2HLEA

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
188
Chain Sequence
AGHHHHHHEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
molecule keywords Ephrin type-B receptor 4
total genus 31
structure length 188
sequence length 188
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hleA00
2ZXQA 2QQJA 4ET7A 4DEVA 3MO4A 3A7QA 3OEAA 4KI5M 4QDSA 4TXWA 1OT5A 1H6YA 2VZSA 3DYMA 3FL7A 3WNNA 4ZXEA 3VD5A 2C9KA 4JKMA 2B9VA 2R7EB 4DXSA 4CU8A 1KGYA 2VZQA 4E8CA 2JKXA 2Y8KA 3C7OA 3CKHA 2L9LA 4GZ9A 3T0DA 3I2KA 1JI6A 1W99A 2BGPA 4DUVA 4ARYA 3HNYM 1DLCA 3NJVA 4OZOA 1W9TA 1GNYA 3DYPA 3WF3A 3GM8A 2W3JA 1JHJA 4QX3A 5HXMA 5G05L 3SEEA 2QQKA 2Y6JA 2J1UA 3I3BA 4JX0A 3IB3A 3K4ZA 3K46A 4QAWA 3OG2A 4TTGA 5A1AA 3DECA 2VZOA 1UMIA 3VDCA 1JZ7A 2VZVA 2E32A 3I97A 3T0BA 3I2GA 4ZZ8A 2DCKA 3IDAA 3WEZA 3MUY1 3ACHA 3I2JA 4QX0A 2YB7A 1NAEA 4MGQA 4XUQA 3LEGA 3CQOA 4DXRA 4M4PA 2VR4A 5JUVA 2X09A 1PMJX 4BK5A 1JZ6A 2VMCA 2W95A 1L7QA 2J1VA 1BHGA 2VMDA 4DXTA 3MUZ1 2WAOA 3OGVA 3WNPA 5JXGA 1DP0A 3AC0A 3WF4A 1US2A 2BGOA 4BDVB 3DYOA 3BGAA 3I2IA 2VC9A 5JXHA 5LA0A 1L7RA 3J7HA 4RYDA 4PT6A 1P8JA 1GOGA 1O8PA 3THDA 1EUTA 1I5PA 3E1F1 3W5NA 4QB1A 1NX9A 2WDBA 2QQOA 4A45A 2EICA 2VZTA 3ETPA 3ABZA 3I2HA 4QB2A 3K77A 1OD3A 2QQLA 2V5DA 1HN1A 2XHNA 4D8MA 1YQ2A 2WAAA 4MGSA 2VQTA 5EIYB 1XNTA 4A4AA 3WNKA 2J1RA 5I0DA 4P00B 2JE8A 2VCCA 1PMHX 2CDPA 2W47A 1JYWA 4FI9A 5C71A 3T0AA 2WABA 3IAPA 2BZDA 3UESA 3SKVA 4BXSV 4ZY9A 4QX2A 2EIBA 4XZUG 1UYZA 3SKJE 1TG7A 2LW8A 3C7FA 3OEBA 2QQIA 1W8NA 1CX1A 2VO5A 1US3A 2WYSA 1PX3A 3HN3A 3NQHA 3I3EA 3SEPA 2VL4A 1O8SA 2E26A 1GUIA 1F4HA 5B4NA 2RJ2A 3MV01 4W50A 5F7UA 2DCJA 3P6BA 2Y6LA 1W0NA 2W1SA 1CZSA 2DDUA 5DMYA 2Y64A 4LHSA 4DEQA 4OYUA 4CUCA 2YG0A 2OKXA 2W5FA 3CDZB 3T08A 4A6OA 4OUEA 1ULPA 5G04L 3U37A 4XUTA 4AAXA 3I3DA 4UI9L 2VZ1A 3VD3A 1RYYA 5B4XA 4A3ZA 3PUHA 2W1QA 3CMGA 5JR2A 1SG3A 3GXUA 2VTFA 2V4VA 1SDDB 2EIDA 3A22A 1OH4A 3K4AA 3WF2A 1GOFA 2WO3A 3HNBM 2B4KA 4XUOA 4P5YA 3OBAA 2VZRA 1JZ8A 4QDQA 3WF0A 3C7HA 3WF1A 1O59A 2YC2A 3WNOA 3NNGA 2HYXA 2E31A 5IHRA 2WBKA 5IFTA 4W8JA 4Z2AA 2YC4A 2ZEXA 1ULOA 2VZ3A 1NUKA 1CZTA 1PX4A 2E33A 4XUPA 5JXJA 1H6XA 3LQCA 4KMQA 2ZEYA 5IJRA 3GGLA 1MPXA 3IIIA 1R64A 4CU9A 1EUUA 3GDBA 2HLEA 4DUWA 4JKLA 2JDAA 4CU7A 3K4DA 5JXIA 3EYPA 2BBAA 3FHQA 1JYNA 1LNSA 2KD7A 2Y6KA 2QQNA 3T2QA 3MBWA 4QX1A 4MADA 3NRUA 3T09A 2J1AA 2Y6GA 5J1XA 3K75B 4GWIA 3VD9A 5LA1A 2WN2A 3A23A 2W87A 4PQQA 3LEIA 1JYXA 4JKKA 3IAQA 4GWJA 4UOJA 3THCA 3P1IA 1JZ4A 4ZZ5A 4BK4A 2BERA 2WO2A 3LEKA 3VD4A 2W92A 3BN6A 4OMDA 5LA2A 2W1UA 1CZVA 2RV9A 3T2PA 1UYYA 2W91A 3ECQA 5EJ1B 1WKYA 4A42A 2VQUA 3C7GA 2J1TA 3C8XA 2WZEA 1XPWA 2WO1A 3C7EA 2Z4FA 4CUAA 4E8DA 1XNAA 2W94A 1JYVA 1GQPA 2VZPA 3ACIA 2J1EA 2LS6A 5CZKA 3HPNA 5EJZB 3D3AA 3T2OA 5FUIA 3ACGA 2C4XA 5IFPA 3MV11 1K45A 2J1SA 1W8OA 4QB6A 1UY1A 1JU4A 1WCQA 4OMCA 2W1WA 5DN2A 5DPNA 3VDAA 4A44A 1OF4A 1W9SA 3A21A 3CZJA 4L0PA 4PF1A 2V72A 1JZ2A 3W5MA 4A41A 2VM9A 4BJ0A 5IYYA 2WQ8A 5CYYA 1J83A 2Y6HA 2YFUA 3CZUA 4M4RA 4IUGA 2VOTA 3WQBA 2VCBA 3WNMA 2PQSA 2CDOA 3HOBA 3WSOA 1UY2A 3FHAA 1UY4A 1UY3A 1XC6A 3EB7A 3PUIA 4LKSA 4AG4A 4LQRA 5HPOA 1GOHA 2WN3A 4ARXA 5C7GA 1OF3A 3FN9A 4P08A 2XOMA 1UWWA 1UX7A 2WZ8A 4XUNA 4XURA 1J84A 4JHZA 1UY0A 2RVAA 2VJXA 5DQ0A 2VMFA 2XONA 5C70A 1UMHA 3HNMA 5JMOA 4P02B 1D7PM 3LPGA 3VDBA 3VD7A 3F2ZA 4HG6B 2ZEWA 3WNLA 1F4AA 2XQXA 3UETA 4D0QA 2VMEA 2J7MA 1SHWB 4CVUA 1UYXA 2ORXA 3OB8A 3LPFA 5LCWL 1JZ3A 1UXXX 2YFZA 4QPWA 1UXZA 2J22A 3HEIA 1W9WA 2W9XA 4XVHA 4YPJA 2ZEZA 4W4ZA 4QDRA 4MOAA 1KEXA 1T2XA 4MO3M 1IQDC 3CIHA 3ZM8A 3JXSA 3ACFA 1JU3A 2X10A 2EIEA 2QQMA 4RN5A 1K42A 2JD9A 2X05A 2VCAA 4DUXA 2ID4A 2C26A 1NKGA 3UNPA 2W46A 3I2FA 3NJXA 2WUHA 4LPLA 1UZ0A 1TVGA 3OGRA 4KWUA 4CU6A 2ORZA 3OGSA 1DYOA 3HJRA 1GMMA 2QBXA 4UAPA 1GU3A 1K3IA 1JZ5A 1K12A 2VZUA 3LE0A 4CUBA 1CIYA
chains in the Genus database with same CATH superfamily
4H55A 4C1XA 2VMGA 1PZ9A 2JJ6A 3M3IA 5F39A 2QQJA 4RS5B 3VBHA 1OXCA 3WG2A 2PHUA 3A7QA 4CZSA 1VBC1 3OEAA 4KI5M 3I8TA 1EYBA 2XGXA 4LBMA 2OQ6A 5A32B 4BYYA 1IKQA 5K8SA 3JQWA 4YZ2A 1V6NA 3DXUA 1BBT3 3FL7A 3THPA 4AHWA 3RJ2X 2DYCA 5DZGA 5FXVA 1H1MA 5FY8A 2C9KA 3NMBA 3H1MA 4LIUA 3MIBA 4EN0A 3AP9A 2B9VA 1ASJ2 2R30A 1GZWA 3AP5A 4JGYA 1QJFA 2OIIA 4S2GA 1FNYA 1YIFA 2JKXA 1WD3A 1QEXA 1ZBA1 2Y8KA 2ZACA 5FZMA 2G9GA 5I0UA 4E4DX 1EP0A 4GZ9A 1ENXA 4RSUA 1QKQA 4IEXA 5IT6A 1O3TA 1QOOA 1F9KA 1DG6A 4OZOA 5E1RA 3ZYPA 2VULA 3AMPA 1TMF3 1GNYA 3DYPA 3FX3A 4NHLA 2W3JA 2VOWA 1LU2A 1PNGA 4JC1A 4FFHA 2QTWB 3SEEA 1RHI1 1N47A 2QQKA 2Y6JA 1UOJA 4FPOB 4JX0A 3N36A 1POV3 3JZVA 2VE1A 1X9PA 1RUG3 3K4ZA 1UU6A 3NNJA 4TWTA 4FFFA 5F5CA 4CP2A 1JUHA 5FXZA 2Q0AA 2GH8A 5L9BA 3S6PA 3S30A 4TTGA 3UK9A 1RUF2 1LOEA 5ISLA 3KQRA 2Q8CA 3DL3A 2FCUA 2JDUA 1QQP3 3WW3A 2MEV2 4XC9A 2K46A 4COYA 1ZZ7A 2FDFA 2AREA 1JZ7A 1SACA 2E32A 3I97A 5FYSA 3SNMA 4ZZ8A 2DCKA 2VVFA 2CAUA 4JGYB 3WEZA 5E88A 5CG9A 3MUY1 1SLCA 5IVJA 1O3SA 3ZSEA 1W6OA 3LKJA 3D5OA 1BBT1 4CCMA 4PLOA 4HKWA 1AX2A 3LAGA 4O9GA 2GP3A 3ETQA 5IVYA 1S0JA 3N9PA 5T52A 2DUPA 4DXRA 5HV0A 2WNVA 2YPDA 1LEDA 3AXEA 2SBAA 4M4PA 2VR4A 4Q29A 4XIOA 4S2DA 4D7YA 4XMAA 1FOD3 1JZ6A 1JYTA 4K6BA 3QBQA 2WLPA 2F4LA 3U10A 3AKSA 4LNVA 1J59A 3RGBA 4AAPA 4CEYA 1QJX3 1KS5A 2NMNA 3DPRB 1OURA 2OQ7A 1B35C 4IL7A 1YWKA 2V4AA 1FMD2 3AZWA 2WFPA 1O7FA 2B42B 2E53A 3BOPA 3N9MA 4XAEA 4FAHA 4DXTA 1YCIA 2VUDA 3KVAA 2RM23 2BOIA 2FZ2A 2WAOA 1D0HA 3JD73 5DAVA 3WXPA 2VMHA 1DP0A 4GH4C 1AR81 5FQ0A 1WLCA 2WS93 1ZYBA 1NCQA 5FZKA 5LA0A 3J7HA 2VOVA 1I1EA 5FY9A 1EY2A 1HW5A 3M70A 4CUGA 1GOGA 2YC0A 4WM8C 4IE0A 1XNDA 2VOKA 5GALA 1FV3A 1NX9A 2BVBA 3DGTA 4RA0A 2WDBA 4NROA 3WQ1A 3BTXA 3VBOC 3K77A 5EP9A 2QQLA 1Y7BA 1COV3 2F6BA 3MIEA 4U36A 4XQWA 1HN1A 2XHNA 1IS5A 3BKZA 2IUWA 2HWD2 3D4KA 1HXS2 3JQXA 2JG8B 1QOTA 5JMCA 5APAA 3WDTA 3VKFC 3OSDA 1PZ7A 5AFEA 3T4VA 1GLHA 3KVBA 5BPXA 2JDHA 1PMHX 1BEV2 3SMHA 2CDPA 3KF3A 2Z69A 1PGW2 3W21A 2YV8A 4DO0A 3O1VA 2PHWA 2WT1A 2WABA 2JG9B 4FSJA 4L92A 3SKVA 4BXSV 1JH5A 4XZUG 1AX1A 1UYZA 5FIXA 4HN1A 2AEZA 5LBCA 3SITA 1AYN3 4QT6A 1M4WA 4XABA 5F5AA 3KCXA 4XJAA 4XETA 2QDNA 4JGZC 1W8NA 2O1QA 1UZZA 4LLOA 1ODMA 1QNYA 5FTTC 1OFSA 3GHMA 3ZPYA 5JZGB 1PO11 3J26N 2VUAA 3S7EA 1A8DA 4JGYC 3JD71 5FCCA 5CA6A 1NLQA 4NPMA 1DU3D 1NE6A 2PELA 1VBE1 4DNYA 3JBG1 2YGLA 1QJX2 1Q8OA 4H2AA 5FZCA 1XXNA 1YXWA 1A6CA 5DUXA 2OPWA 2HWE3 2IVIB 2RJ2A 4IETA 5F7UA 2IXKA 3B02A 3P6BA 2Y6LA 3PVNA 4AI1A 4QM8A 2RMU3 2VVDA 5F2WA 4JZRA 3RWKX 1MZ5A 1BEV3 2ZZJA 3RJRA 4CDUA 1W05A 2BRTA 4XYXA 5FYTA 1HQWA 2BNOA 3WP3A 2PHDA 1XE7A 1AR72 3AZZA 5JSPA 3WP4A 2YBPA 3T08A 4A6OA 4QPIB 1RMU2 5CFCA 5G04L 1VALA 2EXKA 1VAVA 3RRDA 4AAXA 5FUPA 5FDBA 1PK6B 4WM8A 3KZ4C 4L97A 4R52A 1R091 4YW5A 4XFBA 5CFDC 1RYYA 5BYNA 1WLTA 2GMPA 5JAXA 4A3ZA 1W90A 4B4RA 4I09A 1O3QA 3VKLA 4P9GA 1HRI2 3LB9A 2C1FA 2TBVA 3PJYA 5GLWA 3UT0A 3ZSMA 2RJLA 3FBYA 4RR3C 3AKRA 1FPN2 1D0GA 4FPHA 3BIEA 1OD5A 5SV8A 3VB9A 2WFF3 1E5RA 4XDPA 1U5YA 4E2SA 4P9IA 1OH4A 3N35A 1QGLA 2V5YA 3ELNA 4M3CF 5CEHA 3AVRA 3HNBM 5FZOB 1DHKB 2LM3A 2R6QA 1HQNA 2W08A 2R0FA 3BTAA 4FO9A 2R042 1N1VA 1JZ8A 5F1RA 3USUB 4URAA 2DU0A 5KHIA 4C8DA 3WF1A 1ND2B 5DDJ1 1O59A 2YC2A 4N9IA 1DGWX 3LSEA 3GZAA 1REDA 2WBKA 1UU4A 4K9SA 2GN7A 3FLTA 4BZ4A 3ZFFC 4E4SA 1TNRA 2QDRA 3KCYA 3WLUA 2FDIA 4Q4V3 2X8KA 1PK6C 2YC4A 2ZEXA 1KS4A 3ZYBA 4GD4A 3OY8B 4XMIA 1JHNA 5DAQA 2Q8DA 1EPWA 3WG3A 4CYDA 1R081 3ZVXA 1H8TC 1S2BA 3NJZA 2DCTA 5F32A 4UW6A 4AFBA 3O0XA 5IJRA 5EYXA 2PAMA 1BEV1 4RHV1 1EUUA 2WQZC 3W20A 2HLEA 5LBFA 3VN4A 3ZN6A 1H8VA 5JSOA 2ERFA 2BPA2 3K4DA 4WZFA 2PHTA 4Q2FA 2MNGA 1AR63 4BIOA 5JXIA 3LA2A 3EYPA 3M7AA 5FBZA 4D6SA 2BBAA 1RUG2 5DXDA 1J3PA 1LNSA 2KD7A 2NLRA 3HAGA 1G8WA 1D2SA 4Q1PA 4LKEA 1Y43B 4AVCA 3NL1A 3K75B 5LBEA 2AUYA 1SMVA 4C0BA 1FPN3 3K48A 4PQQA 1W6QA 2ZS6B 1AR62 3ZYGA 1D4M3 2C0ZA 4ATFA 4GWJA 4OLLA 2OS2A 4ORFA 3J7NA 2PXJA 4HONA 5FKCA 2QZ3A 4BK4A 3B9CA 4IV3C 4BQ3A 2EXIA 1QXPA 2P6HA 1QY4A 2WO2A 3LEKA 4IEPA 1VR3A 3W58A 4AHXA 3EMRA 3VBSC 4D3WA 5ABJB 3WX5A 2BW8A 2O8QA 5FO9B 3PVOA 5D8AC 5A33A 4A6SA 4NIGA 1X33A 2W1UA 1S0BA 3K3NA 1CZVA 4G3YC 5DUWA 4FPGA 4YARA 4YZ5A 5FYYA 3ECQA 1F2NA 2XL9A 1OI6A 1H1IA 2VW0A 2VQUA 2XLGA 4AVSA 2J1TA 4D94A 3AKPA 3PL0A 1AR71 1MS9A 2DCYA 4Q8LA 3C8XA 5CFDB 3O1PA 3H3UA 5JIAA 1QH7A 1AL21 1K5JA 1F15A 3UL2A 1QWRA 3GNEA 3VBOB 1TZOA 2GNDA 3PTRB 2GP5A 3J8F1 2HEYF 2QNKA 3LZZA 5FAXA 3UJQA 4P9JA 1LULA 1RUNA 2GC0A 1BKZA 2DVAA 4UFKA 5A32A 4LORA 5CZKA 4RHV3 2FDHA 1BLZA 4GB31 1ULGA 1ZRDA 1WLWA 2WFF1 2K9ZA 4QPIC 2HBUA 1JXNA 3IDEA 3PU3A 4RS5A 1LOFA 3VDDC 1AR61 4YGBA 3ILRA 2ZHNA 3ZXAC 1JU4A 3VZLA 3HQXA 1UIKA 5A7PA 3VBUA 2DVGA 3W59A 3OCPA 3PDQA 4KH9A 1NG0A 1PO12 4L0PA 1JZ2A 2XLFA 2VM9A 5FY4A 1GV9A 4LHKA 2P3IA 2DWRA 2ZMNA 4BU2A 4D7TA 4IV1C 4L11A 3VGIA 1H0BA 1UF2C 5BNPC 1PGL1 5LW9A 4OI4A 4DPNA 4IUGA 4QKDA 4XF9A 3E5QA 3AK0A 2VOTA 3WQBA 1D4M1 2VCBA 5FREA 2XPJA 3H7JA 2CDOA 2D6OX 2YU1A 2QCSB 5K0UC 2R062 1VBC3 3Q8EA 3WSOA 1O4TA 1W3VA 4ZXKA 4XE9A 1HRI3 1XC6A 1W8UA 4FFGA 1PMIA 1R083 4AG4A 1YNAA 3O1TA 3ATGA 2B45X 1D4VB 4XFHA 5AVAA 1QJZA 4MG2A 2VBDA 3F95A 4YYOA 1OA3A 1LOCA 2EF6A 1UWWA 3FFZA 2ZX0A 1DIWA 3MIFA 4CP9A 4XFGA 3O0WA 1VPHA 2GH2A 4Q4X1 1BMV1 1S0EA 2AGSA 4FXKB 4AW7A 1Q8PA 1Q5OA 5JZGA 2PHXA 5LEJA 4FPKA 4YW4A 1R092 2Z79A 4JHZA 3H50A 2RVAA 1MQTC 1RUH1 4OHZA 1J58A 2RS53 3J8F3 2VMFA 1O4ZA 3POYA 1E5SA 1UOFA 5C70A 5FQ0B 1TE1B 1VBD1 4FPFA 4O7XA 5FZHA 5JMOA 1Q3EA 4LO5B 2BYVE 5LRSA 3VDBA 3NWKA 2CL2A 3BB6A 3F2ZA 4AGVA 4N7IA 1WGPA 1RVF2 3IT8A 4GALA 1C5HA 2AZ5A 2XVLA 1IG3A 3ME2A 4LK7A 4XJZA 3JCIA 3MI8A 4P14A 2GNTA 1VMHA 3AFKA 5F6LB 1LECA 3IM0A 2BJSA 3Q8CA 3LPFA 1AJKA 5T54A 5LB6A 3ZMNA 1JN2P 3GBFA 2ARBA 2XXZA 3JBG2 1WW6A 4Y24A 2DCZA 4YPJA 2ZEZA 4AEDB 1X7NA 3RDIA 1T2XA 1GZ9A 5AFBA 2WNVB 2X5IB 4XFFA 5EHDA 2XKOA 4IEZA 1OOPC 4JV4A 3CIHA 4Q4W2 4WVWA 1C8M2 3HWJA 4LLFA 1JU3A 3KHBA 5IVEA 1RUC2 4HK8A 4OHWA 4HPKA 5C3QA 1VAKA 3LFIA 5KR7A 1CWPA 2QQMA 2YXSA 4RN5A 1K42A 1EV11 3UGGA 5GLZA 1UOGA 2VCAA 4M01A 5LY1A 5I0RA 1GP6A 3FLRA 1ZA7A 1ZZ8A 3RZMA 2C26A 4F8AA 3G7DA 3UNPA 1VBA2 1V6IA 4INDA 1VBE2 2A6XA 3I2FA 3WHUA 4IV3A 4LPLA 1UZ0A 3OGRA 3NNFA 1DGRN 5HXVA 2ADEA 4CU6A 2ORZA 5HCFA 4IV1A 4COZA 4B4QA 3DUIA 3WT3A 5FY1A 1QU0A 5FY0A 1JZ5A 1S0GA 1K12A 2ZGSA 3I59B 1OQ1A 3V56A 3LSDA 2ZKNA 4QQPA 3VBFB 2LALA 2DUOA 2R1BA 3TEYA 3TAYA 5EJ3A 4MYEA 4CDUC 1DQ1A 2RR12 2WS92 1MS8A 5FYIA 1MVQA 4DEVA 4Y22A 5JOYA 5D21A 4JAAA 1TMF2 5C8CC 1SDWA 4QDSA 4RL7A 2WS91 4JHTA 1OT5A 1H6YA 3OBTA 4Y3OA 4Y20A 2PN5A 2WA3A 1LJ7A 2RJKA 3FBMA 4LKDA 4AGGA 3LOBA 5FWJA 3AMQA 1GWMA 4LA3A 5FMCA 5C9AB 4Q4W1 5CFDA 4QPIA 1LHOA 2R7EB 1GYKA 2YBKA 4CCLA 1NQDA 4GKXA 1LOAA 1IS6A 1I5ZA 1RUE2 4E8CA 4Y4YA 1UZYA 3SH4A 3EBRA 1VRH2 4YG0A 4L9BA 2HWF3 1QJU3 1JI6A 1QF3A 2RS51 5K9YA 3OPTA 4CTEA 2A71A 3HNYM 4QPGC 2JXAA 4CCJA 1OLMA 3VBFC 5CAZA 1GWKA 2ZHKA 1VB2A 1VBD3 2QJVA 3WF3A 2JDPA 2WSVA 1JHJA 1GICA 4YWAA 4QX3A 2JDZA 3S0MA 1H1AA 2VBPA 2VBBA 4NAMA 4OVEA 4A7YA 4MX3A 1W6QB 1YFXA 1QJY2 4FFIA 3K46A 3I59A 3OG2A 2YGMA 4OUMA 5DAPA 3BU0A 3VBRB 4PDWA 4UF0B 3VZNA 2D40A 5A80A 3FUQA 1ZNPA 4K21A 2JIGA 4IV3B 3O1OA 3SCFA 4CDXB 1W06A 2ZGNA 2OYZA 2W52A 3GJBA 4ZPIA 1NY72 1G86A 2JG9A 4FPCA 4BQ1A 4N9HA 3JBG3 4R9BA 5IVFA 5A6XA 5GKAC 1W9FA 3I2JA 5EV7A 4HKLA 5FYZA 4CDQA 1EAH3 3Q8AA 4GMP0 3AYCA 1NAEA 4LULA 1ONAA 3O0VA 3MLLA 3ZSKA 4IE5A 3M3OA 3RZGA 2BBVA 4AFAA 3N7LA 3WW1A 1HB3A 1KXGA 1ZBA2 4XUQA 4HN0A 4ES9A 3T1LA 2GC1A 3LEGA 3CJIB 4NHYA 4P5HA 5F2SA 3OF1A 2PLV3 4ZS2A 3VBHB 3DF0A 5JUVA 2X09A 4QKBA 4QQOA 2VMCA 5A7OA 5FXXA 3A4UA 4AL9A 1S55A 4Z1VA 3ZYRA 2J1VA 1BHGA 2VMDA 4XFCA 1CIWA 1R093 2WWSA 3AJYA 2DVFA 4BOWA 4MGIE 2JB4A 4Y1XA 3MIHA 1FV2A 2YDEA 1BK0A 5GLTA 4SBVA 4GH4B 4DS0A 4Y5Z0 3WNPA 1QXRA 4ASKA 3ES4A 3AC0A 1GR3A 3NAPA 4R9CA 2WIIB 1DQ2A 5T55A 3WF4A 3J7LA 3V0BB 3RSJA 1POV1 3RS6A 1YQ5A 3QH6A 2BGOA 2ZCWA 5FPLA 3MF6A 2IWGB 4IEOA 5FYUA 2JD4A 1LB2A 2TUNA 5E89A 2VC9A 1NA1A 1DBNA 4PT6A 3AFGA 4AYUA 2AYHA 5J48A 4CCEA 3O1UA 5C8WA 1PK6A 4WM8B 4YGCA 3THDA 4C1WA 3HN1A 1I5PA 1YRZA 4QB1A 2WNOA 1TEIA 2ZX3A 2QQOA 4XOGA 1C5IA 1W6PA 3ETPA 1QDOA 3M4FA 4QB2A 3PLQA 4A2UA 1OD3A 4CEWB 2IXJA 3SLIA 1DQ5A 4XJWA 2Q1FA 4NMIA 1LEMA 3RZZA 3IMNA 4XZPA 3VL8A 5FZBA 2WO7A 3ZXLA 4URTA 1AL0G 1WA4A 3T30A 2WAAA 4MGSA 3CO2A 4Q4V1 3JB8A 2VQTA 2XJQA 1VAMA 3WY6A 1XNTA 1G9CA 2JECA 5FZFA 1LGBA 4XF1A 1X36A 4UYBA 5I0DA 4P00B 4HXCA 4Q5OA 3I2OA 2PLV1 3WNXA 2HYKA 3POSA 1UN1A 4FVVA 4K8RB 4EZHA 4HSLA 3T0AA 1FOD1 2BZDA 3LDBA 3TEWA 1FMD1 4M3CB 4QX2A 3SKJE 5LZ6A 1TG7A 1QJX1 4DOUA 4FTEA 4QXCA 2R32A 1QIQA 2LW8A 3FLPA 3OPZA 3C7FA 1AXKA 2BTVC 3PMEA 5BNNA 2QQIA 4IEQA 3JD72 4Y5SA 5DUUA 3MDPA 4LT5A 3PIGA 1HDKA 1IS4A 3HBKA 5FRAA 5M0TA 4LXLA 1STMA 1ZX5A 4JDNA 2D97A 3O1MA 5LEKA 1US3A 2YZ4A 1O5LA 1PX3A 2ZAHA 4DB5A 4EN9B 3FWEA 3WR0A 3SEPA 1WCKA 3E5UA 2VECA 4KWJA 2HEVF 2VAUA 4R9AA 3M1HA 1HXS3 4QPYA 3URFA 4AEDC 1O8SA 4CCNA 1GUIA 1APNA 1EAH1 4QHBA 4Y26A 2VNOA 2A1XA 1VRBA 1WMFA 4I02A 3VBOA 4LJHA 2YYOA 3WG1A 2VNVA 3AYAA 4MVTA 1K5MA 4XIKA 2PAEA 2JB8A 1RUOA 4FPJA 1SLLA 1TME3 2KM2A 2W1SA 2BFUL 3KGZA 1CAXB 3VZJA 1HN0A 2FDJA 1RB8G 3HIFA 3UJOA 4OYUA 1GZWB 4MGKE 2YG0A 4XFAA 4Q26A 1NA1C 1UCXA 2C9AA 4OUEA 2ZMLA 3PU8A 4Y1UA 4IDZA 3VZKA 5A33B 4QX5A 3U37A 5C4WC 2Q1MA 5LA9A 2GNBA 5ABJA 5I91A 2BWCA 3I3DA 4IW3A 2Y34A 4LIVA 4QXBA 4QX7A 4UI9L 3TN91 3ZYJB 2IZWA 1W8WA 3H42B 4JQRA 5C5TA 3VBUC 3WG4A 4DFSA 4B29A 2W1QA 3OGJA 4TYSA 3WVJA 3H8XA 5EQUA 1S0FA 5EFUA 3NVCA 3B9IA 2O14A 4XDQA 4OZXA 3LEMA 4EN7B 1FMD3 4PLNA 3POGA 4AHYA 4NIAA 3FZ3A 1E5IA 1AYN1 2EIDA 4B8EA 1AR93 3K4AA 3SH3A 3ZFFA 2BU9A 4XUOA 1MR5A 1H9PA 1ODNA 1PO13 1YLLA 2VZRA 3MLKA 1W8TA 2ET7A 1F8VA 4QDQA 1NLSA 4CEYB 3LA7A 1YI9A 1H2KA 3H8OA 1PO22 3WNOA 2IXIA 4KBZA 2HYXA 2E31A 3IZOA 1RIRA 1ZBE1 1XE8A 5IHRA 1FYUA 5IFTA 1SLAA 3BI3A 1LHVA 1NE4A 1JYIA 4HSJA 3R4DB 5J98B 1ZREA 2K2SA 5J7MA 2GSYA 1CZTA 1PX4A 4XUPA 3OY8A 5JXJA 2RS13 2XB6C 4MXWB 5JZGC 1H6XA 5ERLA 5FZEA 2GMEA 4OQ9A 4UWDA 3U4SA 3LQCA 4L8QA 2ZEYA 5C5UA 3SC7X 4W6YA 5F9TA 3IIIA 4JCKA 1AR82 2PQQA 4LO6B 4DZGA 3P3PA 4JKLA 4DUWA 3BUCA 2A70A 2JDAA 4DINB 3ACLA 2PFWA 4CU7A 3UGFA 4AFDA 1J3QA 4PBOA 2Q1ZB 1V6JA 1JTZX 3RWNA 4N53A 1GANA 4Q4X3 3VKOA 3FHQA 1HB4A 2AC1A 2QVSB 2B46X 3T2QA 1V6MA 3ILFA 3M3QA 1HIXA 1LHNA 4RR3A 2NQYA 1Z78A 1OPOA 5GZCA 1LENA 3NRUA 2J1AA 1RINA 1ULDA 4M0NA 3LWCA 1C57A 3AL5A 1GZCA 4AOCA 4BH9A 1KDMA 4YRDA 3N3HA 1W2AX 3NO8A 3ES1A 4RGAA 1FNZA 3R6SA 3MZHA 3S57A 4AI0A 3Q8FA 3LDKA 1C1FA 2PHLA 4YW2A 4P9LA 1DGWA 3MW4A 1W03A 3IAQA 4UOJA 3RZHA 4FP2A 1JZ4A 4ZZ5A 2ZBJA 1QJU2 4LBOA 1E57A 5JWPA 2XVGA 3AMMA 1ENQA 2BERA 2UYAA 2ZJCA 1VBA3 1H30A 3B3QE 2Q8OA 3ST7A 3ZIWA 2HWB1 5T50A 2RDRA 5L9RA 3ZSJA 3PMSA 1RUE3 2QUOA 4TZDA 2ZGOA 2D98A 1XNCA 4UBHA 5LA2A 1MEC1 5D8AB 1XB9A 2AR6A 1UYYA 3UKNA 2VD7A 2ES3A 3DV8A 5DDJ3 4Y33A 5ACA1 3VLBB 5EJ1B 4CCOA 5F3IA 1Z7S1 2OW4A 2CGNA 3C7GA 3MFAA 3OBZA 1UO9A 2CGPA 5FKBA 2DTWA 1XPWA 2WO1A 3C7EA 4ONUA 1OVPA 5FY7A 5LBBA 1PGSA 3TN93 4CUAA 4E2GA 1Q8QA 3WCRA 1XNAA 1SPPB 4GB32 3OJBA 3ZYIB 1T6GC 2Y38A 2VZPA 4TLFA 1JYVA 3QH7A 1ND2C 2J1EA 2LS6A 3LGRA 1CAWB 3H9AA 4X8NA 1HRV1 4GQ7A 4UXAA 4FTSA 3WNMA 1KD7A 2ZABA 4JRLA 1ZZ9A 3GZTB 2WR9A 3H0OA 1K45A 4W6XA 5FMBA 1LAJA 1W8OA 1WCSA 4W6WA 1OA2A 4EQVA 3VV1A 5FPXA 2VTXJ 3ASIA 4X6RB 4QU1A 2WZR1 2BWAA 1W9SA 4PF1A 3V64A 4D6RA 5GM0A 3N9QA 3ZO0B 4RFRB 5DZFA 2WZR2 2BP6A 5FZ1A 2X29A 4BJ0A 3N9OA 2WQ8A 5IYYA 3NJYA 5CYYA 4QPGB 2Y6HA 2YFUA 3UV9A 4M4RA 1V6LA 3WCSA 3OBRA 4YVWB 1ZBE3 1DDLA 1VRH1 4F83A 3M3CA 4ITCA 1XE0A 3EJKA 1CAXA 1SBEA 4ISRA 1NYWA 4CEWC 2P3YA 5HI0A 3RZJA 1W6NB 4QU2A 1UY4A 3WQ0A 4XXAA 3M8LA 1RUE1 4DIQA 3PUIA 5A7SA 5LRRA 1NCRA 2NPIA 5BXXA 2IXLA 1DQ4A 3RG0A 4GAZA 5C7GA 2A6ZA 4N53C 4A7KA 2IC1A 3BODA 4Y4RA 4AXOA 1HB2A 1XBFA 2P2KA 4NHMA 3X29B 1IG0A 4P08A 4CP1A 2A3WA 4MGTA 2VU9A 5A70A 3TNQA 1AR73 1OPMA 2I74A 1LCLA 1YC61 2WZ8A 4IGQA 4WBBA 5C3PA 5CISA 4EN6B 4LO8A 5D1IA 1CAVB 4G4FA 4OI1A 4XURA 5A1FA 4AHZA 2PAKA 4AWDA 1UQXA 1S0IA 1MQTB 1AVBA 2DV9A 4JGZA 5FZAA 1Y9GA 2JDKA 4EYUA 2C24A 5L9VA 4LKFA 2CAVA 2YBSA 3B00A 3HR9A 1JOJA 1RUI1 4GB33 3QACA 3CHXA 5D2AA 3B93A 1D7PM 3LPGA 5HBAA 5J09A 1HJFA 1PVXA 4G9SB 1ND3C 4LO4B 5IAXA 1RGSA 5CBLA 4XCBA 1CONA 5FZLA 1Q8VA 4S2HA 2BQPA 4Y1VA 3VBHC 3VHPA 3UYJA 2ORXA 2HWB3 2VGDA 3ZDVA 3ZFEA 1WW5A 3WHTA 4BB3A 1RL3A 3D6EA 1DZQA 1PHMA 4QM9A 4XVHA 1A78A 1UOBA 4BQYA 5J3UA 1N1TA 2AACA 2P4EA 4BMBA 1KJLA 1RC6A 3SXWA 2NZ9A 2WNVC 1ACCA 2EVXA 1W3XA 5KHHA 1OOPB 4EN8B 1ZRFA 3U1XA 1HRI1 3ACFA 4YZ3A 4QD2A 2F4PA 3MIGA 2J42A 4KQ7A 3TWIA 4DY3A 1WLDA 1WW7A 2ARXA 1S2KA 3MHZA 1MS0A 3POIA 2FMDA 2TNFA 3OYWA 2Y0IA 4LE3A 4XF3A 4YVSA 5C4WB 5F5QA 2LTNA 1S0CA 1O6UA 5BNQA 4TN7A 2ID4A 4NN0A 2FQPA 1Q43A 1NKGA 4Q27A 3NNLA 4LOTA 3KQ4B 4BIFA 3NAPB 1HV1A 1OFNA 3V65A 1J3RA 3ZN4A 1WMXA 2WUHA 1PVC1 1OBNA 1W0OA 5FYHA 1JODA 2ET1A 3ENRA 5FBJA 1DCSA 5K7PA 3OGGA 4AVVA 3A0KA 5DAXA 5FZ7A 4UAPA 2QBXA 1ZVFA 3BALA 1GU3A 4HBNA 1VMFA 5C8CA 3LE0A 4E4ZA 1F5JA 1CIYA 2LRPA 3TBDA 5T5PA 1F5FA 2A3XA 5TSWA 2KR2A 4BM8A 1RUJ2 2WC2A 2VCMA 3B5LB 1RJ8A 2VQ0A 3AVSA 4ET7A 1OKQA 3MO4A 5AC93 4DY5A 4JRAA 3OPWA 1RMU1 1W6MA 2D44A 2DBNA 5EZWA 4BE3A 5IK5A 4FQ4A 4H14A 4UFJA 4PIXA 4LE4A 2NYYA 5F8PA 2VZSA 5FYCA 1BBT2 1FX5A 5BNOB 3DKWA 5FZ3A 2ZX2A 1UNBA 3WNNA 1OKOA 4EZ4A 1DYPA 4KGGA 1WBFA 4ZXEA 3VD5A 4GKYA 5DUVA 4CCDA 4MXVA 3CLPA 3KSCA 1RVF1 3CEWA 1DYKA 1ASJ3 2VZQA 2A6WA 1KFUL 1DGLA 2D6NA 5CNAA 4MZUA 4HOOA 4BLIA 1R1A3 3AXDA 4E4HA 3FMGA 3FUOA 3VZOA 3I2KA 3T0DA 3BVCA 5IAVA 3HQRA 1HB1A 3AYEA 3T1MA 1W99A 4DUVA 5I0TA 5BNPB 3AJZA 1DLCA 3NJVA 3SH5A 4XJUA 2ZGKA 3ZX7A 3ZFGC 1W9TA 2EXHA 4TSVA 4K8FA 2A7AA 3AKTA 5BNOA 4JTOA 4RS5C 4YM0A 5IVVA 5L7OA 2X5IC 4UT5A 3THTA 5HXMA 1B35A 5G05L 1YO8A 3QLQA 1RUJ3 4AI3A 1AYM3 1V9U3 3DEMA 2CTVA 5GLUA 1NXMA 3I3BA 4XACA 2OUJA 5FK8A 5I93A 1YQ6A 3ZMOA 1YUDA 2JG9C 4XDOA 1ULEA 1OUSA 4KNCA 2EAAA 4XTPA 1IGOA 4OCTA 3ZN5A 2ZTNA 3DECA 1PGW1 5A1AA 5BNPA 4AQTA 4Q4Y2 3H3ZA 2QQUA 2VZOA 2ADDA 3WUCA 2XG3A 2E7QA 4LBKA 4P9YA 3CNAA 5FP9A 1CR7A 1UMIA 1WBLA 2GN3A 2I45A 3LIHA 5FZGA 5K0UA 3VDCA 4B7KA 4AFMA 1GNHA 3T0BA 2B5HA 4LK6A 4IESA 4X8PA 1RMU3 1SFYA 1PM7A 5A3OA 2RDNA 1XYPA 3U11A 1HXS1 1ZRIA 2UWAA 2OX0A 2WSUA 1OMIA 3IDCB 4QX0A 4AI2A 4AK3A 2WNUA 4K20A 4UFHA 4MGQA 3ZR6A 1GSLA 4RQPC 1Y3TA 2ZA9A 1XYOA 4XILA 5F3EA 2H0VA 4Q4W3 3KLSA 1R1ZA 4YG3A 2MHFA 5I8SA 4C91A 4FPEA 5B2GB 2CU5A 2H6CA 2JDYA 3CF6E 2BVVA 3VKNA 4PBPA 4WM7B 5A3NA 1FAYA 5AC92 4JQTA 5FP3A 2R49A 1AF9A 1N3OA 1AYN2 2XJPA 5IWFA 2YHJA 2RS31 4WV8A 2HWF1 3KT4A 2IVJA 3OD4A 1YFYA 4PJYA 2EXJA 2GMMA 4OHXA 1CAUB 3KT1A 4YW1A 2WKKA 4PI2A 2I2SA 3MUZ1 2QFEA 4F3JA 2PMWB 3OGVA 2R073 5JXGA 1G9AA 2X53S 3AX4A 3I54A 1XU2A 2ZX1A 5I0SA 4BWOA 1QJEA 4FP3A 1US2A 2HJIA 2WA4A 5FYBA 4BDVB 3DYOA 4RGKA 1W04A 3I2IA 2CHHA 4IEUA 1AR91 4NIIA 4DMIA 3H8RA 3RI8A 1L7RA 2OUHA 1BVVA 4RYDA 5HV4A 1DQ6A 3DXTA 4XPVA 5JI9A 1P8JA 4JGZB 1O8PA 1EUTA 2DFBA 4XHXA 4YLZA 2BGCA 5FLHA 2C6SA 4PF5A 4CPBA 3TNPB 5GZFA 4I0BA 1CAVA 2VZTA 4Q0SA 1OOPA 3ABZA 3E97A 3I2HA 2JICA 4YZ4A 2V5DA 4LHLA 4NJ4A 4YW3A 1IPSA 3HQUA 4IE6A 4J25A 5ACA2 4KWKA 1R1A1 4N8MA 2QKDA 1YQ2A 1SBDA 2D3SA 5BNOC 1XNKA 1LGNA 2A5ZA 4L2NA 1YI7A 4BQ4A 5CG8A 1V6KA 4GIQA 2R1DA 1JMUB 2XBO3 4K3UA 4AVAA 4A4AA 3ZFFB 4XAAA 2J1RA 4YNIA 4YM2A 5CFCC 2MEV1 4MUVA 2JE8A 2VCCA 2VG9A 4N43A 3TRSB 5JDBA 1RUF1 3PNAA 5JLVA 2RMU2 1HKDA 1YYNA 2VUJA 4HK9A 4CEYC 5C71A 3V0AA 3IAPA 4R8HA 2GAUA 1QXJA 3GHNA 3UESA 2JENA 3SCHA 1OQDA 2EIBA 1W2NA 2Q5TA 4IGPA 4YVWA 4UFIA 3WDWA 3EO6A 3KHCA 1HX6A 1OQEA 2UWBA 3AZXA 1E5HA 5C9AC 4OI0A 2WWJA 1ND3B 3WW2A 3N4MA 4LUMA 3CU7A 1MZEA 3NAPC 4QQLA 3LCPA 2F17A 4LBQA 2BFUS 4GJYA 4KU8A 4EROA 4YSFA 1CX1A 1KFXL 2CYFA 3GALA 4O61A 1LHWA 5JIUA 1MS4A 3I3EA 3E6BA 3CJIA 1POV0 3PJQA 1IHMA 2P1BA 3D0JA 1XNBA 1MZ6A 1POQA 1IOAA 1CGPA 1FOD2 3ZR5A 1F4HA 3UKVA 1VBA1 3MV01 5GJ6A 1R082 4MHUA 5FZ8A 1COV2 4GWMA 2ZPXA 5IK8A 1W0NA 2D6LX 5EYYA 4A3XA 1CZSA 5FLJA 1D2QA 1MEC3 2DDUA 3VBSB 2ZOEB 4EWDA 5ABJC 1HV0A 4YM1A 2Y64A 4LHSA 1H8TA 4UW3A 4DEQA 5CADA 1CQ9A 3GF6A 1W9YA 2UU8A 1CPMA 5KXDA 1Z0HA 4CDWB 2RHPA 2DU1A 4XUTA 1N1SA 2E6VA 1LGCA 2P17A 2ZHMA 2MEV3 5B4XA 2A6YA 3ZXGA 5JPNB 2AENA 1OUXA 5H9RA 3VBUB 3CMGA 1RUF3 1W6MB 4W65A 1YEWA 1X8EA 1RUI2 3MLJA 4AVTA 2Q30A 1YIPA 5L36A 2JDNA 3ITQA 5T5LA 3WW4A 2FMYA 1QH6A 1B09A 1FI2A 1SDDB 4YFZA 4BQ5A 2RE9A 1L7LA 2VXJA 4LOSA 4I01A 3IWZA 5FMOS 2C5DA 2D7FA 3OUIA 4QGLA 3WF2A 2WO3A 2WZR3 3O1SA 2TEPA 4X6QB 2D93A 2B4KA 3KV6A 4Q4V2 2VTXA 3OBAA 1RUH2 2UWCA 3MF9A 3POJA 3BU7A 4NRPA 2OZ6A 5FLIA 2CSGA 5FPZA 4NE9A 2JG8C 4WM7A 2XJTA 4QWNA 3NV4A 1VRH3 1R1A2 2WQ4A 5LASA 4I3PA 4Z2AA 2VQAA 3GCXA 1WUVA 3NSTA 1W2OA 2O8OA 2E51A 5T3NA 2E33A 2W0XA 2DTYA 3ZXDA 5JSRA 1OC1A 2P5BA 4QKFA 5KHKA 1XQNA 5A7WA 1MVEA 2Y26A 1U5XA 3TN92 4FAGA 5JOXA 1TME1 3GGLA 5FPAA 4B1MA 5KHJA 4CU9A 1R64A 1LKNA 2WNEA 1YJLA 2EIGA 1VLNA 3PUQA 4HANA 4IE7A 4Y22B 1S4CA 4META 3NV3A 2RS32 4K1YA 4AVBA 3ZKYA 3RYPA 1CPNA 3GBGA 3WP5A 1EAH2 1NQJA 1IPKA 3DN7A 4SLIA 1CAUA 5DDJ2 1JYNA 2YROA 3VDDA 2I07B 2Y6KA 2ZGQA 5CU1A 5FP8A 4QX1A 1Q56A 5LATA 5C8CB 4JDMA 1BVP1 3T09A 4OQ8A 1IKPA 1G7YA 2Y6GA 2AEYA 5DG1A 2P3KA 3BPZA 3KV4A 3ZFEC 1ZZBA 2XQRA 3IMMA 4GWIA 4LITA 5F6KA 3PIJA 1NLRA 2R0HA 2B39A 1RUI3 4ZKTB 3LEIA 3N7MA 4AEMA 1GP4A 1B35B 3M3EA 3WZ1A 2SLIA 1OA4A 1OLRA 3ZN6B 1BK1A 1IZ3A 1LR5A 4NRQA 4YVSB 5C6CA 1LHUA 2W92A 4PIYA 1W8HA 2Q8EA 2XMLA 4IQPA 4H7MA 2RS12 5JI7A 4O65A 1WCUA 1MACA 1U5IA 2NP0A 3KM5A 1AJOA 4JTNA 5IVCA 1O4YA 2BDRA 2ARAA 3RMXA 3KB5A 4CCKA 2W91A 2JIJA 2X5IA 4CCCA 4A42A 5FYMA 4Q0PA 5A1LA 1WMDA 1KRIA 1IPJA 5JPMB 2FD8A 1ND2A 2D5FA 5C3SA 4M00A 2P34A 2OT7A 1TNFA 3I3QA 2V09A 5J36A 1GBGA 1A3KA 3VBRA 2VH9A 1SCRA 2RS11 3RFRA 2GZWA 3ZFEB 2W94A 2NM1A 2YUEA 4Q4Y1 1Y4WA 4XF4A 3HPNA 5EJZB 4CXYA 2R061 1AR92 3D0SA 5IUQA 3POBA 2CWSA 3CJXA 3ACGA 1WMEA 2C4XA 5BV6A 2D6KA 4FOYA 5IFPA 4M3CE 3MV11 3L9JT 1RUD1 2CGOA 1UKRA 3ZXFA 5I8YA 1VBB2 4QHZA 4LR4A 4QB6A 5KXBA 2WZPP 2W1WA 4E9KA 5DPNA 1H4GA 3VDAA 2D3RA 2WWUA 3J7MA 1GWLA 1ST8A 1OF4A 2WT2A 5A7QA 3RNSA 3NKGA 4NRMA 3R05A 5CVRA 3CZJA 3R4UA 4QGMA 2V72A 3PHMA 5IW0A 3W5MA 4AI8A 1W0PA 4N43C 5DG2A 4D6QA 2BUKA 2N7GA 4CDWA 1GFF2 3GZEA 4ZU4A 3CZUA 2YU2A 4CP9B 1RUD2 1REFA 4M3CA 3LD8A 4GA9A 4Z82A 1WWYA 2JDMA 3R4SA 4ZU5A 1ENRA 1SCSA 4YVWC 4IEWA 4Y1YA 2OXBA 5FUNA 3HOBA 3SQOA 4PQ9A 4CSWA 4E2QA 5AVPA 4KG0A 5DABA 3O14A 5LK5A 1UY2A 1YHFA 5C4WA 4EWEA 1MEC2 3FHAA 2GC2A 2DUQA 4GWNA 3TB0A 3Q8BA 4BPZA 3BCWA 1UY3A 2IFWA 3KS7A 3I3MA 3EB7A 2UY8A 1NT0A 4LKSA 4Y20B 3D8CA 4XCAA 3RQ0A 5HPOA 1GOHA 4ARXA 3AMHA 1OF3A 3OTFA 4I0WB 3AM2A 1XJAA 3FN9A 2CWMA 5ACA3 5FO7B 5CKNA 4CA9A 4PCRA 3I7DA 1Z7S3 3MICA 3EHKA 2XOMA 4O9EA 1UX7A 2RR11 4L99A 4MGZE 1X8MA 2EA7A 5L7OC 1G9FA 4PIZA 4XUNA 1F35A 5FZIA 3HVDA 3NKTA 4XXPA 1C3HA 1J84A 4ATEA 5BNNB 1UY0A 1OSGA 2CY6A 4AGRA 2UYBA 2AH2A 3PVBB 5A6YA 4EE2A 4NWVA 3ZDSA 4IV1B 1QJY1 1ZZ6A 3MFCA 5A3LA 1YJKA 1UMHA 4IE4A 1LOFC 1HRV3 3HNMA 4P02B 5E6HA 1I3HA 3VD7A 4XBNA 3MIDA 1AYM1 1V9U1 2RS52 3UETA 4D0QA 3OOXA 2J7MA 4GH4A 1SHWB 2FDKA 4AZZA 3IKWA 1UYXA 5DAWA 3VHOA 2MPFA 4AEJA 1JZ3A 4RR3B 4XBQA 1UXXX 1WD4A 2YFZA 1L3JA 4QPWA 2KXLA 4K40A 4I2OA 1UXZA 1XOYA 2A6VA 2ILMA 1NZIA 2J22A 2W9XA 2H0BA 3RI9A 5FXWA 4MOAA 1KEXA 4DXZA 3OUHA 1UZWA 3W9AA 5FYVA 2P6CA 1IQDC 2XH6A 3TYJA 5H9SA 4FPYA 3N7KA 1ZM1A 3JXSA 3INAA 3NW4A 5KHGA 4XHBA 3I2DA 1SQ4A 3HMYA 4CDWC 2EIEA 1SLTA 2JD9A 4GMP3 2X05A 5I8TA 1NA1B 1UAIA 1TMF1 1HLCA 1J1TA 1HQLA 1PVC2 3C2UA 1HJGA 4K1ZA 4MV2A 5ANQA 5C3OA 3L2HA 2W46A 2W2IA 1UZVA 3JUUA 2JX9A 1GNZA 4J1XA 1V0AA 3RVHA 3E6DA 1DZTA 5IATA 1D4M2 2RM22 2RS33 1W2TA 1KITA 5JOZA 2ARCA 1DYOA 1JS9A 3HJRA 4FT8A 4Z07A 4PDWB 4UF0A 3WQ7A 4FXGB 1ZBE2 1G9BA 4BQXA 2DVBA 1QJY3 4CUBA 3T4HB 2RG4A 2YMZA 2ZXQA 1I6XA 4RHV2 1YQ8A 5F37A 5KBFA 3TEZA 1CD3G 5A3TA 2RDQA 1AHSA 2R071 1ZZCA 1N1YA 3U0ZA 2BNMA 1CJDA 2CNAA 3KD4A 4UFMA 4BCUA 4TXWA 3BOWA 1MZFA 1XRUA 4QQHA 4QGNA 3ZIXA 3KWVA 1VJ2A 3DKQA 3PTYA 4MLOA 5LY2A 3DYMA 4AQ6A 4CDQB 3IIAA 5FPUA 1F31A 3M2MA 1NOVA 4XEZA 5FFOC 5KC5A 2IXCA 4HVQA 4JKMA 2XKPA 2VVEA 5C3RA 4DXSA 2E9QA 4N7UA 4CU8A 2ENRA 2RR13 4KGQA 1KGYA 4V2WA 3VKMA 4CDXA 5K0UB 2VW2A 1H8TB 4QKNA 4FPLA 3KCCA 2G4IA 4NWWA 3ZXJA 3C7OA 3CKHA 2HWD1 4AFCA 2L9LA 3HD8B 1FATA 1C8M1 4ZS3A 3USUA 3AYDA 4LA2A 1RXGA 2BGPA 4ARYA 3O1RA 2OZJA 5EXOA 3CL1A 1MS3A 1OLQA 4AI9A 3ORJA 3GM8A 4LTAA 3ZSLA 1BXHA 2K0GA 2RM21 4QHOA 4B4PA 3IBMA 5L7OB 1ZA4A 2O0OA 2B9UA 4WZCA 4XJ8A 1PVC3 1MS5A 1VMJA 1WCDJ 2J1UA 2Y33A 4XBLA 1A34A 4CXXA 4E27A 1UYPA 3IB3A 4Q0UA 3ON7A 4QAWA 2YY1A 1SPPA 4ZONA 2P37A 4AR2A 1BCXA 2VOXA 1UPIA 1YFWA 5JR7B 3WUDA 3FFQA 3VDDB 4P9XA 3ZYHA 5CKQA 5CFCB 2PHFA 2Z42A 1KDKA 1UL9A 3WDVA 2HWC1 2PA7A 2QQWA 1W2UA 2HH9A 4NVPA 2WNUC 3TOJA 4LBNA 2VZVA 1H4HA 3UKTA 4FQZA 1O5UA 3I2GA 1COV1 5AC91 3V0AB 3IDAA 2YPJA 2BOJA 3ACHA 4N43B 2GNMA 1G6NA 4LO7A 3VL9A 4Z2WA 2YB7A 1RITA 1BJQA 2RDSA 3PUAA 5FPBA 1VB4A 3H3LA 3B01A 1W28A 5JVVA 3KGLA 5FO8B 3L2YA 1V6OA 3CQOA 5GZGA 1RVF3 4FCAA 1ASJ1 3H1YA 5EWSA 3S7IA 3BIWE 2XJSA 1PMJX 1V70A 4BK5A 3IN9A 2BEOA 5A7NA 2A75A 4PLMA 2W95A 1URXA 3GYDA 3Q9OA 1L7QA 5F3CA 4OULA 2XJVA 2HWB2 4IERA 4Z92B 5E16A 1W39A 5HCAA 4NIHA 3JU9A 1H9WA 2Q4SA 4XF0A 3MW2A 1VBB1 5BY5A 1MS1A 4I0AA 1RUJ1 1Z7S2 1JW6A 1LOGA 2Y0OA 5BNNC 3HBZA 4CE8A 1DFQA 1RHI2 4Z8BA 1VBE3 3B7MA 5JOWA 4P9WA 1J1LA 4FOVA 3G6JB 3MW3A 5BUVA 3GCWA 3BGAA 3GBWA 1DGRA 4S2FA 5FZ9A 3AP4A 4BXFA 5JXHA 5E8AA 2VW1A 2EAKA 3AZVA 4FOWA 4QMAA 4HPKB 4YW7A 5A3PA 3QD6A 4YGEA 1SEFA 1LODA 3H8UA 4ASLA 3N9NA 1VBC2 3E1F1 3RYRA 3W5NA 4LBLA 1ZRCA 4FTBA 4NIDA 4A45A 1NCQC 4U2AA 2EICA 4WVVA 4KBBA 4COUA 5FK7A 4D7SA 1WZXA 2VNGA 5FY5A 4ZU7A 2JE9A 4F7ZA 1NY71 4NPLA 2HWD3 4D8MA 1AZDA 1YQCA 1GZTA 1OHFA 2XDVA 3ZPOA 1SZBA 3MGUA 1PGL2 2BNNA 4AQ2A 5EIYB 2D43A 1PZ8A 3O12A 5HCBA 3H1WA 5FZOA 3WNKA 5FV3A 1DZRA 5K4LA 4AF9A 1QOSA 5IVBA 5KC6A 1W6NA 3N7JA 2W47A 3FHIB 1JYWA 1GQGA 2JKBA 1XSQA 4FI9A 1UKGA 1C8NA 2VXRA 4LUKA 4CXWA 4HZFA 1CVNA 1PO21 2XJUA 1OLME 4ZY9A 5GZDA 4KU7A 5SV5A 1RUG1 4QPGA 4LBQB 5F5IA 1MQTA 1FT9A 2ETEA 3WDXA 1SFNA 3OEBA 4C90A 2QZ2A 2XUMA 2OPKA 2VNRA 1Y9MA 3D82A 2H6BA 4HLTA 4Q8KA 1VBB3 1DQ0A 2VO5A 3AZYA 3GZUC 3POWA 2WYSA 2E7AA 2EALA 3HN3A 3NQHA 3VZMA 1CAWA 3LF7A 2ZAAA 2VL4A 3IPVB 3A0NA 1RTVA 1LESA 3APBA 1NXD1 3MPPG 3ZFGB 2E26A 2PTMA 1U5ZA 1LOBA 1CX4A 1KQRA 1VP6A 4OFGA 4OI2A 4CPBD 5B4NA 4W50A 1S1AA 2XWJB 2DCJA 1X9TA 2ZGRA 5FOJB 3DCQA 5H9PA 5DMYA 3HT2A 3MYXA 5FZDA 2FDGA 1IQAA 4CUCA 3KV5A 2OKXA 1O91A 2W5FA 1CJPA 1T6BX 2XBO2 3CDZB 3POEA 4XQ4A 4B1LA 3PVEA 4CDQC 2XLAA 4RD7A 4HKOA 1ULPA 2R16A 2W39A 4BA6A 2DBIA 4NUBA 4OHVA 2XBO1 3LOIA 2DVDA 3NV2A 2VZ1A 3VD3A 3IDBB 3JB4C 5GZEA 3U78A 1M06G 2A3YA 5H9QA 3PUHA 2Y60A 1BYHA 4Q4Y3 2ZZQA 4NR1A 2ATFA 2LUWA 4R9DA 2R063 2WL1A 3T3YA 4J6GA 5FJKA 5JCTA 1SG3A 3ZLIA 5JR2A 1AR83 4KL1A 2HKXA 3GXUA 3POFA 2W68A 1UMZA 2HEWF 1RUD3 5J37A 2XWBB 3ZXKA 2VTFA 3RPQA 2V4VA 2Z5WA 2NMOA 3A22A 3VBFA 5IK4A 3ILNA 1VE0A 1GOFA 2FCVA 4DQAA 1X50A 2JG8A 4WM7C 2V73A 4P5YA 1BQPA 1EPZA 2XR4A 2QQPA 1C4RA 4CP0A 1S2EA 2PLV2 3FJSA 3WF0A 2ZHLA 3C7HA 3HT1A 1NCRC 3NV1A 1PNFA 4N53B 5DZEA 4HVOA 2HWF2 3NNGA 3AL6A 3BPSA 5D8AA 2JE7A 2XL7A 4W8JA 3SCGA 3PURA 1WA6X 3KF5A 5A7WB 1XU1A 4AQSA 4M0HA 1ULOA 2VZ3A 1NUKA 3VUOA 1AL23 4H7LA 4Q0VA 3LDRA 3RZLA 3QCWA 3RMYA 3BTYA 4NHXA 2VUCA 5A6ZA 2WNUB 1AX0A 4K7JA 4QXHA 1UPSA 5IK7A 1NCQB 4KMQA 2WLQA 5FR3A 1DF0A 1KJRA 1MPXA 3B94A 2WJSA 3TEXA 4C0HA 2DURA 3GDBA 1PO23 4CRQA 4IEYA 1Y9QA 2GC3A 2D5HA 2ZX4A 2GALA 4I3GA 4COVA 3BTZA 4IEVA 4BHPA 5F3GA 3P5BA 1G9DA 1NZCA 4QX8A 3T2TA 2QQNA 3MBWA 4ZHNA 4MADA 1AYM2 1V9U2 4Y1ZA 5KWRA 1Q8SA 4BISA 5A3UA 2WRAA 5J1XA 2BV4A 2FZ1A 3P3NA 4V2VA 1UD1A 4GULA 2WFF2 3VD9A 5LA1A 2WN2A 3A23A 2B8MA 2WYFA 4Q4X2 4RGGA 1BMV2 2W87A 1PIV2 4IXLA 3LIGA 2VMIA 1RUC3 3S5QA 1JYXA 4JKKA 1TME2 4LBJA 2KA3A 2Y6FA 3THCA 3P1IA 4B3NA 3SISA 3ZXEA 2HWE1 4CDXC 4MXWA 3K51A 1U0AA 2WINB 3KT7A 3VD4A 4PI0A 4MGYE 2HWC2 2HWE2 2FBEA 3SHRA 2RMU1 3BN6A 4B7EA 5FZ4A 5FP7A 4OMDA 4DRRA 2RV9A 1JOBA 1XSRA 3T2PA 3ALQA 2WT0A 1VBD2 4UW4A 2ZMKA 4R4XA 1WKYA 5T5OA 1V00A 5KXCA 1UW8A 4BLJA 1QNWA 4HVRA 4RQPB 2D6MA 5KXEA 3ZKUA 4CDUB 3WD5A 2WZEA 3AP6A 2VY0A 1C28A 4XTMA 5FJHA 4N90A 3C3VA 4XFIA 3WOGA 1K5MC 2Z4FA 4AEKA 5C9AA 3U75A 5LWBA 3RZKA 3KV9A 1RUH3 1IS3A 4MHRA 1X82A 4E8DA 4UFLA 1WW4A 1SFPA 4KG8A 2IXHA 1GQPA 2D6PA 2UY9A 1AL22 4GMP1 4EWAA 3ACIA 2IFRA 4QXKA 3D3AA 1PM4A 3AKQA 4Q1RA 3T2OA 3J8F2 5FUIA 4AE2A 2ZGUA 3I4IA 4MSVA 4BQ2A 3DPRC 1W8ZA 1CN1A 2J1SA 4LBQD 1ULFA 1UY1A 1WCQA 3OUJA 1SLIA 4OMCA 1JOPA 5FMDA 3UGHA 3AB0A 5DN2A 2ZGMA 4A44A 4YM3A 2B7YA 5CB7A 1ND3A 5FPVA 2GDFA 2R043 3A21A 1PIV1 2JEMA 1REEA 2D3PA 4JDOA 4WVMA 4A41A 4FBFA 4DRVA 2XUEA 1A8MA 1N3PA 4YGDA 3EQEA 1JYCA 5FMOL 4EV0A 1J83A 4GJZA 3FE5A 1RJ7A 1GQHA 2NN8A 4V1PA 5L73A 2ZGPA 4ISQA 2PQSA 1LRHA 1H2MA 1JUIA 2G19A 1GP5A 5FZ0A 1K5MB 4BQWA 3WV6A 3N9LA 3FC0A 3OYWB 5LK7B 4YFWA 4I30A 3VHNA 1W8FA 4LQRA 4UBGA 4COWA 3U4XA 1O3RA 5A3WA 2FHRA 1EV13 2WN3A 4PDWC 3E5XA 4OUSA 3O7OA 4ES8A 4XJ9A 2JWPA 5L19A 1LU1A 3ZFGA 4Q0QA 3IPVA 1SLBA 2LROA 3VBRC 1U12A 3MEPA 2XVKA 5FP4A 4JVAA 3OD0A 4A7ZA 4PHZA 4NHKA 2OA2A 2DF7A 1FXZA 2G1MA 3ZOIA 4YVSC 1OVSA 2E7TA 3AMNA 4YZ1A 1TQ5A 1C8M3 4WVMB 2VJXA 1UIJA 1SBFA 2HBTA 4NO4A 3K2OA 4HMZA 5DQ0A 3O5SA 3QOPA 1DLLA 5CIRA 2CV6A 5HCHA 1UX6A 2XONA 4RFT0 3V0BA 1FPN1 4HFSA 1ENSA 1QHDA 3NNMA 2R072 1UU5A 1RUC1 4TLGA 3J4UH 4HG6B 2ZEWA 4YG6A 4FOQA 3WNLA 1F4AA 2XQXA 1H2LA 4OHYA 5T5JA 2VMEA 3CJIC 3LA3A 1I9RA 1ZRRA 3R0RA 5CKMA 3USSA 5C33A 5FOBB 4CVUA 3EXUA 3KMHA 3OB8A 3RYKA 2GU9A 3ROUA 2R041 2UURA 2ZGLA 4HETA 5LCWL 4R4ZA 4HT1T 1CESA 3AP7A 5EPAA 3WINE 2P3JA 3HEIA 3BYWA 2DFCA 3DPRA 3GJAA 3K3OA 1HRV2 1W9WA 2FCTA 4KWLA 4NAOA 4NOTA 4RQPA 1QQP1 4W4ZA 4QDRA 4ASMB 3LFMA 2HWC3 4J1WA 3WDYA 2ZGTA 1W6PB 4NPRA 4CEWA 2Z2SB 4MO3M 1H2NA 3H7YA 4EJRA 3PUSA 4H3WA 3WP6A 2A73B 1QQP2 1AUYA 4XQDA 4D69A 1ZBA3 4AEDA 3ZM8A 2OVUA 2QE3A 2ZKLA 2XHKA 1GKBA 5ANNA 4BMEA 4XW3A 1QJU1 3U07A 1NCRB 2G9FA 1ALYA 1XYNA 2PYTA 2VPVA 4LEJA 2X10A 3WDUA 1JBCA 1QDCA 2G9ZA 4Y5TA 3CBNA 3MPBA 5FWEA 4QQ2A 1W6OB 1RXFA 1YFUA 4DUXA 4LMFA 5A3MA 4HL0A 4IGOA 5A6QA 1EV12 4MH0E 3VHRA 1QMJA 3VBSA 1LTEA 1RHI3 1AXYA 3NJXA 1AXZA 2PHRA 4YW6A 1ULCA 3ZYFA 2XJRA 4UW5A 1TVGA 1S0DA 4KWUA 1N3QA 5GLVA 3U14A 4WVZA 3E6CC 5J96B 2QQVA 3OGSA 2E63A 3B69A 1PIV3 1GMMA 3J9SA 3I49A 1K3IA 2VZUA 1BZWA 4GXLA 1OH3A 1C1LA 4LHNA 5FZ6A 1VIWB 3S5AA
chains in the Genus database with same CATH topology
2ZXQA 2QQJA 4ET7A 4DEVA 3MO4A 3A7QA 3OEAA 4KI5M 4QDSA 4TXWA 1OT5A 1H6YA 2VZSA 3DYMA 3FL7A 3WNNA 4ZXEA 3VD5A 2C9KA 4JKMA 2B9VA 2R7EB 4DXSA 4CU8A 1KGYA 2VZQA 4E8CA 2JKXA 2Y8KA 3C7OA 3CKHA 2L9LA 4GZ9A 3T0DA 3I2KA 1JI6A 1W99A 2BGPA 4DUVA 4ARYA 3HNYM 1DLCA 3NJVA 4OZOA 1W9TA 1GNYA 3DYPA 3WF3A 3GM8A 2W3JA 1JHJA 4QX3A 5HXMA 5G05L 3SEEA 2QQKA 2Y6JA 2J1UA 3I3BA 4JX0A 3IB3A 3K4ZA 3K46A 4QAWA 3OG2A 4TTGA 5A1AA 3DECA 2VZOA 1UMIA 3VDCA 1JZ7A 2VZVA 2E32A 3I97A 3T0BA 3I2GA 4ZZ8A 2DCKA 3IDAA 3WEZA 3MUY1 3ACHA 3I2JA 4QX0A 2YB7A 1NAEA 4MGQA 4XUQA 3LEGA 3CQOA 4DXRA 4M4PA 2VR4A 5JUVA 2X09A 1PMJX 4BK5A 1JZ6A 2VMCA 2W95A 1L7QA 2J1VA 1BHGA 2VMDA 4DXTA 3MUZ1 2WAOA 3OGVA 3WNPA 5JXGA 1DP0A 3AC0A 3WF4A 1US2A 2BGOA 4BDVB 3DYOA 3BGAA 3I2IA 2VC9A 5JXHA 5LA0A 1L7RA 3J7HA 4RYDA 4PT6A 1P8JA 1GOGA 1O8PA 3THDA 1EUTA 1I5PA 3E1F1 3W5NA 4QB1A 1NX9A 2WDBA 2QQOA 4A45A 2EICA 2VZTA 3ETPA 3ABZA 3I2HA 4QB2A 3K77A 1OD3A 2QQLA 2V5DA 1HN1A 2XHNA 4D8MA 1YQ2A 2WAAA 4MGSA 2VQTA 5EIYB 1XNTA 4A4AA 3WNKA 2J1RA 5I0DA 4P00B 2JE8A 2VCCA 1PMHX 2CDPA 2W47A 1JYWA 4FI9A 5C71A 3T0AA 2WABA 3IAPA 2BZDA 3UESA 3SKVA 4BXSV 4ZY9A 4QX2A 2EIBA 4XZUG 1UYZA 3SKJE 1TG7A 2LW8A 3C7FA 3OEBA 2QQIA 1W8NA 1CX1A 2VO5A 1US3A 2WYSA 1PX3A 3HN3A 3NQHA 3I3EA 3SEPA 2VL4A 1O8SA 2E26A 1GUIA 1F4HA 5B4NA 2RJ2A 3MV01 4W50A 5F7UA 2DCJA 3P6BA 2Y6LA 1W0NA 2W1SA 1CZSA 2DDUA 5DMYA 2Y64A 4LHSA 4DEQA 4OYUA 4CUCA 2YG0A 2OKXA 2W5FA 3CDZB 3T08A 4A6OA 4OUEA 1ULPA 5G04L 3U37A 4XUTA 4AAXA 3I3DA 4UI9L 2VZ1A 3VD3A 1RYYA 5B4XA 4A3ZA 3PUHA 2W1QA 3CMGA 5JR2A 1SG3A 3GXUA 2VTFA 2V4VA 1SDDB 2EIDA 3A22A 1OH4A 3K4AA 3WF2A 1GOFA 2WO3A 3HNBM 2B4KA 4XUOA 4P5YA 3OBAA 2VZRA 1JZ8A 4QDQA 3WF0A 3C7HA 3WF1A 1O59A 2YC2A 3WNOA 3NNGA 2HYXA 2E31A 5IHRA 2WBKA 5IFTA 4W8JA 4Z2AA 2YC4A 2ZEXA 1ULOA 2VZ3A 1NUKA 1CZTA 1PX4A 2E33A 4XUPA 5JXJA 1H6XA 3LQCA 4KMQA 2ZEYA 5IJRA 3GGLA 1MPXA 3IIIA 1R64A 4CU9A 1EUUA 3GDBA 2HLEA 4DUWA 4JKLA 2JDAA 4CU7A 3K4DA 5JXIA 3EYPA 2BBAA 3FHQA 1JYNA 1LNSA 2KD7A 2Y6KA 2QQNA 3T2QA 3MBWA 4QX1A 4MADA 3NRUA 3T09A 2J1AA 2Y6GA 5J1XA 3K75B 4GWIA 3VD9A 5LA1A 2WN2A 3A23A 2W87A 4PQQA 3LEIA 1JYXA 4JKKA 3IAQA 4GWJA 4UOJA 3THCA 3P1IA 1JZ4A 4ZZ5A 4BK4A 2BERA 2WO2A 3LEKA 3VD4A 2W92A 3BN6A 4OMDA 5LA2A 2W1UA 1CZVA 2RV9A 3T2PA 1UYYA 2W91A 3ECQA 5EJ1B 1WKYA 4A42A 2VQUA 3C7GA 2J1TA 3C8XA 2WZEA 1XPWA 2WO1A 3C7EA 2Z4FA 4CUAA 4E8DA 1XNAA 2W94A 1JYVA 1GQPA 2VZPA 3ACIA 2J1EA 2LS6A 5CZKA 3HPNA 5EJZB 3D3AA 3T2OA 5FUIA 3ACGA 2C4XA 5IFPA 3MV11 1K45A 2J1SA 1W8OA 4QB6A 1UY1A 1JU4A 1WCQA 4OMCA 2W1WA 5DN2A 5DPNA 3VDAA 4A44A 1OF4A 1W9SA 3A21A 3CZJA 4L0PA 4PF1A 2V72A 1JZ2A 3W5MA 4A41A 2VM9A 4BJ0A 5IYYA 2WQ8A 5CYYA 1J83A 2Y6HA 2YFUA 3CZUA 4M4RA 4IUGA 2VOTA 3WQBA 2VCBA 3WNMA 2PQSA 2CDOA 3HOBA 3WSOA 1UY2A 3FHAA 1UY4A 1UY3A 1XC6A 3EB7A 3PUIA 4LKSA 4AG4A 4LQRA 5HPOA 1GOHA 2WN3A 4ARXA 5C7GA 1OF3A 3FN9A 4P08A 2XOMA 1UWWA 1UX7A 2WZ8A 4XUNA 4XURA 1J84A 4JHZA 1UY0A 2RVAA 2VJXA 5DQ0A 2VMFA 2XONA 5C70A 1UMHA 3HNMA 5JMOA 4P02B 1D7PM 3LPGA 3VDBA 3VD7A 3F2ZA 4HG6B 2ZEWA 3WNLA 1F4AA 2XQXA 3UETA 4D0QA 2VMEA 2J7MA 1SHWB 4CVUA 1UYXA 2ORXA 3OB8A 3LPFA 5LCWL 1JZ3A 1UXXX 2YFZA 4QPWA 1UXZA 2J22A 3HEIA 1W9WA 2W9XA 4XVHA 4YPJA 2ZEZA 4W4ZA 4QDRA 4MOAA 1KEXA 1T2XA 4MO3M 1IQDC 3CIHA 3ZM8A 3JXSA 3ACFA 1JU3A 2X10A 2EIEA 2QQMA 4RN5A 1K42A 2JD9A 2X05A 2VCAA 4DUXA 2ID4A 2C26A 1NKGA 3UNPA 2W46A 3I2FA 3NJXA 2WUHA 4LPLA 1UZ0A 1TVGA 3OGRA 4KWUA 4CU6A 2ORZA 3OGSA 1DYOA 3HJRA 1GMMA 2QBXA 4UAPA 1GU3A 1K3IA 1JZ5A 1K12A 2VZUA 3LE0A 4CUBA 1CIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXQ A;  2QQJ A;  4ET7 A;  4DEV A;  3MO4 A;  3A7Q A;  3OEA A;  4KI5 M;  4QDS A;  4TXW A;  1OT5 A;  1H6Y A;  2VZS A;  3DYM A;  3FL7 A;  3WNN A;  4ZXE A;  3VD5 A;  2C9K A;  4JKM A;  2B9V A;  2R7E B;  4DXS A;  4CU8 A;  1KGY A;  2VZQ A;  4E8C A;  2JKX A;  2Y8K A;  3C7O A;  3CKH A;  2L9L A;  4GZ9 A;  3T0D A;  3I2K A;  1JI6 A;  1W99 A;  2BGP A;  4DUV A;  4ARY A;  3HNY M;  1DLC A;  3NJV A;  4OZO A;  1W9T A;  1GNY A;  3DYP A;  3WF3 A;  3GM8 A;  2W3J A;  1JHJ A;  4QX3 A;  5HXM A;  5G05 L;  3SEE A;  2QQK A;  2Y6J A;  2J1U A;  3I3B A;  4JX0 A;  3IB3 A;  3K4Z A;  3K46 A;  4QAW A;  3OG2 A;  4TTG A;  5A1A A;  3DEC A;  2VZO A;  1UMI A;  3VDC A;  1JZ7 A;  2VZV A;  2E32 A;  3I97 A;  3T0B A;  3I2G A;  4ZZ8 A;  2DCK A;  3IDA A;  3WEZ A;  3MUY 1;  3ACH A;  3I2J A;  4QX0 A;  2YB7 A;  1NAE A;  4MGQ A;  4XUQ A;  3LEG A;  3CQO A;  4DXR A;  4M4P A;  2VR4 A;  5JUV A;  2X09 A;  1PMJ X;  4BK5 A;  1JZ6 A;  2VMC A;  2W95 A;  1L7Q A;  2J1V A;  1BHG A;  2VMD A;  4DXT A;  3MUZ 1;  2WAO A;  3OGV A;  3WNP A;  5JXG A;  1DP0 A;  3AC0 A;  3WF4 A;  1US2 A;  2BGO A;  4BDV B;  3DYO A;  3BGA A;  3I2I A;  2VC9 A;  5JXH A;  5LA0 A;  1L7R A;  3J7H A;  4RYD A;  4PT6 A;  1P8J A;  1GOG A;  1O8P A;  3THD A;  1EUT A;  1I5P A;  3E1F 1;  3W5N A;  4QB1 A;  1NX9 A;  2WDB A;  2QQO A;  4A45 A;  2EIC A;  2VZT A;  3ETP A;  3ABZ A;  3I2H A;  4QB2 A;  3K77 A;  1OD3 A;  2QQL A;  2V5D A;  1HN1 A;  2XHN A;  4D8M A;  1YQ2 A;  2WAA A;  4MGS A;  2VQT A;  5EIY B;  1XNT A;  4A4A A;  3WNK A;  2J1R A;  5I0D A;  4P00 B;  2JE8 A;  2VCC A;  1PMH X;  2CDP A;  2W47 A;  1JYW A;  4FI9 A;  5C71 A;  3T0A A;  2WAB A;  3IAP A;  2BZD A;  3UES A;  3SKV A;  4BXS V;  4ZY9 A;  4QX2 A;  2EIB A;  4XZU G;  1UYZ A;  3SKJ E;  1TG7 A;  2LW8 A;  3C7F A;  3OEB A;  2QQI A;  1W8N A;  1CX1 A;  2VO5 A;  1US3 A;  2WYS A;  1PX3 A;  3HN3 A;  3NQH A;  3I3E A;  3SEP A;  2VL4 A;  1O8S A;  2E26 A;  1GUI A;  1F4H A;  5B4N A;  2RJ2 A;  3MV0 1;  4W50 A;  5F7U A;  2DCJ A;  3P6B A;  2Y6L A;  1W0N A;  2W1S A;  1CZS A;  2DDU A;  5DMY A;  2Y64 A;  4LHS A;  4DEQ A;  4OYU A;  4CUC A;  2YG0 A;  2OKX A;  2W5F A;  3CDZ B;  3T08 A;  4A6O A;  4OUE A;  1ULP A;  5G04 L;  3U37 A;  4XUT A;  4AAX A;  3I3D A;  4UI9 L;  2VZ1 A;  3VD3 A;  1RYY A;  5B4X A;  4A3Z A;  3PUH A;  2W1Q A;  3CMG A;  5JR2 A;  1SG3 A;  3GXU A;  2VTF A;  2V4V A;  1SDD B;  2EID A;  3A22 A;  1OH4 A;  3K4A A;  3WF2 A;  1GOF A;  2WO3 A;  3HNB M;  2B4K A;  4XUO A;  4P5Y A;  3OBA A;  2VZR A;  1JZ8 A;  4QDQ A;  3WF0 A;  3C7H A;  3WF1 A;  1O59 A;  2YC2 A;  3WNO A;  3NNG A;  2HYX A;  2E31 A;  5IHR A;  2WBK A;  5IFT A;  4W8J A;  4Z2A A;  2YC4 A;  2ZEX A;  1ULO A;  2VZ3 A;  1NUK A;  1CZT A;  1PX4 A;  2E33 A;  4XUP A;  5JXJ A;  1H6X A;  3LQC A;  4KMQ A;  2ZEY A;  5IJR A;  3GGL A;  1MPX A;  3III A;  1R64 A;  4CU9 A;  1EUU A;  3GDB A;  2HLE A;  4DUW A;  4JKL A;  2JDA A;  4CU7 A;  3K4D A;  5JXI A;  3EYP A;  2BBA A;  3FHQ A;  1JYN A;  1LNS A;  2KD7 A;  2Y6K A;  2QQN A;  3T2Q A;  3MBW A;  4QX1 A;  4MAD A;  3NRU A;  3T09 A;  2J1A A;  2Y6G A;  5J1X A;  3K75 B;  4GWI A;  3VD9 A;  5LA1 A;  2WN2 A;  3A23 A;  2W87 A;  4PQQ A;  3LEI A;  1JYX A;  4JKK A;  3IAQ A;  4GWJ A;  4UOJ A;  3THC A;  3P1I A;  1JZ4 A;  4ZZ5 A;  4BK4 A;  2BER A;  2WO2 A;  3LEK A;  3VD4 A;  2W92 A;  3BN6 A;  4OMD A;  5LA2 A;  2W1U A;  1CZV A;  2RV9 A;  3T2P A;  1UYY A;  2W91 A;  3ECQ A;  5EJ1 B;  1WKY A;  4A42 A;  2VQU A;  3C7G A;  2J1T A;  3C8X A;  2WZE A;  1XPW A;  2WO1 A;  3C7E A;  2Z4F A;  4CUA A;  4E8D A;  1XNA A;  2W94 A;  1JYV A;  1GQP A;  2VZP A;  3ACI A;  2J1E A;  2LS6 A;  5CZK A;  3HPN A;  5EJZ B;  3D3A A;  3T2O A;  5FUI A;  3ACG A;  2C4X A;  5IFP A;  3MV1 1;  1K45 A;  2J1S A;  1W8O A;  4QB6 A;  1UY1 A;  1JU4 A;  1WCQ A;  4OMC A;  2W1W A;  5DN2 A;  5DPN A;  3VDA A;  4A44 A;  1OF4 A;  1W9S A;  3A21 A;  3CZJ A;  4L0P A;  4PF1 A;  2V72 A;  1JZ2 A;  3W5M A;  4A41 A;  2VM9 A;  4BJ0 A;  5IYY A;  2WQ8 A;  5CYY A;  1J83 A;  2Y6H A;  2YFU A;  3CZU A;  4M4R A;  4IUG A;  2VOT A;  3WQB A;  2VCB A;  3WNM A;  2PQS A;  2CDO A;  3HOB A;  3WSO A;  1UY2 A;  3FHA A;  1UY4 A;  1UY3 A;  1XC6 A;  3EB7 A;  3PUI A;  4LKS A;  4AG4 A;  4LQR A;  5HPO A;  1GOH A;  2WN3 A;  4ARX A;  5C7G A;  1OF3 A;  3FN9 A;  4P08 A;  2XOM A;  1UWW A;  1UX7 A;  2WZ8 A;  4XUN A;  4XUR A;  1J84 A;  4JHZ A;  1UY0 A;  2RVA A;  2VJX A;  5DQ0 A;  2VMF A;  2XON A;  5C70 A;  1UMH A;  3HNM A;  5JMO A;  4P02 B;  1D7P M;  3LPG A;  3VDB A;  3VD7 A;  3F2Z A;  4HG6 B;  2ZEW A;  3WNL A;  1F4A A;  2XQX A;  3UET A;  4D0Q A;  2VME A;  2J7M A;  1SHW B;  4CVU A;  1UYX A;  2ORX A;  3OB8 A;  3LPF A;  5LCW L;  1JZ3 A;  1UXX X;  2YFZ A;  4QPW A;  1UXZ A;  2J22 A;  3HEI A;  1W9W A;  2W9X A;  4XVH A;  4YPJ A;  2ZEZ A;  4W4Z A;  4QDR A;  4MOA A;  1KEX A;  1T2X A;  4MO3 M;  1IQD C;  3CIH A;  3ZM8 A;  3JXS A;  3ACF A;  1JU3 A;  2X10 A;  2EIE A;  2QQM A;  4RN5 A;  1K42 A;  2JD9 A;  2X05 A;  2VCA A;  4DUX A;  2ID4 A;  2C26 A;  1NKG A;  3UNP A;  2W46 A;  3I2F A;  3NJX A;  2WUH A;  4LPL A;  1UZ0 A;  1TVG A;  3OGR A;  4KWU A;  4CU6 A;  2ORZ A;  3OGS A;  1DYO A;  3HJR A;  1GMM A;  2QBX A;  4UAP A;  1GU3 A;  1K3I A;  1JZ5 A;  1K12 A;  2VZU A;  3LE0 A;  4CUB A;  1CIY A; 
#chains in the Genus database with same CATH topology
 4H55 A;  4C1X A;  2VMG A;  1PZ9 A;  2JJ6 A;  3M3I A;  5F39 A;  2QQJ A;  4RS5 B;  3VBH A;  1OXC A;  3WG2 A;  2PHU A;  3A7Q A;  4CZS A;  1VBC 1;  3OEA A;  4KI5 M;  3I8T A;  1EYB A;  2XGX A;  4LBM A;  2OQ6 A;  5A32 B;  4BYY A;  1IKQ A;  5K8S A;  3JQW A;  4YZ2 A;  1V6N A;  3DXU A;  1BBT 3;  3FL7 A;  3THP A;  4AHW A;  3RJ2 X;  2DYC A;  5DZG A;  5FXV A;  1H1M A;  5FY8 A;  2C9K A;  3NMB A;  3H1M A;  4LIU A;  3MIB A;  4EN0 A;  3AP9 A;  2B9V A;  1ASJ 2;  2R30 A;  1GZW A;  3AP5 A;  4JGY A;  1QJF A;  2OII A;  4S2G A;  1FNY A;  1YIF A;  2JKX A;  1WD3 A;  1QEX A;  1ZBA 1;  2Y8K A;  2ZAC A;  5FZM A;  2G9G A;  5I0U A;  4E4D X;  1EP0 A;  4GZ9 A;  1ENX A;  4RSU A;  1QKQ A;  4IEX A;  5IT6 A;  1O3T A;  1QOO A;  1F9K A;  1DG6 A;  4OZO A;  5E1R A;  3ZYP A;  2VUL A;  3AMP A;  1TMF 3;  1GNY A;  3DYP A;  3FX3 A;  4NHL A;  2W3J A;  2VOW A;  1LU2 A;  1PNG A;  4JC1 A;  4FFH A;  2QTW B;  3SEE A;  1RHI 1;  1N47 A;  2QQK A;  2Y6J A;  1UOJ A;  4FPO B;  4JX0 A;  3N36 A;  1POV 3;  3JZV A;  2VE1 A;  1X9P A;  1RUG 3;  3K4Z A;  1UU6 A;  3NNJ A;  4TWT A;  4FFF A;  5F5C A;  4CP2 A;  1JUH A;  5FXZ A;  2Q0A A;  2GH8 A;  5L9B A;  3S6P A;  3S30 A;  4TTG A;  3UK9 A;  1RUF 2;  1LOE A;  5ISL A;  3KQR A;  2Q8C A;  3DL3 A;  2FCU A;  2JDU A;  1QQP 3;  3WW3 A;  2MEV 2;  4XC9 A;  2K46 A;  4COY A;  1ZZ7 A;  2FDF A;  2ARE A;  1JZ7 A;  1SAC A;  2E32 A;  3I97 A;  5FYS A;  3SNM A;  4ZZ8 A;  2DCK A;  2VVF A;  2CAU A;  4JGY B;  3WEZ A;  5E88 A;  5CG9 A;  3MUY 1;  1SLC A;  5IVJ A;  1O3S A;  3ZSE A;  1W6O A;  3LKJ A;  3D5O A;  1BBT 1;  4CCM A;  4PLO A;  4HKW A;  1AX2 A;  3LAG A;  4O9G A;  2GP3 A;  3ETQ A;  5IVY A;  1S0J A;  3N9P A;  5T52 A;  2DUP A;  4DXR A;  5HV0 A;  2WNV A;  2YPD A;  1LED A;  3AXE A;  2SBA A;  4M4P A;  2VR4 A;  4Q29 A;  4XIO A;  4S2D A;  4D7Y A;  4XMA A;  1FOD 3;  1JZ6 A;  1JYT A;  4K6B A;  3QBQ A;  2WLP A;  2F4L A;  3U10 A;  3AKS A;  4LNV A;  1J59 A;  3RGB A;  4AAP A;  4CEY A;  1QJX 3;  1KS5 A;  2NMN A;  3DPR B;  1OUR A;  2OQ7 A;  1B35 C;  4IL7 A;  1YWK A;  2V4A A;  1FMD 2;  3AZW A;  2WFP A;  1O7F A;  2B42 B;  2E53 A;  3BOP A;  3N9M A;  4XAE A;  4FAH A;  4DXT A;  1YCI A;  2VUD A;  3KVA A;  2RM2 3;  2BOI A;  2FZ2 A;  2WAO A;  1D0H A;  3JD7 3;  5DAV A;  3WXP A;  2VMH A;  1DP0 A;  4GH4 C;  1AR8 1;  5FQ0 A;  1WLC A;  2WS9 3;  1ZYB A;  1NCQ A;  5FZK A;  5LA0 A;  3J7H A;  2VOV A;  1I1E A;  5FY9 A;  1EY2 A;  1HW5 A;  3M70 A;  4CUG A;  1GOG A;  2YC0 A;  4WM8 C;  4IE0 A;  1XND A;  2VOK A;  5GAL A;  1FV3 A;  1NX9 A;  2BVB A;  3DGT A;  4RA0 A;  2WDB A;  4NRO A;  3WQ1 A;  3BTX A;  3VBO C;  3K77 A;  5EP9 A;  2QQL A;  1Y7B A;  1COV 3;  2F6B A;  3MIE A;  4U36 A;  4XQW A;  1HN1 A;  2XHN A;  1IS5 A;  3BKZ A;  2IUW A;  2HWD 2;  3D4K A;  1HXS 2;  3JQX A;  2JG8 B;  1QOT A;  5JMC A;  5APA A;  3WDT A;  3VKF C;  3OSD A;  1PZ7 A;  5AFE A;  3T4V A;  1GLH A;  3KVB A;  5BPX A;  2JDH A;  1PMH X;  1BEV 2;  3SMH A;  2CDP A;  3KF3 A;  2Z69 A;  1PGW 2;  3W21 A;  2YV8 A;  4DO0 A;  3O1V A;  2PHW A;  2WT1 A;  2WAB A;  2JG9 B;  4FSJ A;  4L92 A;  3SKV A;  4BXS V;  1JH5 A;  4XZU G;  1AX1 A;  1UYZ A;  5FIX A;  4HN1 A;  2AEZ A;  5LBC A;  3SIT A;  1AYN 3;  4QT6 A;  1M4W A;  4XAB A;  5F5A A;  3KCX A;  4XJA A;  4XET A;  2QDN A;  4JGZ C;  1W8N A;  2O1Q A;  1UZZ A;  4LLO A;  1ODM A;  1QNY A;  5FTT C;  1OFS A;  3GHM A;  3ZPY A;  5JZG B;  1PO1 1;  3J26 N;  2VUA A;  3S7E A;  1A8D A;  4JGY C;  3JD7 1;  5FCC A;  5CA6 A;  1NLQ A;  4NPM A;  1DU3 D;  1NE6 A;  2PEL A;  1VBE 1;  4DNY A;  3JBG 1;  2YGL A;  1QJX 2;  1Q8O A;  4H2A A;  5FZC A;  1XXN A;  1YXW A;  1A6C A;  5DUX A;  2OPW A;  2HWE 3;  2IVI B;  2RJ2 A;  4IET A;  5F7U A;  2IXK A;  3B02 A;  3P6B A;  2Y6L A;  3PVN A;  4AI1 A;  4QM8 A;  2RMU 3;  2VVD A;  5F2W A;  4JZR A;  3RWK X;  1MZ5 A;  1BEV 3;  2ZZJ A;  3RJR A;  4CDU A;  1W05 A;  2BRT A;  4XYX A;  5FYT A;  1HQW A;  2BNO A;  3WP3 A;  2PHD A;  1XE7 A;  1AR7 2;  3AZZ A;  5JSP A;  3WP4 A;  2YBP A;  3T08 A;  4A6O A;  4QPI B;  1RMU 2;  5CFC A;  5G04 L;  1VAL A;  2EXK A;  1VAV A;  3RRD A;  4AAX A;  5FUP A;  5FDB A;  1PK6 B;  4WM8 A;  3KZ4 C;  4L97 A;  4R52 A;  1R09 1;  4YW5 A;  4XFB A;  5CFD C;  1RYY A;  5BYN A;  1WLT A;  2GMP A;  5JAX A;  4A3Z A;  1W90 A;  4B4R A;  4I09 A;  1O3Q A;  3VKL A;  4P9G A;  1HRI 2;  3LB9 A;  2C1F A;  2TBV A;  3PJY A;  5GLW A;  3UT0 A;  3ZSM A;  2RJL A;  3FBY A;  4RR3 C;  3AKR A;  1FPN 2;  1D0G A;  4FPH A;  3BIE A;  1OD5 A;  5SV8 A;  3VB9 A;  2WFF 3;  1E5R A;  4XDP A;  1U5Y A;  4E2S A;  4P9I A;  1OH4 A;  3N35 A;  1QGL A;  2V5Y A;  3ELN A;  4M3C F;  5CEH A;  3AVR A;  3HNB M;  5FZO B;  1DHK B;  2LM3 A;  2R6Q A;  1HQN A;  2W08 A;  2R0F A;  3BTA A;  4FO9 A;  2R04 2;  1N1V A;  1JZ8 A;  5F1R A;  3USU B;  4URA A;  2DU0 A;  5KHI A;  4C8D A;  3WF1 A;  1ND2 B;  5DDJ 1;  1O59 A;  2YC2 A;  4N9I A;  1DGW X;  3LSE A;  3GZA A;  1RED A;  2WBK A;  1UU4 A;  4K9S A;  2GN7 A;  3FLT A;  4BZ4 A;  3ZFF C;  4E4S A;  1TNR A;  2QDR A;  3KCY A;  3WLU A;  2FDI A;  4Q4V 3;  2X8K A;  1PK6 C;  2YC4 A;  2ZEX A;  1KS4 A;  3ZYB A;  4GD4 A;  3OY8 B;  4XMI A;  1JHN A;  5DAQ A;  2Q8D A;  1EPW A;  3WG3 A;  4CYD A;  1R08 1;  3ZVX A;  1H8T C;  1S2B A;  3NJZ A;  2DCT A;  5F32 A;  4UW6 A;  4AFB A;  3O0X A;  5IJR A;  5EYX A;  2PAM A;  1BEV 1;  4RHV 1;  1EUU A;  2WQZ C;  3W20 A;  2HLE A;  5LBF A;  3VN4 A;  3ZN6 A;  1H8V A;  5JSO A;  2ERF A;  2BPA 2;  3K4D A;  4WZF A;  2PHT A;  4Q2F A;  2MNG A;  1AR6 3;  4BIO A;  5JXI A;  3LA2 A;  3EYP A;  3M7A A;  5FBZ A;  4D6S A;  2BBA A;  1RUG 2;  5DXD A;  1J3P A;  1LNS A;  2KD7 A;  2NLR A;  3HAG A;  1G8W A;  1D2S A;  4Q1P A;  4LKE A;  1Y43 B;  4AVC A;  3NL1 A;  3K75 B;  5LBE A;  2AUY A;  1SMV A;  4C0B A;  1FPN 3;  3K48 A;  4PQQ A;  1W6Q A;  2ZS6 B;  1AR6 2;  3ZYG A;  1D4M 3;  2C0Z A;  4ATF A;  4GWJ A;  4OLL A;  2OS2 A;  4ORF A;  3J7N A;  2PXJ A;  4HON A;  5FKC A;  2QZ3 A;  4BK4 A;  3B9C A;  4IV3 C;  4BQ3 A;  2EXI A;  1QXP A;  2P6H A;  1QY4 A;  2WO2 A;  3LEK A;  4IEP A;  1VR3 A;  3W58 A;  4AHX A;  3EMR A;  3VBS C;  4D3W A;  5ABJ B;  3WX5 A;  2BW8 A;  2O8Q A;  5FO9 B;  3PVO A;  5D8A C;  5A33 A;  4A6S A;  4NIG A;  1X33 A;  2W1U A;  1S0B A;  3K3N A;  1CZV A;  4G3Y C;  5DUW A;  4FPG A;  4YAR A;  4YZ5 A;  5FYY A;  3ECQ A;  1F2N A;  2XL9 A;  1OI6 A;  1H1I A;  2VW0 A;  2VQU A;  2XLG A;  4AVS A;  2J1T A;  4D94 A;  3AKP A;  3PL0 A;  1AR7 1;  1MS9 A;  2DCY A;  4Q8L A;  3C8X A;  5CFD B;  3O1P A;  3H3U A;  5JIA A;  1QH7 A;  1AL2 1;  1K5J A;  1F15 A;  3UL2 A;  1QWR A;  3GNE A;  3VBO B;  1TZO A;  2GND A;  3PTR B;  2GP5 A;  3J8F 1;  2HEY F;  2QNK A;  3LZZ A;  5FAX A;  3UJQ A;  4P9J A;  1LUL A;  1RUN A;  2GC0 A;  1BKZ A;  2DVA A;  4UFK A;  5A32 A;  4LOR A;  5CZK A;  4RHV 3;  2FDH A;  1BLZ A;  4GB3 1;  1ULG A;  1ZRD A;  1WLW A;  2WFF 1;  2K9Z A;  4QPI C;  2HBU A;  1JXN A;  3IDE A;  3PU3 A;  4RS5 A;  1LOF A;  3VDD C;  1AR6 1;  4YGB A;  3ILR A;  2ZHN A;  3ZXA C;  1JU4 A;  3VZL A;  3HQX A;  1UIK A;  5A7P A;  3VBU A;  2DVG A;  3W59 A;  3OCP A;  3PDQ A;  4KH9 A;  1NG0 A;  1PO1 2;  4L0P A;  1JZ2 A;  2XLF A;  2VM9 A;  5FY4 A;  1GV9 A;  4LHK A;  2P3I A;  2DWR A;  2ZMN A;  4BU2 A;  4D7T A;  4IV1 C;  4L11 A;  3VGI A;  1H0B A;  1UF2 C;  5BNP C;  1PGL 1;  5LW9 A;  4OI4 A;  4DPN A;  4IUG A;  4QKD A;  4XF9 A;  3E5Q A;  3AK0 A;  2VOT A;  3WQB A;  1D4M 1;  2VCB A;  5FRE A;  2XPJ A;  3H7J A;  2CDO A;  2D6O X;  2YU1 A;  2QCS B;  5K0U C;  2R06 2;  1VBC 3;  3Q8E A;  3WSO A;  1O4T A;  1W3V A;  4ZXK A;  4XE9 A;  1HRI 3;  1XC6 A;  1W8U A;  4FFG A;  1PMI A;  1R08 3;  4AG4 A;  1YNA A;  3O1T A;  3ATG A;  2B45 X;  1D4V B;  4XFH A;  5AVA A;  1QJZ A;  4MG2 A;  2VBD A;  3F95 A;  4YYO A;  1OA3 A;  1LOC A;  2EF6 A;  1UWW A;  3FFZ A;  2ZX0 A;  1DIW A;  3MIF A;  4CP9 A;  4XFG A;  3O0W A;  1VPH A;  2GH2 A;  4Q4X 1;  1BMV 1;  1S0E A;  2AGS A;  4FXK B;  4AW7 A;  1Q8P A;  1Q5O A;  5JZG A;  2PHX A;  5LEJ A;  4FPK A;  4YW4 A;  1R09 2;  2Z79 A;  4JHZ A;  3H50 A;  2RVA A;  1MQT C;  1RUH 1;  4OHZ A;  1J58 A;  2RS5 3;  3J8F 3;  2VMF A;  1O4Z A;  3POY A;  1E5S A;  1UOF A;  5C70 A;  5FQ0 B;  1TE1 B;  1VBD 1;  4FPF A;  4O7X A;  5FZH A;  5JMO A;  1Q3E A;  4LO5 B;  2BYV E;  5LRS A;  3VDB A;  3NWK A;  2CL2 A;  3BB6 A;  3F2Z A;  4AGV A;  4N7I A;  1WGP A;  1RVF 2;  3IT8 A;  4GAL A;  1C5H A;  2AZ5 A;  2XVL A;  1IG3 A;  3ME2 A;  4LK7 A;  4XJZ A;  3JCI A;  3MI8 A;  4P14 A;  2GNT A;  1VMH A;  3AFK A;  5F6L B;  1LEC A;  3IM0 A;  2BJS A;  3Q8C A;  3LPF A;  1AJK A;  5T54 A;  5LB6 A;  3ZMN A;  1JN2 P;  3GBF A;  2ARB A;  2XXZ A;  3JBG 2;  1WW6 A;  4Y24 A;  2DCZ A;  4YPJ A;  2ZEZ A;  4AED B;  1X7N A;  3RDI A;  1T2X A;  1GZ9 A;  5AFB A;  2WNV B;  2X5I B;  4XFF A;  5EHD A;  2XKO A;  4IEZ A;  1OOP C;  4JV4 A;  3CIH A;  4Q4W 2;  4WVW A;  1C8M 2;  3HWJ A;  4LLF A;  1JU3 A;  3KHB A;  5IVE A;  1RUC 2;  4HK8 A;  4OHW A;  4HPK A;  5C3Q A;  1VAK A;  3LFI A;  5KR7 A;  1CWP A;  2QQM A;  2YXS A;  4RN5 A;  1K42 A;  1EV1 1;  3UGG A;  5GLZ A;  1UOG A;  2VCA A;  4M01 A;  5LY1 A;  5I0R A;  1GP6 A;  3FLR A;  1ZA7 A;  1ZZ8 A;  3RZM A;  2C26 A;  4F8A A;  3G7D A;  3UNP A;  1VBA 2;  1V6I A;  4IND A;  1VBE 2;  2A6X A;  3I2F A;  3WHU A;  4IV3 A;  4LPL A;  1UZ0 A;  3OGR A;  3NNF A;  1DGR N;  5HXV A;  2ADE A;  4CU6 A;  2ORZ A;  5HCF A;  4IV1 A;  4COZ A;  4B4Q A;  3DUI A;  3WT3 A;  5FY1 A;  1QU0 A;  5FY0 A;  1JZ5 A;  1S0G A;  1K12 A;  2ZGS A;  3I59 B;  1OQ1 A;  3V56 A;  3LSD A;  2ZKN A;  4QQP A;  3VBF B;  2LAL A;  2DUO A;  2R1B A;  3TEY A;  3TAY A;  5EJ3 A;  4MYE A;  4CDU C;  1DQ1 A;  2RR1 2;  2WS9 2;  1MS8 A;  5FYI A;  1MVQ A;  4DEV A;  4Y22 A;  5JOY A;  5D21 A;  4JAA A;  1TMF 2;  5C8C C;  1SDW A;  4QDS A;  4RL7 A;  2WS9 1;  4JHT A;  1OT5 A;  1H6Y A;  3OBT A;  4Y3O A;  4Y20 A;  2PN5 A;  2WA3 A;  1LJ7 A;  2RJK A;  3FBM A;  4LKD A;  4AGG A;  3LOB A;  5FWJ A;  3AMQ A;  1GWM A;  4LA3 A;  5FMC A;  5C9A B;  4Q4W 1;  5CFD A;  4QPI A;  1LHO A;  2R7E B;  1GYK A;  2YBK A;  4CCL A;  1NQD A;  4GKX A;  1LOA A;  1IS6 A;  1I5Z A;  1RUE 2;  4E8C A;  4Y4Y A;  1UZY A;  3SH4 A;  3EBR A;  1VRH 2;  4YG0 A;  4L9B A;  2HWF 3;  1QJU 3;  1JI6 A;  1QF3 A;  2RS5 1;  5K9Y A;  3OPT A;  4CTE A;  2A71 A;  3HNY M;  4QPG C;  2JXA A;  4CCJ A;  1OLM A;  3VBF C;  5CAZ A;  1GWK A;  2ZHK A;  1VB2 A;  1VBD 3;  2QJV A;  3WF3 A;  2JDP A;  2WSV A;  1JHJ A;  1GIC A;  4YWA A;  4QX3 A;  2JDZ A;  3S0M A;  1H1A A;  2VBP A;  2VBB A;  4NAM A;  4OVE A;  4A7Y A;  4MX3 A;  1W6Q B;  1YFX A;  1QJY 2;  4FFI A;  3K46 A;  3I59 A;  3OG2 A;  2YGM A;  4OUM A;  5DAP A;  3BU0 A;  3VBR B;  4PDW A;  4UF0 B;  3VZN A;  2D40 A;  5A80 A;  3FUQ A;  1ZNP A;  4K21 A;  2JIG A;  4IV3 B;  3O1O A;  3SCF A;  4CDX B;  1W06 A;  2ZGN A;  2OYZ A;  2W52 A;  3GJB A;  4ZPI A;  1NY7 2;  1G86 A;  2JG9 A;  4FPC A;  4BQ1 A;  4N9H A;  3JBG 3;  4R9B A;  5IVF A;  5A6X A;  5GKA C;  1W9F A;  3I2J A;  5EV7 A;  4HKL A;  5FYZ A;  4CDQ A;  1EAH 3;  3Q8A A;  4GMP 0;  3AYC A;  1NAE A;  4LUL A;  1ONA A;  3O0V A;  3MLL A;  3ZSK A;  4IE5 A;  3M3O A;  3RZG A;  2BBV A;  4AFA A;  3N7L A;  3WW1 A;  1HB3 A;  1KXG A;  1ZBA 2;  4XUQ A;  4HN0 A;  4ES9 A;  3T1L A;  2GC1 A;  3LEG A;  3CJI B;  4NHY A;  4P5H A;  5F2S A;  3OF1 A;  2PLV 3;  4ZS2 A;  3VBH B;  3DF0 A;  5JUV A;  2X09 A;  4QKB A;  4QQO A;  2VMC A;  5A7O A;  5FXX A;  3A4U A;  4AL9 A;  1S55 A;  4Z1V A;  3ZYR A;  2J1V A;  1BHG A;  2VMD A;  4XFC A;  1CIW A;  1R09 3;  2WWS A;  3AJY A;  2DVF A;  4BOW A;  4MGI E;  2JB4 A;  4Y1X A;  3MIH A;  1FV2 A;  2YDE A;  1BK0 A;  5GLT A;  4SBV A;  4GH4 B;  4DS0 A;  4Y5Z 0;  3WNP A;  1QXR A;  4ASK A;  3ES4 A;  3AC0 A;  1GR3 A;  3NAP A;  4R9C A;  2WII B;  1DQ2 A;  5T55 A;  3WF4 A;  3J7L A;  3V0B B;  3RSJ A;  1POV 1;  3RS6 A;  1YQ5 A;  3QH6 A;  2BGO A;  2ZCW A;  5FPL A;  3MF6 A;  2IWG B;  4IEO A;  5FYU A;  2JD4 A;  1LB2 A;  2TUN A;  5E89 A;  2VC9 A;  1NA1 A;  1DBN A;  4PT6 A;  3AFG A;  4AYU A;  2AYH A;  5J48 A;  4CCE A;  3O1U A;  5C8W A;  1PK6 A;  4WM8 B;  4YGC A;  3THD A;  4C1W A;  3HN1 A;  1I5P A;  1YRZ A;  4QB1 A;  2WNO A;  1TEI A;  2ZX3 A;  2QQO A;  4XOG A;  1C5I A;  1W6P A;  3ETP A;  1QDO A;  3M4F A;  4QB2 A;  3PLQ A;  4A2U A;  1OD3 A;  4CEW B;  2IXJ A;  3SLI A;  1DQ5 A;  4XJW A;  2Q1F A;  4NMI A;  1LEM A;  3RZZ A;  3IMN A;  4XZP A;  3VL8 A;  5FZB A;  2WO7 A;  3ZXL A;  4URT A;  1AL0 G;  1WA4 A;  3T30 A;  2WAA A;  4MGS A;  3CO2 A;  4Q4V 1;  3JB8 A;  2VQT A;  2XJQ A;  1VAM A;  3WY6 A;  1XNT A;  1G9C A;  2JEC A;  5FZF A;  1LGB A;  4XF1 A;  1X36 A;  4UYB A;  5I0D A;  4P00 B;  4HXC A;  4Q5O A;  3I2O A;  2PLV 1;  3WNX A;  2HYK A;  3POS A;  1UN1 A;  4FVV A;  4K8R B;  4EZH A;  4HSL A;  3T0A A;  1FOD 1;  2BZD A;  3LDB A;  3TEW A;  1FMD 1;  4M3C B;  4QX2 A;  3SKJ E;  5LZ6 A;  1TG7 A;  1QJX 1;  4DOU A;  4FTE A;  4QXC A;  2R32 A;  1QIQ A;  2LW8 A;  3FLP A;  3OPZ A;  3C7F A;  1AXK A;  2BTV C;  3PME A;  5BNN A;  2QQI A;  4IEQ A;  3JD7 2;  4Y5S A;  5DUU A;  3MDP A;  4LT5 A;  3PIG A;  1HDK A;  1IS4 A;  3HBK A;  5FRA A;  5M0T A;  4LXL A;  1STM A;  1ZX5 A;  4JDN A;  2D97 A;  3O1M A;  5LEK A;  1US3 A;  2YZ4 A;  1O5L A;  1PX3 A;  2ZAH A;  4DB5 A;  4EN9 B;  3FWE A;  3WR0 A;  3SEP A;  1WCK A;  3E5U A;  2VEC A;  4KWJ A;  2HEV F;  2VAU A;  4R9A A;  3M1H A;  1HXS 3;  4QPY A;  3URF A;  4AED C;  1O8S A;  4CCN A;  1GUI A;  1APN A;  1EAH 1;  4QHB A;  4Y26 A;  2VNO A;  2A1X A;  1VRB A;  1WMF A;  4I02 A;  3VBO A;  4LJH A;  2YYO A;  3WG1 A;  2VNV A;  3AYA A;  4MVT A;  1K5M A;  4XIK A;  2PAE A;  2JB8 A;  1RUO A;  4FPJ A;  1SLL A;  1TME 3;  2KM2 A;  2W1S A;  2BFU L;  3KGZ A;  1CAX B;  3VZJ A;  1HN0 A;  2FDJ A;  1RB8 G;  3HIF A;  3UJO A;  4OYU A;  1GZW B;  4MGK E;  2YG0 A;  4XFA A;  4Q26 A;  1NA1 C;  1UCX A;  2C9A A;  4OUE A;  2ZML A;  3PU8 A;  4Y1U A;  4IDZ A;  3VZK A;  5A33 B;  4QX5 A;  3U37 A;  5C4W C;  2Q1M A;  5LA9 A;  2GNB A;  5ABJ A;  5I91 A;  2BWC A;  3I3D A;  4IW3 A;  2Y34 A;  4LIV A;  4QXB A;  4QX7 A;  4UI9 L;  3TN9 1;  3ZYJ B;  2IZW A;  1W8W A;  3H42 B;  4JQR A;  5C5T A;  3VBU C;  3WG4 A;  4DFS A;  4B29 A;  2W1Q A;  3OGJ A;  4TYS A;  3WVJ A;  3H8X A;  5EQU A;  1S0F A;  5EFU A;  3NVC A;  3B9I A;  2O14 A;  4XDQ A;  4OZX A;  3LEM A;  4EN7 B;  1FMD 3;  4PLN A;  3POG A;  4AHY A;  4NIA A;  3FZ3 A;  1E5I A;  1AYN 1;  2EID A;  4B8E A;  1AR9 3;  3K4A A;  3SH3 A;  3ZFF A;  2BU9 A;  4XUO A;  1MR5 A;  1H9P A;  1ODN A;  1PO1 3;  1YLL A;  2VZR A;  3MLK A;  1W8T A;  2ET7 A;  1F8V A;  4QDQ A;  1NLS A;  4CEY B;  3LA7 A;  1YI9 A;  1H2K A;  3H8O A;  1PO2 2;  3WNO A;  2IXI A;  4KBZ A;  2HYX A;  2E31 A;  3IZO A;  1RIR A;  1ZBE 1;  1XE8 A;  5IHR A;  1FYU A;  5IFT A;  1SLA A;  3BI3 A;  1LHV A;  1NE4 A;  1JYI A;  4HSJ A;  3R4D B;  5J98 B;  1ZRE A;  2K2S A;  5J7M A;  2GSY A;  1CZT A;  1PX4 A;  4XUP A;  3OY8 A;  5JXJ A;  2RS1 3;  2XB6 C;  4MXW B;  5JZG C;  1H6X A;  5ERL A;  5FZE A;  2GME A;  4OQ9 A;  4UWD A;  3U4S A;  3LQC A;  4L8Q A;  2ZEY A;  5C5U A;  3SC7 X;  4W6Y A;  5F9T A;  3III A;  4JCK A;  1AR8 2;  2PQQ A;  4LO6 B;  4DZG A;  3P3P A;  4JKL A;  4DUW A;  3BUC A;  2A70 A;  2JDA A;  4DIN B;  3ACL A;  2PFW A;  4CU7 A;  3UGF A;  4AFD A;  1J3Q A;  4PBO A;  2Q1Z B;  1V6J A;  1JTZ X;  3RWN A;  4N53 A;  1GAN A;  4Q4X 3;  3VKO A;  3FHQ A;  1HB4 A;  2AC1 A;  2QVS B;  2B46 X;  3T2Q A;  1V6M A;  3ILF A;  3M3Q A;  1HIX A;  1LHN A;  4RR3 A;  2NQY A;  1Z78 A;  1OPO A;  5GZC A;  1LEN A;  3NRU A;  2J1A A;  1RIN A;  1ULD A;  4M0N A;  3LWC A;  1C57 A;  3AL5 A;  1GZC A;  4AOC A;  4BH9 A;  1KDM A;  4YRD A;  3N3H A;  1W2A X;  3NO8 A;  3ES1 A;  4RGA A;  1FNZ A;  3R6S A;  3MZH A;  3S57 A;  4AI0 A;  3Q8F A;  3LDK A;  1C1F A;  2PHL A;  4YW2 A;  4P9L A;  1DGW A;  3MW4 A;  1W03 A;  3IAQ A;  4UOJ A;  3RZH A;  4FP2 A;  1JZ4 A;  4ZZ5 A;  2ZBJ A;  1QJU 2;  4LBO A;  1E57 A;  5JWP A;  2XVG A;  3AMM A;  1ENQ A;  2BER A;  2UYA A;  2ZJC A;  1VBA 3;  1H30 A;  3B3Q E;  2Q8O A;  3ST7 A;  3ZIW A;  2HWB 1;  5T50 A;  2RDR A;  5L9R A;  3ZSJ A;  3PMS A;  1RUE 3;  2QUO A;  4TZD A;  2ZGO A;  2D98 A;  1XNC A;  4UBH A;  5LA2 A;  1MEC 1;  5D8A B;  1XB9 A;  2AR6 A;  1UYY A;  3UKN A;  2VD7 A;  2ES3 A;  3DV8 A;  5DDJ 3;  4Y33 A;  5ACA 1;  3VLB B;  5EJ1 B;  4CCO A;  5F3I A;  1Z7S 1;  2OW4 A;  2CGN A;  3C7G A;  3MFA A;  3OBZ A;  1UO9 A;  2CGP A;  5FKB A;  2DTW A;  1XPW A;  2WO1 A;  3C7E A;  4ONU A;  1OVP A;  5FY7 A;  5LBB A;  1PGS A;  3TN9 3;  4CUA A;  4E2G A;  1Q8Q A;  3WCR A;  1XNA A;  1SPP B;  4GB3 2;  3OJB A;  3ZYI B;  1T6G C;  2Y38 A;  2VZP A;  4TLF A;  1JYV A;  3QH7 A;  1ND2 C;  2J1E A;  2LS6 A;  3LGR A;  1CAW B;  3H9A A;  4X8N A;  1HRV 1;  4GQ7 A;  4UXA A;  4FTS A;  3WNM A;  1KD7 A;  2ZAB A;  4JRL A;  1ZZ9 A;  3GZT B;  2WR9 A;  3H0O A;  1K45 A;  4W6X A;  5FMB A;  1LAJ A;  1W8O A;  1WCS A;  4W6W A;  1OA2 A;  4EQV A;  3VV1 A;  5FPX A;  2VTX J;  3ASI A;  4X6R B;  4QU1 A;  2WZR 1;  2BWA A;  1W9S A;  4PF1 A;  3V64 A;  4D6R A;  5GM0 A;  3N9Q A;  3ZO0 B;  4RFR B;  5DZF A;  2WZR 2;  2BP6 A;  5FZ1 A;  2X29 A;  4BJ0 A;  3N9O A;  2WQ8 A;  5IYY A;  3NJY A;  5CYY A;  4QPG B;  2Y6H A;  2YFU A;  3UV9 A;  4M4R A;  1V6L A;  3WCS A;  3OBR A;  4YVW B;  1ZBE 3;  1DDL A;  1VRH 1;  4F83 A;  3M3C A;  4ITC A;  1XE0 A;  3EJK A;  1CAX A;  1SBE A;  4ISR A;  1NYW A;  4CEW C;  2P3Y A;  5HI0 A;  3RZJ A;  1W6N B;  4QU2 A;  1UY4 A;  3WQ0 A;  4XXA A;  3M8L A;  1RUE 1;  4DIQ A;  3PUI A;  5A7S A;  5LRR A;  1NCR A;  2NPI A;  5BXX A;  2IXL A;  1DQ4 A;  3RG0 A;  4GAZ A;  5C7G A;  2A6Z A;  4N53 C;  4A7K A;  2IC1 A;  3BOD A;  4Y4R A;  4AXO A;  1HB2 A;  1XBF A;  2P2K A;  4NHM A;  3X29 B;  1IG0 A;  4P08 A;  4CP1 A;  2A3W A;  4MGT A;  2VU9 A;  5A70 A;  3TNQ A;  1AR7 3;  1OPM A;  2I74 A;  1LCL A;  1YC6 1;  2WZ8 A;  4IGQ A;  4WBB A;  5C3P A;  5CIS A;  4EN6 B;  4LO8 A;  5D1I A;  1CAV B;  4G4F A;  4OI1 A;  4XUR A;  5A1F A;  4AHZ A;  2PAK A;  4AWD A;  1UQX A;  1S0I A;  1MQT B;  1AVB A;  2DV9 A;  4JGZ A;  5FZA A;  1Y9G A;  2JDK A;  4EYU A;  2C24 A;  5L9V A;  4LKF A;  2CAV A;  2YBS A;  3B00 A;  3HR9 A;  1JOJ A;  1RUI 1;  4GB3 3;  3QAC A;  3CHX A;  5D2A A;  3B93 A;  1D7P M;  3LPG A;  5HBA A;  5J09 A;  1HJF A;  1PVX A;  4G9S B;  1ND3 C;  4LO4 B;  5IAX A;  1RGS A;  5CBL A;  4XCB A;  1CON A;  5FZL A;  1Q8V A;  4S2H A;  2BQP A;  4Y1V A;  3VBH C;  3VHP A;  3UYJ A;  2ORX A;  2HWB 3;  2VGD A;  3ZDV A;  3ZFE A;  1WW5 A;  3WHT A;  4BB3 A;  1RL3 A;  3D6E A;  1DZQ A;  1PHM A;  4QM9 A;  4XVH A;  1A78 A;  1UOB A;  4BQY A;  5J3U A;  1N1T A;  2AAC A;  2P4E A;  4BMB A;  1KJL A;  1RC6 A;  3SXW A;  2NZ9 A;  2WNV C;  1ACC A;  2EVX A;  1W3X A;  5KHH A;  1OOP B;  4EN8 B;  1ZRF A;  3U1X A;  1HRI 1;  3ACF A;  4YZ3 A;  4QD2 A;  2F4P A;  3MIG A;  2J42 A;  4KQ7 A;  3TWI A;  4DY3 A;  1WLD A;  1WW7 A;  2ARX A;  1S2K A;  3MHZ A;  1MS0 A;  3POI A;  2FMD A;  2TNF A;  3OYW A;  2Y0I A;  4LE3 A;  4XF3 A;  4YVS A;  5C4W B;  5F5Q A;  2LTN A;  1S0C A;  1O6U A;  5BNQ A;  4TN7 A;  2ID4 A;  4NN0 A;  2FQP A;  1Q43 A;  1NKG A;  4Q27 A;  3NNL A;  4LOT A;  3KQ4 B;  4BIF A;  3NAP B;  1HV1 A;  1OFN A;  3V65 A;  1J3R A;  3ZN4 A;  1WMX A;  2WUH A;  1PVC 1;  1OBN A;  1W0O A;  5FYH A;  1JOD A;  2ET1 A;  3ENR A;  5FBJ A;  1DCS A;  5K7P A;  3OGG A;  4AVV A;  3A0K A;  5DAX A;  5FZ7 A;  4UAP A;  2QBX A;  1ZVF A;  3BAL A;  1GU3 A;  4HBN A;  1VMF A;  5C8C A;  3LE0 A;  4E4Z A;  1F5J A;  1CIY A;  2LRP A;  3TBD A;  5T5P A;  1F5F A;  2A3X A;  5TSW A;  2KR2 A;  4BM8 A;  1RUJ 2;  2WC2 A;  2VCM A;  3B5L B;  1RJ8 A;  2VQ0 A;  3AVS A;  4ET7 A;  1OKQ A;  3MO4 A;  5AC9 3;  4DY5 A;  4JRA A;  3OPW A;  1RMU 1;  1W6M A;  2D44 A;  2DBN A;  5EZW A;  4BE3 A;  5IK5 A;  4FQ4 A;  4H14 A;  4UFJ A;  4PIX A;  4LE4 A;  2NYY A;  5F8P A;  2VZS A;  5FYC A;  1BBT 2;  1FX5 A;  5BNO B;  3DKW A;  5FZ3 A;  2ZX2 A;  1UNB A;  3WNN A;  1OKO A;  4EZ4 A;  1DYP A;  4KGG A;  1WBF A;  4ZXE A;  3VD5 A;  4GKY A;  5DUV A;  4CCD A;  4MXV A;  3CLP A;  3KSC A;  1RVF 1;  3CEW A;  1DYK A;  1ASJ 3;  2VZQ A;  2A6W A;  1KFU L;  1DGL A;  2D6N A;  5CNA A;  4MZU A;  4HOO A;  4BLI A;  1R1A 3;  3AXD A;  4E4H A;  3FMG A;  3FUO A;  3VZO A;  3I2K A;  3T0D A;  3BVC A;  5IAV A;  3HQR A;  1HB1 A;  3AYE A;  3T1M A;  1W99 A;  4DUV A;  5I0T A;  5BNP B;  3AJZ A;  1DLC A;  3NJV A;  3SH5 A;  4XJU A;  2ZGK A;  3ZX7 A;  3ZFG C;  1W9T A;  2EXH A;  4TSV A;  4K8F A;  2A7A A;  3AKT A;  5BNO A;  4JTO A;  4RS5 C;  4YM0 A;  5IVV A;  5L7O A;  2X5I C;  4UT5 A;  3THT A;  5HXM A;  1B35 A;  5G05 L;  1YO8 A;  3QLQ A;  1RUJ 3;  4AI3 A;  1AYM 3;  1V9U 3;  3DEM A;  2CTV A;  5GLU A;  1NXM A;  3I3B A;  4XAC A;  2OUJ A;  5FK8 A;  5I93 A;  1YQ6 A;  3ZMO A;  1YUD A;  2JG9 C;  4XDO A;  1ULE A;  1OUS A;  4KNC A;  2EAA A;  4XTP A;  1IGO A;  4OCT A;  3ZN5 A;  2ZTN A;  3DEC A;  1PGW 1;  5A1A A;  5BNP A;  4AQT A;  4Q4Y 2;  3H3Z A;  2QQU A;  2VZO A;  2ADD A;  3WUC A;  2XG3 A;  2E7Q A;  4LBK A;  4P9Y A;  3CNA A;  5FP9 A;  1CR7 A;  1UMI A;  1WBL A;  2GN3 A;  2I45 A;  3LIH A;  5FZG A;  5K0U A;  3VDC A;  4B7K A;  4AFM A;  1GNH A;  3T0B A;  2B5H A;  4LK6 A;  4IES A;  4X8P A;  1RMU 3;  1SFY A;  1PM7 A;  5A3O A;  2RDN A;  1XYP A;  3U11 A;  1HXS 1;  1ZRI A;  2UWA A;  2OX0 A;  2WSU A;  1OMI A;  3IDC B;  4QX0 A;  4AI2 A;  4AK3 A;  2WNU A;  4K20 A;  4UFH A;  4MGQ A;  3ZR6 A;  1GSL A;  4RQP C;  1Y3T A;  2ZA9 A;  1XYO A;  4XIL A;  5F3E A;  2H0V A;  4Q4W 3;  3KLS A;  1R1Z A;  4YG3 A;  2MHF A;  5I8S A;  4C91 A;  4FPE A;  5B2G B;  2CU5 A;  2H6C A;  2JDY A;  3CF6 E;  2BVV A;  3VKN A;  4PBP A;  4WM7 B;  5A3N A;  1FAY A;  5AC9 2;  4JQT A;  5FP3 A;  2R49 A;  1AF9 A;  1N3O A;  1AYN 2;  2XJP A;  5IWF A;  2YHJ A;  2RS3 1;  4WV8 A;  2HWF 1;  3KT4 A;  2IVJ A;  3OD4 A;  1YFY A;  4PJY A;  2EXJ A;  2GMM A;  4OHX A;  1CAU B;  3KT1 A;  4YW1 A;  2WKK A;  4PI2 A;  2I2S A;  3MUZ 1;  2QFE A;  4F3J A;  2PMW B;  3OGV A;  2R07 3;  5JXG A;  1G9A A;  2X53 S;  3AX4 A;  3I54 A;  1XU2 A;  2ZX1 A;  5I0S A;  4BWO A;  1QJE A;  4FP3 A;  1US2 A;  2HJI A;  2WA4 A;  5FYB A;  4BDV B;  3DYO A;  4RGK A;  1W04 A;  3I2I A;  2CHH A;  4IEU A;  1AR9 1;  4NII A;  4DMI A;  3H8R A;  3RI8 A;  1L7R A;  2OUH A;  1BVV A;  4RYD A;  5HV4 A;  1DQ6 A;  3DXT A;  4XPV A;  5JI9 A;  1P8J A;  4JGZ B;  1O8P A;  1EUT A;  2DFB A;  4XHX A;  4YLZ A;  2BGC A;  5FLH A;  2C6S A;  4PF5 A;  4CPB A;  3TNP B;  5GZF A;  4I0B A;  1CAV A;  2VZT A;  4Q0S A;  1OOP A;  3ABZ A;  3E97 A;  3I2H A;  2JIC A;  4YZ4 A;  2V5D A;  4LHL A;  4NJ4 A;  4YW3 A;  1IPS A;  3HQU A;  4IE6 A;  4J25 A;  5ACA 2;  4KWK A;  1R1A 1;  4N8M A;  2QKD A;  1YQ2 A;  1SBD A;  2D3S A;  5BNO C;  1XNK A;  1LGN A;  2A5Z A;  4L2N A;  1YI7 A;  4BQ4 A;  5CG8 A;  1V6K A;  4GIQ A;  2R1D A;  1JMU B;  2XBO 3;  4K3U A;  4AVA A;  4A4A A;  3ZFF B;  4XAA A;  2J1R A;  4YNI A;  4YM2 A;  5CFC C;  2MEV 1;  4MUV A;  2JE8 A;  2VCC A;  2VG9 A;  4N43 A;  3TRS B;  5JDB A;  1RUF 1;  3PNA A;  5JLV A;  2RMU 2;  1HKD A;  1YYN A;  2VUJ A;  4HK9 A;  4CEY C;  5C71 A;  3V0A A;  3IAP A;  4R8H A;  2GAU A;  1QXJ A;  3GHN A;  3UES A;  2JEN A;  3SCH A;  1OQD A;  2EIB A;  1W2N A;  2Q5T A;  4IGP A;  4YVW A;  4UFI A;  3WDW A;  3EO6 A;  3KHC A;  1HX6 A;  1OQE A;  2UWB A;  3AZX A;  1E5H A;  5C9A C;  4OI0 A;  2WWJ A;  1ND3 B;  3WW2 A;  3N4M A;  4LUM A;  3CU7 A;  1MZE A;  3NAP C;  4QQL A;  3LCP A;  2F17 A;  4LBQ A;  2BFU S;  4GJY A;  4KU8 A;  4ERO A;  4YSF A;  1CX1 A;  1KFX L;  2CYF A;  3GAL A;  4O61 A;  1LHW A;  5JIU A;  1MS4 A;  3I3E A;  3E6B A;  3CJI A;  1POV 0;  3PJQ A;  1IHM A;  2P1B A;  3D0J A;  1XNB A;  1MZ6 A;  1POQ A;  1IOA A;  1CGP A;  1FOD 2;  3ZR5 A;  1F4H A;  3UKV A;  1VBA 1;  3MV0 1;  5GJ6 A;  1R08 2;  4MHU A;  5FZ8 A;  1COV 2;  4GWM A;  2ZPX A;  5IK8 A;  1W0N A;  2D6L X;  5EYY A;  4A3X A;  1CZS A;  5FLJ A;  1D2Q A;  1MEC 3;  2DDU A;  3VBS B;  2ZOE B;  4EWD A;  5ABJ C;  1HV0 A;  4YM1 A;  2Y64 A;  4LHS A;  1H8T A;  4UW3 A;  4DEQ A;  5CAD A;  1CQ9 A;  3GF6 A;  1W9Y A;  2UU8 A;  1CPM A;  5KXD A;  1Z0H A;  4CDW B;  2RHP A;  2DU1 A;  4XUT A;  1N1S A;  2E6V A;  1LGC A;  2P17 A;  2ZHM A;  2MEV 3;  5B4X A;  2A6Y A;  3ZXG A;  5JPN B;  2AEN A;  1OUX A;  5H9R A;  3VBU B;  3CMG A;  1RUF 3;  1W6M B;  4W65 A;  1YEW A;  1X8E A;  1RUI 2;  3MLJ A;  4AVT A;  2Q30 A;  1YIP A;  5L36 A;  2JDN A;  3ITQ A;  5T5L A;  3WW4 A;  2FMY A;  1QH6 A;  1B09 A;  1FI2 A;  1SDD B;  4YFZ A;  4BQ5 A;  2RE9 A;  1L7L A;  2VXJ A;  4LOS A;  4I01 A;  3IWZ A;  5FMO S;  2C5D A;  2D7F A;  3OUI A;  4QGL A;  3WF2 A;  2WO3 A;  2WZR 3;  3O1S A;  2TEP A;  4X6Q B;  2D93 A;  2B4K A;  3KV6 A;  4Q4V 2;  2VTX A;  3OBA A;  1RUH 2;  2UWC A;  3MF9 A;  3POJ A;  3BU7 A;  4NRP A;  2OZ6 A;  5FLI A;  2CSG A;  5FPZ A;  4NE9 A;  2JG8 C;  4WM7 A;  2XJT A;  4QWN A;  3NV4 A;  1VRH 3;  1R1A 2;  2WQ4 A;  5LAS A;  4I3P A;  4Z2A A;  2VQA A;  3GCX A;  1WUV A;  3NST A;  1W2O A;  2O8O A;  2E51 A;  5T3N A;  2E33 A;  2W0X A;  2DTY A;  3ZXD A;  5JSR A;  1OC1 A;  2P5B A;  4QKF A;  5KHK A;  1XQN A;  5A7W A;  1MVE A;  2Y26 A;  1U5X A;  3TN9 2;  4FAG A;  5JOX A;  1TME 1;  3GGL A;  5FPA A;  4B1M A;  5KHJ A;  4CU9 A;  1R64 A;  1LKN A;  2WNE A;  1YJL A;  2EIG A;  1VLN A;  3PUQ A;  4HAN A;  4IE7 A;  4Y22 B;  1S4C A;  4MET A;  3NV3 A;  2RS3 2;  4K1Y A;  4AVB A;  3ZKY A;  3RYP A;  1CPN A;  3GBG A;  3WP5 A;  1EAH 2;  1NQJ A;  1IPK A;  3DN7 A;  4SLI A;  1CAU A;  5DDJ 2;  1JYN A;  2YRO A;  3VDD A;  2I07 B;  2Y6K A;  2ZGQ A;  5CU1 A;  5FP8 A;  4QX1 A;  1Q56 A;  5LAT A;  5C8C B;  4JDM A;  1BVP 1;  3T09 A;  4OQ8 A;  1IKP A;  1G7Y A;  2Y6G A;  2AEY A;  5DG1 A;  2P3K A;  3BPZ A;  3KV4 A;  3ZFE C;  1ZZB A;  2XQR A;  3IMM A;  4GWI A;  4LIT A;  5F6K A;  3PIJ A;  1NLR A;  2R0H A;  2B39 A;  1RUI 3;  4ZKT B;  3LEI A;  3N7M A;  4AEM A;  1GP4 A;  1B35 B;  3M3E A;  3WZ1 A;  2SLI A;  1OA4 A;  1OLR A;  3ZN6 B;  1BK1 A;  1IZ3 A;  1LR5 A;  4NRQ A;  4YVS B;  5C6C A;  1LHU A;  2W92 A;  4PIY A;  1W8H A;  2Q8E A;  2XML A;  4IQP A;  4H7M A;  2RS1 2;  5JI7 A;  4O65 A;  1WCU A;  1MAC A;  1U5I A;  2NP0 A;  3KM5 A;  1AJO A;  4JTN A;  5IVC A;  1O4Y A;  2BDR A;  2ARA A;  3RMX A;  3KB5 A;  4CCK A;  2W91 A;  2JIJ A;  2X5I A;  4CCC A;  4A42 A;  5FYM A;  4Q0P A;  5A1L A;  1WMD A;  1KRI A;  1IPJ A;  5JPM B;  2FD8 A;  1ND2 A;  2D5F A;  5C3S A;  4M00 A;  2P34 A;  2OT7 A;  1TNF A;  3I3Q A;  2V09 A;  5J36 A;  1GBG A;  1A3K A;  3VBR A;  2VH9 A;  1SCR A;  2RS1 1;  3RFR A;  2GZW A;  3ZFE B;  2W94 A;  2NM1 A;  2YUE A;  4Q4Y 1;  1Y4W A;  4XF4 A;  3HPN A;  5EJZ B;  4CXY A;  2R06 1;  1AR9 2;  3D0S A;  5IUQ A;  3POB A;  2CWS A;  3CJX A;  3ACG A;  1WME A;  2C4X A;  5BV6 A;  2D6K A;  4FOY A;  5IFP A;  4M3C E;  3MV1 1;  3L9J T;  1RUD 1;  2CGO A;  1UKR A;  3ZXF A;  5I8Y A;  1VBB 2;  4QHZ A;  4LR4 A;  4QB6 A;  5KXB A;  2WZP P;  2W1W A;  4E9K A;  5DPN A;  1H4G A;  3VDA A;  2D3R A;  2WWU A;  3J7M A;  1GWL A;  1ST8 A;  1OF4 A;  2WT2 A;  5A7Q A;  3RNS A;  3NKG A;  4NRM A;  3R05 A;  5CVR A;  3CZJ A;  3R4U A;  4QGM A;  2V72 A;  3PHM A;  5IW0 A;  3W5M A;  4AI8 A;  1W0P A;  4N43 C;  5DG2 A;  4D6Q A;  2BUK A;  2N7G A;  4CDW A;  1GFF 2;  3GZE A;  4ZU4 A;  3CZU A;  2YU2 A;  4CP9 B;  1RUD 2;  1REF A;  4M3C A;  3LD8 A;  4GA9 A;  4Z82 A;  1WWY A;  2JDM A;  3R4S A;  4ZU5 A;  1ENR A;  1SCS A;  4YVW C;  4IEW A;  4Y1Y A;  2OXB A;  5FUN A;  3HOB A;  3SQO A;  4PQ9 A;  4CSW A;  4E2Q A;  5AVP A;  4KG0 A;  5DAB A;  3O14 A;  5LK5 A;  1UY2 A;  1YHF A;  5C4W A;  4EWE A;  1MEC 2;  3FHA A;  2GC2 A;  2DUQ A;  4GWN A;  3TB0 A;  3Q8B A;  4BPZ A;  3BCW A;  1UY3 A;  2IFW A;  3KS7 A;  3I3M A;  3EB7 A;  2UY8 A;  1NT0 A;  4LKS A;  4Y20 B;  3D8C A;  4XCA A;  3RQ0 A;  5HPO A;  1GOH A;  4ARX A;  3AMH A;  1OF3 A;  3OTF A;  4I0W B;  3AM2 A;  1XJA A;  3FN9 A;  2CWM A;  5ACA 3;  5FO7 B;  5CKN A;  4CA9 A;  4PCR A;  3I7D A;  1Z7S 3;  3MIC A;  3EHK A;  2XOM A;  4O9E A;  1UX7 A;  2RR1 1;  4L99 A;  4MGZ E;  1X8M A;  2EA7 A;  5L7O C;  1G9F A;  4PIZ A;  4XUN A;  1F35 A;  5FZI A;  3HVD A;  3NKT A;  4XXP A;  1C3H A;  1J84 A;  4ATE A;  5BNN B;  1UY0 A;  1OSG A;  2CY6 A;  4AGR A;  2UYB A;  2AH2 A;  3PVB B;  5A6Y A;  4EE2 A;  4NWV A;  3ZDS A;  4IV1 B;  1QJY 1;  1ZZ6 A;  3MFC A;  5A3L A;  1YJK A;  1UMH A;  4IE4 A;  1LOF C;  1HRV 3;  3HNM A;  4P02 B;  5E6H A;  1I3H A;  3VD7 A;  4XBN A;  3MID A;  1AYM 1;  1V9U 1;  2RS5 2;  3UET A;  4D0Q A;  3OOX A;  2J7M A;  4GH4 A;  1SHW B;  2FDK A;  4AZZ A;  3IKW A;  1UYX A;  5DAW A;  3VHO A;  2MPF A;  4AEJ A;  1JZ3 A;  4RR3 B;  4XBQ A;  1UXX X;  1WD4 A;  2YFZ A;  1L3J A;  4QPW A;  2KXL A;  4K40 A;  4I2O A;  1UXZ A;  1XOY A;  2A6V A;  2ILM A;  1NZI A;  2J22 A;  2W9X A;  2H0B A;  3RI9 A;  5FXW A;  4MOA A;  1KEX A;  4DXZ A;  3OUH A;  1UZW A;  3W9A A;  5FYV A;  2P6C A;  1IQD C;  2XH6 A;  3TYJ A;  5H9S A;  4FPY A;  3N7K A;  1ZM1 A;  3JXS A;  3INA A;  3NW4 A;  5KHG A;  4XHB A;  3I2D A;  1SQ4 A;  3HMY A;  4CDW C;  2EIE A;  1SLT A;  2JD9 A;  4GMP 3;  2X05 A;  5I8T A;  1NA1 B;  1UAI A;  1TMF 1;  1HLC A;  1J1T A;  1HQL A;  1PVC 2;  3C2U A;  1HJG A;  4K1Z A;  4MV2 A;  5ANQ A;  5C3O A;  3L2H A;  2W46 A;  2W2I A;  1UZV A;  3JUU A;  2JX9 A;  1GNZ A;  4J1X A;  1V0A A;  3RVH A;  3E6D A;  1DZT A;  5IAT A;  1D4M 2;  2RM2 2;  2RS3 3;  1W2T A;  1KIT A;  5JOZ A;  2ARC A;  1DYO A;  1JS9 A;  3HJR A;  4FT8 A;  4Z07 A;  4PDW B;  4UF0 A;  3WQ7 A;  4FXG B;  1ZBE 2;  1G9B A;  4BQX A;  2DVB A;  1QJY 3;  4CUB A;  3T4H B;  2RG4 A;  2YMZ A;  2ZXQ A;  1I6X A;  4RHV 2;  1YQ8 A;  5F37 A;  5KBF A;  3TEZ A;  1CD3 G;  5A3T A;  2RDQ A;  1AHS A;  2R07 1;  1ZZC A;  1N1Y A;  3U0Z A;  2BNM A;  1CJD A;  2CNA A;  3KD4 A;  4UFM A;  4BCU A;  4TXW A;  3BOW A;  1MZF A;  1XRU A;  4QQH A;  4QGN A;  3ZIX A;  3KWV A;  1VJ2 A;  3DKQ A;  3PTY A;  4MLO A;  5LY2 A;  3DYM A;  4AQ6 A;  4CDQ B;  3IIA A;  5FPU A;  1F31 A;  3M2M A;  1NOV A;  4XEZ A;  5FFO C;  5KC5 A;  2IXC A;  4HVQ A;  4JKM A;  2XKP A;  2VVE A;  5C3R A;  4DXS A;  2E9Q A;  4N7U A;  4CU8 A;  2ENR A;  2RR1 3;  4KGQ A;  1KGY A;  4V2W A;  3VKM A;  4CDX A;  5K0U B;  2VW2 A;  1H8T B;  4QKN A;  4FPL A;  3KCC A;  2G4I A;  4NWW A;  3ZXJ A;  3C7O A;  3CKH A;  2HWD 1;  4AFC A;  2L9L A;  3HD8 B;  1FAT A;  1C8M 1;  4ZS3 A;  3USU A;  3AYD A;  4LA2 A;  1RXG A;  2BGP A;  4ARY A;  3O1R A;  2OZJ A;  5EXO A;  3CL1 A;  1MS3 A;  1OLQ A;  4AI9 A;  3ORJ A;  3GM8 A;  4LTA A;  3ZSL A;  1BXH A;  2K0G A;  2RM2 1;  4QHO A;  4B4P A;  3IBM A;  5L7O B;  1ZA4 A;  2O0O A;  2B9U A;  4WZC A;  4XJ8 A;  1PVC 3;  1MS5 A;  1VMJ A;  1WCD J;  2J1U A;  2Y33 A;  4XBL A;  1A34 A;  4CXX A;  4E27 A;  1UYP A;  3IB3 A;  4Q0U A;  3ON7 A;  4QAW A;  2YY1 A;  1SPP A;  4ZON A;  2P37 A;  4AR2 A;  1BCX A;  2VOX A;  1UPI A;  1YFW A;  5JR7 B;  3WUD A;  3FFQ A;  3VDD B;  4P9X A;  3ZYH A;  5CKQ A;  5CFC B;  2PHF A;  2Z42 A;  1KDK A;  1UL9 A;  3WDV A;  2HWC 1;  2PA7 A;  2QQW A;  1W2U A;  2HH9 A;  4NVP A;  2WNU C;  3TOJ A;  4LBN A;  2VZV A;  1H4H A;  3UKT A;  4FQZ A;  1O5U A;  3I2G A;  1COV 1;  5AC9 1;  3V0A B;  3IDA A;  2YPJ A;  2BOJ A;  3ACH A;  4N43 B;  2GNM A;  1G6N A;  4LO7 A;  3VL9 A;  4Z2W A;  2YB7 A;  1RIT A;  1BJQ A;  2RDS A;  3PUA A;  5FPB A;  1VB4 A;  3H3L A;  3B01 A;  1W28 A;  5JVV A;  3KGL A;  5FO8 B;  3L2Y A;  1V6O A;  3CQO A;  5GZG A;  1RVF 3;  4FCA A;  1ASJ 1;  3H1Y A;  5EWS A;  3S7I A;  3BIW E;  2XJS A;  1PMJ X;  1V70 A;  4BK5 A;  3IN9 A;  2BEO A;  5A7N A;  2A75 A;  4PLM A;  2W95 A;  1URX A;  3GYD A;  3Q9O A;  1L7Q A;  5F3C A;  4OUL A;  2XJV A;  2HWB 2;  4IER A;  4Z92 B;  5E16 A;  1W39 A;  5HCA A;  4NIH A;  3JU9 A;  1H9W A;  2Q4S A;  4XF0 A;  3MW2 A;  1VBB 1;  5BY5 A;  1MS1 A;  4I0A A;  1RUJ 1;  1Z7S 2;  1JW6 A;  1LOG A;  2Y0O A;  5BNN C;  3HBZ A;  4CE8 A;  1DFQ A;  1RHI 2;  4Z8B A;  1VBE 3;  3B7M A;  5JOW A;  4P9W A;  1J1L A;  4FOV A;  3G6J B;  3MW3 A;  5BUV A;  3GCW A;  3BGA A;  3GBW A;  1DGR A;  4S2F A;  5FZ9 A;  3AP4 A;  4BXF A;  5JXH A;  5E8A A;  2VW1 A;  2EAK A;  3AZV A;  4FOW A;  4QMA A;  4HPK B;  4YW7 A;  5A3P A;  3QD6 A;  4YGE A;  1SEF A;  1LOD A;  3H8U A;  4ASL A;  3N9N A;  1VBC 2;  3E1F 1;  3RYR A;  3W5N A;  4LBL A;  1ZRC A;  4FTB A;  4NID A;  4A45 A;  1NCQ C;  4U2A A;  2EIC A;  4WVV A;  4KBB A;  4COU A;  5FK7 A;  4D7S A;  1WZX A;  2VNG A;  5FY5 A;  4ZU7 A;  2JE9 A;  4F7Z A;  1NY7 1;  4NPL A;  2HWD 3;  4D8M A;  1AZD A;  1YQC A;  1GZT A;  1OHF A;  2XDV A;  3ZPO A;  1SZB A;  3MGU A;  1PGL 2;  2BNN A;  4AQ2 A;  5EIY B;  2D43 A;  1PZ8 A;  3O12 A;  5HCB A;  3H1W A;  5FZO A;  3WNK A;  5FV3 A;  1DZR A;  5K4L A;  4AF9 A;  1QOS A;  5IVB A;  5KC6 A;  1W6N A;  3N7J A;  2W47 A;  3FHI B;  1JYW A;  1GQG A;  2JKB A;  1XSQ A;  4FI9 A;  1UKG A;  1C8N A;  2VXR A;  4LUK A;  4CXW A;  4HZF A;  1CVN A;  1PO2 1;  2XJU A;  1OLM E;  4ZY9 A;  5GZD A;  4KU7 A;  5SV5 A;  1RUG 1;  4QPG A;  4LBQ B;  5F5I A;  1MQT A;  1FT9 A;  2ETE A;  3WDX A;  1SFN A;  3OEB A;  4C90 A;  2QZ2 A;  2XUM A;  2OPK A;  2VNR A;  1Y9M A;  3D82 A;  2H6B A;  4HLT A;  4Q8K A;  1VBB 3;  1DQ0 A;  2VO5 A;  3AZY A;  3GZU C;  3POW A;  2WYS A;  2E7A A;  2EAL A;  3HN3 A;  3NQH A;  3VZM A;  1CAW A;  3LF7 A;  2ZAA A;  2VL4 A;  3IPV B;  3A0N A;  1RTV A;  1LES A;  3APB A;  1NXD 1;  3MPP G;  3ZFG B;  2E26 A;  2PTM A;  1U5Z A;  1LOB A;  1CX4 A;  1KQR A;  1VP6 A;  4OFG A;  4OI2 A;  4CPB D;  5B4N A;  4W50 A;  1S1A A;  2XWJ B;  2DCJ A;  1X9T A;  2ZGR A;  5FOJ B;  3DCQ A;  5H9P A;  5DMY A;  3HT2 A;  3MYX A;  5FZD A;  2FDG A;  1IQA A;  4CUC A;  3KV5 A;  2OKX A;  1O91 A;  2W5F A;  1CJP A;  1T6B X;  2XBO 2;  3CDZ B;  3POE A;  4XQ4 A;  4B1L A;  3PVE A;  4CDQ C;  2XLA A;  4RD7 A;  4HKO A;  1ULP A;  2R16 A;  2W39 A;  4BA6 A;  2DBI A;  4NUB A;  4OHV A;  2XBO 1;  3LOI A;  2DVD A;  3NV2 A;  2VZ1 A;  3VD3 A;  3IDB B;  3JB4 C;  5GZE A;  3U78 A;  1M06 G;  2A3Y A;  5H9Q A;  3PUH A;  2Y60 A;  1BYH A;  4Q4Y 3;  2ZZQ A;  4NR1 A;  2ATF A;  2LUW A;  4R9D A;  2R06 3;  2WL1 A;  3T3Y A;  4J6G A;  5FJK A;  5JCT A;  1SG3 A;  3ZLI A;  5JR2 A;  1AR8 3;  4KL1 A;  2HKX A;  3GXU A;  3POF A;  2W68 A;  1UMZ A;  2HEW F;  1RUD 3;  5J37 A;  2XWB B;  3ZXK A;  2VTF A;  3RPQ A;  2V4V A;  2Z5W A;  2NMO A;  3A22 A;  3VBF A;  5IK4 A;  3ILN A;  1VE0 A;  1GOF A;  2FCV A;  4DQA A;  1X50 A;  2JG8 A;  4WM7 C;  2V73 A;  4P5Y A;  1BQP A;  1EPZ A;  2XR4 A;  2QQP A;  1C4R A;  4CP0 A;  1S2E A;  2PLV 2;  3FJS A;  3WF0 A;  2ZHL A;  3C7H A;  3HT1 A;  1NCR C;  3NV1 A;  1PNF A;  4N53 B;  5DZE A;  4HVO A;  2HWF 2;  3NNG A;  3AL6 A;  3BPS A;  5D8A A;  2JE7 A;  2XL7 A;  4W8J A;  3SCG A;  3PUR A;  1WA6 X;  3KF5 A;  5A7W B;  1XU1 A;  4AQS A;  4M0H A;  1ULO A;  2VZ3 A;  1NUK A;  3VUO A;  1AL2 3;  4H7L A;  4Q0V A;  3LDR A;  3RZL A;  3QCW A;  3RMY A;  3BTY A;  4NHX A;  2VUC A;  5A6Z A;  2WNU B;  1AX0 A;  4K7J A;  4QXH A;  1UPS A;  5IK7 A;  1NCQ B;  4KMQ A;  2WLQ A;  5FR3 A;  1DF0 A;  1KJR A;  1MPX A;  3B94 A;  2WJS A;  3TEX A;  4C0H A;  2DUR A;  3GDB A;  1PO2 3;  4CRQ A;  4IEY A;  1Y9Q A;  2GC3 A;  2D5H A;  2ZX4 A;  2GAL A;  4I3G A;  4COV A;  3BTZ A;  4IEV A;  4BHP A;  5F3G A;  3P5B A;  1G9D A;  1NZC A;  4QX8 A;  3T2T A;  2QQN A;  3MBW A;  4ZHN A;  4MAD A;  1AYM 2;  1V9U 2;  4Y1Z A;  5KWR A;  1Q8S A;  4BIS A;  5A3U A;  2WRA A;  5J1X A;  2BV4 A;  2FZ1 A;  3P3N A;  4V2V A;  1UD1 A;  4GUL A;  2WFF 2;  3VD9 A;  5LA1 A;  2WN2 A;  3A23 A;  2B8M A;  2WYF A;  4Q4X 2;  4RGG A;  1BMV 2;  2W87 A;  1PIV 2;  4IXL A;  3LIG A;  2VMI A;  1RUC 3;  3S5Q A;  1JYX A;  4JKK A;  1TME 2;  4LBJ A;  2KA3 A;  2Y6F A;  3THC A;  3P1I A;  4B3N A;  3SIS A;  3ZXE A;  2HWE 1;  4CDX C;  4MXW A;  3K51 A;  1U0A A;  2WIN B;  3KT7 A;  3VD4 A;  4PI0 A;  4MGY E;  2HWC 2;  2HWE 2;  2FBE A;  3SHR A;  2RMU 1;  3BN6 A;  4B7E A;  5FZ4 A;  5FP7 A;  4OMD A;  4DRR A;  2RV9 A;  1JOB A;  1XSR A;  3T2P A;  3ALQ A;  2WT0 A;  1VBD 2;  4UW4 A;  2ZMK A;  4R4X A;  1WKY A;  5T5O A;  1V00 A;  5KXC A;  1UW8 A;  4BLJ A;  1QNW A;  4HVR A;  4RQP B;  2D6M A;  5KXE A;  3ZKU A;  4CDU B;  3WD5 A;  2WZE A;  3AP6 A;  2VY0 A;  1C28 A;  4XTM A;  5FJH A;  4N90 A;  3C3V A;  4XFI A;  3WOG A;  1K5M C;  2Z4F A;  4AEK A;  5C9A A;  3U75 A;  5LWB A;  3RZK A;  3KV9 A;  1RUH 3;  1IS3 A;  4MHR A;  1X82 A;  4E8D A;  4UFL A;  1WW4 A;  1SFP A;  4KG8 A;  2IXH A;  1GQP A;  2D6P A;  2UY9 A;  1AL2 2;  4GMP 1;  4EWA A;  3ACI A;  2IFR A;  4QXK A;  3D3A A;  1PM4 A;  3AKQ A;  4Q1R A;  3T2O A;  3J8F 2;  5FUI A;  4AE2 A;  2ZGU A;  3I4I A;  4MSV A;  4BQ2 A;  3DPR C;  1W8Z A;  1CN1 A;  2J1S A;  4LBQ D;  1ULF A;  1UY1 A;  1WCQ A;  3OUJ A;  1SLI A;  4OMC A;  1JOP A;  5FMD A;  3UGH A;  3AB0 A;  5DN2 A;  2ZGM A;  4A44 A;  4YM3 A;  2B7Y A;  5CB7 A;  1ND3 A;  5FPV A;  2GDF A;  2R04 3;  3A21 A;  1PIV 1;  2JEM A;  1REE A;  2D3P A;  4JDO A;  4WVM A;  4A41 A;  4FBF A;  4DRV A;  2XUE A;  1A8M A;  1N3P A;  4YGD A;  3EQE A;  1JYC A;  5FMO L;  4EV0 A;  1J83 A;  4GJZ A;  3FE5 A;  1RJ7 A;  1GQH A;  2NN8 A;  4V1P A;  5L73 A;  2ZGP A;  4ISQ A;  2PQS A;  1LRH A;  1H2M A;  1JUI A;  2G19 A;  1GP5 A;  5FZ0 A;  1K5M B;  4BQW A;  3WV6 A;  3N9L A;  3FC0 A;  3OYW B;  5LK7 B;  4YFW A;  4I30 A;  3VHN A;  1W8F A;  4LQR A;  4UBG A;  4COW A;  3U4X A;  1O3R A;  5A3W A;  2FHR A;  1EV1 3;  2WN3 A;  4PDW C;  3E5X A;  4OUS A;  3O7O A;  4ES8 A;  4XJ9 A;  2JWP A;  5L19 A;  1LU1 A;  3ZFG A;  4Q0Q A;  3IPV A;  1SLB A;  2LRO A;  3VBR C;  1U12 A;  3MEP A;  2XVK A;  5FP4 A;  4JVA A;  3OD0 A;  4A7Z A;  4PHZ A;  4NHK A;  2OA2 A;  2DF7 A;  1FXZ A;  2G1M A;  3ZOI A;  4YVS C;  1OVS A;  2E7T A;  3AMN A;  4YZ1 A;  1TQ5 A;  1C8M 3;  4WVM B;  2VJX A;  1UIJ A;  1SBF A;  2HBT A;  4NO4 A;  3K2O A;  4HMZ A;  5DQ0 A;  3O5S A;  3QOP A;  1DLL A;  5CIR A;  2CV6 A;  5HCH A;  1UX6 A;  2XON A;  4RFT 0;  3V0B A;  1FPN 1;  4HFS A;  1ENS A;  1QHD A;  3NNM A;  2R07 2;  1UU5 A;  1RUC 1;  4TLG A;  3J4U H;  4HG6 B;  2ZEW A;  4YG6 A;  4FOQ A;  3WNL A;  1F4A A;  2XQX A;  1H2L A;  4OHY A;  5T5J A;  2VME A;  3CJI C;  3LA3 A;  1I9R A;  1ZRR A;  3R0R A;  5CKM A;  3USS A;  5C33 A;  5FOB B;  4CVU A;  3EXU A;  3KMH A;  3OB8 A;  3RYK A;  2GU9 A;  3ROU A;  2R04 1;  2UUR A;  2ZGL A;  4HET A;  5LCW L;  4R4Z A;  4HT1 T;  1CES A;  3AP7 A;  5EPA A;  3WIN E;  2P3J A;  3HEI A;  3BYW A;  2DFC A;  3DPR A;  3GJA A;  3K3O A;  1HRV 2;  1W9W A;  2FCT A;  4KWL A;  4NAO A;  4NOT A;  4RQP A;  1QQP 1;  4W4Z A;  4QDR A;  4ASM B;  3LFM A;  2HWC 3;  4J1W A;  3WDY A;  2ZGT A;  1W6P B;  4NPR A;  4CEW A;  2Z2S B;  4MO3 M;  1H2N A;  3H7Y A;  4EJR A;  3PUS A;  4H3W A;  3WP6 A;  2A73 B;  1QQP 2;  1AUY A;  4XQD A;  4D69 A;  1ZBA 3;  4AED A;  3ZM8 A;  2OVU A;  2QE3 A;  2ZKL A;  2XHK A;  1GKB A;  5ANN A;  4BME A;  4XW3 A;  1QJU 1;  3U07 A;  1NCR B;  2G9F A;  1ALY A;  1XYN A;  2PYT A;  2VPV A;  4LEJ A;  2X10 A;  3WDU A;  1JBC A;  1QDC A;  2G9Z A;  4Y5T A;  3CBN A;  3MPB A;  5FWE A;  4QQ2 A;  1W6O B;  1RXF A;  1YFU A;  4DUX A;  4LMF A;  5A3M A;  4HL0 A;  4IGO A;  5A6Q A;  1EV1 2;  4MH0 E;  3VHR A;  1QMJ A;  3VBS A;  1LTE A;  1RHI 3;  1AXY A;  3NJX A;  1AXZ A;  2PHR A;  4YW6 A;  1ULC A;  3ZYF A;  2XJR A;  4UW5 A;  1TVG A;  1S0D A;  4KWU A;  1N3Q A;  5GLV A;  3U14 A;  4WVZ A;  3E6C C;  5J96 B;  2QQV A;  3OGS A;  2E63 A;  3B69 A;  1PIV 3;  1GMM A;  3J9S A;  3I49 A;  1K3I A;  2VZU A;  1BZW A;  4GXL A;  1OH3 A;  1C1L A;  4LHN A;  5FZ6 A;  1VIW B;  3S5A A; 
#chains in the Genus database with same CATH homology
 2ZXQ A;  2QQJ A;  4ET7 A;  4DEV A;  3MO4 A;  3A7Q A;  3OEA A;  4KI5 M;  4QDS A;  4TXW A;  1OT5 A;  1H6Y A;  2VZS A;  3DYM A;  3FL7 A;  3WNN A;  4ZXE A;  3VD5 A;  2C9K A;  4JKM A;  2B9V A;  2R7E B;  4DXS A;  4CU8 A;  1KGY A;  2VZQ A;  4E8C A;  2JKX A;  2Y8K A;  3C7O A;  3CKH A;  2L9L A;  4GZ9 A;  3T0D A;  3I2K A;  1JI6 A;  1W99 A;  2BGP A;  4DUV A;  4ARY A;  3HNY M;  1DLC A;  3NJV A;  4OZO A;  1W9T A;  1GNY A;  3DYP A;  3WF3 A;  3GM8 A;  2W3J A;  1JHJ A;  4QX3 A;  5HXM A;  5G05 L;  3SEE A;  2QQK A;  2Y6J A;  2J1U A;  3I3B A;  4JX0 A;  3IB3 A;  3K4Z A;  3K46 A;  4QAW A;  3OG2 A;  4TTG A;  5A1A A;  3DEC A;  2VZO A;  1UMI A;  3VDC A;  1JZ7 A;  2VZV A;  2E32 A;  3I97 A;  3T0B A;  3I2G A;  4ZZ8 A;  2DCK A;  3IDA A;  3WEZ A;  3MUY 1;  3ACH A;  3I2J A;  4QX0 A;  2YB7 A;  1NAE A;  4MGQ A;  4XUQ A;  3LEG A;  3CQO A;  4DXR A;  4M4P A;  2VR4 A;  5JUV A;  2X09 A;  1PMJ X;  4BK5 A;  1JZ6 A;  2VMC A;  2W95 A;  1L7Q A;  2J1V A;  1BHG A;  2VMD A;  4DXT A;  3MUZ 1;  2WAO A;  3OGV A;  3WNP A;  5JXG A;  1DP0 A;  3AC0 A;  3WF4 A;  1US2 A;  2BGO A;  4BDV B;  3DYO A;  3BGA A;  3I2I A;  2VC9 A;  5JXH A;  5LA0 A;  1L7R A;  3J7H A;  4RYD A;  4PT6 A;  1P8J A;  1GOG A;  1O8P A;  3THD A;  1EUT A;  1I5P A;  3E1F 1;  3W5N A;  4QB1 A;  1NX9 A;  2WDB A;  2QQO A;  4A45 A;  2EIC A;  2VZT A;  3ETP A;  3ABZ A;  3I2H A;  4QB2 A;  3K77 A;  1OD3 A;  2QQL A;  2V5D A;  1HN1 A;  2XHN A;  4D8M A;  1YQ2 A;  2WAA A;  4MGS A;  2VQT A;  5EIY B;  1XNT A;  4A4A A;  3WNK A;  2J1R A;  5I0D A;  4P00 B;  2JE8 A;  2VCC A;  1PMH X;  2CDP A;  2W47 A;  1JYW A;  4FI9 A;  5C71 A;  3T0A A;  2WAB A;  3IAP A;  2BZD A;  3UES A;  3SKV A;  4BXS V;  4ZY9 A;  4QX2 A;  2EIB A;  4XZU G;  1UYZ A;  3SKJ E;  1TG7 A;  2LW8 A;  3C7F A;  3OEB A;  2QQI A;  1W8N A;  1CX1 A;  2VO5 A;  1US3 A;  2WYS A;  1PX3 A;  3HN3 A;  3NQH A;  3I3E A;  3SEP A;  2VL4 A;  1O8S A;  2E26 A;  1GUI A;  1F4H A;  5B4N A;  2RJ2 A;  3MV0 1;  4W50 A;  5F7U A;  2DCJ A;  3P6B A;  2Y6L A;  1W0N A;  2W1S A;  1CZS A;  2DDU A;  5DMY A;  2Y64 A;  4LHS A;  4DEQ A;  4OYU A;  4CUC A;  2YG0 A;  2OKX A;  2W5F A;  3CDZ B;  3T08 A;  4A6O A;  4OUE A;  1ULP A;  5G04 L;  3U37 A;  4XUT A;  4AAX A;  3I3D A;  4UI9 L;  2VZ1 A;  3VD3 A;  1RYY A;  5B4X A;  4A3Z A;  3PUH A;  2W1Q A;  3CMG A;  5JR2 A;  1SG3 A;  3GXU A;  2VTF A;  2V4V A;  1SDD B;  2EID A;  3A22 A;  1OH4 A;  3K4A A;  3WF2 A;  1GOF A;  2WO3 A;  3HNB M;  2B4K A;  4XUO A;  4P5Y A;  3OBA A;  2VZR A;  1JZ8 A;  4QDQ A;  3WF0 A;  3C7H A;  3WF1 A;  1O59 A;  2YC2 A;  3WNO A;  3NNG A;  2HYX A;  2E31 A;  5IHR A;  2WBK A;  5IFT A;  4W8J A;  4Z2A A;  2YC4 A;  2ZEX A;  1ULO A;  2VZ3 A;  1NUK A;  1CZT A;  1PX4 A;  2E33 A;  4XUP A;  5JXJ A;  1H6X A;  3LQC A;  4KMQ A;  2ZEY A;  5IJR A;  3GGL A;  1MPX A;  3III A;  1R64 A;  4CU9 A;  1EUU A;  3GDB A;  2HLE A;  4DUW A;  4JKL A;  2JDA A;  4CU7 A;  3K4D A;  5JXI A;  3EYP A;  2BBA A;  3FHQ A;  1JYN A;  1LNS A;  2KD7 A;  2Y6K A;  2QQN A;  3T2Q A;  3MBW A;  4QX1 A;  4MAD A;  3NRU A;  3T09 A;  2J1A A;  2Y6G A;  5J1X A;  3K75 B;  4GWI A;  3VD9 A;  5LA1 A;  2WN2 A;  3A23 A;  2W87 A;  4PQQ A;  3LEI A;  1JYX A;  4JKK A;  3IAQ A;  4GWJ A;  4UOJ A;  3THC A;  3P1I A;  1JZ4 A;  4ZZ5 A;  4BK4 A;  2BER A;  2WO2 A;  3LEK A;  3VD4 A;  2W92 A;  3BN6 A;  4OMD A;  5LA2 A;  2W1U A;  1CZV A;  2RV9 A;  3T2P A;  1UYY A;  2W91 A;  3ECQ A;  5EJ1 B;  1WKY A;  4A42 A;  2VQU A;  3C7G A;  2J1T A;  3C8X A;  2WZE A;  1XPW A;  2WO1 A;  3C7E A;  2Z4F A;  4CUA A;  4E8D A;  1XNA A;  2W94 A;  1JYV A;  1GQP A;  2VZP A;  3ACI A;  2J1E A;  2LS6 A;  5CZK A;  3HPN A;  5EJZ B;  3D3A A;  3T2O A;  5FUI A;  3ACG A;  2C4X A;  5IFP A;  3MV1 1;  1K45 A;  2J1S A;  1W8O A;  4QB6 A;  1UY1 A;  1JU4 A;  1WCQ A;  4OMC A;  2W1W A;  5DN2 A;  5DPN A;  3VDA A;  4A44 A;  1OF4 A;  1W9S A;  3A21 A;  3CZJ A;  4L0P A;  4PF1 A;  2V72 A;  1JZ2 A;  3W5M A;  4A41 A;  2VM9 A;  4BJ0 A;  5IYY A;  2WQ8 A;  5CYY A;  1J83 A;  2Y6H A;  2YFU A;  3CZU A;  4M4R A;  4IUG A;  2VOT A;  3WQB A;  2VCB A;  3WNM A;  2PQS A;  2CDO A;  3HOB A;  3WSO A;  1UY2 A;  3FHA A;  1UY4 A;  1UY3 A;  1XC6 A;  3EB7 A;  3PUI A;  4LKS A;  4AG4 A;  4LQR A;  5HPO A;  1GOH A;  2WN3 A;  4ARX A;  5C7G A;  1OF3 A;  3FN9 A;  4P08 A;  2XOM A;  1UWW A;  1UX7 A;  2WZ8 A;  4XUN A;  4XUR A;  1J84 A;  4JHZ A;  1UY0 A;  2RVA A;  2VJX A;  5DQ0 A;  2VMF A;  2XON A;  5C70 A;  1UMH A;  3HNM A;  5JMO A;  4P02 B;  1D7P M;  3LPG A;  3VDB A;  3VD7 A;  3F2Z A;  4HG6 B;  2ZEW A;  3WNL A;  1F4A A;  2XQX A;  3UET A;  4D0Q A;  2VME A;  2J7M A;  1SHW B;  4CVU A;  1UYX A;  2ORX A;  3OB8 A;  3LPF A;  5LCW L;  1JZ3 A;  1UXX X;  2YFZ A;  4QPW A;  1UXZ A;  2J22 A;  3HEI A;  1W9W A;  2W9X A;  4XVH A;  4YPJ A;  2ZEZ A;  4W4Z A;  4QDR A;  4MOA A;  1KEX A;  1T2X A;  4MO3 M;  1IQD C;  3CIH A;  3ZM8 A;  3JXS A;  3ACF A;  1JU3 A;  2X10 A;  2EIE A;  2QQM A;  4RN5 A;  1K42 A;  2JD9 A;  2X05 A;  2VCA A;  4DUX A;  2ID4 A;  2C26 A;  1NKG A;  3UNP A;  2W46 A;  3I2F A;  3NJX A;  2WUH A;  4LPL A;  1UZ0 A;  1TVG A;  3OGR A;  4KWU A;  4CU6 A;  2ORZ A;  3OGS A;  1DYO A;  3HJR A;  1GMM A;  2QBX A;  4UAP A;  1GU3 A;  1K3I A;  1JZ5 A;  1K12 A;  2VZU A;  3LE0 A;  4CUB A;  1CIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...