2YFZ A;  3LQC A;  4W50 A;  2QQN A;  5LA2 A;  5B4N A;  2KD7 A;  4ZXE A;  1PMJ X;  1T2X A;  5F7U A;  5FUI A;  4XVH A;  3CDZ B;  2W1U A;  4XZU G;  1W0N A;  2ORZ A;  1NKG A;  3FHA A;  5G04 L;  5IJR A;  2QQI A;  1UY4 A;  4UOJ A;  2V5D A;  3WF0 A;  2LS6 A;  2J1T A;  2QQM A;  4PF1 A;  2VQT A;  4ZZ8 A;  4JHZ A;  4D8M A;  3SKJ E;  5A1A A;  4QPW A;  1GOG A;  1OH4 A;  2YC4 A;  2J22 A;  3MV1 1;  3OB8 A;  2WO3 A;  2QQL A;  4QAW A;  2B9V A;  4QX0 A;  4CU7 A;  2VCA A;  1K42 A;  3OGR A;  2E33 A;  2CDP A;  2Y64 A;  2YB7 A;  1JZ6 A;  3GGL A;  4OMD A;  1H6Y A;  3OBA A;  3T2O A;  3UET A;  4AG4 A;  5G05 L;  2WO2 A;  3E1F 1;  4QB1 A;  1UWW A;  2W5F A;  2VZR A;  3LE0 A;  1JYN A;  4L0P A;  2ORX A;  3CZJ A;  2JD9 A;  2QBX A;  3UNP A;  2EIB A;  2VME A;  1TVG A;  3MV0 1;  2BER A;  2C4X A;  2VL4 A;  4RN5 A;  4UI9 L;  3HNM A;  1TG7 A;  2WQ8 A;  4A41 A;  1OF4 A;  3T09 A;  1W9W A;  4ZY9 A;  1O59 A;  3I3B A;  2BBA A;  2JE8 A;  2E32 A;  4A4A A;  4CUB A;  1XPW A;  2WAB A;  3LPG A;  4IUG A;  2BGO A;  1GOF A;  5JR2 A;  2CDO A;  3MUZ 1;  1US2 A;  3FN9 A;  3OEB A;  4TTG A;  3WNP A;  1JZ2 A;  1LNS A;  4A6O A;  1JZ4 A;  2EID A;  3FL7 A;  1JZ3 A;  2VO5 A;  1US3 A;  1GU3 A;  3ACI A;  3LPF A;  3WF4 A;  2VZV A;  3C7H A;  2B4K A;  2W91 A;  1SG3 A;  1UX7 A;  2Y6J A;  3NJX A;  3ETP A;  4CVU A;  2PQS A;  3C7F A;  2W9X A;  4JKK A;  4UAP A;  5IFP A;  1JHJ A;  3C8X A;  3GM8 A;  1IQD C;  2XQX A;  2Y6G A;  3PUI A;  2WDB A;  4XUO A;  2LW8 A;  1WKY A;  2J1S A;  1OT5 A;  1CZV A;  1NAE A;  4QX1 A;  4XUP A;  3K4Z A;  3K77 A;  4ET7 A;  3VD7 A;  2W95 A;  1NX9 A;  1CX1 A;  1PX4 A;  1W99 A;  4BK5 A;  5DMY A;  2HYX A;  3WNM A;  1EUT A;  1JYX A;  3VD9 A;  4DEQ A;  2WUH A;  1OF3 A;  1EUU A;  1GOH A;  1NUK A;  2Y6K A;  4DEV A;  2W46 A;  5JUV A;  3HJR A;  3IAP A;  2W1S A;  4PQQ A;  2EIE A;  3LEI A;  1UYZ A;  3I2K A;  3OGS A;  1KGY A;  5EIY B;  2VZQ A;  2Y6H A;  1PMH X;  3I3E A;  2W92 A;  3VD4 A;  1PX3 A;  3FHQ A;  3HNB M;  4Z2A A;  3D3A A;  2XHN A;  3MBW A;  1O8S A;  3T0B A;  4A42 A;  1GUI A;  4A45 A;  4GZ9 A;  4QDR A;  5LCW L;  3CZU A;  1OD3 A;  5LA1 A;  3WNK A;  3A7Q A;  2R7E B;  2X09 A;  3OG2 A;  3F2Z A;  2V4V A;  4MOA A;  3I2I A;  4HG6 B;  4MGQ A;  4XUT A;  3OGV A;  2W47 A;  1WCQ A;  3IDA A;  2RJ2 A;  1JZ7 A;  1UXX X;  1SHW B;  1XNT A;  2VMD A;  3T08 A;  4DXS A;  1KEX A;  2J7M A;  4QX2 A;  3VDB A;  2X05 A;  3I2G A;  2EIC A;  5JXH A;  5B4X A;  4E8D A;  1JU4 A;  3WF3 A;  4DUV A;  5DPN A;  5JXI A;  1XNA A;  1XC6 A;  1H6X A;  1W9S A;  2J1V A;  3ACG A;  2RV9 A;  2WZE A;  4JKL A;  2VZO A;  3C7G A;  3T2P A;  3OEA A;  3DYP A;  1UZ0 A;  1I5P A;  2QQO A;  3GDB A;  2WAO A;  5IHR A;  2DCK A;  2YFU A;  3P6B A;  4A44 A;  2ZEX A;  1JYW A;  2WAA A;  1W8N A;  5EJZ B;  1ULP A;  1UY1 A;  1DP0 A;  1K45 A;  2E26 A;  4QX3 A;  3I3D A;  5I0D A;  3I2F A;  3T0A A;  2VCB A;  3CQO A;  4CU9 A;  2XOM A;  3HNY M;  3WF1 A;  3BN6 A;  2QQK A;  2VZU A;  1W9T A;  1L7R A;  4QDS A;  3BGA A;  3T0D A;  4QDQ A;  5HPO A;  1F4H A;  2E31 A;  4XUQ A;  2C26 A;  1K3I A;  4LPL A;  3C7O A;  3I2J A;  3NQH A;  3THC A;  3NJV A; 
#chains in the Genus database with same CATH topology
 3DGT A;  5FLI A;  3CJI C;  2ZGQ A;  1YUD A;  3ES1 A;  2P5B A;  1UYX A;  4NHX A;  2FDK A;  5FY7 A;  2QFE A;  2YZ4 A;  4OCT A;  3THD A;  3I2H A;  1CD3 G;  1Y9G A;  2ZEZ A;  3NW4 A;  5IVE A;  2B39 A;  1QGL A;  5BV6 A;  4XAB A;  2BWA A;  4YM0 A;  1R64 A;  4UF0 A;  3KV5 A;  4CCK A;  4TZD A;  1ENS A;  1PZ7 A;  2C6S A;  2VQU A;  2XGX A;  5DUU A;  1AL2 1;  5FIX A;  4FAH A;  3W20 A;  2UWC A;  1COV 3;  2BYV E;  2ZKN A;  3DYM A;  4DXR A;  1XSR A;  4AK3 A;  1AR9 1;  1VBC 3;  2R30 A;  4M00 A;  2NZ9 A;  3Q8E A;  5ACA 3;  3WNN A;  3ACH A;  1WW7 A;  1SCR A;  1VBB 3;  3KT1 A;  1H4H A;  5GLW A;  5IAT A;  2IC1 A;  4PT6 A;  4D0Q A;  1MQT C;  1PVC 3;  1A78 A;  4CUC A;  5C71 A;  1LJ7 A;  2CY6 A;  1H9W A;  2XB6 C;  4AE2 A;  1NA1 B;  2DYC A;  3C7E A;  3PME A;  1DZT A;  2DU1 A;  5KWR A;  1EV1 3;  2OPW A;  3WCS A;  3RWK X;  4HKL A;  2E9Q A;  5E16 A;  1L7Q A;  3UJQ A;  1ZZB A;  3VZJ A;  3MF6 A;  2HBU A;  1RMU 2;  2J1U A;  3CHX A;  1W39 A;  2XJR A;  2ZHM A;  1KD7 A;  4XIK A;  1YQ5 A;  3WLU A;  4AXO A;  5FXW A;  4WM7 A;  1LEC A;  4Y1X A;  1OPO A;  4R9B A;  4O7X A;  3N35 A;  2C5D A;  1ENX A;  3POS A;  3I7D A;  2PLV 2;  5FYI A;  4BXS V;  1RYY A;  1HIX A;  1Q8V A;  4R8H A;  2GC3 A;  4RQP C;  4Q0U A;  5M0T A;  3MEP A;  3OYW B;  4J1W A;  3KB5 A;  2Y33 A;  3GYD A;  2QNK A;  4ORF A;  2VW2 A;  4HN0 A;  1NCR B;  2E6V A;  2RS5 2;  2WLP A;  4FPK A;  2WS9 2;  3LB9 A;  4LKF A;  4FFG A;  2RM2 1;  1O3T A;  1YYN A;  2RDN A;  2V4A A;  3FZ3 A;  4D3W A;  1B35 C;  2JKX A;  2WRA A;  3WQB A;  4YSF A;  4YZ2 A;  1ZVF A;  4KWL A;  4Q4Y 1;  2RDS A;  4TXW A;  5L7O B;  2P37 A;  2FCU A;  3H42 B;  3IIA A;  4CCC A;  4FVV A;  1YNA A;  2VBD A;  5HXM A;  4WZC A;  4I30 A;  3BI3 A;  2XBO 2;  1CPN A;  1Y3T A;  1ZRC A;  1BLZ A;  4UFK A;  1H1M A;  3DYO A;  5FOJ B;  2NYY A;  5CFD B;  2X53 S;  4XXA A;  1DDL A;  4XUN A;  2EXI A;  4QX7 A;  5FPA A;  1V70 A;  4PJY A;  4XPV A;  2IVI B;  4BU2 A;  2ZTN A;  4IES A;  4OZO A;  3S7I A;  5C70 A;  3ZYR A;  1OLM A;  4KMQ A;  1RED A;  5JDB A;  3CJI B;  1X33 A;  2OX0 A;  3ABZ A;  4O65 A;  2MHF A;  5FXX A;  3LSD A;  2ZGN A;  3SH4 A;  3N9M A;  3JQW A;  1QDO A;  3MW4 A;  3OGJ A;  4CU8 A;  5BNP A;  2A3W A;  4CCE A;  4XQW A;  2LAL A;  3M1H A;  1NE4 A;  1GKB A;  4TYS A;  4IEW A;  4Y26 A;  4DB5 A;  1H8T B;  3ZPO A;  4ZXK A;  3O5S A;  4L9B A;  3ZXF A;  4CDU A;  5FAX A;  4Q8K A;  3RZG A;  3U0Z A;  3SIS A;  2GH8 A;  3PUR A;  1CR7 A;  4Y22 A;  2EA7 A;  3MUY 1;  3TWI A;  1QQP 3;  1RUI 3;  3FUO A;  1MEC 3;  1VRH 2;  3NV2 A;  4AF9 A;  5GM0 A;  2LM3 A;  1C8M 2;  2NN8 A;  4PBP A;  4KI5 M;  5FMO L;  3VBU B;  5IK8 A;  2C1F A;  3WNL A;  3USU B;  1CZS A;  5LAT A;  1ND2 B;  5IVF A;  1POV 0;  1QJX 3;  1H1I A;  1SDD B;  1YWK A;  1QH6 A;  1W8T A;  5FZ9 A;  1GBG A;  4XQ4 A;  3VBS A;  1DGL A;  1NOV A;  4LBN A;  1JW6 A;  4MGK E;  4QHB A;  2BU9 A;  5J98 B;  3U10 A;  1ULO A;  4ZPI A;  4N43 A;  5H9Q A;  1REF A;  1O8P A;  1QXP A;  1AVB A;  4RHV 1;  3BOD A;  5BUV A;  1NLQ A;  4N9I A;  5IAX A;  5K8S A;  4HOO A;  3WUD A;  3W5M A;  2F17 A;  1REE A;  4MO3 M;  3SCF A;  5KHJ A;  4XIL A;  4FXK B;  1HRV 1;  4JX0 A;  4BMB A;  2R16 A;  2LRP A;  3CKH A;  3ZVX A;  5IFT A;  4XAE A;  4AVT A;  1OOP A;  1ZBA 1;  5FLJ A;  4GMP 3;  4KBZ A;  2Z5W A;  2IXL A;  2RVA A;  3AXD A;  4YPJ A;  3RFR A;  1UMZ A;  2ARE A;  2KA3 A;  3JUU A;  1G9C A;  1GAN A;  2CAV A;  5FMC A;  1K5M C;  3MI8 A;  1WW4 A;  4WM8 A;  4IGO A;  1FOD 3;  3K4D A;  1AR6 2;  3FWE A;  2YC0 A;  4Q4V 1;  1VMH A;  5KHK A;  4LBQ D;  3VBO A;  3DKW A;  3E5U A;  2Y8K A;  3GHM A;  3GZE A;  1O6U A;  5JZG A;  2W3J A;  1GWK A;  1MS0 A;  4U2A A;  4XJW A;  5EPA A;  3VD5 A;  4U36 A;  4I02 A;  3P5B A;  3MIE A;  1A8D A;  5GLZ A;  2VR4 A;  3M3C A;  5K7P A;  3LA2 A;  3H3U A;  2D5H A;  3JD7 2;  5JVV A;  4Q1R A;  2YU2 A;  4QB6 A;  3ZFE B;  1FXZ A;  3J26 N;  4RA0 A;  3ASI A;  1JOJ A;  1WLT A;  5GLT A;  3VHN A;  4B7K A;  1WUV A;  3L2H A;  2YFZ A;  4BYY A;  4C0B A;  4LIV A;  5HI0 A;  3HIF A;  4GJY A;  5K0U C;  3ILF A;  3KS7 A;  1JYC A;  1Y7B A;  2DWR A;  3IWZ A;  5FRA A;  4ZXE A;  1RUH 3;  3V56 A;  4CDW B;  3D6E A;  4V2W A;  3ZDV A;  2ZAA A;  3SH5 A;  5JSP A;  3URF A;  4FPC A;  4HPK A;  1LED A;  3ZN6 B;  2CHH A;  1COV 2;  1IS3 A;  1AYM 3;  1SFP A;  3TOJ A;  4XZU G;  2RS1 3;  1W0N A;  1AXY A;  2D6N A;  4Q4X 3;  5F6L B;  3WHU A;  2DF7 A;  2GME A;  2MNG A;  1NKG A;  3FHA A;  1AJK A;  1DHK B;  5ACA 2;  5JOW A;  4OI1 A;  3MF9 A;  4OHW A;  4HMZ A;  1RGS A;  3JB4 C;  4JQR A;  4QD2 A;  4WVM A;  1W03 A;  5G04 L;  4YZ5 A;  2V5D A;  1EAH 1;  2H6C A;  2QCS B;  4ZZ8 A;  4D8M A;  1O7F A;  1NCR A;  3BB6 A;  1GOG A;  1TQ5 A;  1VBD 3;  3OB8 A;  2WO3 A;  3K51 A;  4QAW A;  4QX0 A;  4BH9 A;  4CU7 A;  3MLL A;  4N53 C;  4BQW A;  4K21 A;  2NQY A;  2E33 A;  3OGR A;  4YNI A;  1Q8S A;  3H0O A;  1IZ3 A;  1W90 A;  3GGL A;  5CG9 A;  3SC7 X;  3BVC A;  4LMF A;  1CIW A;  2SLI A;  3CEW A;  1H6Y A;  2D93 A;  2ZA9 A;  4AG4 A;  2BEO A;  4I09 A;  3AFG A;  4JDN A;  4EN9 B;  5FXZ A;  2WO2 A;  4AHX A;  3KCY A;  3E1F 1;  1GNZ A;  3OBT A;  1NY7 1;  3Q8B A;  4ISQ A;  4QB1 A;  1UOJ A;  3H1Y A;  1JYN A;  4XW3 A;  2I45 A;  3CZJ A;  4IE0 A;  5LRR A;  3J7L A;  4HXC A;  2E7Q A;  5DUW A;  4G3Y C;  2BER A;  2C4X A;  2VL4 A;  1V6J A;  4QPI B;  1W6N B;  1OLR A;  4UI9 L;  3RVH A;  3ZOI A;  3P3N A;  4N8M A;  1CVN A;  3PVO A;  1TG7 A;  1Y9M A;  3BTZ A;  3VHO A;  4A41 A;  4XFB A;  1MS3 A;  4P5H A;  1OF4 A;  4AQ2 A;  1PO1 3;  1QJY 1;  3Q9O A;  4Q0S A;  4HKW A;  1RUF 3;  3QLQ A;  1LOA A;  5A3T A;  3I3B A;  5D1I A;  4PLO A;  4JTN A;  5FBJ A;  3S6P A;  2XKP A;  2BOJ A;  4GIQ A;  4BQ5 A;  2D6K A;  4A4A A;  4JV4 A;  4P9Y A;  3VBR A;  5J3U A;  1MZE A;  5EYY A;  3TEX A;  2XLF A;  2K46 A;  1US2 A;  4HL0 A;  2VVF A;  2A5Z A;  4B4P A;  1DQ6 A;  4CEW B;  2XLG A;  1IS4 A;  1JZ2 A;  3I49 A;  3KT7 A;  3USU A;  1WA6 X;  3ZPY A;  2PFW A;  5FYV A;  4NO4 A;  2OUH A;  1X36 A;  3VBH A;  1UZW A;  4D7S A;  1SCS A;  1AYN 1;  2D6P A;  2EID A;  1Y9Q A;  3RRD A;  5CAD A;  5FDB A;  1CAW B;  3WV6 A;  3ZYP A;  3VZN A;  3LFI A;  1WGP A;  2VZV A;  4D7T A;  4YZ1 A;  4TLF A;  1UX7 A;  4XF9 A;  3AP7 A;  3NJX A;  4IER A;  5FPZ A;  2GNB A;  2P3J A;  3OBZ A;  4CVU A;  1ST8 A;  1W2T A;  1SPP B;  5DG1 A;  5GLU A;  2BFU L;  4PLN A;  1S2B A;  2OA2 A;  4EYU A;  1HV0 A;  5KXB A;  1JOB A;  1RHI 1;  1MEC 2;  3DV8 A;  4PI0 A;  2XL7 A;  1JHJ A;  1G8W A;  1XQN A;  3G7D A;  4GAZ A;  3VBF C;  3RPQ A;  2YMZ A;  1QJU 1;  3E6C C;  2DVG A;  2IXC A;  2JG9 C;  1QJX 2;  2P3I A;  3N7M A;  2LW8 A;  3WP3 A;  4AYU A;  5FMB A;  2DFC A;  2HWF 3;  3DXU A;  1SEF A;  2PHR A;  2W08 A;  3MDP A;  1LEM A;  4LO7 A;  2B46 X;  5GZC A;  4YFZ A;  2AEZ A;  4MH0 E;  4AQ6 A;  5JOZ A;  1XU1 A;  1OLQ A;  4BPZ A;  1PX4 A;  1XNC A;  3B9C A;  1GZT A;  5FZ1 A;  3WNM A;  5H9P A;  1R08 3;  4Y24 A;  3VD9 A;  4C0H A;  1YJL A;  2ZGM A;  3OTF A;  4YM3 A;  3PHM A;  2WUH A;  3ZFE A;  3WDV A;  1EUU A;  4MXW B;  4CXY A;  1ONA A;  1NUK A;  3J8F 3;  4CDX A;  2VMI A;  1YFY A;  4DEV A;  1ACC A;  2W46 A;  4S2D A;  3HJR A;  4Y4R A;  5J7M A;  2IUW A;  2VTX J;  4PQQ A;  1BEV 1;  2G9G A;  3FBY A;  4QPG B;  2Q1Z B;  4YVS C;  4PLM A;  2ZOE B;  4E4Z A;  1AJO A;  3I2K A;  5LBE A;  1KGY A;  1HJG A;  4NUB A;  4W6Y A;  3WVJ A;  2RE9 A;  2H0V A;  2O0O A;  3M3O A;  3Q8A A;  3ZX7 A;  2RR1 3;  4FBF A;  2TUN A;  3IM0 A;  2UWB A;  3FHQ A;  2WO7 A;  3HNB M;  3WX5 A;  5FWE A;  2OII A;  4YG3 A;  3SCG A;  4GWN A;  1DQ4 A;  3ES4 A;  1A6C A;  5A7Q A;  4FT8 A;  2HKX A;  4YGD A;  3ZYJ B;  2Q8D A;  3O1U A;  5BNQ A;  3EO6 A;  4OI2 A;  4NJ4 A;  4X8P A;  1Y4W A;  4OFG A;  1BXH A;  1AR8 3;  1LU2 A;  4HAN A;  4KU8 A;  5LCW L;  4SBV A;  1OQ1 A;  2QQW A;  2WJS A;  4AI0 A;  1RUN A;  3CZU A;  1LUL A;  1YRZ A;  3MPP G;  1F8V A;  5F6K A;  2R49 A;  1R09 1;  2UY9 A;  3DEM A;  5CU1 A;  4D6R A;  4S2G A;  2V4V A;  1F9K A;  1RUH 2;  2VMG A;  2TBV A;  2PAE A;  3LA3 A;  1W0P A;  4MOA A;  1IPS A;  2A1X A;  2CWS A;  1NCQ C;  5CFC B;  4CDQ C;  2BJS A;  3KV9 A;  1LOC A;  1GIC A;  2NMN A;  4YG0 A;  1IQA A;  2JE9 A;  4Q4X 2;  4IEX A;  4NHL A;  4XET A;  1VBA 3;  2RDR A;  4IDZ A;  3PIG A;  1RB8 G;  2RS3 3;  3ON7 A;  1CAU B;  1RL3 A;  1S0C A;  5D8A B;  5F5Q A;  3U1X A;  1SHW B;  4K1Z A;  4EV0 A;  4YGB A;  2JEC A;  4JVA A;  4LBQ B;  1FNZ A;  4BA6 A;  4IE7 A;  4GXL A;  2GNT A;  4DXS A;  4FFH A;  3TN9 1;  3AVR A;  3VDD A;  5J48 A;  4GD4 A;  4QX2 A;  1C1L A;  1LGN A;  4ISR A;  1VBD 2;  3EBR A;  2ZKL A;  1WMD A;  4LBO A;  1HRI 1;  1GZW B;  1PNF A;  2WNV A;  3ZSE A;  5E6H A;  3OD4 A;  3GZU C;  2CYF A;  3BYW A;  1W06 A;  2ZGS A;  3WY6 A;  1U0A A;  2OQ6 A;  3BOW A;  3UKN A;  4ASM B;  4B4R A;  1XNA A;  3AMN A;  2ZZQ A;  5LAS A;  1XC6 A;  3HQR A;  3DPR C;  4B7E A;  4LEJ A;  4ES9 A;  1GNH A;  1W2U A;  1KFU L;  4YW1 A;  2PHD A;  2WFF 3;  3C7G A;  3OEA A;  4QX8 A;  1ZA7 A;  1YQ6 A;  4NRQ A;  3THP A;  3HMY A;  3KD4 A;  3KV6 A;  4CUG A;  5T3N A;  1XU2 A;  3GDB A;  4W6X A;  5FMD A;  5IHR A;  4WM7 C;  1HV1 A;  2YDE A;  4KNC A;  4UBG A;  4CCN A;  3M8L A;  4ZS2 A;  4ATE A;  1ULP A;  2A3Y A;  1TZO A;  1UY1 A;  2E26 A;  1DP0 A;  1K45 A;  3WCR A;  2DTW A;  1U5Y A;  4AGR A;  4EN7 B;  1AX2 A;  1RUC 2;  4CU9 A;  5C8W A;  2XOM A;  4FP2 A;  4R52 A;  1RJ7 A;  1XYO A;  2IXK A;  2HWD 2;  2QQK A;  4RGG A;  3SCH A;  3W59 A;  5F1R A;  1PO1 2;  4AI9 A;  4H14 A;  5JMC A;  1W6M B;  1CAW A;  1VBE 2;  4MGT A;  1WME A;  3N3H A;  5FK7 A;  2VVE A;  3ZKY A;  3FLR A;  3T0D A;  5BNO A;  1D2S A;  4QDQ A;  1TME 1;  2HEY F;  2VXR A;  5HPO A;  1PGL 1;  3TNP B;  1E5R A;  3B01 A;  3MIC A;  5LA9 A;  1RUG 1;  1S2E A;  1BJQ A;  4W65 A;  3CJX A;  4O9E A;  1RUO A;  3NNG A;  1D0H A;  3PJY A;  3OCP A;  3I97 A;  5FLH A;  5CVR A;  2FCV A;  3UGH A;  1RXG A;  1JZ8 A;  2VOV A;  1T6B X;  3PVB B;  5A3M A;  3NL1 A;  2V72 A;  3AYE A;  3OPT A;  3LWC A;  4I2O A;  5APA A;  4BQX A;  5F3C A;  2VZ1 A;  4M01 A;  1M06 G;  1HLC A;  2YGL A;  5I8Y A;  2ZHL A;  2RMU 1;  3IDB B;  2PXJ A;  4WBB A;  5E1R A;  4DIQ A;  4M3C B;  3HT2 A;  5LBC A;  2VM9 A;  5FFO C;  3OUI A;  1DGW X;  5J1X A;  2BGC A;  1HKD A;  3I2D A;  3AP5 A;  2RS5 3;  2BP6 A;  4AEJ A;  5BNP C;  1MS9 A;  1UMI A;  2WWU A;  5C5U A;  5JXG A;  1W6P A;  3ZFG B;  4CXX A;  4MZU A;  3ZFF B;  1JN2 P;  4EN6 B;  3RI9 A;  4FAG A;  5AC9 2;  4S2H A;  4FQZ A;  5SV8 A;  1VMJ A;  2Z4F A;  2WNU C;  5C7G A;  4MHU A;  2W0X A;  5JMO A;  2GN7 A;  2HWC 3;  2XBO 3;  2HJI A;  4W6W A;  4I01 A;  2WFP A;  4GWM A;  1HXS 1;  2CGO A;  5DAX A;  1WD3 A;  3ME2 A;  4V1P A;  1OHF A;  4E4H A;  1JS9 A;  1YI9 A;  1RVF 1;  4QHO A;  2EVX A;  1UYY A;  4PF5 A;  1MPX A;  1HN1 A;  1RUD 1;  4LXL A;  4LTA A;  2VTF A;  1LGB A;  4IEQ A;  5CKQ A;  1K12 A;  5FZI A;  2OQ7 A;  3VD3 A;  3VV1 A;  4FOQ A;  1R08 2;  3AFK A;  2BUK A;  3VBS C;  4M4P A;  2VBB A;  2KXL A;  2VNR A;  3WP4 A;  4BXF A;  5C33 A;  2IZW A;  5FZL A;  5JOX A;  2Z79 A;  3JXS A;  2Q8E A;  4WVV A;  1T6G C;  4N43 C;  2WT2 A;  1GQP A;  4NAO A;  3GZT B;  5BPX A;  4Q0P A;  4FPJ A;  5LA0 A;  5F5C A;  3I3M A;  3VZM A;  1W9Y A;  2W94 A;  3OGG A;  2G9Z A;  4FQ4 A;  1WWY A;  3IT8 A;  3KT4 A;  4WV8 A;  2H0B A;  4YVW A;  2E7T A;  2RR1 2;  1OOP C;  4PDW A;  3VGI A;  4JAA A;  5F5I A;  2WLQ A;  1E57 A;  3AZX A;  3N7J A;  2JKB A;  2ZX1 A;  3P1I A;  4SLI A;  4XDO A;  5HCB A;  3LOI A;  5FKC A;  1KXG A;  4QHZ A;  1LR5 A;  4NAM A;  4WM8 C;  2MEV 3;  3AZW A;  5FPB A;  3TNQ A;  1LOB A;  4PQ9 A;  2YRO A;  1JH5 A;  1VRH 3;  1CAU A;  4RSU A;  2WYF A;  1AR8 2;  1Z7S 3;  1JYV A;  1TMF 1;  2YYO A;  3WSO A;  2JB4 A;  1KJL A;  1VP6 A;  2RM2 2;  2YBK A;  1WLC A;  5JZG C;  4D6S A;  5C9A C;  4DXT A;  2HEV F;  2BNM A;  4JGY B;  4XFF A;  2ZEW A;  4RS5 A;  3UES A;  2VG9 A;  2QQJ A;  1GZW A;  2AUY A;  3KCX A;  4Q8L A;  5FZ6 A;  4COU A;  3ETQ A;  5DQ0 A;  5FZ7 A;  4IV3 A;  4DPN A;  4I3P A;  2K2S A;  3GCX A;  2FMD A;  2C0Z A;  1E5I A;  4Q1P A;  5FZG A;  3D0S A;  5EWS A;  4E8C A;  2Y26 A;  3JBG 3;  2YPD A;  5C4W A;  3THC A;  1W9F A;  2FZ1 A;  1BBT 1;  3QH7 A;  4Q0V A;  5F2S A;  5FUN A;  4LKS A;  2XML A;  3K4A A;  1AXK A;  1JYI A;  3HBZ A;  4P9J A;  1DYP A;  2OXB A;  5F39 A;  4QQL A;  3UK9 A;  4AI8 A;  5JPN B;  4P9W A;  5A7O A;  2WN2 A;  4ZKT B;  2JDA A;  5AFE A;  5I91 A;  4O61 A;  3IPV B;  2ZPX A;  4AZZ A;  3AJY A;  3CLP A;  1WW5 A;  4IV1 A;  3WEZ A;  2BVV A;  4GB3 1;  2CGP A;  2Q1M A;  2CWM A;  4QKN A;  4QU1 A;  2ZGP A;  2XJT A;  3S0M A;  5JCT A;  2ZMK A;  5C8C B;  5HCH A;  3LF7 A;  5FYH A;  4FPO B;  3V65 A;  3U37 A;  3O0X A;  2VZ3 A;  2PEL A;  3DL3 A;  1KDM A;  2JIC A;  2VCC A;  5ANN A;  5BNN B;  3CU7 A;  5A7W B;  2ZJC A;  1SLC A;  3NAP A;  4FFI A;  1OD5 A;  2XXZ A;  2RG4 A;  3B69 A;  5CIR A;  2E51 A;  4GH4 A;  2VTX A;  4XDP A;  5JIA A;  3WR0 A;  2XON A;  3V0A B;  3MYX A;  4K40 A;  5FQ0 A;  5KBF A;  2D7F A;  4AI1 A;  4FTS A;  4A3Z A;  1H1A A;  1STM A;  1SLL A;  5IYY A;  1DYO A;  3C2U A;  1YFW A;  3N9Q A;  2YUE A;  5AVP A;  3SHR A;  3V64 A;  3ZXA C;  1FT9 A;  1RIN A;  3DXT A;  1ZYB A;  4RHV 2;  1GFF 2;  3RYK A;  3EMR A;  2W1W A;  4UWD A;  5F37 A;  4A7Z A;  2YY1 A;  1ZRR A;  3PTR B;  2PHT A;  2NPI A;  3III A;  1W3V A;  1HRV 2;  1PK6 A;  1V6M A;  1EPZ A;  1SFN A;  5FY1 A;  4CU6 A;  4CCM A;  1SBE A;  4QM8 A;  5T5J A;  2PHL A;  3O1T A;  1AF9 A;  1OA3 A;  2UYA A;  3L2Y A;  2UUR A;  1Q8O A;  1V9U 1;  4BJ0 A;  5A3U A;  3A21 A;  1KDK A;  3LEG A;  4Y3O A;  3QBQ A;  1ODM A;  2XR4 A;  1F35 A;  4Y1V A;  3ZFG A;  4ZZ5 A;  3ZFF A;  4E9K A;  1HB3 A;  5C9A B;  5ABJ B;  1OUS A;  3LQC A;  3W5N A;  2DVB A;  5FRE A;  2X5I B;  4HVO A;  5B4N A;  1UAI A;  4D94 A;  5J37 A;  3E5X A;  2HWB 1;  2YHJ A;  4Q4W 1;  3VBR C;  1GWM A;  2QZ3 A;  3TAY A;  3N4M A;  5JI9 A;  1D4M 1;  2BRT A;  4XVH A;  2N7G A;  1QMJ A;  3JU9 A;  1W04 A;  1EPW A;  1MVQ A;  1JMU B;  5JR7 B;  2I2S A;  1CON A;  2ORZ A;  3FLP A;  3O12 A;  5FYT A;  3B9I A;  3IN9 A;  3GAL A;  2DUP A;  1IOA A;  1ZRE A;  3AB0 A;  4L11 A;  3ATG A;  5IJR A;  4DS0 A;  1WCD J;  2R32 A;  3APB A;  4XJU A;  3BIE A;  1YCI A;  4DOU A;  4CTE A;  3T4V A;  4MHR A;  3NST A;  4ASK A;  1HN0 A;  4NMI A;  1DFQ A;  1QY4 A;  2VGD A;  4JHZ A;  5T50 A;  5A1A A;  5FWJ A;  4FP3 A;  3IDC B;  4MV2 A;  1QXR A;  3M2M A;  5DDJ 3;  2B9V A;  4OZX A;  4CSW A;  2HWC 2;  1MVE A;  1FI2 A;  2VUJ A;  3ZXE A;  4LHK A;  4FTB A;  3TEW A;  4COY A;  2Y64 A;  2ETE A;  2ZX3 A;  5DUX A;  4E27 A;  2D44 A;  2IXH A;  5A70 A;  4OMD A;  5A6Y A;  5T5L A;  1I3H A;  2BBV A;  3OBA A;  3M3Q A;  2EAK A;  5FKB A;  3T2O A;  1PM7 A;  1RUE 1;  2VCM A;  3UET A;  4MSV A;  1ASJ 3;  5H9R A;  3BCW A;  2HWE 3;  5G05 L;  1ZZC A;  3RGB A;  2FQP A;  3MLJ A;  4XFA A;  5FP9 A;  5IK5 A;  2ET7 A;  1UKR A;  1OVP A;  3I4I A;  3IBM A;  3WUC A;  3H3L A;  1DG6 A;  1ZBE 1;  3LDK A;  5DAV A;  1ND3 C;  2ORX A;  1PIV 3;  4YG6 A;  1H8V A;  3NNJ A;  1EYB A;  3MV0 1;  4JGY A;  5L9V A;  2CNA A;  3BPS A;  5GAL A;  4QU2 A;  2GP5 A;  4AHW A;  3VLB B;  5T52 A;  4R9D A;  5JAX A;  4JGZ A;  4OHY A;  2ZX2 A;  1OSG A;  3B7M A;  1MS8 A;  3N9L A;  4NWW A;  1YI7 A;  1UO9 A;  3LZZ A;  4AL9 A;  5A7P A;  4MVT A;  1H2L A;  2DFB A;  4Y1Y A;  2KM2 A;  1V00 A;  1QXJ A;  2ZMN A;  3IDE A;  1LEN A;  1O59 A;  4BQ2 A;  1MQT B;  4AVB A;  2MEV 2;  4CEY C;  1IPJ A;  2DVA A;  4XFG A;  2BBA A;  4PBO A;  1V6O A;  1BKZ A;  1Z7S 2;  4QXB A;  1XPW A;  2G19 A;  2WAB A;  3KMH A;  3LPG A;  4XCA A;  4P9X A;  4C8D A;  4CUB A;  2XLA A;  2AGS A;  2BGO A;  3NNM A;  3PNA A;  5FCC A;  2VOW A;  5IK4 A;  4KWJ A;  2GU9 A;  1XYN A;  1DGR N;  1R1A 1;  3OEB A;  1PNG A;  2O1Q A;  5CNA A;  4F3J A;  5FZ4 A;  3WG2 A;  2OS2 A;  1KRI A;  4FPL A;  4XHX A;  1CAX B;  5FP7 A;  4A6O A;  2P1B A;  4AFD A;  4CCL A;  1UN1 A;  3LDR A;  3POI A;  1JZ4 A;  4LOR A;  3U4X A;  4O9G A;  1LES A;  3FL7 A;  3LCP A;  4L2N A;  2WSU A;  1GU3 A;  1IGO A;  5B2G B;  3LPF A;  1JHN A;  3WF4 A;  3C7H A;  5L36 A;  2W91 A;  2NLR A;  4RQP B;  1SG3 A;  3JBG 2;  2Y6J A;  2R04 1;  4M3C E;  3DKQ A;  2IWG B;  3M4F A;  5SV5 A;  5C8C A;  1DIW A;  3H8R A;  1KS5 A;  2FDF A;  3ETP A;  2GZW A;  3Q8C A;  2PQS A;  3JZV A;  3CO2 A;  2IXJ A;  1XB9 A;  4UW5 A;  1AUY A;  1JOD A;  1OUR A;  3B5L B;  1B35 B;  5IFP A;  1FMD 1;  3C8X A;  3VL8 A;  1OUX A;  4RR3 C;  5F3I A;  1FPN 1;  2XQX A;  2R06 1;  3PUI A;  1J1T A;  2DV9 A;  2VNV A;  4XXP A;  3N9O A;  1IKP A;  3ENR A;  2JG8 C;  4UXA A;  4AVA A;  4RFT 0;  3H8O A;  1A34 A;  4IET A;  3GNE A;  1VPH A;  1MZF A;  4D6Q A;  2ZGO A;  1OT5 A;  1MZ5 A;  2P3Y A;  4QGM A;  1O5L A;  1S0D A;  1YFX A;  5HBA A;  4LK6 A;  2D98 A;  2WNV C;  3OJB A;  3ILN A;  3VD7 A;  2DU0 A;  4FPY A;  1CX1 A;  3SXW A;  3FMG A;  5CEH A;  4QQO A;  3H1M A;  1RHI 2;  4BK5 A;  5CA6 A;  5KHI A;  1UZY A;  3N7K A;  4EJR A;  1RMU 1;  1NA1 A;  1IG0 A;  1B09 A;  4DEQ A;  5FJK A;  4Y1U A;  1OF3 A;  4YAR A;  2AZ5 A;  2BWC A;  5FJH A;  3TBD A;  1J58 A;  4IEO A;  5ABJ A;  1O3R A;  1IG3 A;  4IQP A;  3IAP A;  2W1S A;  1WA4 A;  2PLV 1;  2EIE A;  4DY3 A;  1UYZ A;  4AVV A;  4NIH A;  2IFR A;  2FHR A;  4Z1V A;  1WBL A;  1F15 A;  2Y6H A;  1PMH X;  3FLT A;  3I3E A;  2W92 A;  2JIJ A;  4XFH A;  2YBS A;  2XHN A;  2WS9 1;  3O14 A;  5A3O A;  1POV 1;  4EWA A;  3FBM A;  5FR3 A;  2Q30 A;  2XJU A;  3OYW A;  4LA3 A;  5CAZ A;  2QDR A;  4EN0 A;  4GZ9 A;  4XF0 A;  4K8F A;  4Z07 A;  2B9U A;  1UU6 A;  1MS5 A;  4QGL A;  2XBO 1;  1F5F A;  2C9A A;  4GUL A;  5FYS A;  4Y4Y A;  3ZXK A;  5L7O A;  2CU5 A;  2WZR 3;  3WNK A;  5LA1 A;  2WZP P;  2GNM A;  3DUI A;  3RDI A;  2R0F A;  2B5H A;  3F2Z A;  4JDO A;  1OFS A;  3I2I A;  1RJ8 A;  2GC0 A;  4XC9 A;  3RQ0 A;  1POQ A;  4GKY A;  4MGQ A;  2UU8 A;  1QNY A;  3LSE A;  5CFD A;  3ZSK A;  1SLI A;  3GJA A;  3OGV A;  2BV4 A;  2EXJ A;  1OFN A;  4PIX A;  4AEM A;  1WCQ A;  3IDA A;  2RJ2 A;  3HR9 A;  1JZ7 A;  3OOX A;  1UXX X;  4OUM A;  5KXC A;  3V0B B;  1ZRD A;  2PAM A;  2B45 X;  2F6B A;  5HCF A;  3O1P A;  3CJI A;  2X8K A;  2R0H A;  1K5M B;  2ZCW A;  4HFS A;  3POF A;  1AHS A;  1R09 2;  5FYY A;  2J7M A;  2PN5 A;  2WC2 A;  1GP6 A;  1RUC 3;  2PHF A;  4FOY A;  4XQD A;  4YM2 A;  3I2G A;  4RR3 B;  4ERO A;  5DDJ 2;  2HWD 3;  1HW5 A;  3A4U A;  3AYD A;  1JU4 A;  3M70 A;  2JG8 B;  1PMI A;  4HKO A;  2E53 A;  4DQA A;  1VBE 3;  4MYE A;  2R6Q A;  1H8T A;  4EZ4 A;  5H9S A;  5T55 A;  4G9S B;  4NPM A;  4EQV A;  4IE5 A;  1ASJ 2;  3FUQ A;  1C8M 1;  1H30 A;  2XKO A;  1H6X A;  1VRB A;  1SAC A;  2HWE 2;  3SLI A;  5JWP A;  1YQC A;  3RMX A;  1CJP A;  2XVG A;  3ACG A;  3AKT A;  1DZQ A;  2WZE A;  3TN9 2;  2QDN A;  2VZO A;  1PZ8 A;  3G6J B;  3AXE A;  1UZ0 A;  1SMV A;  2PMW B;  2EF6 A;  3VBU A;  1FX5 A;  1RUJ 2;  2QQO A;  4N7U A;  5K0U B;  2I07 B;  1PIV 2;  4BM8 A;  1JYW A;  4A44 A;  1EY2 A;  1ND2 A;  4H2A A;  3WXP A;  1PO2 3;  2R07 3;  1AX1 A;  4KG0 A;  4UW6 A;  1W8N A;  3ZYH A;  1CGP A;  3POG A;  4Y5S A;  3T1M A;  5DUV A;  3I2F A;  1AX0 A;  3D8C A;  5LBF A;  3FFZ A;  3PU8 A;  4ES8 A;  1WW6 A;  2XVK A;  4MG2 A;  5J96 B;  4JZR A;  1PHM A;  3PUQ A;  1W9T A;  5ANQ A;  4HT1 T;  2D3P A;  3W21 A;  3IMM A;  1UOB A;  3BGA A;  5LWB A;  3AL6 A;  1VAM A;  1XJA A;  2YBP A;  3ELN A;  5JSO A;  1AR6 1;  1J3R A;  1NXM A;  5IK7 A;  1NE6 A;  4AVC A;  4LOS A;  3OPZ A;  5F8P A;  4AFM A;  2EXH A;  1QOS A;  4YVW C;  4XUQ A;  2C26 A;  4PDW C;  5AC9 3;  5CKN A;  1HQW A;  1WCU A;  4YWA A;  4BQ3 A;  3C7O A;  4N53 B;  3NQH A;  1S0G A;  1V6L A;  1G6N A;  1CAV B;  3EHK A;  4LLF A;  3MW3 A;  1UD1 A;  4UW4 A;  1OBN A;  3RMY A;  3BPZ A;  2ZML A;  1MS1 A;  3A0K A;  1AR9 3;  3PUH A;  3JD7 1;  4MGY E;  3K3O A;  4YRD A;  2LTN A;  5GZE A;  2E63 A;  1NQJ A;  2VBP A;  4LIT A;  4DRR A;  4PHZ A;  3I8T A;  4AED C;  4LQR A;  4GQ7 A;  4RS5 C;  3KHB A;  5IAV A;  1ZA4 A;  2WNE A;  4UFI A;  4R9A A;  4AAX A;  2A3X A;  5IUQ A;  2OKX A;  3EQE A;  4OHZ A;  1RUG 2;  2J1A A;  2DCJ A;  4P9L A;  4Y20 B;  1UF2 C;  2VMC A;  4IV3 C;  3Q8F A;  5A80 A;  4FI9 A;  3A0N A;  3VDC A;  4CP1 A;  4QKF A;  1O3Q A;  4A7K A;  1COV 1;  1JI6 A;  5GJ6 A;  4CUA A;  4Q26 A;  4NID A;  3L9J T;  3R4U A;  1DLC A;  1VBC 1;  2FDI A;  5C4W C;  2D97 A;  2X10 A;  3PJQ A;  3PIJ A;  1UNB A;  4M4R A;  3MHZ A;  1GLH A;  2CL2 A;  3H50 A;  4QPY A;  4CDW A;  5ACA 1;  3ST7 A;  1QU0 A;  1VBB 1;  4C90 A;  5FZ3 A;  3T30 A;  3ZN6 A;  3D5O A;  1PVC 1;  2RMU 2;  2WT0 A;  1O3S A;  4IGQ A;  1XND A;  5GZF A;  3ZXD A;  4LO8 A;  3QH6 A;  2OUJ A;  2QJV A;  3ACF A;  1EV1 1;  1NYW A;  3WDU A;  2RM2 3;  2YU1 A;  2DTY A;  3K3N A;  2FZ2 A;  4IV1 C;  3HOB A;  4XOG A;  3VKF C;  3IB3 A;  2B42 B;  1J3P A;  4Q4Y 3;  4KH9 A;  2OYZ A;  1D0G A;  3A22 A;  3IAQ A;  4CE8 A;  1UQX A;  4YFW A;  1BQP A;  5FMO S;  3MO4 A;  2LRO A;  3S5A A;  4DXZ A;  5FZO B;  5KXE A;  2V5Y A;  3ROU A;  3ZXG A;  3CMG A;  1LB2 A;  2CV6 A;  5LK7 B;  4XMA A;  3THT A;  3OF1 A;  4B1L A;  2JE7 A;  3B00 A;  3HBK A;  4P9I A;  2DDU A;  4F8A A;  4D69 A;  3ZLI A;  2QQV A;  3MID A;  3WD5 A;  1TNR A;  1ALY A;  1C57 A;  1GSL A;  2Z42 A;  2ZGT A;  1XOY A;  3NMB A;  5E8A A;  1NT0 A;  5HXV A;  4BDV B;  2FDH A;  3WT3 A;  3VBF B;  1J84 A;  2J1E A;  1YQ2 A;  1LGC A;  4ASL A;  3M7A A;  1BZW A;  4GMP 0;  3PVN A;  1CZT A;  4MGS A;  3MIB A;  2Y0O A;  4NHY A;  2JG9 B;  2V09 A;  1ULG A;  3CBN A;  4QPI A;  1W6N A;  3VKL A;  5I0T A;  3RZZ A;  5DN2 A;  3SH3 A;  4DMI A;  2WZR 2;  4EWD A;  1PK6 C;  4CA9 A;  3I2O A;  4XEZ A;  2ZX4 A;  4B4Q A;  2VZT A;  1RC6 A;  5E88 A;  3WW4 A;  2GSY A;  4XFC A;  4GA9 A;  1AR7 2;  5F32 A;  4ZS3 A;  3N36 A;  1F4A A;  4Y5Z 0;  1YIP A;  3AMP A;  3T2T A;  2XJS A;  2PQQ A;  2YV8 A;  3NRU A;  1W6O B;  2HLE A;  4AED B;  4FPE A;  2VZP A;  3AC0 A;  4LIU A;  1H9P A;  1E5S A;  4P00 B;  4V2V A;  3NNF A;  3T3Y A;  2PTM A;  2RJK A;  3N9P A;  2Q8C A;  1GZ9 A;  1UKG A;  1ZM1 A;  1DF0 A;  2WL1 A;  2JJ6 A;  3K46 A;  4CEW A;  1W2A X;  1F5J A;  1GNY A;  1Q8Q A;  5FPX A;  2ZXQ A;  2IFW A;  3LKJ A;  3AM2 A;  1JUI A;  1W6Q B;  4CP0 A;  4YVS B;  1WCS A;  2WO1 A;  4RYD A;  2GMP A;  2WN3 A;  5L19 A;  3OY8 B;  2DBN A;  2GC1 A;  2ZAH A;  1N1S A;  2Q0A A;  2VZS A;  4RHV 3;  1VIW B;  4BOW A;  1UOF A;  1QKQ A;  4HK8 A;  2JDM A;  5I8T A;  5GKA C;  5LEK A;  3BKZ A;  3B02 A;  1HRV 3;  1QQP 1;  1RUI 1;  1MEC 1;  3H1W A;  3OSD A;  2W87 A;  3GBF A;  1ZBA 3;  2CAU A;  4AI2 A;  3BTX A;  2VQA A;  4H3W A;  1SPP A;  1WLW A;  5A33 B;  2VW0 A;  2VOT A;  2P3K A;  1QJX 1;  3K75 B;  4FPF A;  3HN3 A;  3UJO A;  3S7E A;  1OXC A;  4MAD A;  2GAU A;  5JPM B;  4Q4V 3;  3RYR A;  1S1A A;  2Z69 A;  1GMM A;  2JX9 A;  4GWJ A;  4KWU A;  4AR2 A;  3MZH A;  5CG8 A;  4P08 A;  3VZO A;  3EB7 A;  3A23 A;  1PO2 2;  2R07 2;  4ARX A;  3RZJ A;  3ZM8 A;  1VAK A;  2JDH A;  1YHF A;  4AFB A;  1JBC A;  1V6N A;  2XL9 A;  5IT6 A;  1NCQ B;  4CDQ B;  1H0B A;  2C9K A;  4OQ9 A;  3HEI A;  5CYY A;  5FY0 A;  4OQ8 A;  3CL1 A;  3H7J A;  2KR2 A;  5LY2 A;  4XF3 A;  2VMF A;  2D6O X;  2UWA A;  4GMP 1;  3VZK A;  1UXZ A;  4OHX A;  3O7O A;  3ZO0 B;  3WP5 A;  3T4H B;  4QB2 A;  1LCL A;  3M3E A;  1FOD 1;  1U12 A;  1VE0 A;  1C8N A;  4UF0 B;  3VN4 A;  1LOF A;  3J7M A;  4ATF A;  4MXW A;  1J83 A;  2VJX A;  3PVE A;  4QMA A;  1OPM A;  4ARY A;  3DCQ A;  3AKS A;  3UKV A;  3ZN5 A;  4W4Z A;  1OKO A;  3LIG A;  4CDU C;  2WNO A;  1OC1 A;  4QPG A;  1BK0 A;  2BOI A;  4HLT A;  4C1W A;  1AL2 2;  3AMM A;  2JEN A;  2VU9 A;  1VLN A;  5LA2 A;  3ORJ A;  1AR9 2;  2KD7 A;  1G9B A;  1LKN A;  3VHR A;  5DZE A;  2Y60 A;  3DPR B;  2JXA A;  2E7A A;  3SQO A;  1UZZ A;  3QOP A;  3CDZ B;  5FPL A;  1EAH 3;  2W1U A;  5T5O A;  1OI6 A;  4QKB A;  1V9U 2;  1DQ1 A;  1K5J A;  1PM4 A;  1RUH 1;  3NVC A;  2NP0 A;  4WM7 B;  4AAP A;  4Y1Z A;  5FO8 B;  5KR7 A;  4UFH A;  1MS4 A;  3GZA A;  2QQI A;  5IVY A;  1WD4 A;  3WF0 A;  4LUM A;  3WP6 A;  5HV4 A;  2LS6 A;  1CWP A;  2HBT A;  1TE1 B;  2J1T A;  1JUH A;  1AYM 1;  1IHM A;  2AAC A;  4PF1 A;  2RS1 1;  4Q4W 2;  4Q4X 1;  4J25 A;  2GAL A;  5A1L A;  2AC1 A;  1UCX A;  2MPF A;  2J22 A;  2YC4 A;  4RGA A;  4YGC A;  1RTV A;  2F4P A;  1UZV A;  2ET1 A;  1D4M 2;  5CFC A;  2A73 B;  4LLO A;  4NRP A;  4E2Q A;  1JZ6 A;  2CDP A;  2YB7 A;  5LY1 A;  4HK9 A;  3O1V A;  4TSV A;  3ZMN A;  3PU3 A;  1DQ0 A;  4XDQ A;  3B93 A;  5FZC A;  4C1X A;  2K0G A;  4FPG A;  5D8A A;  5FZE A;  1VBD 1;  1OMI A;  4AW7 A;  3VBO C;  1VB4 A;  4IEY A;  4LBQ A;  3TYJ A;  2NMO A;  1DYK A;  4UFM A;  4A7Y A;  1BCX A;  2QTW B;  2BFU S;  3AP6 A;  4TWT A;  4LUK A;  4Q4Y 2;  3W9A A;  1UWW A;  2W5F A;  1GWL A;  2VZR A;  1C3H A;  1XE7 A;  3LE0 A;  3TEY A;  1W8H A;  1X8E A;  4QQ2 A;  4QT6 A;  1SDW A;  3AKR A;  5IWF A;  1QWR A;  2QBX A;  3T1L A;  3U14 A;  3WIN E;  3AKQ A;  4MUV A;  2VME A;  4K1Y A;  1DQ5 A;  1O4T A;  3BOP A;  3QAC A;  3I54 A;  2FDJ A;  4RN5 A;  4OVE A;  1D4V B;  2VE1 A;  3AL5 A;  2AEN A;  3WNX A;  4R4X A;  2Q5T A;  1YXW A;  5LZ6 A;  1RUE 2;  1NA1 C;  2XG3 A;  3AK0 A;  5ERL A;  2A6W A;  2BQP A;  4Z2W A;  3PUS A;  5FY9 A;  3U78 A;  3T09 A;  1W9W A;  1W6O A;  3MPB A;  3H7Y A;  2ZGR A;  5BNP B;  1HX6 A;  3RYP A;  4X6Q B;  4ZY9 A;  2OPK A;  2W68 A;  1QJF A;  1RUC 1;  2JE8 A;  3OBR A;  2G9F A;  1A8M A;  1NZI A;  1GOF A;  2WKK A;  2WNU B;  1NG0 A;  5FYM A;  4CDU B;  1PO1 1;  1XBF A;  2CDO A;  2PAK A;  1AYN 3;  1RUF 1;  1W6Q A;  3FN9 A;  5FZH A;  1NQD A;  3WNP A;  4Y22 B;  4OUL A;  1L7L A;  4BME A;  1LNS A;  1MR5 A;  5JIU A;  2WQ4 A;  3ZMO A;  4GKX A;  1LHV A;  1NCR C;  1W6M A;  2WIN B;  4LBM A;  2HYK A;  5F2W A;  1LHW A;  3KSC A;  1EP0 A;  4NIA A;  4D7Y A;  1JZ3 A;  2VO5 A;  3ACI A;  1U5I A;  1RHI 3;  3LFM A;  5L7O C;  3VBS B;  5FP3 A;  4BLJ A;  4H7L A;  1S4C A;  4XFI A;  1QJU 3;  4LA2 A;  1IS5 A;  1SLT A;  4N43 B;  4PIY A;  2BTV C;  3H8U A;  2G4I A;  2ES3 A;  1R1A 2;  3WG1 A;  4FFF A;  5CFD C;  1LTE A;  5F3E A;  3WOG A;  2W39 A;  4JKK A;  4LOT A;  1WMX A;  3LA7 A;  1BMV 1;  3UV9 A;  2DCZ A;  5FZB A;  2VUC A;  3POB A;  1OOP B;  3AZZ A;  3H9A A;  3KGL A;  2WDB A;  5KC5 A;  1ZZ8 A;  4CDQ A;  1ULF A;  2GP3 A;  2J1S A;  3S57 A;  2A6Z A;  1V0A A;  4WM8 B;  3R6S A;  1J59 A;  4M3C A;  1NAE A;  4QX1 A;  2R04 2;  4ZHN A;  1ZBA 2;  2XWJ B;  1XXN A;  4J1X A;  4JQT A;  4XUP A;  5AC9 1;  2ILM A;  3K4Z A;  3K77 A;  3KVA A;  4IXL A;  4MXV A;  3VBO B;  2JDU A;  2W95 A;  1NX9 A;  3QCW A;  4KQ7 A;  2VQ0 A;  3E97 A;  4NRO A;  5JZG B;  1W99 A;  2ZAC A;  3BAL A;  1BEV 3;  2HWF 1;  3AYA A;  1FMD 2;  4PCR A;  4YW4 A;  3ZSL A;  5DMY A;  1EUT A;  5IVB A;  1H8T C;  1LHO A;  4Q4V 2;  3WHT A;  1XNB A;  1FPN 2;  2R06 2;  4B8E A;  3RZL A;  1LHN A;  4I0A A;  1GOH A;  1O5U A;  2OT7 A;  2ZGU A;  3FFQ A;  3ITQ A;  5FV3 A;  3RSJ A;  4F7Z A;  4QX5 A;  5JUV A;  1G9D A;  1G86 A;  1QJE A;  5A3W A;  2XVL A;  1R08 1;  4I0W B;  4JC1 A;  4YW7 A;  1UPS A;  4NHM A;  4DRV A;  2QUO A;  3DPR A;  2VZQ A;  2Y6F A;  2QKD A;  3VBU C;  3FE5 A;  4ZON A;  4NII A;  4L99 A;  3FX3 A;  3VD4 A;  1PX3 A;  3J8F 1;  1NLS A;  5KXD A;  1WLD A;  1ND2 C;  4DFS A;  1XE8 A;  2YPJ A;  1JOP A;  4J6G A;  3VBH C;  4DNY A;  3T0B A;  4A42 A;  1FV2 A;  1UIJ A;  2JIG A;  3O1O A;  1BYH A;  4QXH A;  4UFL A;  5FY5 A;  5FBZ A;  2G1M A;  2QE3 A;  2UYB A;  1R09 3;  4HPK B;  2ZHN A;  1JTZ X;  1O4Y A;  2ARC A;  4YLZ A;  5A32 B;  4L8Q A;  2RR1 1;  3NKG A;  3LOB A;  5FY8 A;  2FDG A;  3N9N A;  1IKQ A;  2DCY A;  5LK5 A;  1G9F A;  2ZS6 B;  3CF6 E;  4WVM B;  4LO6 B;  2Y38 A;  1W8W A;  4YZ3 A;  5KC6 A;  1C4R A;  2VD7 A;  1QEX A;  3FC0 A;  1RXF A;  3A7Q A;  3HQX A;  2R7E B;  3J4U H;  5FYC A;  1AR8 1;  5JSR A;  4FCA A;  2CTV A;  1N3Q A;  3MIF A;  4K9S A;  1F31 A;  4HG6 B;  3UGG A;  4HBN A;  1Y43 B;  1ZZ6 A;  3TB0 A;  2JDN A;  3ZXJ A;  5FZA A;  1EAH 2;  2ZAB A;  2W47 A;  4FO9 A;  3TN9 3;  1PZ9 A;  1SLB A;  1IS6 A;  3FHI B;  5BXX A;  4MGZ E;  5JOY A;  4NPR A;  3KLS A;  1DLL A;  1SZB A;  1RUJ 3;  2XJV A;  3EJK A;  3GHN A;  4IEP A;  1HRI 3;  2TEP A;  2P4E A;  2D6M A;  4AVS A;  1XNT A;  4AQS A;  4HVR A;  3T08 A;  4ZU5 A;  4X6R B;  3NJY A;  3PMS A;  3VDB A;  1UW8 A;  2BNO A;  1VBA 1;  2XDV A;  1AL0 G;  2RS3 1;  5JXH A;  3R4S A;  3ZFE C;  4LO5 B;  2R1D A;  4H55 A;  1JXN A;  3OD0 A;  4E8D A;  4CDX C;  5LB6 A;  1NY7 2;  3KWV A;  3ZIX A;  1QNW A;  4PIZ A;  3VZL A;  2C24 A;  2WII B;  4DUV A;  4YZ4 A;  3H3Z A;  5C3R A;  5JXI A;  1KQR A;  4NWV A;  4XCB A;  1DGW A;  4DO0 A;  2X29 A;  4XE9 A;  2J1V A;  4CDW C;  2Q4S A;  4Y33 A;  3E5Q A;  3PDQ A;  1S0J A;  3WQ0 A;  1UIK A;  2RV9 A;  4Y5T A;  4HZF A;  1SFY A;  1BVP 1;  4JKL A;  3T2P A;  3WW1 A;  5FTT C;  1PGW 1;  4NPL A;  5LBB A;  3VB9 A;  3JQX A;  3VL9 A;  4DY5 A;  4UT5 A;  1I5P A;  2ZBJ A;  1VR3 A;  2WNU A;  3IPV A;  4HSL A;  4IND A;  2WAO A;  3VBR B;  2DCK A;  2YFU A;  4LHL A;  1QJY 2;  1N47 A;  2WAA A;  5CKM A;  4NRM A;  2R1B A;  5EJZ B;  1U5X A;  1QF3 A;  1FYU A;  3LEM A;  4QX3 A;  2WFF 1;  2ARB A;  3I3D A;  5GZD A;  4QKD A;  5I0D A;  5FOB B;  2VCB A;  4FTE A;  1OH3 A;  4IL7 A;  4M3C F;  3HNY M;  1TME 3;  2VUD A;  4TLG A;  3WQ1 A;  3O0W A;  3ZXL A;  4XJ8 A;  3BTA A;  4Z8B A;  1XNK A;  2CGN A;  5K9Y A;  1RUG 3;  1CN1 A;  3ALQ A;  4QDS A;  3VBH B;  2RJL A;  4MLO A;  4AFC A;  5A3P A;  4Q5O A;  3J7N A;  5DAW A;  5FUP A;  5A3N A;  3I3Q A;  5BNN A;  5A7W A;  4JRA A;  3UT0 A;  4CZS A;  3KM5 A;  3NJZ A;  5A7S A;  3V0A A;  4FPH A;  3HQU A;  3UKT A;  1F4H A;  2RDQ A;  4QXC A;  2XJQ A;  1AYN 2;  2DVF A;  2D43 A;  1SLA A;  4AI3 A;  5KHG A;  4ZU7 A;  3O1R A;  4KGQ A;  1ULD A;  1UY0 A;  1TEI A;  5LW9 A;  1I6X A;  2RMU 3;  3P3P A;  1Q8P A;  4KU7 A;  3D82 A;  3VDD C;  4K3U A;  5A1F A;  5JXJ A;  2ERF A;  4JKM A;  3RZM A;  4KWK A;  3IKW A;  2AYH A;  3NV4 A;  4AGG A;  3PL0 A;  3AVS A;  5EJ1 B;  5F5A A;  3RNS A;  4QPI C;  2AH2 A;  3WDX A;  4LJH A;  1F2N A;  2GDF A;  4QQH A;  4A6S A;  1ULE A;  2DUQ A;  4BE3 A;  1KFX L;  1QJU 2;  5A6Q A;  3HWJ A;  4XJZ A;  2VC9 A;  1ND3 B;  2OVU A;  4P9G A;  4YYO A;  3WZ1 A;  1YLL A;  1X8M A;  4GJZ A;  1S2K A;  4LK7 A;  2XWB B;  4EZH A;  5C9A A;  1ZZ7 A;  4I3G A;  5FZ8 A;  2W1Q A;  2X5I A;  2DUO A;  1R1Z A;  1V6I A;  2ZX0 A;  1HXS 3;  3AP9 A;  2VOX A;  4AWD A;  3N7L A;  4YW3 A;  3LGR A;  1QH7 A;  3HVD A;  1BK1 A;  1RVF 3;  1JZ5 A;  4HET A;  2RS5 1;  1RUD 3;  2QQU A;  1W05 A;  4CDX B;  2XUM A;  4CYD A;  4CPB D;  1S55 A;  3KHC A;  5A3L A;  4CEW C;  2JD4 A;  2A6V A;  3ZKU A;  4AGV A;  4CEY B;  5K4L A;  4XF4 A;  4NOT A;  5IVC A;  1X9P A;  2FMY A;  3QD6 A;  2WA3 A;  3WF2 A;  1UOG A;  1D7P M;  2AR6 A;  2J1R A;  2WWJ A;  3INA A;  4YGE A;  4BIS A;  4LUL A;  1GR3 A;  2HWC 1;  3WG4 A;  1BEV 2;  2ARX A;  3RZK A;  5A32 A;  5F9T A;  4QM9 A;  2YC2 A;  2WA4 A;  1G9A A;  3LIH A;  1VBC 2;  4JHT A;  5BNO C;  2ID4 A;  4Q2F A;  4C91 A;  3NV1 A;  5EFU A;  1VBB 2;  1AR7 3;  2BGP A;  2NM1 A;  5FY4 A;  3ECQ A;  2VAU A;  1SQ4 A;  5JI7 A;  1NXD 1;  4JRL A;  1PVC 2;  1OA4 A;  4W8J A;  4FXG B;  5DAQ A;  3ZIW A;  3KZ4 C;  1OLM E;  1KIT A;  2VPV A;  5HV0 A;  4CXW A;  1N1V A;  1EV1 2;  2TNF A;  4AOC A;  1TMF 3;  3POE A;  4DIN B;  2BW8 A;  3H8X A;  2XQR A;  4CCJ A;  1W8O A;  3AZV A;  5J36 A;  3VDA A;  1QJZ A;  5F3G A;  3FJS A;  4AFA A;  1I9R A;  2IXI A;  4LR4 A;  1ZZ9 A;  3GJB A;  1UY3 A;  1E5H A;  1KJR A;  1YFU A;  2A6X A;  3SEE A;  4BCU A;  3GXU A;  4K7J A;  4M0N A;  5CZK A;  4P5Y A;  3CIH A;  4DUW A;  3LDB A;  4RFR B;  3HPN A;  4KG8 A;  3LD8 A;  2WYS A;  3E6D A;  3RZH A;  2MEV 1;  5L9R A;  2GH2 A;  1LOF C;  2W2I A;  3VDD B;  1VRH 1;  4RGK A;  3ZYB A;  2BVB A;  2BPA 2;  1Z7S 1;  4BLI A;  2Y0I A;  5DG2 A;  1UL9 A;  3LAG A;  1BBT 3;  1HJF A;  2PYT A;  5FZ0 A;  2WNV B;  2WBK A;  1ZRF A;  2GN3 A;  1MQT A;  3MGU A;  4QPG C;  5FZK A;  1NLR A;  1P8J A;  1RIT A;  4GWI A;  4BK4 A;  5J09 A;  2QVS B;  4R4Z A;  4GAL A;  1JYT A;  2JDP A;  3POW A;  2VY0 A;  5DXD A;  1DZR A;  3WW2 A;  4K20 A;  1CIY A;  4RD7 A;  3EYP A;  1HRI 2;  1VAV A;  3WNO A;  4Z92 B;  2WZ8 A;  4DUX A;  4BQ1 A;  3BUC A;  2YG0 A;  4XAA A;  4GB3 3;  1CPM A;  3AZY A;  4XHB A;  5D2A A;  4H7M A;  5FZD A;  1CAX A;  3MFA A;  1YEW A;  3BU7 A;  4XTM A;  2DCT A;  3JBG 1;  1X7N A;  4KGG A;  3SEP A;  2B8M A;  1UY2 A;  1H2K A;  4MX3 A;  1C1F A;  2A75 A;  3J9S A;  4OUE A;  1CES A;  2YGM A;  5JLV A;  5FPV A;  4CP9 B;  3IZO A;  2K9Z A;  4XUR A;  3OPW A;  1HB4 A;  4RQP A;  5L73 A;  1GQG A;  5FK8 A;  2Y6L A;  3ZDS A;  4BZ4 A;  4OI4 A;  5FYB A;  3KGZ A;  2ADD A;  2IVJ A;  5DZF A;  3POY A;  3I59 B;  3T2Q A;  4E2S A;  4F83 A;  2VMH A;  5C3P A;  1UMH A;  1N1Y A;  1B35 A;  2J42 A;  5CFC C;  1URX A;  2AEY A;  4HSJ A;  1QOT A;  1Q5O A;  5E89 A;  1GV9 A;  3HAG A;  1AL2 3;  1H2N A;  1W8F A;  3SKV A;  3LEK A;  5BNO B;  3JB8 A;  3KQ4 B;  1JU3 A;  4YW6 A;  3ZN4 A;  4LBK A;  5D8A C;  2ZEY A;  4LT5 A;  4NVP A;  4COV A;  3DEC A;  3K2O A;  3PUA A;  2A71 A;  2VH9 A;  1G7Y A;  1LOE A;  2ZZJ A;  4HN1 A;  1QQP 2;  1O91 A;  1RUI 2;  4UBH A;  3R0R A;  2LUW A;  4OMC A;  4P02 B;  1RIR A;  4G4F A;  1TME 2;  2L9L A;  4XYX A;  4MET A;  1PGL 2;  1UPI A;  3SNM A;  2O8O A;  1V9U 3;  3VKM A;  4AEK A;  4BWO A;  1HB1 A;  1AXZ A;  2F4L A;  2EXK A;  1MZ6 A;  4YW5 A;  5FYU A;  5DAB A;  3AKP A;  4CCO A;  4OYU A;  4DZG A;  1BHG A;  5FO7 B;  2FCT A;  3ZSM A;  4LHS A;  4R9C A;  1M4W A;  1ND3 A;  4ITC A;  2HWB 3;  3J7H A;  4Q4W 3;  3NO8 A;  4OLL A;  3POJ A;  1UYP A;  1YJK A;  2BZD A;  1D4M 3;  4X8N A;  4ZU4 A;  4B3N A;  5C3O A;  4NIG A;  5I93 A;  4W50 A;  1KS4 A;  4IEU A;  4N7I A;  1XE0 A;  3VHP A;  4BB3 A;  3R4D B;  1W6P B;  3U4S A;  2QQN A;  2W52 A;  2VXJ A;  4E4S A;  1XSQ A;  4FOV A;  4YW2 A;  4AHY A;  5EP9 A;  4L92 A;  1S0E A;  1PMJ X;  3M3I A;  4URT A;  2A70 A;  2XH6 A;  1J3Q A;  2O8Q A;  1T2X A;  3MLK A;  5D21 A;  5FUI A;  4EWE A;  5F7U A;  4B29 A;  1FOD 2;  1H4G A;  4CEY A;  2VNO A;  3MFC A;  2XUE A;  3C3V A;  1I1E A;  3BIW E;  3GCW A;  1S0I A;  1D2Q A;  5FZF A;  1N3P A;  5EXO A;  2SBA A;  1MAC A;  4L97 A;  1W28 A;  1TNF A;  4AHZ A;  4LNV A;  4E4D X;  3O0V A;  2Z2S B;  1W8Z A;  1QIQ A;  5T54 A;  5BYN A;  4XIO A;  2ZGK A;  1UY4 A;  4PI2 A;  4UOJ A;  4Z82 A;  1IPK A;  1HXS 2;  2WSV A;  4KBB A;  2QQM A;  4XAC A;  2VQT A;  3SKJ E;  4QPW A;  1RUE 3;  1OH4 A;  2HEW F;  3ACL A;  1DQ2 A;  3NAP C;  1RVF 2;  3MV1 1;  2ENR A;  2QQL A;  2D3S A;  4GH4 C;  1CQ9 A;  1RUD 2;  4IEV A;  2VCA A;  1K42 A;  1U5Z A;  1YIF A;  5FO9 B;  4QXK A;  3UYJ A;  1AZD A;  1ZBE 3;  1XYP A;  4Q29 A;  1VAL A;  3U07 A;  3V0B A;  3BTY A;  4TN7 A;  4YVW B;  1N1T A;  1ULC A;  2GND A;  5DDJ 1;  4PDW B;  3ZYG A;  2BNN A;  4B1M A;  1WBF A;  2V73 A;  4QGN A;  1K5M A;  1APN A;  1AYM 2;  1YO8 A;  1Z78 A;  3GBW A;  2RS1 2;  1W0O A;  2I74 A;  4FSJ A;  4RR3 A;  1W3X A;  5A7N A;  1SBD A;  3NNL A;  4L0P A;  4NHK A;  1ASJ 1;  1GP4 A;  1LOD A;  1PVX A;  2JD9 A;  2EIB A;  3UNP A;  2HWE 1;  2JG8 A;  1V6K A;  1TVG A;  1C5H A;  1FAT A;  4QQP A;  1WMF A;  3ZFG C;  2VEC A;  2YXS A;  3HNM A;  5EHD A;  3VKO A;  3ZFF C;  1GP5 A;  2D40 A;  3ZYI B;  1LRH A;  5HCA A;  3TEZ A;  4RS5 B;  2A6Y A;  2JDY A;  2XPJ A;  2WQ8 A;  1O4Z A;  1TMF 2;  1RUJ 1;  1HDK A;  1HQN A;  2GC2 A;  1PIV 1;  5DAP A;  2D3R A;  3UL2 A;  1A3K A;  3MIG A;  1LU1 A;  1Q3E A;  1R1A 3;  3TRS B;  4IV3 B;  3HN1 A;  3OUJ A;  2ATF A;  4Q0Q A;  5AVA A;  5CBL A;  4I0B A;  3KCC A;  3NKT A;  4OHV A;  5K0U A;  3RG0 A;  3RS6 A;  1N3O A;  2E32 A;  2OZJ A;  2EAA A;  3WQ7 A;  4IUG A;  4CRQ A;  1NZC A;  5C4W B;  4XBN A;  5JR2 A;  3MUZ 1;  3U11 A;  3D4K A;  4TTG A;  3RJ2 X;  5FZM A;  2VOK A;  1PGS A;  3O1S A;  1Q43 A;  4KL1 A;  5I0R A;  2R04 3;  2FBE A;  2WR9 A;  1GQH A;  1W2O A;  3KVB A;  1BBT 2;  4BIF A;  4CP9 A;  4URA A;  4XTP A;  4IV1 B;  3HD8 B;  1US3 A;  5L9B A;  1FMD 3;  2B4K A;  3I59 A;  5EV7 A;  4LE4 A;  2DUR A;  3MW2 A;  1W8U A;  5IVJ A;  1FPN 3;  1ENR A;  2R06 3;  3ZR5 A;  4COZ A;  4N9H A;  4N53 A;  1RUF 2;  1CAV A;  3RWN A;  1C5I A;  3C7F A;  4GB3 2;  4UYB A;  2XHK A;  3KF3 A;  2VUA A;  2W9X A;  3KV4 A;  4NN0 A;  4UAP A;  1WCK A;  1CX4 A;  3WDT A;  3GM8 A;  4BIO A;  3WDY A;  1ZNP A;  4N90 A;  1IQD C;  2Y6G A;  3NAP B;  1CJD A;  2JEM A;  1VB2 A;  2UY8 A;  4GH4 B;  1DU3 D;  4IE4 A;  4UFJ A;  4XUO A;  5GZG A;  3B3Q E;  5FQ0 B;  1WKY A;  4HON A;  4JGY C;  1J1L A;  1X50 A;  1RMU 3;  3AX4 A;  3VUO A;  3UGF A;  3JCI A;  1CZV A;  1W2N A;  4JGZ C;  4LE3 A;  2FD8 A;  1OVS A;  4HVQ A;  1FV3 A;  2OW4 A;  4ET7 A;  4ONU A;  4Y20 A;  3WDW A;  1VMF A;  5FP8 A;  3VKN A;  5C3S A;  2CSG A;  2PLV 3;  2HYX A;  4LO4 B;  1PK6 B;  1QOO A;  1Q56 A;  5CB7 A;  3S30 A;  1JYX A;  3W58 A;  1BMV 2;  2JDZ A;  4IW3 A;  5DZG A;  1UU4 A;  2JDK A;  2D5F A;  3X29 B;  2Y6K A;  4A2U A;  2WS9 3;  3AMH A;  4E2G A;  4LBJ A;  3DN7 A;  4MGI E;  5FYZ A;  1H2M A;  1POV 3;  1ZX5 A;  4BQY A;  4A3X A;  3HT1 A;  3LEI A;  2H6B A;  3OGS A;  1C28 A;  4P14 A;  5EIY B;  2QZ2 A;  2WQZ C;  2ZHK A;  4CCD A;  4COW A;  3RI8 A;  2JB8 A;  4BHP A;  4Z2A A;  3D3A A;  2P6H A;  3MBW A;  3BU0 A;  3K48 A;  4YM1 A;  1O8S A;  2DBI A;  2HWF 2;  3KQR A;  2HH9 A;  4XJA A;  1GUI A;  1FAY A;  4RL7 A;  5A6Z A;  4IE6 A;  4A45 A;  4XF1 A;  2HWB 2;  4QDR A;  4LKE A;  5CIS A;  5C8C C;  1DBN A;  3AYC A;  5FZO A;  2D6L X;  1S0B A;  2PA7 A;  1OD3 A;  5EYX A;  1Z0H A;  1LAJ A;  5BNN C;  4LKD A;  1HB2 A;  5LRS A;  1LHU A;  1OA2 A;  4QWN A;  4XMI A;  2X09 A;  3OG2 A;  5EQU A;  5IVV A;  4NR1 A;  2JWP A;  2EAL A;  3J8F 2;  2A7A A;  3KF5 A;  5A6X A;  5I0S A;  1GZC A;  3GF6 A;  4WVZ A;  5IW0 A;  5I8S A;  1UX6 A;  2Q8O A;  4XUT A;  1XRU A;  3SMH A;  1SBF A;  2WZR 1;  3VBF A;  3U75 A;  1FNY A;  2EIG A;  5AFB A;  3S5Q A;  5C3Q A;  2JG9 A;  3USS A;  2VVD A;  1AR7 1;  5EZW A;  1QJY 3;  2OZ6 A;  3AMQ A;  1X82 A;  2VMD A;  4IEZ A;  3ZSJ A;  2PHX A;  4EE2 A;  4XBQ A;  3R05 A;  1OKQ A;  1KEX A;  1QHD A;  3E6B A;  3CNA A;  2X05 A;  3RJR A;  5C5T A;  2EIC A;  2P17 A;  3F95 A;  1C8M 3;  3GBG A;  3NWK A;  4LHN A;  5B4X A;  5ISL A;  4XJ9 A;  2P6C A;  1GYK A;  2BDR A;  3OUH A;  4WVW A;  4AED A;  5ABJ C;  4JCK A;  2ARA A;  1S0F A;  2ZGL A;  4K6B A;  3DF0 A;  2X5I C;  1OQE A;  3WF3 A;  3AJZ A;  5BY5 A;  1I5Z A;  5DPN A;  1OQD A;  3O1M A;  3EXU A;  1ZBE 2;  2P2K A;  2Q1F A;  4JGZ B;  4JTO A;  3IMN A;  1W9S A;  2HWD 1;  2VNG A;  2P34 A;  2WWS A;  4UW3 A;  1ODN A;  4CP2 A;  4LBL A;  2VUL A;  5GLV A;  2VW1 A;  2DVD A;  4YVS A;  1VBE 1;  3PTY A;  4CPB A;  3DYP A;  3B94 A;  1VBA 2;  2PHU A;  3OY8 A;  4NE9 A;  1LOG A;  2RS3 2;  5T5P A;  1YC6 1;  1QDC A;  4WZF A;  3P6B A;  2ZEX A;  1DGR A;  3PLQ A;  4FOW A;  1VJ2 A;  1ZRI A;  3ZR6 A;  1X9T A;  1WZX A;  4M0H A;  5TSW A;  2XJP A;  3T0A A;  1AR6 3;  3CQO A;  4EN8 B;  4K8R B;  1DCS A;  5C6C A;  4XBL A;  2O14 A;  4XZP A;  5A33 A;  3NV3 A;  3WG3 A;  1BVV A;  1HQL A;  3BN6 A;  3WF1 A;  4AQT A;  1L3J A;  4BQ4 A;  5EJ3 A;  2VZU A;  1PO2 1;  2R07 1;  2RHP A;  1L7R A;  2ADE A;  5FXV A;  5KHH A;  1PGW 2;  2WT1 A;  4IGP A;  5FP4 A;  3ZYF A;  4OI0 A;  3D0J A;  5FPU A;  3ILR A;  5LEJ A;  2Y34 A;  1ENQ A;  2PHW A;  4JDM A;  2GMM A;  3SIT A;  2E31 A;  3WW3 A;  1K3I A;  3JD7 3;  4OUS A;  4Q27 A;  2B7Y A;  4LPL A;  1UU5 A;  4S2F A;  1NCQ A;  3I2J A;  2QQP A;  5I0U A;  2WFF 2;  3AP4 A;  1YQ8 A;  3MIH A;  3NJV A; 
#chains in the Genus database with same CATH homology
 3NNG A;  1UY0 A;  5JXJ A;  1UYX A;  3I97 A;  4JKM A;  3PUH A;  3THD A;  1JZ8 A;  3I2H A;  2ZEZ A;  5EJ1 B;  2V72 A;  1R64 A;  2VQU A;  2VZ1 A;  4LQR A;  3DYM A;  4DXR A;  4AAX A;  2VM9 A;  2VC9 A;  2OKX A;  5J1X A;  2J1A A;  2DCJ A;  3ACH A;  3WNN A;  2VMC A;  1UMI A;  4PT6 A;  4FI9 A;  2W1Q A;  3VDC A;  4D0Q A;  5JXG A;  4CUC A;  5C71 A;  1JI6 A;  4CUA A;  3C7E A;  1DLC A;  2Z4F A;  2X10 A;  4M4R A;  5C7G A;  1JYV A;  1JZ5 A;  5JMO A;  1L7Q A;  2J1U A;  3WF2 A;  1D7P M;  3ACF A;  2J1R A;  1UYY A;  1MPX A;  1HN1 A;  2VTF A;  3HOB A;  1K12 A;  3IB3 A;  3VD3 A;  4BXS V;  1RYY A;  2YC2 A;  3A22 A;  4M4P A;  3IAQ A;  2ID4 A;  3JXS A;  1GQP A;  3MO4 A;  2BGP A;  3ECQ A;  5LA0 A;  2JKX A;  4W8J A;  3WQB A;  3CMG A;  2W94 A;  4TXW A;  2DDU A;  5HXM A;  1W8O A;  3P1I A;  3VDA A;  3DYO A;  1UY3 A;  4BDV B;  4XUN A;  3SEE A;  3GXU A;  1J84 A;  2J1E A;  5CZK A;  1YQ2 A;  4P5Y A;  3CIH A;  4MGS A;  1CZT A;  3WSO A;  4DUW A;  3HPN A;  4OZO A;  5C70 A;  5DN2 A;  4DXT A;  4KMQ A;  2ZEW A;  2WYS A;  3ABZ A;  3UES A;  2VZT A;  2QQJ A;  4CU8 A;  1F4A A;  5DQ0 A;  2WBK A;  3NRU A;  2HLE A;  1P8J A;  4GWI A;  4BK4 A;  2VZP A;  3AC0 A;  4P00 B;  4E8C A;  1CIY A;  3WNO A;  3EYP A;  2WZ8 A;  4DUX A;  4LKS A;  3K4A A;  3K46 A;  2YG0 A;  1GNY A;  2ZXQ A;  3MUY 1;  2WO1 A;  4RYD A;  2WN2 A;  2JDA A;  2WN3 A;  4KI5 M;  2VZS A;  3SEP A;  1UY2 A;  3WNL A;  1CZS A;  3WEZ A;  4OUE A;  1SDD B;  4XUR A;  2Y6L A;  2W87 A;  1ULO A;  1O8P A;  3T2Q A;  1UMH A;  2VOT A;  3K75 B;  3W5M A;  3HN3 A;  3U37 A;  4MO3 M;  2VZ3 A;  4JX0 A;  3SKV A;  2VCC A;  4MAD A;  3CKH A;  3LEK A;  5IFT A;  1GMM A;  4GWJ A;  1JU3 A;  4KWU A;  2ZEY A;  4P08 A;  3EB7 A;  3A23 A;  2RVA A;  2XON A;  4ARX A;  4YPJ A;  3DEC A;  3ZM8 A;  4A3Z A;  2C9K A;  3K4D A;  4P02 B;  4OMC A;  3HEI A;  5CYY A;  5IYY A;  1DYO A;  2L9L A;  2VMF A;  2Y8K A;  2W1W A;  1UXZ A;  2W3J A;  3VD5 A;  3III A;  4CU6 A;  4QB2 A;  4OYU A;  1BHG A;  2VR4 A;  4LHS A;  1J83 A;  2VJX A;  3J7H A;  4BJ0 A;  4ARY A;  3A21 A;  3LEG A;  4QB6 A;  4W4Z A;  4ZZ5 A;  2BZD A;  3W5N A;  2YFZ A;  3LQC A;  4W50 A;  2QQN A;  5LA2 A;  5B4N A;  2KD7 A;  4ZXE A;  1PMJ X;  1T2X A;  5F7U A;  5FUI A;  4XVH A;  3CDZ B;  2W1U A;  4XZU G;  1W0N A;  2ORZ A;  1NKG A;  3FHA A;  5G04 L;  5IJR A;  2QQI A;  1UY4 A;  4UOJ A;  2V5D A;  3WF0 A;  2LS6 A;  2J1T A;  2QQM A;  4PF1 A;  2VQT A;  4ZZ8 A;  4JHZ A;  4D8M A;  3SKJ E;  5A1A A;  4QPW A;  1GOG A;  1OH4 A;  2YC4 A;  2J22 A;  3MV1 1;  3OB8 A;  2WO3 A;  2QQL A;  4QAW A;  2B9V A;  4QX0 A;  4CU7 A;  2VCA A;  1K42 A;  3OGR A;  2E33 A;  2CDP A;  2Y64 A;  2YB7 A;  1JZ6 A;  3GGL A;  4OMD A;  1H6Y A;  3OBA A;  3T2O A;  3UET A;  4AG4 A;  5G05 L;  2WO2 A;  3E1F 1;  4QB1 A;  1UWW A;  2W5F A;  2VZR A;  3LE0 A;  1JYN A;  4L0P A;  2ORX A;  3CZJ A;  2JD9 A;  2QBX A;  3UNP A;  2EIB A;  2VME A;  1TVG A;  3MV0 1;  2BER A;  2C4X A;  2VL4 A;  4RN5 A;  4UI9 L;  3HNM A;  1TG7 A;  2WQ8 A;  4A41 A;  1OF4 A;  3T09 A;  1W9W A;  4ZY9 A;  1O59 A;  3I3B A;  2BBA A;  2JE8 A;  2E32 A;  4A4A A;  4CUB A;  1XPW A;  2WAB A;  3LPG A;  4IUG A;  2BGO A;  1GOF A;  5JR2 A;  2CDO A;  3MUZ 1;  1US2 A;  3FN9 A;  3OEB A;  4TTG A;  3WNP A;  1JZ2 A;  1LNS A;  4A6O A;  1JZ4 A;  2EID A;  3FL7 A;  1JZ3 A;  2VO5 A;  1US3 A;  1GU3 A;  3ACI A;  3LPF A;  3WF4 A;  2VZV A;  3C7H A;  2B4K A;  2W91 A;  1SG3 A;  1UX7 A;  2Y6J A;  3NJX A;  3ETP A;  4CVU A;  2PQS A;  3C7F A;  2W9X A;  4JKK A;  4UAP A;  5IFP A;  1JHJ A;  3C8X A;  3GM8 A;  1IQD C;  2XQX A;  2Y6G A;  3PUI A;  2WDB A;  4XUO A;  2LW8 A;  1WKY A;  2J1S A;  1OT5 A;  1CZV A;  1NAE A;  4QX1 A;  4XUP A;  3K4Z A;  3K77 A;  4ET7 A;  3VD7 A;  2W95 A;  1NX9 A;  1CX1 A;  1PX4 A;  1W99 A;  4BK5 A;  5DMY A;  2HYX A;  3WNM A;  1EUT A;  1JYX A;  3VD9 A;  4DEQ A;  2WUH A;  1OF3 A;  1EUU A;  1GOH A;  1NUK A;  2Y6K A;  4DEV A;  2W46 A;  5JUV A;  3HJR A;  3IAP A;  2W1S A;  4PQQ A;  2EIE A;  3LEI A;  1UYZ A;  3I2K A;  3OGS A;  1KGY A;  5EIY B;  2VZQ A;  2Y6H A;  1PMH X;  3I3E A;  2W92 A;  3VD4 A;  1PX3 A;  3FHQ A;  3HNB M;  4Z2A A;  3D3A A;  2XHN A;  3MBW A;  1O8S A;  3T0B A;  4A42 A;  1GUI A;  4A45 A;  4GZ9 A;  4QDR A;  5LCW L;  3CZU A;  1OD3 A;  5LA1 A;  3WNK A;  3A7Q A;  2R7E B;  2X09 A;  3OG2 A;  3F2Z A;  2V4V A;  4MOA A;  3I2I A;  4HG6 B;  4MGQ A;  4XUT A;  3OGV A;  2W47 A;  1WCQ A;  3IDA A;  2RJ2 A;  1JZ7 A;  1UXX X;  1SHW B;  1XNT A;  2VMD A;  3T08 A;  4DXS A;  1KEX A;  2J7M A;  4QX2 A;  3VDB A;  2X05 A;  3I2G A;  2EIC A;  5JXH A;  5B4X A;  4E8D A;  1JU4 A;  3WF3 A;  4DUV A;  5DPN A;  5JXI A;  1XNA A;  1XC6 A;  1H6X A;  1W9S A;  2J1V A;  3ACG A;  2RV9 A;  2WZE A;  4JKL A;  2VZO A;  3C7G A;  3T2P A;  3OEA A;  3DYP A;  1UZ0 A;  1I5P A;  2QQO A;  3GDB A;  2WAO A;  5IHR A;  2DCK A;  2YFU A;  3P6B A;  4A44 A;  2ZEX A;  1JYW A;  2WAA A;  1W8N A;  5EJZ B;  1ULP A;  1UY1 A;  1DP0 A;  1K45 A;  2E26 A;  4QX3 A;  3I3D A;  5I0D A;  3I2F A;  3T0A A;  2VCB A;  3CQO A;  4CU9 A;  2XOM A;  3HNY M;  3WF1 A;  3BN6 A;  2QQK A;  2VZU A;  1W9T A;  1L7R A;  4QDS A;  3BGA A;  3T0D A;  4QDQ A;  5HPO A;  1F4H A;  2E31 A;  4XUQ A;  2C26 A;  1K3I A;  4LPL A;  3C7O A;  3I2J A;  3NQH A;  3THC A;  3NJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...