2HLEA

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
188
Chain Sequence
AGHHHHHHEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
molecule keywords Ephrin type-B receptor 4
total genus 31
structure length 188
sequence length 188
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2hleA00
4Z2AA 3C7GA 2OKXA 3WSOA 3CDZB 5IYYA 2C9KA 4TTGA 3ACFA 2EIDA 5CYYA 2X09A 2E26A 1JZ8A 2QBXA 2BZDA 4AAXA 4CUCA 2BGPA 1US3A 2VJXA 2V5DA 2YG0A 2VC9A 3WF0A 2J1UA 1GQPA 1I5PA 1NX9A 2QQKA 2Y6LA 3ACIA 1TG7A 2YFZA 4P08A 2EIEA 4LQRA 5JUVA 4DXTA 3VDBA 3E1F1 3IIIA 1UYXA 3EYPA 3K75B 3OGRA 5JXIA 2BGOA 1UY0A 3NJVA 5I0DA 3VD9A 5J1XA 1OD3A 5JMOA 4QX0A 2CDPA 3I3EA 2VZPA 2WBKA 3IAQA 4ARYA 4CU8A 4PT6A 3LPFA 4BJ0A 1NAEA 3GDBA 3LE0A 4QDQA 2BERA 3WF4A 2KD7A 1UZ0A 2QQMA 2X05A 3U37A 1W0NA 4XUPA 4JKLA 3F2ZA 1XNAA 3WNPA 3IAPA 3MO4A 2JDAA 3OGVA 1OF3A 2QQNA 1ULPA 1JU4A 4ZZ8A 5IJRA 4DXSA 4OMDA 4IUGA 1H6XA 1UXZA 3BN6A 2Y6GA 2Z4FA 3A23A 3VD5A 3WF3A 1GNYA 2WDBA 4QX2A 3C7FA 5JR2A 2J1AA 2W46A 2VQTA 3J7HA 3VD3A 2HLEA 1W99A 2VO5A 3OG2A 2ZEWA 3LQCA 2V72A 1SDDB 2W94A 3C7EA 2WABA 4CUBA 3MUY1 2VR4A 1UY2A 2CDOA 3AC0A 3OEAA 2WZ8A 4QAWA 2W1SA 3HOBA 4CU6A 2JKXA 2ZEYA 4DEVA 1JYXA 5DPNA 1US2A 4OMCA 3CZJA 4A45A 1CIYA 4PF1A 3P6BA 3DYMA 1EUTA 3HNBM 1DP0A 1JU3A 5JXHA 2ORXA 5C70A 1K3IA 4BXSV 4XUTA 4XZUG 4QX3A 3I3BA 3I97A 2W95A 3DYOA 2W87A 1UWWA 4RYDA 3T0AA 3PUIA 2W92A 2RVAA 4LKSA 1PMHX 3GM8A 1ULOA 1H6YA 2XOMA 3FL7A 2EIBA 2VCAA 1O59A 1L7RA 4DUWA 2VMDA 3FN9A 3NNGA 3I2JA 2YB7A 4A4AA 3PUHA 4QDRA 1W9TA 3T08A 2VZRA 3UETA 1UX7A 2ORZA 4LPLA 4CVUA 1GMMA 1TVGA 5FUIA 3A7QA 4ZZ5A 4KMQA 3GGLA 5IHRA 3ACHA 3UNPA 2Y8KA 2VMFA 4JKKA 4MO3M 5DQ0A 1SHWB 2C4XA 3NJXA 4MOAA 4DUXA 1CZVA 2X10A 1T2XA 1OH4A 3A21A 1GOFA 2W1QA 1W8NA 2W5FA 1HN1A 1WCQA 3T09A 2J1SA 2XHNA 1EUUA 4P00B 1W8OA 4M4PA 5G05L 5B4XA 2J22A 1CX1A 4ET7A 2WN2A 3CQOA 2E31A 4ZXEA 1JHJA 2JD9A 3OGSA 1XPWA 4BK4A 3I2IA 4UI9L 3LEGA 1LNSA 4DUVA 4OZOA 2Y64A 3CZUA 3WNMA 4QPWA 4RN5A 1MPXA 2WO1A 3MUZ1 4QX1A 3K46A 3LEIA 5EIYB 2B4KA 3P1IA 1O8SA 5DMYA 2XQXA 1F4AA 1P8JA 2VZSA 1RYYA 2VZQA 1J84A 1R64A 3K4AA 4QDSA 1UMHA 3MBWA 2VZVA 3MV01 3WNKA 4D8MA 1JYVA 4KI5M 3VD7A 2VZ1A 3DECA 3T2PA 3CMGA 1O8PA 4W4ZA 3W5NA 4XUNA 3VDAA 1UYZA 1UXXX 2DCJA 3I2KA 2Y6KA 3ECQA 1XNTA 2DDUA 3T2QA 3FHAA 4GZ9A 4MGSA 2Y6HA 4YPJA 3C7HA 2W47A 3OB8A 1JZ4A 1W9SA 3ZM8A 3K77A 3WNLA 2WQ8A 2VZ3A 1JZ7A 1GOHA 3VD4A 3A22A 2Y6JA 4GWIA 4TXWA 3HN3A 5IFTA 1JZ3A 3SKVA 4A41A 2W1UA 1DYOA 5A1AA 2DCKA 4W8JA 3C7OA 3SEPA 5HXMA 3IB3A 1UY3A 3K4DA 4AG4A 3FHQA 2VZTA 2YFUA 2BBAA 3DYPA 3LPGA 5LA0A 4L0PA 2WUHA 4OYUA 1PX4A 2QQJA 2VMEA 3IDAA 3JXSA 2J1EA 4XURA 4E8DA 2RJ2A 2VZUA 2YC4A 3K4ZA 4A3ZA 2B9VA 2R7EB 1UY1A 1DLCA 3ACGA 4JKMA 1JYWA 3WNOA 3NQHA 3LEKA 5F7UA 4PQQA 3WQBA 5LA1A 5EJZB 4JHZA 5EJ1B 4KWUA 1GOGA 4CU7A 1OF4A 1OT5A 3CKHA 2VQUA 3CIHA 2QQIA 2J1RA 4E8CA 1W9WA 4ZY9A 1CZTA 5DN2A 3THCA 2XONA 3W5MA 4W50A 4P5YA 5C7GA 4M4RA 2LS6A 1KGYA 1NUKA 3HEIA 3OEBA 3OBAA 2VL4A 1BHGA 1UY4A 4QB2A 4CU9A 5JXGA 1L7QA 5LCWL 3HNYM 4A6OA 4HG6B 2EICA 4D0QA 2J1VA 2VCBA 4XVHA 5B4NA 2QQLA 2V4VA 3D3AA 4MADA 4MGQA 5HPOA 2L9LA 5CZKA 5C71A 3THDA 1GU3A 2E32A 1PMJX 4BK5A 3WF1A 3WNNA 4UAPA 1CZSA 4GWJA 3T0DA 4CUAA 3I3DA 4BDVB 2PQSA 2C26A 1YQ2A 1IQDC 3WF2A 2W9XA 4JX0A 2VZOA 2J1TA 1D7PM 3HNMA 2ZXQA 1UMIA 4ARXA 3I2FA 3BGAA 1JZ2A 2WAAA 1SG3A 1PX3A 2HYXA 3MV11 2VOTA 1XC6A 4DXRA 4DEQA 5JXJA 2LW8A 4XUQA 2W91A 3SEEA 1NKGA 2WAOA 2WZEA 4FI9A 2W3JA 5LA2A 3SKJE 4QB6A 1F4HA 3GXUA 1JI6A 3VDCA 2ID4A 2VM9A 2WO2A 3I2HA 2VMCA 2WYSA 2QQOA 3I2GA 3UESA 4OUEA 2WN3A 3ABZA 2VTFA 4P02B 2ZEXA 5G04L 4A44A 5IFPA 2E33A 4A42A 2JE8A 1J83A 2VCCA 2YC2A 3EB7A 4UOJA 1UYYA 2ZEZA 1K42A 1JYNA 4LHSA 1JZ6A 3T2OA 4XUOA 4QB1A 3HJRA 2W1WA 3HPNA 1WKYA 3C8XA 3WEZA 1KEXA 1K45A 1GUIA 3ETPA 3NRUA 1K12A 1JZ5A 2J7MA 2RV9A 3T0BA 2WO3A
chains in the Genus database with same CATH superfamily
1UIKA 2FD8A 5BNNA 1LTEA 1N1YA 3LWCA 1TME1 4HN0A 3CDZB 5IYYA 2ZGSA 2MEV1 1DLLA 1XJAA 1A6CA 4BPZA 3E6BA 1W6PA 2E26A 1WCSA 2D6OX 4M3CA 1LOBA 1YLLA 3GYDA 3J9SA 4AAXA 5FDBA 1R091 3CJIA 3KCXA 5FP3A 2BGPA 2YBSA 1MS0A 1NCRA 2YY1A 4Q1RA 5DZEA 1QMJA 5A7PA 1JYCA 1MZ5A 1OHFA 2CV6A 1REDA 3DXTA 4YLZA 3WF0A 3KLSA 5C8CA 4WM7B 3RZJA 4YVWC 4ZKTB 3ACIA 5EWSA 1TG7A 2I2SA 4OI0A 1OQEA 1QJZA 1WBLA 2Z79A 5JUVA 4UF0B 1W8TA 2PLV3 2UYBA 5IUQA 5BNNB 3IMNA 1BYHA 4IESA 4XZPA 4AFBA 2GH2A 4LA3A 2JXAA 2K46A 1ND2C 2WNVB 1PMIA 3E1F1 4GMP1 5A3UA 1QH7A 3LSEA 2XGXA 1OKQA 1UYXA 3ENRA 3WG4A 2WFF2 4OUMA 5FP7A 3O14A 1UD1A 4WZCA 3R4DB 4UYBA 5JCTA 3APBA 5FUNA 2ZGLA 5J1XA 1XU1A 1QU0A 2QCSB 4GKYA 5JMOA 5T5PA 1VBD2 3BOWA 4AXOA 4K20A 3LDBA 2FCTA 3D4KA 2CDPA 3M1HA 3I3EA 3SLIA 1GQGA 2XWBB 4L8QA 2Q30A 1HXS2 2WRAA 5D1IA 4AGGA 3HAGA 4ARYA 3CO2A 3AZYA 3PUAA 1ONAA 4QDQA 1ENSA 2BERA 2JECA 4LE4A 2KD7A 1VAVA 2X05A 3UKTA 2JDNA 1F5FA 1VBD3 4MG2A 2VBDA 3KGLA 4XUPA 4RA0A 4C90A 1XNAA 2RS32 3ILNA 1B09A 2FMDA 3J4UH 3NO8A 3PURA 5FJKA 3RYRA 5FPUA 2RDQA 5JSRA 2PN5A 2JDAA 3K3OA 1OF3A 3Q9OA 4IE0A 4W6YA 4AVVA 5C5UA 4AQ2A 1PGSA 1UIJA 3SNMA 2D43A 1ND3B 3ZXDA 1H8VA 2VNGA 1HRI1 1Y9MA 5IJRA 2A1XA 4YFWA 2ZHNA 4WBBA 3VN4A 4DXSA 2PAKA 1RXGA 3OYWB 4IUGA 4AFCA 4YSFA 1RINA 1TZOA 2Y6GA 3A23A 1OMIA 5J09A 1XE7A 4MGZE 1VB4A 2KA3A 4YM2A 1EAH2 5GALA 3TB0A 4MGKE 1UZYA 4Y1ZA 4NO4A 3H3ZA 2D6PA 2R0HA 1AXZA 2DFBA 2PHDA 4Q4X1 5BNPC 2X53S 4LULA 5IAVA 3WCRA 2VQTA 3LDRA 4CDWA 2P1BA 3LKJA 1BBT2 5FQ0B 5CKQA 3NJYA 1VALA 4HBNA 4ASMB 1BKZA 4V2VA 3SHRA 3WR0A 2ZGRA 1AR82 2VUAA 3MLLA 4CUBA 3PDQA 4AW7A 3MFCA 3MUY1 4XILA 4CP9A 5H9QA 3RZMA 2WSVA 1BEV1 5ABJC 1V6JA 1LESA 1LRHA 5F2SA 2ENRA 1YFWA 4LT5A 1NLSA 1VBB3 3POBA 1OA2A 5ABJB 2BP6A 1ND3A 4NPMA 1XB9A 2RS53 5EFUA 4DEVA 5ABJA 4TZDA 3V0AB 5FZIA 4AHXA 2ZBJA 3MPPG 1OPOA 4K40A 1PM7A 1S0JA 3CZJA 3B02A 4A45A 1COV3 4QX8A 1CIYA 1SLTA 5DUUA 3GCXA 3BODA 5DAWA 4QQOA 4HOOA 4XXPA 3AFGA 5JXHA 1YFUA 3GNEA 4FXGB 3J8F1 5BNPB 1BEV2 2XH6A 1KDKA 4QX3A 1OLRA 1YQCA 2BGCA 1W8FA 3OSDA 5FYZA 5A32B 2R042 4W6WA 3SQOA 4Q4V1 3U4XA 4Y24A 4Q0QA 1HB1A 2JEMA 4BU2A 3S57A 2W87A 5JZGC 2OUJA 2B9UA 2FDIA 2OA2A 5GZEA 4QGNA 2QE3A 1CQ9A 3MLKA 5KHIA 2W92A 1QNWA 1EV13 4WZFA 3VBSB 1QWRA 1IQAA 1H6YA 4A7KA 5CIRA 2EIBA 1U5XA 2VCAA 2E7AA 1NA1A 3MPBA 1JHNA 1FATA 3I2JA 1ULEA 1OVPA 2NQYA 2WT2A 3U0ZA 2D3PA 1UU4A 4QDRA 4EN9B 1WGPA 5FZ8A 4CXXA 1W9TA 1JBCA 2ZAHA 5FO9B 1S1AA 2QKDA 3UETA 2OZJA 2JJ6A 4LNVA 2DBNA 1VJ2A 3UGGA 2ORZA 3OBTA 1G7YA 1MEC2 4BCUA 2VMGA 1BCXA 1IGOA 1RHI1 5F39A 4C1XA 1TVGA 4QQHA 4CDXC 3ON7A 4WM8B 3WX5A 1DGLA 1AL0G 2V09A 4LBKA 4WM8A 4I09A 4EN0A 4B29A 2VOKA 1AR73 5F5QA 4H2AA 4J6GA 4XJZA 3UNPA 4AEDB 1ZRRA 4WM8C 1S0CA 3VBSA 2HWC2 4NAOA 1X50A 3POFA 1W8WA 4MOAA 3ATGA 1VE0A 1JODA 4D7YA 5LEJA 1GV9A 1CZVA 1RUD1 3H1MA 1MS9A 1CVNA 3D6EA 3ZDSA 1UQXA 1RB8G 1T2XA 2O8QA 1OH4A 4R4XA 5CEHA 1X33A 1NXD1 4K8FA 3UKNA 3TN91 1EUUA 4YVWB 5A33B 4J1WA 2LUWA 3AJYA 1W8OA 4TLGA 4WM7C 4YW3A 3PJYA 4Q29A 4C91A 1YFYA 1GANA 3WDVA 1N3OA 2WNEA 1ZYBA 4D7TA 4CUGA 4JTOA 3ZVXA 4LUMA 4ET7A 4Q4V2 2ZGMA 2E31A 4ZXEA 2JD9A 3OGSA 3HWJA 1UCXA 3NV2A 4DUVA 5E88A 2AREA 4B7EA 4QGMA 5I8SA 3AP6A 3WNMA 1G9AA 4OQ9A 3R0RA 1RMU2 2JDUA 1UYPA 2ZABA 1GNZA 3U07A 1UNBA 2BQPA 3VHOA 1FX5A 2FDJA 1LOGA 1LEMA 4QPWA 4RN5A 1RUC3 3WOGA 3MUZ1 3GALA 2ZX4A 4JRAA 3IBMA 4MSVA 5HV4A 1N3QA 3W21A 1F4AA 3ES4A 1O3QA 4U36A 2VZSA 1RYYA 4B1MA 2XQRA 3WUCA 2O1QA 5C9AB 2VXJA 3E5XA 3PMEA 4AVBA 5TSWA 4PF5A 2K9ZA 3AP7A 3ITQA 1W2NA 3POEA 4D8MA 2B8MA 2F4PA 4IE4A 4JDNA 4CDWB 3GZAA 3GCWA 1FOD2 4BQYA 2XLFA 3CMGA 3INAA 3O7OA 1PZ8A 3W5NA 2E9QA 3I54A 3DXUA 3WT3A 1TMF3 2R0FA 4AEDC 1PM4A 4EZHA 2LALA 4AYUA 4YZ4A 2ZGPA 2Y6KA 3ECQA 3B93A 2BFUL 5AC93 3IMMA 2NLRA 2VOXA 3FHAA 2WYFA 2E63A 1D2SA 4BQ3A 2D5HA 5H9RA 1VBC2 1Q43A 1I5ZA 4CA9A 3MHZA 3VZLA 1HRI2 3JBG1 1GOHA 1R1A2 4RQPA 3VD4A 3R4SA 2BW8A 4AI9A 4XCAA 5FYYA 2R6QA 3VBUB 1BVP1 1GP4A 1MQTC 1LOCA 4JTNA 2V5YA 5IFTA 4XFGA 5M0TA 1AR61 3KB5A 2DTYA 5A1AA 2FHRA 3PU3A 4KBBA 3WDYA 4CDXA 3WXPA 2DCKA 4FPJA 3C7OA 1ZRIA 4XTPA 1WW4A 2NYYA 3FHQA 1C8M1 2XDVA 4YW1A 1EPZA 3KVAA 4QXKA 1G9DA 2CYFA 2QFEA 3LPGA 5ACA2 5LA0A 2H6BA 3ZSEA 2IFRA 1ND3C 1PX4A 1YIPA 4NIAA 2QQJA 4Y5TA 3ZLIA 3IDAA 3K2OA 5FAXA 5J48A 3TEWA 4XJ9A 1RMU3 1PIV1 2VVEA 3ASIA 3AMNA 1H2LA 1SLBA 4YZ3A 2HWC1 3FFZA 2R7EB 4G3YC 1JS9A 1O7FA 2KR2A 4JKMA 5FMCA 2RMU1 3NQHA 2JE9A 2ZGNA 4JGYB 3HR9A 4PQQA 1AXKA 5A6QA 5BYNA 4NR1A 4OI2A 5LRRA 3B01A 3CLPA 2WZPP 1RHI2 2JG8C 4CU7A 3B3QE 1QJFA 2VQUA 4IV1A 4L9BA 3TNPB 2RS12 1PGL2 2QQIA 2GN3A 5KC5A 1RVF2 2PAMA 1MZ6A 4G4FA 5C8CB 3KCCA 1J3QA 1LHWA 3LZZA 2JENA 3IT8A 5GM0A 4CTEA 2PYTA 3CF6E 4AVCA 5FZOA 4JC1A 3EBRA 3BTAA 1NUKA 3HEIA 1YI7A 4FFHA 4UFJA 3I3MA 1YJLA 5AC91 2G19A 1HX6A 3POYA 1OC1A 1EV12 2D3SA 1BHGA 2A3YA 2WNVC 5FZ6A 2XR4A 2WO7A 5FK7A 4AF9A 1OFSA 3VKNA 4XFHA 5C3OA 5FY9A 3SITA 1AX0A 1WW6A 3A0NA 3DGTA 3EO6A 1PZ7A 2VXRA 4LO4B 4XVHA 4EYUA 2OYZA 2L9LA 2XHKA 2QDRA 3S6PA 3B5LB 1QKQA 2VUCA 1GZ9A 4YGDA 4PQ9A 5CG8A 1C28A 4R52A 3THDA 3AXEA 1NOVA 1AYM2 1UAIA 3FE5A 1FPN2 1PMJX 3B00A 4JQTA 5FZGA 4BK5A 2P17A 1WW5A 1CAXB 1COV1 4NWVA 3T0DA 1IG3A 4ZONA 5F2WA 1GP6A 5FZLA 5LEKA 4OI4A 3VLBB 4AGRA 1RUOA 4MHUA 5IWFA 5C3SA 4WVVA 2D6LX 1GBGA 1QXJA 1PVC2 2DFCA 2E7TA 4BB3A 1PO21 4JX0A 5KR7A 2J1TA 3H50A 5IVYA 4XHXA 3X29B 4BMBA 4LORA 3U10A 3ME2A 1I6XA 1UMIA 3ZFFA 2HBTA 1TMF2 4N9HA 3RG0A 1H2MA 1JZ2A 2GDFA 1W0PA 1MVQA 2JG9B 2Q8OA 1S0FA 3MV11 5T5JA 2VBPA 3KHCA 3AL6A 2Q4SA 1FYUA 2VTXA 2W39A 2LW8A 1YQ8A 2BEOA 1PO11 1RJ8A 2W91A 2WS93 3PIJA 3SEEA 4CPBA 2J42A 2GZWA 4GH4C 1SZBA 2CY6A 3USUB 2PHWA 3HN1A 4AI3A 2WZEA 5FO8B 1DQ4A 1MS8A 4PBOA 2D44A 1I3HA 1CIWA 4IV3A 1WBFA 3GXUA 4HKWA 3VBHB 3UKVA 5DAVA 4E9KA 3VBFA 4R9BA 1DZTA 4JGZA 5DAPA 5LATA 1VBA1 3PTYA 1CX4A 1H1MA 2W68A 2PHUA 3H1YA 1SFPA 1VR3A 4Z8BA 1AR62 4NIHA 4XIOA 2VTFA 1WCKA 2GC1A 3TN93 2Y6FA 1U12A 4AQ6A 2BWAA 1C5IA 3JD71 3KT1A 5JVVA 2Q1FA 1BBT3 4H14A 4XF4A 4CEYC 2AR6A 2ZEZA 4AAPA 4YZ1A 4LO6B 1JYNA 2WKKA 3RRDA 2B42B 2PELA 2ZPXA 4JDOA 4AEDA 4EWEA 3WVJA 4HVQA 3M3EA 2YU2A 3K3NA 4QPGA 3K51A 1PVC1 1SLCA 1WKYA 3C8XA 2EIGA 4P9IA 5F1RA 2BOJA 2NZ9A 2FDHA 1WCDJ 2BYVE 4Q0PA 1CAVA 1K45A 3EHKA 4PBPA 3RZGA 1HRV1 3ETPA 4P9LA 4RHV3 4LBQB 3NRUA 3PL0A 1JZ5A 4JZRA 3VUOA 3BU7A 1AR72 3IPVA 1QJU1 4FP3A 3KV4A 4BWOA 2WO1A 2WO3A 4N53C 4XETA 1D4VB 1OBNA 3NAPC 4HK9A 3E5QA 4RQPC 3DPRA 3MZHA 4MVTA 2A6YA 5FZKA 4A3XA 2AGSA 2PMWB 1NCQB 2WWSA 2XJUA 3C7GA 2AYHA 4RGAA 5DDJ2 4EV0A 3R4UA 4GMP0 3KS7A 4ASKA 1DGWA 3K48A 1UZWA 3POGA 5CISA 2G9FA 1NT0A 5LBFA 1TEIA 3P3NA 4L92A 3MW2A 2DTWA 3D0JA 1HXS3 2A3WA 1QOOA 3OD4A 3V65A 1HB2A 1GQPA 3FJSA 4Y33A 1NX9A 3VHPA 3S7IA 1RUF2 2YFZA 5JAXA 1CAVB 2Q0AA 4LQRA 5FLIA 5K7PA 5L7OB 5LRSA 4AQTA 3S30A 4X6QB 4FT8A 5SV8A 1FXZA 3BVCA 2RM23 1VPHA 4RR3B 4CE8A 2R1DA 3BOPA 1CAWA 1BVVA 5BNOB 1JUIA 4CYDA 5H9PA 4AK3A 3NJVA 3PUQA 5FYMA 3WW3A 2R043 1Q5OA 3KQRA 1ZBA1 2UY9A 1QQP1 5DAQA 5L19A 5HCHA 1LODA 1QJX3 2HWF1 3BU0A 4Y1UA 3HT1A 3SH4A 2BBVA 3WY6A 1RUG2 2I74A 2WBKA 4Q4W2 1KJLA 3OUJA 4R8HA 3OPZA 1ODNA 3IAQA 3BB6A 4PDWB 3FZ3A 4CDUA 3NNFA 1OUXA 3ZYIB 4C8DA 2CTVA 2VTXJ 5EP9A 1MS4A 1NAEA 3GDBA 1UPIA 3SMHA 5EZWA 1LAJA 5C9AA 4EJRA 2DU1A 2WQ4A 2WNVA 1UZ0A 1NCRC 4QU2A 3V0BB 4CCJA 1VBB2 1C8M2 1W0NA 1DZRA 3P3PA 3LA7A 1LJ7A 5A7NA 1RXFA 4F7ZA 1YEWA 2WFF1 4HMZA 2ET1A 3JD72 1UOBA 3MO4A 3MIGA 1W0OA 3PLQA 4QWNA 3OGVA 1WCUA 2QQNA 1ULPA 1N1VA 3GHMA 2XBO1 2ZX2A 4DRVA 3JZVA 2ZX0A 1H8TA 4ZZ8A 1LR5A 1V00A 3AL5A 1ACCA 5A6XA 5I8YA 1KFXL 1H6XA 1UXZA 1REEA 2GNMA 3AZWA 2YUEA 3BN6A 3MICA 3OOXA 3VD5A 2BU9A 1XNKA 4AR2A 1OA3A 4FQ4A 4QX2A 1VMJA 2XL9A 4AFDA 1W90A 4PI2A 2RR11 1QJY1 2J1AA 1UN1A 3AP9A 5FBJA 5D21A 2HLEA 3VD3A 2NPIA 4BZ4A 3S0MA 2CL2A 1XNDA 3AZZA 1W99A 1UOGA 1DYPA 1ZZ6A 4OCTA 4UW3A 5F32A 4NIIA 3FMGA 2JDZA 3V64A 2ZHMA 1F2NA 1POV0 1KS4A 1SDDB 2V72A 3BPSA 3C7EA 1SPPB 1HB4A 1ZNPA 1NLRA 1GLHA 4O7XA 2DCZA 2CDOA 5A7QA 1V6OA 1ZBE2 2RS33 3DUIA 3OBZA 5EJ3A 4DXZA 1QEXA 1S0DA 5FZCA 1GZTA 2YROA 5IK4A 2YU1A 3ZPOA 4XJUA 1W9YA 3FHIB 4EWAA 3QACA 4GH4A 3H8OA 2JKXA 4FVVA 3U14A 2ZGTA 1SBDA 4COZA 3CJIB 5FP4A 2CGOA 3ZXKA 1JYXA 1WMXA 5DPNA 1US2A 5FPZA 3GJBA 1CD3G 4PF1A 3N3HA 5A3PA 2HWB3 4A7YA 3DYMA 1SLAA 2HKXA 2Y26A 2AACA 3H7YA 3ZFGA 1VMHA 3HNBM 5FWEA 1Q56A 2YPDA 4D69A 1F5JA 3WP5A 3ZYJB 2ORXA 4FPOB 1K3IA 5C70A 2IFWA 3IWZA 3TYJA 1TME3 5T50A 4B4QA 1OLQA 1ZZ7A 1W04A 1GWKA 1UF2C 4S2DA 5LW9A 4Q4Y2 4JRLA 5KHKA 5A7WB 2R062 3BUCA 1ZRDA 3T0AA 4C0HA 1ZZ8A 3NV4A 1VBE1 4XQ4A 3MYXA 4FAGA 2WR9A 4Q4X2 2LRPA 4NWWA 5FYVA 5FZOB 2WS91 3GBGA 3LB9A 1S0GA 2DV9A 3SISA 3KSCA 3WP3A 3LFIA 3ZFFC 1LGBA 1K5MA 3U1XA 2JG8B 2PTMA 1LOEA 3FN9A 4QHOA 3WDWA 4UWDA 4PLOA 3ZXLA 3PUHA 1IS5A 4A4AA 3W20A 1E5HA 4RS5A 1NE4A 5HCBA 1W6PB 1UX7A 3T1MA 5KHJA 4EZ4A 2F6BA 4FCAA 2JB8A 4Y4RA 3RYKA 2LTNA 3TWIA 2ZGQA 1AUYA 2FBEA 1V9U3 3IDBB 4FPHA 4ITCA 3AVRA 2JB4A 3ZN6A 1W6MB 1XXNA 1C57A 4HT1T 4CCLA 4CDQB 4ZZ5A 2YMZA 3I3QA 2EAKA 1DCSA 1SEFA 5FREA 1POV1 4LHNA 3WW4A 5E6HA 4NAMA 1DIWA 3VBFC 5JPNB 1BMV2 3GBWA 5KC6A 4JGZC 1LOAA 1JOPA 1LOFA 2Y8KA 3B94A 2ZX3A 4MO3M 5DQ0A 1W2AX 3VBOB 4CSWA 4FPKA 3H8XA 3ZX7A 2IXLA 4DUXA 4JGYA 2C24A 2Z42A 4L2NA 4MGYE 2R072 3VBUC 4XBNA 4DY3A 3EJKA 2DYCA 1V6MA 4AVSA 2WS92 3FLTA 2JX9A 2O14A 3T09A 4IL7A 1AL22 5HV0A 4BQWA 5B4XA 2A6XA 3MI8A 3KT4A 1KQRA 4EWDA 1Q8SA 1CESA 4AEMA 1H4HA 2J22A 1UZVA 4FTSA 3FBMA 5IK8A 4ONUA 1POV3 3ZKYA 1HQLA 2I45A 2ARCA 4UI9L 1HQNA 3ILFA 5FXVA 1LNSA 1W3XA 3LFMA 4XF1A 4LBLA 3ZSLA 4Q8LA 5HCFA 4HFSA 3MEPA 1EV11 4IEPA 5E16A 4IEZA 5FLJA 1VMFA 4IE5A 1RGSA 2AC1A 3AB0A 3PVNA 4OZXA 3ZYPA 3M8LA 2AEYA 1I9RA 1VB2A 3Q8CA 2G4IA 4BYYA 4YG3A 2VH9A 1MQTA 3MIEA 4LTAA 1DF0A 4QX1A 5D2AA 3JCIA 4C1WA 1V6NA 1LECA 2WINB 3AP4A 3P1IA 3VHNA 1O8SA 2ZKNA 3B69A 4LLFA 3MIHA 5D8AA 2RMU3 5DUXA 5LBBA 3W58A 3ZYRA 1XYOA 1D4M2 4HSLA 4XQWA 3VL9A 1J84A 2IXJA 4MXWA 4KG8A 2Y0OA 4QDSA 4BIFA 4OULA 4YVWA 1MZFA 3I7DA 2XUEA 3AKRA 3UK9A 1W3VA 3FFQA 3N9PA 3MV01 4ZU5A 3WNKA 4XJ8A 4D3WA 2VZ1A 4FPFA 3T2PA 5KBFA 2D7FA 4JCKA 1G9FA 1U5YA 1ZA7A 1G86A 5I0UA 3W5MA 3GZUC 1L7LA 3AYDA 2R16A 3MGUA 4N8MA 2DCJA 3FBYA 3MIDA 4I3PA 4RFT0 5FLHA 2VY0A 4CCNA 3U78A 5FQ0A 2QJVA 3NMBA 4HL0A 2CU5A 2WNOA 3T2QA 1RUE1 1VAKA 2Z69A 4GZ9A 2OT7A 4F83A 2R073 1N3PA 2R49A 4WVMA 3RJRA 3POSA 3C7HA 4YPJA 1AR91 3JBG3 1JZ4A 3TOJA 5F5IA 4QX7A 4IEXA 3K77A 1H0BA 1ULGA 4QMAA 3RGBA 4L99A 3ZIWA 5ANQA 4CCEA 2IZWA 3W59A 3CL1A 3A22A 1MS1A 2W2IA 2WZR2 1BK0A 5GLUA 1VP6A 1O91A 3SKVA 3O0XA 3RZKA 1YYNA 1N47A 3O0WA 1FI2A 5F3EA 2D97A 5A3WA 4AZZA 4COWA 3VDBA 2CWMA 4W8JA 2DCTA 5HXMA 5FTTC 2GU9A 1FMD2 4BIOA 5FZEA 5FMDA 3SCFA 1OI6A 2D5FA 4UFIA 2W08A 3UT0A 4LUKA 2RJKA 4GJYA 4OYUA 5EV7A 4AFMA 4AOCA 3AZVA 2HWE1 2VMEA 4E27A 3I2OA 1WMDA 1ENXA 2Q1MA 3JXSA 1UKRA 4K3UA 3LD8A 5FCCA 4ZXKA 3WW2A 4H55A 4XC9A 4URAA 3K4ZA 4A3ZA 4QQPA 4GKXA 4EN6B 2XVLA 2BNMA 2CWSA 3VKOA 3WHTA 1HN0A 3ZO0B 1U0AA 4NVPA 4KU7A 1DLCA 4WVMB 1AJKA 2IVIB 1SBEA 2RM21 1VBD1 4Q27A 3WNOA 4E4ZA 2GSYA 4NPLA 2HWF2 3KHBA 1WMEA 5EJZB 1H8TC 3WG1A 1RTVA 1BZWA 4HONA 2DVGA 4KWUA 4UW4A 5JIUA 2DU0A 3N9LA 4ZPIA 3ZMOA 4LEJA 3CKHA 2IXHA 2P37A 4DINB 1W9WA 3VKMA 3WDUA 4ZY9A 5DN2A 2XONA 3PMSA 2ZMLA 1CJDA 1Y43B 1IHMA 3AP5A 4ZU7A 3AYCA 5C3RA 5C7GA 1G9CA 2R1BA 4M4RA 5T3NA 3NWKA 5IK7A 4KWLA 1AF9A 3O1OA 4LO5B 1BXHA 1UU6A 1JN2P 1HDKA 2HWB2 4OHXA 5C4WB 1Y9QA 3A0KA 1Z7S2 4QB2A 2ZGOA 3UL2A 1L7QA 5LCWL 4EE2A 1IS3A 1REFA 4HG6B 1STMA 1YFXA 1DG6A 2DVAA 2EICA 1W6QB 2J1VA 2VCBA 2YGMA 3BPZA 5H9SA 2XLGA 1GZWA 5GLTA 4X8NA 3D3AA 4MADA 5A3TA 4MGQA 5HPOA 5DDJ1 5IVCA 1ZBE3 3BKZA 2OXBA 3D5OA 5A7SA 1GZCA 5CZKA 4FPEA 4LBNA 1OA4A 2QDNA 2VU9A 1NZIA 2ETEA 1GU3A 3SH3A 1GNHA 1VBE3 1ZBA3 2PQQA 5F3GA 3RQ0A 3WNNA 4CXYA 2NP0A 3N7MA 1CZSA 1S2EA 4D7SA 2QQWA 5JZGA 2HWD3 1UX6A 3BTZA 3I3DA 4X6RB 2PQSA 4N9IA 2DUQA 2C26A 2QTWB 4LBMA 4PLNA 2OZ6A 2A70A 2ZMNA 2ZOEB 1BJQA 3MW4A 4PIYA 5FUPA 2UURA 3AYAA 3RZHA 5APAA 2VZOA 3KV9A 1FNYA 1LGCA 1SMVA 2IXIA 4B7KA 2IWGB 4AI1A 2ZXQA 3VL8A 1S0EA 3S7EA 4ARXA 3I2FA 1LHOA 3AMHA 5A70A 4P9GA 5FZMA 5CVRA 3WP4A 2P5BA 4ES9A 3G7DA 2VOTA 4MUVA 2ZS6B 3VDDB 1IPJA 3OY8A 3PVOA 4AQSA 2QZ3A 3N9MA 5T5LA 4NIGA 2VG9A 3KWVA 1T6GC 4I30A 3KCYA 4N43A 3TEYA 1KJRA 5CNAA 1R082 4DMIA 3PIGA 1J1LA 1C8M3 2QVSB 3POIA 3W9AA 5LA2A 5DAXA 3Q8BA 3CBNA 2HWE2 3T2TA 4FPYA 1CGPA 2R30A 1JTZX 3I2HA 2BNOA 3U4SA 3J8F3 2VMCA 5CA6A 4MGTA 3LOIA 1WUVA 1OOPB 4KWKA 5T5OA 5CFDB 5JOXA 4EN8B 1OPMA 4Z82A 3H3LA 1MEC3 2GAUA 2WN3A 5J7MA 4HKLA 2ZEXA 5G04L 2VNRA 1FV2A 1J83A 2G9GA 1RJ7A 3VHRA 3HQRA 2OVUA 1LOFC 4PHZA 1O3SA 3AKPA 5KXBA 1OLMA 1W6MA 4AVTA 1VBB1 3B7MA 1QH6A 1IKPA 2QUOA 2AEZA 4D6SA 5FZ0A 4IV3B 4QB1A 4QPIB 2W1WA 1RUI2 2X5IC 1O5UA 4COUA 2XJTA 3HPNA 1ODMA 1RUE2 1H4GA 3ZMNA 3TEZA 1RUF3 3WEZA 4BM8A 4QHZA 4XFFA 3J7MA 3VBOA 1KEXA 1RUI3 3CNAA 3T3YA 1URXA 1KFUL 1ND2B 1EP0A 3VGIA 1GUIA 2ARXA 2OPWA 3DL3A 3KV6A 5BNNC 1H2NA 4L11A 3WW1A 4CCOA 3T0BA 5JSOA 4BQ2A 4GMP3 3I4IA 1FOD1 1CAUB 1FPN1 5AVPA 5K8SA 5A1LA 4FSJA 3RDIA 1O4ZA 1FNZA 4Z92B 1SACA 2BRTA 2OKXA 5ERLA 3WSOA 4IEYA 3CJIC 3MW3A 5CKNA 1DQ2A 4FOYA 3RS6A 3WV6A 1JZ8A 3N36A 4JVAA 1UW8A 3BIEA 2QBXA 1RITA 2RDNA 2YHJA 3V56A 1PO13 4QQLA 2RR12 1WD4A 3VB9A 1AX1A 4M0NA 1R093 3GBFA 3N7JA 2V5DA 2VC9A 2J1UA 4CP0A 4KNCA 5B2GB 1ZM1A 5K0UC 2QQKA 1NQDA 2Y6LA 4Y22A 2BV4A 3WD5A 1DDLA 4MV2A 3HBZA 5KHGA 3B9IA 4FOVA 1CPNA 1XNCA 1HW5A 2XBO2 4N43B 4XF0A 4XHBA 4DXTA 1AR83 3IIIA 4K7JA 2E7QA 4M01A 3K75B 4LO7A 4BISA 1HJGA 4AI2A 5DUWA 1DGRN 4KGGA 5IK5A 3O1TA 4K9SA 1YQ6A 1ZRFA 5I0DA 3VD9A 3TN92 1JH5A 4XFAA 3U75A 1SFNA 1OD3A 5FYUA 5JOZA 1AR71 1YRZA 3WQ7A 2UYAA 5FOJB 4Q0VA 4GXLA 4IERA 2O8OA 1EAH3 4INDA 1HRV2 2WT0A 2VZPA 3N9NA 2D98A 1LENA 4QU1A 4Q1PA 4YRDA 3V0AA 3LA3A 4XEZA 1GYKA 4XAEA 5GLZA 2Y0IA 3OCPA 3LPFA 4K21A 4Q4W1 4CU8A 3LE0A 5BY5A 4FOQA 1BK1A 4MX3A 2LM3A 4R4ZA 2EVXA 1QOSA 5AFEA 3KV5A 1NCRB 3IKWA 3WF4A 4LBJA 1TE1B 2FDGA 3U37A 4A6SA 4D6QA 5DZFA 1LKNA 4KU8A 3F2ZA 1X8MA 2D40A 3KQ4B 3O1VA 4WVWA 2TUNA 5F6KA 2DUPA 4LIUA 4QPIA 4H3WA 4DZGA 3RZLA 5LB6A 3ELNA 2P6HA 4RD7A 4FO9A 1OURA 3RWNA 5CFCA 4YW7A 4IE7A 2VNVA 1JU4A 5FMOS 1CAWB 4XPVA 3S5QA 1E5RA 1VBA2 5A3MA 1A3KA 3OY8B 2ZTNA 5BNOA 5L36A 1V70A 2Z4FA 4IV1B 5C4WA 1W8HA 1GNYA 5LBEA 3BIWE 4N7IA 5EYXA 3ZN4A 2Q5TA 5DXDA 3I59A 4QPGB 1GQHA 1NY72 5BNOC 3VBRC 4ZS2A 3J7NA 3ZPYA 3CEWA 4RR3C 4MHRA 4BA6A 2C1FA 2W46A 5FYHA 3B9CA 4Z1VA 4XTMA 1R092 4YGBA 3J7HA 4BQ4A 5F8PA 4OVEA 4CDQA 1X8EA 3VBRA 4IGOA 2VO5A 2FMYA 3H42B 1DBNA 5DZGA 4RR3A 4PDWA 5L73A 3OG2A 2E53A 4OHZA 3ZR6A 1SCSA 2MEV2 1B35B 5I0SA 5JDBA 3RJ2X 1A34A 4JDMA 2ZHKA 1N1SA 4I0WB 4Q4Y1 2W94A 4XOGA 1KS5A 4E4HA 2WNUB 2VR4A 1DFQA 3QH7A 1PVXA 1UY2A 2H6CA 3AC0A 2ES3A 4KWJA 4GALA 1C1FA 3KM5A 3OEAA 4UF0A 5JR7B 1V9U1 2GNBA 1X7NA 4KL1A 2RS51 1PK6B 1TMF1 4AHWA 3H0OA 1IOAA 1VAMA 2DUOA 4CU6A 4XJAA 3ZSJA 1DZQA 4LK7A 3ZXAC 1JMUB 4XDOA 1OQ1A 2O0OA 1PO22 2QQVA 3SXWA 2XJQA 3OPTA 4XFBA 4C0BA 3S5AA 4DO0A 2WNUC 2AZ5A 4NHYA 3GJAA 3KF3A 2RJLA 3ZXGA 3AKSA 4OQ8A 1WA4A 1H9WA 1RUI1 3P6BA 4IEQA 4XFIA 1H1IA 5LY2A 1EUTA 3ZOIA 1JU3A 2GNDA 4QKBA 1FMD3 4ISQA 4BXSV 4EQVA 4HKOA 1CWPA 4NRPA 2GMMA 4XZUG 5BUVA 3VBRB 4HETA 2XJPA 1QXPA 2JDYA 4R9AA 4IV1C 2W95A 2WZR3 3DYOA 3LIHA 4NRMA 3T4VA 3FUQA 3LOBA 2C9AA 5FY0A 4OI1A 2LROA 1Q8QA 1UWWA 4RYDA 5FYCA 1BBT1 5FYTA 1RUH2 3O12A 1YHFA 1UOJA 3PUIA 3TEXA 2XL7A 2DURA 1MS3A 1YQ5A 1D0GA 1RUJ1 2JKBA 2CNAA 4LKSA 2BNNA 4NROA 4PIZA 3GM8A 5FZ1A 1F8VA 2IVJA 4ORFA 5JSPA 1O3TA 3AMMA 1ULOA 4KGQA 1V6LA 2XOMA 3FL7A 2Q8CA 2X29A 4N7UA 1QDOA 1G9BA 1IG0A 5J98B 5F3CA 1O59A 4GULA 4AWDA 2HWE3 2YB7A 4Q5OA 4OHWA 2TBVA 5FRAA 3AX4A 4HPKA 2GC3A 3T08A 1MVEA 5CAZA 1AVBA 2PLV1 3O1PA 3VV1A 3WNXA 5J36A 3F95A 4GB31 2DBIA 4KG0A 4OUSA 4YW6A 3BALA 4PCRA 1J3PA 3N7LA 1NYWA 2AH2A 1RL3A 1DQ1A 1XQNA 5A7WA 5JPMB 3ACLA 3ZFEB 5JOWA 5IVVA 4XMAA 4A2UA 5IVJA 1IZ3A 1DGRA 1OKOA 4K1YA 3WINE 1SLLA 4ATFA 5CKMA 2Y38A 3GGLA 4GH4B 4JQRA 4W6XA 2EXJA 3WCSA 3ACHA 1C4RA 1JOJA 1W28A 4LBQD 5FZBA 4XJWA 4CEYA 1XYNA 1SHWB 3JB8A 3LAGA 3GHNA 4Q0UA 1SCRA 3NJXA 1W6NB 1HB3A 3ZFEC 4UBGA 1PNGA 1W8ZA 2JG9C 1DQ0A 5A80A 4FTBA 1W39A 3FWEA 2DVBA 4LHKA 2W1QA 1DYKA 1IS6A 1W8NA 3ZFEA 1CAUA 1HN1A 4OLLA 2A73B 2JG9A 2XHNA 1KDMA 1ZBA2 1VBE2 5LASA 4BQXA 4P00B 5K0UB 4M4PA 1RUNA 1WLWA 1V6KA 3ST7A 3NNJA 1K5MC 1ND2A 2XVGA 2V4AA 1CX1A 2D6MA 3H7JA 3CQOA 3JQWA 3CJXA 2RG4A 5IAXA 2OQ6A 5FPAA 2BPA2 1XPWA 3OBRA 2VQ0A 3I2IA 4OZOA 2Y64A 1QY4A 1GWLA 3CZUA 3OPWA 5CBLA 5LK5A 1VBC1 3E5UA 1CAXA 1AR92 1XRUA 3ILRA 5E1RA 4NJ4A 1EY2A 1APNA 4XBQA 2XB6C 2OS2A 1MPXA 1DHKB 5FY5A 2PHTA 2E51A 4MGIE 4CCMA 4Z2WA 1W6NA 3LEIA 5EIYB 5D8AB 4CCKA 2B4KA 2ERFA 3KGZA 4RHV1 5CFDA 4YARA 4UFHA 1XU2A 2XJSA 1VLNA 1RVF1 4O61A 2VZQA 2XXZA 3AXDA 1OFNA 3MBWA 4E2QA 1V9U2 1JYTA 4Q26A 4CRQA 3PU8A 2ZJCA 4FAHA 2ZZJA 4V1PA 1JYVA 4KI5M 4HZFA 4QPIC 1AR81 3DECA 1W2TA 1OLME 1SFYA 1O8PA 2QNKA 4JAAA 4OHYA 1POQA 3A4UA 3RZZA 1XSRA 2ZGUA 4QQ2A 3ALQA 5FYIA 5C8CC 1X9PA 1UYZA 1UXXX 4HANA 3M4FA 4XDQA 5FZFA 4F8AA 1PK6C 3I2KA 4HPKB 5HI0A 4IGQA 4H7MA 1QHDA 1HV1A 1OOPA 3I2DA 4LOTA 1C1LA 4U2AA 2C5DA 2EXKA 1AX2A 2BFUS 3DCQA 3FC0A 3HVDA 2GC0A 1EPWA 3RVHA 1PK6A 4QXBA 2A7AA 2XMLA 1HV0A 3AZXA 1OH3A 1OOPC 4R9DA 1Z0HA 2W47A 4UFMA 2HWC3 1O5LA 1O4YA 2EF6A 5BNPA 3ZM8A 3N9QA 3WNLA 4BLIA 2WQ8A 2VMIA 2VZ3A 2UWAA 1JZ7A 4G9SB 2P34A 3NSTA 2P3JA 4TXWA 3IM0A 2GMPA 5L9VA 4X8PA 2W1UA 5FV3A 2WZR1 2NM1A 4FTEA 3O1UA 1WZXA 2XJRA 5HBAA 2RS31 2BVVA 3V0BA 2XG3A 1MS5A 4YM1A 5FZAA 1YCIA 4OFGA 3K4DA 1EYBA 2D93A 4LR4A 4YW4A 5FP8A 5BPXA 3SCGA 1N1TA 4AG4A 1W2UA 2VZTA 3AVSA 4NUBA 2BBAA 3DYPA 5HCAA 2A75A 4L0PA 5A6YA 5KXDA 1UU5A 2P3KA 1HLCA 3VDDC 1AR93 1MQTB 2J1EA 4XURA 4E8DA 4HXCA 1LULA 2RJ2A 2YC4A 4YM0A 1F15A 2DVDA 4NHKA 1Z78A 4AGVA 3BI3A 1R081 1UY1A 2VVDA 3RYPA 4D6RA 5F37A 3E6DA 1XE8A 1JYWA 5F7UA 3LEKA 3AKQA 1J59A 4LBQA 3H8UA 4LMFA 3WUDA 5LA1A 3I59B 2VW2A 3AMPA 2IXKA 2P2KA 2VE1A 4IDZA 4NHXA 1W2OA 5A6ZA 2YC0A 4NHLA 3QD6A 3P5BA 2G9ZA 3OUHA 3ZKUA 5DUVA 4IEUA 5JMCA 3CIHA 5FZHA 4E8CA 4I02A 5KXCA 4PLMA 4TSVA 1G8WA 3QCWA 2F17A 4S2GA 1CZTA 1LHVA 3THCA 1A8DA 2XUMA 4TWTA 3NKTA 3NJZA 2XKPA 3PVBB 2JD4A 4P5YA 4CP2A 4LIVA 4EROA 1BQPA 3LSDA 4IW3A 4CZSA 4ZHNA 4CDWC 2YBKA 3J7LA 5C8WA 2RHPA 2LS6A 3ZFGC 4QHBA 5FFOC 1YWKA 2VL4A 5BNQA 1COV2 2PHLA 5I0RA 1UOFA 5C9AC 5T54A 2A5ZA 4LOSA 4XCBA 1TQ5A 3NV3A 4N43C 4A6OA 5FZ4A 4BMEA 1W06A 4Y5SA 3AMQA 4YG6A 4D0QA 4DNYA 1AJOA 2DWRA 4XDPA 2R061 4COVA 5GLVA 5B4NA 5FPVA 3HQUA 2BWCA 4J25A 2WT1A 4QT6A 2A3XA 3OGGA 2I07B 4UFLA 5GLWA 5GZGA 4P9XA 4TYSA 2D6NA 4Y1VA 3WF1A 2GP5A 4P5HA 2W52A 2B45X 2VW0A 1GP5A 1O6UA 4K6BA 5A33A 4CUAA 2WLPA 5JI7A 3ZDVA 1PO23 4Q4W3 1H8TB 1IQDC 2JIGA 4GJZA 3EMRA 3AFKA 2W9XA 3M7AA 3QBQA 3OF1A 1D7PM 5I91A 4W65A 3ZIXA 3HNMA 5FXZA 4KH9A 5FZ3A 5AFBA 5DG1A 1H2KA 3VKFC 5A1FA 5JIAA 3D0SA 4AVAA 2WAAA 1SG3A 2XJVA 2JDMA 2HYXA 1XC6A 4R9CA 4DXRA 1IKQA 1SQ4A 5FYBA 5IW0A 5JXJA 2FZ2A 1DGWX 5FY7A 1ZVFA 3T1LA 1QQP3 4IE6A 4WVZA 4XUQA 4PIXA 1T6BX 1UO9A 5LA9A 3NNLA 4YG0A 3VZMA 2X5IB 2ZA9A 3NVCA 5IVEA 4IV3C 1F35A 4M3CE 2JIJA 4M3CB 4FI9A 1ULCA 3MDPA 3URFA 2CAUA 3WDTA 1QJY2 3SKJE 1W6OB 5FPLA 1J1TA 1JI6A 1EAH1 1XNBA 4AEKA 4I2OA 2P4EA 1SBFA 4YW5A 4BXFA 3HMYA 3OUIA 3WG3A 4GIQA 5GZDA 1RUH1 1AYN2 2EXIA 2QQOA 4ZS3A 2AUYA 4P9YA 5CFDC 3UJQA 3FLRA 3I2GA 3VBUA 3UESA 4AHYA 4OUEA 1CPMA 1M06G 2R063 4P02B 1S2KA 2E33A 2K2SA 4QKFA 5DG2A 1OUSA 1ZZ9A 4UT5A 3EB7A 2WJSA 1R1A1 3KZ4C 3M3CA 4XACA 3VBSC 3ZXFA 4ISRA 5J3UA 5LWBA 1ZRCA 1VRH3 3WHUA 1K42A 3H8RA 4LHSA 5CADA 5FKBA 1JZ6A 4AL9A 5A32A 2ZKLA 1YI9A 3HJRA 3Q8AA 5JZGB 3D8CA 4NE9A 1E5IA 3SCHA 2KXLA 5FJHA 1WLTA 3VZNA 2YV8A 1WD3A 4DS0A 2WFPA 1VBA3 1HRV3 2HJIA 4BQ5A 5K9YA 2DF7A 4QM8A 1HXS1 1MZEA 4RFRB 2B7YA 1YUDA 3SH5A 5IT6A 2Y60A 1NXMA 4CDXB 4GWNA 3NL1A 1OSGA 5CFCB 3E97A 3MIBA 4O65A 4LXLA 1W6QA 4Z2AA 4N90A 5C6CA 2D3RA 5IVBA 3H3UA 1JYIA 1PHMA 4N53A 1QXRA 2C9KA 5IVFA 4TTGA 3ROUA 3ACFA 2EIDA 1D4M1 2ZMKA 4QKNA 2X09A 3JD73 4QGLA 5CYYA 1O3RA 3O1RA 3PUSA 2BZDA 1PGL1 1K5JA 3QH6A 4HSJA 1UL9A 2W0XA 4CUCA 2ZGKA 4FPLA 2BOIA 1US3A 1Z7S1 1RUF1 1U5IA 1NY71 2BVBA 2VJXA 4Y26A 5FMOL 3ZN6B 2A6WA 2YG0A 3JU9A 2VVFA 2ZZQA 3IIAA 1NQJA 1I5PA 4MXVA 2HWB1 5FR3A 4YNIA 4FXKB 3U11A 1V6IA 1CJPA 1NLQA 3SC7X 2HBUA 4ZU4A 4P08A 5FIXA 1JOBA 2EIEA 2H0VA 5CFCC 1DQ5A 2GALA 3UGHA 5KXEA 3D82A 1I1EA 3HBKA 4I01A 2YBPA 1GSLA 4XMIA 1QJX2 4LA2A 3UV9A 3VBOC 3EYPA 5F5AA 3OGRA 2DCYA 5JXIA 2BGOA 2JDHA 2XBO3 3M3QA 4JGZB 1UY0A 5C4WC 1W03A 3IZOA 5IATA 3JB4C 2ZACA 4XE9A 4UBHA 2Z2SB 3H9AA 2B5HA 2BDRA 1Q3EA 4KBZA 2VNOA 5FY8A 3USSA 4QX0A 2RM22 3N7KA 1RUD2 2PHXA 1JUHA 1NCQA 3J26N 4CDQC 2UY8A 5C3PA 5FOBB 2XKOA 5FBZA 3G6JB 2N7GA 3GZEA 3NW4A 4IEWA 1RUJ3 4YZ5A 1FAYA 1RUE3 4NPRA 2RR13 5GKAC 1ULFA 4PT6A 2B46X 2Y33A 4BJ0A 4DY5A 3R6SA 4UXAA 5GJ6A 4MLOA 4O9EA 2XLAA 2MHFA 2PHFA 3LIGA 3BTYA 3AKTA 3N4MA 4ASLA 4LITA 1AYM3 2EALA 3FUOA 1RUG3 1A8MA 2QQMA 5JWPA 1L3JA 3GF6A 3RI9A 1F9KA 4JKLA 2A6ZA 4B4RA 5CG9A 5EXOA 3WNPA 1OQDA 3IAPA 1MEC1 5FO7B 1CR7A 3USUA 2HYKA 3QOPA 5DDJ3 3RNSA 3RI8A 5I8TA 1ENQA 1Y3TA 4DFSA 1LU1A 5K4LA 4DRRA 1ALYA 2MEV3 1XYPA 2ZX1A 3BYWA 4J1XA 1ASJ3 1AYN1 2GN7A 3O5SA 4OMDA 3ZXJA 1QDCA 5A3NA 3WG2A 3MF6A 4XF3A 4I0AA 4HVRA 3WF3A 3ZSKA 4UW5A 1WLCA 2WDBA 1GKBA 4S2HA 1UKGA 4AI0A 2RE9A 4FBFA 1RUD3 2FDFA 3HD8B 3IDCB 4Y5Z0 3T4HB 3C7FA 3OGJA 1S55A 3WDXA 5JR2A 3DKWA 2JG8A 2V73A 4AE2A 2VQAA 2JICA 1D2QA 1GFF2 2HEVF 3M3IA 3ZYHA 4Y4YA 1ZA4A 2RS13 5T52A 1LHNA 2GH8A 3M70A 2WC2A 2RDSA 2ZEWA 3LQCA 3NV1A 3OD0A 2VD7A 1QNYA 4QXCA 3ZR5A 2OIIA 3DF0A 2WABA 4NHMA 1YNAA 3Q8FA 2A71A 3KMHA 2ZAAA 4Q8KA 2WZ8A 4F3JA 1QJU2 3J8F2 1A78A 3CU7A 4QAWA 4M0HA 1AR63 1HIXA 4NRQA 2W1SA 4E2GA 3H1WA 3HOBA 4YGCA 4NMIA 3AYEA 2VBBA 2ZEYA 3AK0A 2VCMA 4TN7A 4UW6A 4RHV2 1E57A 1QF3A 4OMCA 2WIIB 2GP3A 1QIQA 4IETA 1PGW1 3RPQA 5GZFA 1DP0A 1RMU1 4IGPA 2MNGA 4XUTA 5T55A 4B1LA 1AYM1 3I3BA 1UMZA 4MYEA 2GNTA 4GB33 1B35A 4FPCA 1VRBA 3I97A 2OQ7A 4XBLA 2KM2A 4DB5A 4YM3A 2PXJA 3ZFGB 4RGGA 1HRI3 1XOYA 2HH9A 3AJZA 4YVSC 5EPAA 4IXLA 1S4CA 2VMHA 4GWMA 3RFRA 3THPA 1VBC3 3WQ0A 2RVAA 1QGLA 1QOTA 3AM2A 1SPPA 1G6NA 1PMHX 4BLJA 2WLQA 4CEWC 4YVSA 4SLIA 4AI8A 4PI0A 2BTVC 4XIKA 2R32A 4PJYA 1X36A 5EYYA 2R071 2OX0A 2NN8A 5HXVA 1LEDA 5AC92 1L7RA 3UYJA 5JLVA 2PA7A 2K0GA 2VMDA 4E2SA 4DUWA 3NNGA 1Y9GA 3DN7A 5BV6A 2RDRA 1O4TA 4DOUA 1VRH2 2A6VA 3OJBA 1RUC1 3GZTB 3ZSMA 4M3CF 4XXAA 2UU8A 5L9BA 1PO12 2VZRA 4GA9A 4SBVA 1SDWA 3MFAA 3JQXA 2WNUA 4XABA 1J3RA 2C0ZA 1FPN3 4LPLA 4E4DX 5FXWA 2PAEA 4P9WA 3NKGA 4KQ7A 4AFAA 4CVUA 3L2HA 1GMMA 1ASJ1 1AYN3 4YGEA 1RC6A 1W05A 5FUIA 3UGFA 3A7QA 4CCDA 2YPJA 4CP1A 1Z7S3 1ZZCA 1H9PA 4KMQA 5A3OA 3ZYFA 5IHRA 3VBFB 2VUJA 4RGKA 4FFFA 4GD4A 1RUC2 2EA7A 5C33A 3EXUA 1QJY3 2VMFA 4JKKA 3WZ1A 3ZYBA 1PVC3 2TNFA 2C4XA 2VUDA 2WWUA 1ZX5A 1PIV2 4LLOA 1D0HA 2ATFA 4HLTA 3TRSB 3HT2A 1RUG1 2X10A 1OVSA 4DQAA 2PHRA 1YJKA 4TLFA 5L7OC 2W5FA 3A21A 1GOFA 4FFGA 3Q8EA 1WCQA 1QQP2 2J1SA 1ZREA 3LGRA 1WLDA 5G05L 3O1MA 1CONA 3VKLA 4BQ1A 1LB2A 3I49A 2FDKA 2HEWF 2Q8EA 1FT9A 4QX5A 1NZCA 4DIQA 1NA1C 5F9TA 1QJX1 2HWF3 2GC2A 3KVBA 2EXHA 2WN2A 5SV5A 5LK7B 2R041 1JHJA 1OD5A 3ZFFB 4COYA 2XWJB 4BK4A 3LEGA 3JBG2 1LU2A 4CDUB 2VOWA 4FFIA 4HVOA 4E4SA 2FCVA 3BCWA 4ES8A 3IN9A 5JOYA 1NCQC 4FP2A 3IPVB 4I3GA 5AVAA 5FYSA 4RQPB 2UWCA 3L2YA 3NAPB 3L9JT 4ATEA 3NAPA 3K46A 3VZOA 3DPRC 4RS5B 1W9FA 5DMYA 3THTA 1JW6A 2XQXA 5CB7A 1P8JA 1GZWB 2CGNA 1R083 2XVKA 4QM9A 5FK8A 2RS11 3MIFA 1R64A 3VZKA 3K4AA 2FCUA 4YWAA 1UMHA 1WA6X 5JI9A 5D8AC 1RVF3 3VBHA 1ULDA 1ZBE1 4LKDA 2ADDA 4L97A 2VZVA 2HEYF 4XQDA 4XFCA 3VDDA 2WA3A 3PNAA 1WMFA 3BTXA 4MZUA 3VD7A 5FMBA 1RHI3 4W4ZA 2VAUA 1C5HA 2RMU2 1AXYA 2UWBA 1S0IA 1VIWB 4XUNA 4WM7A 4YW2A 3VDAA 4B3NA 2X5IA 5EQUA 4CEYB 5FKCA 4D94A 3O1SA 4LJHA 5C5TA 1FV3A 1XNTA 2DDUA 1IPKA 1ST8A 2CSGA 1XSQA 4FPGA 1QJEA 4GQ7A 2FZ1A 4QXHA 4O9GA 4M00A 4LKFA 1GICA 1W8UA 4IQPA 1X82A 4MGSA 1K5MB 2Y6HA 1PIV3 2HWD2 3OB8A 2VECA 1J58A 1W9SA 1UZZA 5ACA3 4S2FA 1HKDA 2F4LA 5J96B 3C2UA 4NOTA 4CCCA 1M4WA 2Y6JA 4H7LA 4GWIA 3ZN5A 1JXNA 2BJSA 2SBAA 3HN3A 3EQEA 3LF7A 2NMOA 1JZ3A 4A41A 1DYOA 5BXXA 1AL23 5FZ7A 5L9RA 4BH9A 1BEV3 4OHVA 3SEPA 1W6OA 1TNFA 3IB3A 1UY3A 1LGNA 4CDUC 1AL21 1ENRA 1Q8VA 2ILMA 3LEMA 3M3OA 1R1A3 4JV4A 1IS4A 2P6CA 5FZ9A 2YFUA 5ANNA 3RSJA 2HWD1 2VULA 2Z5WA 1KRIA 5DABA 2VPVA 2WUHA 2VGDA 2JDPA 3POWA 4MH0E 3ORJA 2PFWA 4BHPA 1V0AA 2AENA 2IXCA 2TEPA 3KT7A 1BLZA 5K0UA 4Z07A 2VZUA 4Y22B 2CAVA 1S2BA 3E6CC 2ADEA 2B9VA 2ZCWA 3VZJA 4LK6A 1U5ZA 1OXCA 5I0TA 4URTA 4CXWA 2WA4A 3ACGA 3WLUA 4BOWA 1BMV1 4XW3A 1WWYA 1X9TA 4MXWB 4AEJA 2QQUA 5E8AA 3WQBA 3HQXA 3RMXA 4JHZA 5A7OA 1HJFA 1NE6A 1WW7A 2BUKA 4Y1XA 5EJ1B 1GOGA 4RL7A 1FOD3 1OF4A 3DV8A 3PHMA 1OT5A 3WQ1A 4Q4V3 2QQPA 4V2WA 4PDWC 4B8EA 4META 2J1RA 3QLQA 4GB32 1DQ6A 1YC61 4A7ZA 3TNQA 4W50A 2JDKA 2JWPA 2Q1ZB 2SLIA 2WSUA 4QPYA 3ZYGA 2CGPA 1H30A 2ZHLA 4FOWA 1MACA 4CEWA 1CN1A 1KGYA 3O0VA 3OEBA 5CU1A 2WQZC 2H0BA 4YZ2A 1KXGA 3HIFA 3OBAA 3RMYA 3FLPA 4Q4X3 4XYXA 5ISLA 2CHHA 1UY4A 4CU9A 4CP9B 5F3IA 5EHDA 5JXGA 1Y4WA 4DPNA 5FXXA 3HNYM 4K8RB 4RS5C 3TAYA 3DPRB 1H1AA 4Y20B 1Q8PA 1RIRA 4WV8A 4CPBD 2QQLA 2V4VA 3N35A 4Y20A 3IDEA 4P9JA 1QJU3 1TME2 2ARBA 4QKDA 2VOVA 5C71A 2Q8DA 4HN1A 5FPBA 4Y1YA 1NG0A 2E32A 3OTFA 1MR5A 4IEVA 5A3LA 4UAPA 5FY1A 4QD2A 1PGW2 1E5SA 2E6VA 4GWJA 2GMEA 2NMNA 1ZZBA 1NA1B 3DKQA 4XAAA 4BDVB 1Y7BA 1YQ2A 1UPSA 3WF2A 4JGYC 1GR3A 2B39A 4LO8A 3M2MA 5I93A 2ET7A 3LA2A 1B35C 2D6KA 3KD4A 2OUHA 1C3HA 2OW4A 4HK8A 4N53B 3CHXA 3ZXEA 5FWJA 5GZCA 4UFKA 5LZ6A 4Q4Y3 3BGAA 1LCLA 1ASJ2 2MPFA 5F5CA 1PX3A 2WFF3 3POJA 1XE0A 5LBCA 4DEQA 4QPGC 3WP6A 3R05A 2YXSA 4LHLA 4YFZA 1F31A 1PNFA 2VW1A 4IEOA 5KHHA 1S0BA 2YYOA 2PLV2 2P3IA 2QZ2A 1NKGA 3PVEA 3MF9A 2YDEA 4NN0A 4Y3OA 3NNMA 4B4PA 1C8NA 4LE3A 1VRH1 1D4M3 4RSUA 5C3QA 3FX3A 4P14A 2JE7A 2WAOA 2W3JA 3C3VA 2EAAA 2Y34A 5FPXA 4QB6A 4Q2FA 2WWJA 3MLJA 1F4HA 1PZ9A 4GAZA 3RWKX 3VDCA 5FP9A 2YGLA 5E89A 2ID4A 1XBFA 5ACA1 2VM9A 3DEMA 2WL1A 1RUJ2 2WO2A 4Q0SA 1HQWA 3T30A 3TBDA 3I8TA 2FQPA 1KITA 1FMD1 1IPSA 1LHUA 2WYSA 1AZDA 1YO8A 4LKEA 3ABZA 2C6SA 3LCPA 4FQZA 4A44A 1TNRA 5F6LB 1R1ZA 3VBHC 4A42A 4AHZA 5IFPA 2JE8A 2VCCA 2YC2A 3LDKA 4CEWB 4UOJA 2G1MA 1UYYA 1YIFA 4BE3A 1SLIA 2XPJA 3PTRB 1GWMA 3N9OA 3PJQA 3T2OA 4YVSB 3JUUA 3UJOA 5J37A 4XUOA 1DU3D 2YZ4A 3ETQA 5FZDA 4EN7B 5L7OA 1Q8OA 2X8KA 2P3YA 4K1ZA 5LY1A 5FY4A 4LBOA 2IC1A 3KF5A 2IUWA 1KD7A 4YYOA 1RUH3 5KWRA 4NIDA 3OYWA 4I0BA 1K12A 1YXWA 2J7MA 2RS52 2RV9A 3ES1A 2OPKA 2ARAA 4XF9A 4JHTA 1AHSA 2DVFA
chains in the Genus database with same CATH topology
4Z2AA 3C7GA 2OKXA 3WSOA 3CDZB 5IYYA 2C9KA 4TTGA 3ACFA 2EIDA 5CYYA 2X09A 2E26A 1JZ8A 2QBXA 2BZDA 4AAXA 4CUCA 2BGPA 1US3A 2VJXA 2V5DA 2YG0A 2VC9A 3WF0A 2J1UA 1GQPA 1I5PA 1NX9A 2QQKA 2Y6LA 3ACIA 1TG7A 2YFZA 4P08A 2EIEA 4LQRA 5JUVA 4DXTA 3VDBA 3E1F1 3IIIA 1UYXA 3EYPA 3K75B 3OGRA 5JXIA 2BGOA 1UY0A 3NJVA 5I0DA 3VD9A 5J1XA 1OD3A 5JMOA 4QX0A 2CDPA 3I3EA 2VZPA 2WBKA 3IAQA 4ARYA 4CU8A 4PT6A 3LPFA 4BJ0A 1NAEA 3GDBA 3LE0A 4QDQA 2BERA 3WF4A 2KD7A 1UZ0A 2QQMA 2X05A 3U37A 1W0NA 4XUPA 4JKLA 3F2ZA 1XNAA 3WNPA 3IAPA 3MO4A 2JDAA 3OGVA 1OF3A 2QQNA 1ULPA 1JU4A 4ZZ8A 5IJRA 4DXSA 4OMDA 4IUGA 1H6XA 1UXZA 3BN6A 2Y6GA 2Z4FA 3A23A 3VD5A 3WF3A 1GNYA 2WDBA 4QX2A 3C7FA 5JR2A 2J1AA 2W46A 2VQTA 3J7HA 3VD3A 2HLEA 1W99A 2VO5A 3OG2A 2ZEWA 3LQCA 2V72A 1SDDB 2W94A 3C7EA 2WABA 4CUBA 3MUY1 2VR4A 1UY2A 2CDOA 3AC0A 3OEAA 2WZ8A 4QAWA 2W1SA 3HOBA 4CU6A 2JKXA 2ZEYA 4DEVA 1JYXA 5DPNA 1US2A 4OMCA 3CZJA 4A45A 1CIYA 4PF1A 3P6BA 3DYMA 1EUTA 3HNBM 1DP0A 1JU3A 5JXHA 2ORXA 5C70A 1K3IA 4BXSV 4XUTA 4XZUG 4QX3A 3I3BA 3I97A 2W95A 3DYOA 2W87A 1UWWA 4RYDA 3T0AA 3PUIA 2W92A 2RVAA 4LKSA 1PMHX 3GM8A 1ULOA 1H6YA 2XOMA 3FL7A 2EIBA 2VCAA 1O59A 1L7RA 4DUWA 2VMDA 3FN9A 3NNGA 3I2JA 2YB7A 4A4AA 3PUHA 4QDRA 1W9TA 3T08A 2VZRA 3UETA 1UX7A 2ORZA 4LPLA 4CVUA 1GMMA 1TVGA 5FUIA 3A7QA 4ZZ5A 4KMQA 3GGLA 5IHRA 3ACHA 3UNPA 2Y8KA 2VMFA 4JKKA 4MO3M 5DQ0A 1SHWB 2C4XA 3NJXA 4MOAA 4DUXA 1CZVA 2X10A 1T2XA 1OH4A 3A21A 1GOFA 2W1QA 1W8NA 2W5FA 1HN1A 1WCQA 3T09A 2J1SA 2XHNA 1EUUA 4P00B 1W8OA 4M4PA 5G05L 5B4XA 2J22A 1CX1A 4ET7A 2WN2A 3CQOA 2E31A 4ZXEA 1JHJA 2JD9A 3OGSA 1XPWA 4BK4A 3I2IA 4UI9L 3LEGA 1LNSA 4DUVA 4OZOA 2Y64A 3CZUA 3WNMA 4QPWA 4RN5A 1MPXA 2WO1A 3MUZ1 4QX1A 3K46A 3LEIA 5EIYB 2B4KA 3P1IA 1O8SA 5DMYA 2XQXA 1F4AA 1P8JA 2VZSA 1RYYA 2VZQA 1J84A 1R64A 3K4AA 4QDSA 1UMHA 3MBWA 2VZVA 3MV01 3WNKA 4D8MA 1JYVA 4KI5M 3VD7A 2VZ1A 3DECA 3T2PA 3CMGA 1O8PA 4W4ZA 3W5NA 4XUNA 3VDAA 1UYZA 1UXXX 2DCJA 3I2KA 2Y6KA 3ECQA 1XNTA 2DDUA 3T2QA 3FHAA 4GZ9A 4MGSA 2Y6HA 4YPJA 3C7HA 2W47A 3OB8A 1JZ4A 1W9SA 3ZM8A 3K77A 3WNLA 2WQ8A 2VZ3A 1JZ7A 1GOHA 3VD4A 3A22A 2Y6JA 4GWIA 4TXWA 3HN3A 5IFTA 1JZ3A 3SKVA 4A41A 2W1UA 1DYOA 5A1AA 2DCKA 4W8JA 3C7OA 3SEPA 5HXMA 3IB3A 1UY3A 3K4DA 4AG4A 3FHQA 2VZTA 2YFUA 2BBAA 3DYPA 3LPGA 5LA0A 4L0PA 2WUHA 4OYUA 1PX4A 2QQJA 2VMEA 3IDAA 3JXSA 2J1EA 4XURA 4E8DA 2RJ2A 2VZUA 2YC4A 3K4ZA 4A3ZA 2B9VA 2R7EB 1UY1A 1DLCA 3ACGA 4JKMA 1JYWA 3WNOA 3NQHA 3LEKA 5F7UA 4PQQA 3WQBA 5LA1A 5EJZB 4JHZA 5EJ1B 4KWUA 1GOGA 4CU7A 1OF4A 1OT5A 3CKHA 2VQUA 3CIHA 2QQIA 2J1RA 4E8CA 1W9WA 4ZY9A 1CZTA 5DN2A 3THCA 2XONA 3W5MA 4W50A 4P5YA 5C7GA 4M4RA 2LS6A 1KGYA 1NUKA 3HEIA 3OEBA 3OBAA 2VL4A 1BHGA 1UY4A 4QB2A 4CU9A 5JXGA 1L7QA 5LCWL 3HNYM 4A6OA 4HG6B 2EICA 4D0QA 2J1VA 2VCBA 4XVHA 5B4NA 2QQLA 2V4VA 3D3AA 4MADA 4MGQA 5HPOA 2L9LA 5CZKA 5C71A 3THDA 1GU3A 2E32A 1PMJX 4BK5A 3WF1A 3WNNA 4UAPA 1CZSA 4GWJA 3T0DA 4CUAA 3I3DA 4BDVB 2PQSA 2C26A 1YQ2A 1IQDC 3WF2A 2W9XA 4JX0A 2VZOA 2J1TA 1D7PM 3HNMA 2ZXQA 1UMIA 4ARXA 3I2FA 3BGAA 1JZ2A 2WAAA 1SG3A 1PX3A 2HYXA 3MV11 2VOTA 1XC6A 4DXRA 4DEQA 5JXJA 2LW8A 4XUQA 2W91A 3SEEA 1NKGA 2WAOA 2WZEA 4FI9A 2W3JA 5LA2A 3SKJE 4QB6A 1F4HA 3GXUA 1JI6A 3VDCA 2ID4A 2VM9A 2WO2A 3I2HA 2VMCA 2WYSA 2QQOA 3I2GA 3UESA 4OUEA 2WN3A 3ABZA 2VTFA 4P02B 2ZEXA 5G04L 4A44A 5IFPA 2E33A 4A42A 2JE8A 1J83A 2VCCA 2YC2A 3EB7A 4UOJA 1UYYA 2ZEZA 1K42A 1JYNA 4LHSA 1JZ6A 3T2OA 4XUOA 4QB1A 3HJRA 2W1WA 3HPNA 1WKYA 3C8XA 3WEZA 1KEXA 1K45A 1GUIA 3ETPA 3NRUA 1K12A 1JZ5A 2J7MA 2RV9A 3T0BA 2WO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z2A A;  3C7G A;  2OKX A;  3WSO A;  3CDZ B;  5IYY A;  2C9K A;  4TTG A;  3ACF A;  2EID A;  5CYY A;  2X09 A;  2E26 A;  1JZ8 A;  2QBX A;  2BZD A;  4AAX A;  4CUC A;  2BGP A;  1US3 A;  2VJX A;  2V5D A;  2YG0 A;  2VC9 A;  3WF0 A;  2J1U A;  1GQP A;  1I5P A;  1NX9 A;  2QQK A;  2Y6L A;  3ACI A;  1TG7 A;  2YFZ A;  4P08 A;  2EIE A;  4LQR A;  5JUV A;  4DXT A;  3VDB A;  3E1F 1;  3III A;  1UYX A;  3EYP A;  3K75 B;  3OGR A;  5JXI A;  2BGO A;  1UY0 A;  3NJV A;  5I0D A;  3VD9 A;  5J1X A;  1OD3 A;  5JMO A;  4QX0 A;  2CDP A;  3I3E A;  2VZP A;  2WBK A;  3IAQ A;  4ARY A;  4CU8 A;  4PT6 A;  3LPF A;  4BJ0 A;  1NAE A;  3GDB A;  3LE0 A;  4QDQ A;  2BER A;  3WF4 A;  2KD7 A;  1UZ0 A;  2QQM A;  2X05 A;  3U37 A;  1W0N A;  4XUP A;  4JKL A;  3F2Z A;  1XNA A;  3WNP A;  3IAP A;  3MO4 A;  2JDA A;  3OGV A;  1OF3 A;  2QQN A;  1ULP A;  1JU4 A;  4ZZ8 A;  5IJR A;  4DXS A;  4OMD A;  4IUG A;  1H6X A;  1UXZ A;  3BN6 A;  2Y6G A;  2Z4F A;  3A23 A;  3VD5 A;  3WF3 A;  1GNY A;  2WDB A;  4QX2 A;  3C7F A;  5JR2 A;  2J1A A;  2W46 A;  2VQT A;  3J7H A;  3VD3 A;  2HLE A;  1W99 A;  2VO5 A;  3OG2 A;  2ZEW A;  3LQC A;  2V72 A;  1SDD B;  2W94 A;  3C7E A;  2WAB A;  4CUB A;  3MUY 1;  2VR4 A;  1UY2 A;  2CDO A;  3AC0 A;  3OEA A;  2WZ8 A;  4QAW A;  2W1S A;  3HOB A;  4CU6 A;  2JKX A;  2ZEY A;  4DEV A;  1JYX A;  5DPN A;  1US2 A;  4OMC A;  3CZJ A;  4A45 A;  1CIY A;  4PF1 A;  3P6B A;  3DYM A;  1EUT A;  3HNB M;  1DP0 A;  1JU3 A;  5JXH A;  2ORX A;  5C70 A;  1K3I A;  4BXS V;  4XUT A;  4XZU G;  4QX3 A;  3I3B A;  3I97 A;  2W95 A;  3DYO A;  2W87 A;  1UWW A;  4RYD A;  3T0A A;  3PUI A;  2W92 A;  2RVA A;  4LKS A;  1PMH X;  3GM8 A;  1ULO A;  1H6Y A;  2XOM A;  3FL7 A;  2EIB A;  2VCA A;  1O59 A;  1L7R A;  4DUW A;  2VMD A;  3FN9 A;  3NNG A;  3I2J A;  2YB7 A;  4A4A A;  3PUH A;  4QDR A;  1W9T A;  3T08 A;  2VZR A;  3UET A;  1UX7 A;  2ORZ A;  4LPL A;  4CVU A;  1GMM A;  1TVG A;  5FUI A;  3A7Q A;  4ZZ5 A;  4KMQ A;  3GGL A;  5IHR A;  3ACH A;  3UNP A;  2Y8K A;  2VMF A;  4JKK A;  4MO3 M;  5DQ0 A;  1SHW B;  2C4X A;  3NJX A;  4MOA A;  4DUX A;  1CZV A;  2X10 A;  1T2X A;  1OH4 A;  3A21 A;  1GOF A;  2W1Q A;  1W8N A;  2W5F A;  1HN1 A;  1WCQ A;  3T09 A;  2J1S A;  2XHN A;  1EUU A;  4P00 B;  1W8O A;  4M4P A;  5G05 L;  5B4X A;  2J22 A;  1CX1 A;  4ET7 A;  2WN2 A;  3CQO A;  2E31 A;  4ZXE A;  1JHJ A;  2JD9 A;  3OGS A;  1XPW A;  4BK4 A;  3I2I A;  4UI9 L;  3LEG A;  1LNS A;  4DUV A;  4OZO A;  2Y64 A;  3CZU A;  3WNM A;  4QPW A;  4RN5 A;  1MPX A;  2WO1 A;  3MUZ 1;  4QX1 A;  3K46 A;  3LEI A;  5EIY B;  2B4K A;  3P1I A;  1O8S A;  5DMY A;  2XQX A;  1F4A A;  1P8J A;  2VZS A;  1RYY A;  2VZQ A;  1J84 A;  1R64 A;  3K4A A;  4QDS A;  1UMH A;  3MBW A;  2VZV A;  3MV0 1;  3WNK A;  4D8M A;  1JYV A;  4KI5 M;  3VD7 A;  2VZ1 A;  3DEC A;  3T2P A;  3CMG A;  1O8P A;  4W4Z A;  3W5N A;  4XUN A;  3VDA A;  1UYZ A;  1UXX X;  2DCJ A;  3I2K A;  2Y6K A;  3ECQ A;  1XNT A;  2DDU A;  3T2Q A;  3FHA A;  4GZ9 A;  4MGS A;  2Y6H A;  4YPJ A;  3C7H A;  2W47 A;  3OB8 A;  1JZ4 A;  1W9S A;  3ZM8 A;  3K77 A;  3WNL A;  2WQ8 A;  2VZ3 A;  1JZ7 A;  1GOH A;  3VD4 A;  3A22 A;  2Y6J A;  4GWI A;  4TXW A;  3HN3 A;  5IFT A;  1JZ3 A;  3SKV A;  4A41 A;  2W1U A;  1DYO A;  5A1A A;  2DCK A;  4W8J A;  3C7O A;  3SEP A;  5HXM A;  3IB3 A;  1UY3 A;  3K4D A;  4AG4 A;  3FHQ A;  2VZT A;  2YFU A;  2BBA A;  3DYP A;  3LPG A;  5LA0 A;  4L0P A;  2WUH A;  4OYU A;  1PX4 A;  2QQJ A;  2VME A;  3IDA A;  3JXS A;  2J1E A;  4XUR A;  4E8D A;  2RJ2 A;  2VZU A;  2YC4 A;  3K4Z A;  4A3Z A;  2B9V A;  2R7E B;  1UY1 A;  1DLC A;  3ACG A;  4JKM A;  1JYW A;  3WNO A;  3NQH A;  3LEK A;  5F7U A;  4PQQ A;  3WQB A;  5LA1 A;  5EJZ B;  4JHZ A;  5EJ1 B;  4KWU A;  1GOG A;  4CU7 A;  1OF4 A;  1OT5 A;  3CKH A;  2VQU A;  3CIH A;  2QQI A;  2J1R A;  4E8C A;  1W9W A;  4ZY9 A;  1CZT A;  5DN2 A;  3THC A;  2XON A;  3W5M A;  4W50 A;  4P5Y A;  5C7G A;  4M4R A;  2LS6 A;  1KGY A;  1NUK A;  3HEI A;  3OEB A;  3OBA A;  2VL4 A;  1BHG A;  1UY4 A;  4QB2 A;  4CU9 A;  5JXG A;  1L7Q A;  5LCW L;  3HNY M;  4A6O A;  4HG6 B;  2EIC A;  4D0Q A;  2J1V A;  2VCB A;  4XVH A;  5B4N A;  2QQL A;  2V4V A;  3D3A A;  4MAD A;  4MGQ A;  5HPO A;  2L9L A;  5CZK A;  5C71 A;  3THD A;  1GU3 A;  2E32 A;  1PMJ X;  4BK5 A;  3WF1 A;  3WNN A;  4UAP A;  1CZS A;  4GWJ A;  3T0D A;  4CUA A;  3I3D A;  4BDV B;  2PQS A;  2C26 A;  1YQ2 A;  1IQD C;  3WF2 A;  2W9X A;  4JX0 A;  2VZO A;  2J1T A;  1D7P M;  3HNM A;  2ZXQ A;  1UMI A;  4ARX A;  3I2F A;  3BGA A;  1JZ2 A;  2WAA A;  1SG3 A;  1PX3 A;  2HYX A;  3MV1 1;  2VOT A;  1XC6 A;  4DXR A;  4DEQ A;  5JXJ A;  2LW8 A;  4XUQ A;  2W91 A;  3SEE A;  1NKG A;  2WAO A;  2WZE A;  4FI9 A;  2W3J A;  5LA2 A;  3SKJ E;  4QB6 A;  1F4H A;  3GXU A;  1JI6 A;  3VDC A;  2ID4 A;  2VM9 A;  2WO2 A;  3I2H A;  2VMC A;  2WYS A;  2QQO A;  3I2G A;  3UES A;  4OUE A;  2WN3 A;  3ABZ A;  2VTF A;  4P02 B;  2ZEX A;  5G04 L;  4A44 A;  5IFP A;  2E33 A;  4A42 A;  2JE8 A;  1J83 A;  2VCC A;  2YC2 A;  3EB7 A;  4UOJ A;  1UYY A;  2ZEZ A;  1K42 A;  1JYN A;  4LHS A;  1JZ6 A;  3T2O A;  4XUO A;  4QB1 A;  3HJR A;  2W1W A;  3HPN A;  1WKY A;  3C8X A;  3WEZ A;  1KEX A;  1K45 A;  1GUI A;  3ETP A;  3NRU A;  1K12 A;  1JZ5 A;  2J7M A;  2RV9 A;  3T0B A;  2WO3 A; 
#chains in the Genus database with same CATH topology
 1UIK A;  2FD8 A;  5BNN A;  1LTE A;  1N1Y A;  3LWC A;  1TME 1;  4HN0 A;  3CDZ B;  5IYY A;  2ZGS A;  2MEV 1;  1DLL A;  1XJA A;  1A6C A;  4BPZ A;  3E6B A;  1W6P A;  2E26 A;  1WCS A;  2D6O X;  4M3C A;  1LOB A;  1YLL A;  3GYD A;  3J9S A;  4AAX A;  5FDB A;  1R09 1;  3CJI A;  3KCX A;  5FP3 A;  2BGP A;  2YBS A;  1MS0 A;  1NCR A;  2YY1 A;  4Q1R A;  5DZE A;  1QMJ A;  5A7P A;  1JYC A;  1MZ5 A;  1OHF A;  2CV6 A;  1RED A;  3DXT A;  4YLZ A;  3WF0 A;  3KLS A;  5C8C A;  4WM7 B;  3RZJ A;  4YVW C;  4ZKT B;  3ACI A;  5EWS A;  1TG7 A;  2I2S A;  4OI0 A;  1OQE A;  1QJZ A;  1WBL A;  2Z79 A;  5JUV A;  4UF0 B;  1W8T A;  2PLV 3;  2UYB A;  5IUQ A;  5BNN B;  3IMN A;  1BYH A;  4IES A;  4XZP A;  4AFB A;  2GH2 A;  4LA3 A;  2JXA A;  2K46 A;  1ND2 C;  2WNV B;  1PMI A;  3E1F 1;  4GMP 1;  5A3U A;  1QH7 A;  3LSE A;  2XGX A;  1OKQ A;  1UYX A;  3ENR A;  3WG4 A;  2WFF 2;  4OUM A;  5FP7 A;  3O14 A;  1UD1 A;  4WZC A;  3R4D B;  4UYB A;  5JCT A;  3APB A;  5FUN A;  2ZGL A;  5J1X A;  1XU1 A;  1QU0 A;  2QCS B;  4GKY A;  5JMO A;  5T5P A;  1VBD 2;  3BOW A;  4AXO A;  4K20 A;  3LDB A;  2FCT A;  3D4K A;  2CDP A;  3M1H A;  3I3E A;  3SLI A;  1GQG A;  2XWB B;  4L8Q A;  2Q30 A;  1HXS 2;  2WRA A;  5D1I A;  4AGG A;  3HAG A;  4ARY A;  3CO2 A;  3AZY A;  3PUA A;  1ONA A;  4QDQ A;  1ENS A;  2BER A;  2JEC A;  4LE4 A;  2KD7 A;  1VAV A;  2X05 A;  3UKT A;  2JDN A;  1F5F A;  1VBD 3;  4MG2 A;  2VBD A;  3KGL A;  4XUP A;  4RA0 A;  4C90 A;  1XNA A;  2RS3 2;  3ILN A;  1B09 A;  2FMD A;  3J4U H;  3NO8 A;  3PUR A;  5FJK A;  3RYR A;  5FPU A;  2RDQ A;  5JSR A;  2PN5 A;  2JDA A;  3K3O A;  1OF3 A;  3Q9O A;  4IE0 A;  4W6Y A;  4AVV A;  5C5U A;  4AQ2 A;  1PGS A;  1UIJ A;  3SNM A;  2D43 A;  1ND3 B;  3ZXD A;  1H8V A;  2VNG A;  1HRI 1;  1Y9M A;  5IJR A;  2A1X A;  4YFW A;  2ZHN A;  4WBB A;  3VN4 A;  4DXS A;  2PAK A;  1RXG A;  3OYW B;  4IUG A;  4AFC A;  4YSF A;  1RIN A;  1TZO A;  2Y6G A;  3A23 A;  1OMI A;  5J09 A;  1XE7 A;  4MGZ E;  1VB4 A;  2KA3 A;  4YM2 A;  1EAH 2;  5GAL A;  3TB0 A;  4MGK E;  1UZY A;  4Y1Z A;  4NO4 A;  3H3Z A;  2D6P A;  2R0H A;  1AXZ A;  2DFB A;  2PHD A;  4Q4X 1;  5BNP C;  2X53 S;  4LUL A;  5IAV A;  3WCR A;  2VQT A;  3LDR A;  4CDW A;  2P1B A;  3LKJ A;  1BBT 2;  5FQ0 B;  5CKQ A;  3NJY A;  1VAL A;  4HBN A;  4ASM B;  1BKZ A;  4V2V A;  3SHR A;  3WR0 A;  2ZGR A;  1AR8 2;  2VUA A;  3MLL A;  4CUB A;  3PDQ A;  4AW7 A;  3MFC A;  3MUY 1;  4XIL A;  4CP9 A;  5H9Q A;  3RZM A;  2WSV A;  1BEV 1;  5ABJ C;  1V6J A;  1LES A;  1LRH A;  5F2S A;  2ENR A;  1YFW A;  4LT5 A;  1NLS A;  1VBB 3;  3POB A;  1OA2 A;  5ABJ B;  2BP6 A;  1ND3 A;  4NPM A;  1XB9 A;  2RS5 3;  5EFU A;  4DEV A;  5ABJ A;  4TZD A;  3V0A B;  5FZI A;  4AHX A;  2ZBJ A;  3MPP G;  1OPO A;  4K40 A;  1PM7 A;  1S0J A;  3CZJ A;  3B02 A;  4A45 A;  1COV 3;  4QX8 A;  1CIY A;  1SLT A;  5DUU A;  3GCX A;  3BOD A;  5DAW A;  4QQO A;  4HOO A;  4XXP A;  3AFG A;  5JXH A;  1YFU A;  3GNE A;  4FXG B;  3J8F 1;  5BNP B;  1BEV 2;  2XH6 A;  1KDK A;  4QX3 A;  1OLR A;  1YQC A;  2BGC A;  1W8F A;  3OSD A;  5FYZ A;  5A32 B;  2R04 2;  4W6W A;  3SQO A;  4Q4V 1;  3U4X A;  4Y24 A;  4Q0Q A;  1HB1 A;  2JEM A;  4BU2 A;  3S57 A;  2W87 A;  5JZG C;  2OUJ A;  2B9U A;  2FDI A;  2OA2 A;  5GZE A;  4QGN A;  2QE3 A;  1CQ9 A;  3MLK A;  5KHI A;  2W92 A;  1QNW A;  1EV1 3;  4WZF A;  3VBS B;  1QWR A;  1IQA A;  1H6Y A;  4A7K A;  5CIR A;  2EIB A;  1U5X A;  2VCA A;  2E7A A;  1NA1 A;  3MPB A;  1JHN A;  1FAT A;  3I2J A;  1ULE A;  1OVP A;  2NQY A;  2WT2 A;  3U0Z A;  2D3P A;  1UU4 A;  4QDR A;  4EN9 B;  1WGP A;  5FZ8 A;  4CXX A;  1W9T A;  1JBC A;  2ZAH A;  5FO9 B;  1S1A A;  2QKD A;  3UET A;  2OZJ A;  2JJ6 A;  4LNV A;  2DBN A;  1VJ2 A;  3UGG A;  2ORZ A;  3OBT A;  1G7Y A;  1MEC 2;  4BCU A;  2VMG A;  1BCX A;  1IGO A;  1RHI 1;  5F39 A;  4C1X A;  1TVG A;  4QQH A;  4CDX C;  3ON7 A;  4WM8 B;  3WX5 A;  1DGL A;  1AL0 G;  2V09 A;  4LBK A;  4WM8 A;  4I09 A;  4EN0 A;  4B29 A;  2VOK A;  1AR7 3;  5F5Q A;  4H2A A;  4J6G A;  4XJZ A;  3UNP A;  4AED B;  1ZRR A;  4WM8 C;  1S0C A;  3VBS A;  2HWC 2;  4NAO A;  1X50 A;  3POF A;  1W8W A;  4MOA A;  3ATG A;  1VE0 A;  1JOD A;  4D7Y A;  5LEJ A;  1GV9 A;  1CZV A;  1RUD 1;  3H1M A;  1MS9 A;  1CVN A;  3D6E A;  3ZDS A;  1UQX A;  1RB8 G;  1T2X A;  2O8Q A;  1OH4 A;  4R4X A;  5CEH A;  1X33 A;  1NXD 1;  4K8F A;  3UKN A;  3TN9 1;  1EUU A;  4YVW B;  5A33 B;  4J1W A;  2LUW A;  3AJY A;  1W8O A;  4TLG A;  4WM7 C;  4YW3 A;  3PJY A;  4Q29 A;  4C91 A;  1YFY A;  1GAN A;  3WDV A;  1N3O A;  2WNE A;  1ZYB A;  4D7T A;  4CUG A;  4JTO A;  3ZVX A;  4LUM A;  4ET7 A;  4Q4V 2;  2ZGM A;  2E31 A;  4ZXE A;  2JD9 A;  3OGS A;  3HWJ A;  1UCX A;  3NV2 A;  4DUV A;  5E88 A;  2ARE A;  4B7E A;  4QGM A;  5I8S A;  3AP6 A;  3WNM A;  1G9A A;  4OQ9 A;  3R0R A;  1RMU 2;  2JDU A;  1UYP A;  2ZAB A;  1GNZ A;  3U07 A;  1UNB A;  2BQP A;  3VHO A;  1FX5 A;  2FDJ A;  1LOG A;  1LEM A;  4QPW A;  4RN5 A;  1RUC 3;  3WOG A;  3MUZ 1;  3GAL A;  2ZX4 A;  4JRA A;  3IBM A;  4MSV A;  5HV4 A;  1N3Q A;  3W21 A;  1F4A A;  3ES4 A;  1O3Q A;  4U36 A;  2VZS A;  1RYY A;  4B1M A;  2XQR A;  3WUC A;  2O1Q A;  5C9A B;  2VXJ A;  3E5X A;  3PME A;  4AVB A;  5TSW A;  4PF5 A;  2K9Z A;  3AP7 A;  3ITQ A;  1W2N A;  3POE A;  4D8M A;  2B8M A;  2F4P A;  4IE4 A;  4JDN A;  4CDW B;  3GZA A;  3GCW A;  1FOD 2;  4BQY A;  2XLF A;  3CMG A;  3INA A;  3O7O A;  1PZ8 A;  3W5N A;  2E9Q A;  3I54 A;  3DXU A;  3WT3 A;  1TMF 3;  2R0F A;  4AED C;  1PM4 A;  4EZH A;  2LAL A;  4AYU A;  4YZ4 A;  2ZGP A;  2Y6K A;  3ECQ A;  3B93 A;  2BFU L;  5AC9 3;  3IMM A;  2NLR A;  2VOX A;  3FHA A;  2WYF A;  2E63 A;  1D2S A;  4BQ3 A;  2D5H A;  5H9R A;  1VBC 2;  1Q43 A;  1I5Z A;  4CA9 A;  3MHZ A;  3VZL A;  1HRI 2;  3JBG 1;  1GOH A;  1R1A 2;  4RQP A;  3VD4 A;  3R4S A;  2BW8 A;  4AI9 A;  4XCA A;  5FYY A;  2R6Q A;  3VBU B;  1BVP 1;  1GP4 A;  1MQT C;  1LOC A;  4JTN A;  2V5Y A;  5IFT A;  4XFG A;  5M0T A;  1AR6 1;  3KB5 A;  2DTY A;  5A1A A;  2FHR A;  3PU3 A;  4KBB A;  3WDY A;  4CDX A;  3WXP A;  2DCK A;  4FPJ A;  3C7O A;  1ZRI A;  4XTP A;  1WW4 A;  2NYY A;  3FHQ A;  1C8M 1;  2XDV A;  4YW1 A;  1EPZ A;  3KVA A;  4QXK A;  1G9D A;  2CYF A;  2QFE A;  3LPG A;  5ACA 2;  5LA0 A;  2H6B A;  3ZSE A;  2IFR A;  1ND3 C;  1PX4 A;  1YIP A;  4NIA A;  2QQJ A;  4Y5T A;  3ZLI A;  3IDA A;  3K2O A;  5FAX A;  5J48 A;  3TEW A;  4XJ9 A;  1RMU 3;  1PIV 1;  2VVE A;  3ASI A;  3AMN A;  1H2L A;  1SLB A;  4YZ3 A;  2HWC 1;  3FFZ A;  2R7E B;  4G3Y C;  1JS9 A;  1O7F A;  2KR2 A;  4JKM A;  5FMC A;  2RMU 1;  3NQH A;  2JE9 A;  2ZGN A;  4JGY B;  3HR9 A;  4PQQ A;  1AXK A;  5A6Q A;  5BYN A;  4NR1 A;  4OI2 A;  5LRR A;  3B01 A;  3CLP A;  2WZP P;  1RHI 2;  2JG8 C;  4CU7 A;  3B3Q E;  1QJF A;  2VQU A;  4IV1 A;  4L9B A;  3TNP B;  2RS1 2;  1PGL 2;  2QQI A;  2GN3 A;  5KC5 A;  1RVF 2;  2PAM A;  1MZ6 A;  4G4F A;  5C8C B;  3KCC A;  1J3Q A;  1LHW A;  3LZZ A;  2JEN A;  3IT8 A;  5GM0 A;  4CTE A;  2PYT A;  3CF6 E;  4AVC A;  5FZO A;  4JC1 A;  3EBR A;  3BTA A;  1NUK A;  3HEI A;  1YI7 A;  4FFH A;  4UFJ A;  3I3M A;  1YJL A;  5AC9 1;  2G19 A;  1HX6 A;  3POY A;  1OC1 A;  1EV1 2;  2D3S A;  1BHG A;  2A3Y A;  2WNV C;  5FZ6 A;  2XR4 A;  2WO7 A;  5FK7 A;  4AF9 A;  1OFS A;  3VKN A;  4XFH A;  5C3O A;  5FY9 A;  3SIT A;  1AX0 A;  1WW6 A;  3A0N A;  3DGT A;  3EO6 A;  1PZ7 A;  2VXR A;  4LO4 B;  4XVH A;  4EYU A;  2OYZ A;  2L9L A;  2XHK A;  2QDR A;  3S6P A;  3B5L B;  1QKQ A;  2VUC A;  1GZ9 A;  4YGD A;  4PQ9 A;  5CG8 A;  1C28 A;  4R52 A;  3THD A;  3AXE A;  1NOV A;  1AYM 2;  1UAI A;  3FE5 A;  1FPN 2;  1PMJ X;  3B00 A;  4JQT A;  5FZG A;  4BK5 A;  2P17 A;  1WW5 A;  1CAX B;  1COV 1;  4NWV A;  3T0D A;  1IG3 A;  4ZON A;  5F2W A;  1GP6 A;  5FZL A;  5LEK A;  4OI4 A;  3VLB B;  4AGR A;  1RUO A;  4MHU A;  5IWF A;  5C3S A;  4WVV A;  2D6L X;  1GBG A;  1QXJ A;  1PVC 2;  2DFC A;  2E7T A;  4BB3 A;  1PO2 1;  4JX0 A;  5KR7 A;  2J1T A;  3H50 A;  5IVY A;  4XHX A;  3X29 B;  4BMB A;  4LOR A;  3U10 A;  3ME2 A;  1I6X A;  1UMI A;  3ZFF A;  2HBT A;  1TMF 2;  4N9H A;  3RG0 A;  1H2M A;  1JZ2 A;  2GDF A;  1W0P A;  1MVQ A;  2JG9 B;  2Q8O A;  1S0F A;  3MV1 1;  5T5J A;  2VBP A;  3KHC A;  3AL6 A;  2Q4S A;  1FYU A;  2VTX A;  2W39 A;  2LW8 A;  1YQ8 A;  2BEO A;  1PO1 1;  1RJ8 A;  2W91 A;  2WS9 3;  3PIJ A;  3SEE A;  4CPB A;  2J42 A;  2GZW A;  4GH4 C;  1SZB A;  2CY6 A;  3USU B;  2PHW A;  3HN1 A;  4AI3 A;  2WZE A;  5FO8 B;  1DQ4 A;  1MS8 A;  4PBO A;  2D44 A;  1I3H A;  1CIW A;  4IV3 A;  1WBF A;  3GXU A;  4HKW A;  3VBH B;  3UKV A;  5DAV A;  4E9K A;  3VBF A;  4R9B A;  1DZT A;  4JGZ A;  5DAP A;  5LAT A;  1VBA 1;  3PTY A;  1CX4 A;  1H1M A;  2W68 A;  2PHU A;  3H1Y A;  1SFP A;  1VR3 A;  4Z8B A;  1AR6 2;  4NIH A;  4XIO A;  2VTF A;  1WCK A;  2GC1 A;  3TN9 3;  2Y6F A;  1U12 A;  4AQ6 A;  2BWA A;  1C5I A;  3JD7 1;  3KT1 A;  5JVV A;  2Q1F A;  1BBT 3;  4H14 A;  4XF4 A;  4CEY C;  2AR6 A;  2ZEZ A;  4AAP A;  4YZ1 A;  4LO6 B;  1JYN A;  2WKK A;  3RRD A;  2B42 B;  2PEL A;  2ZPX A;  4JDO A;  4AED A;  4EWE A;  3WVJ A;  4HVQ A;  3M3E A;  2YU2 A;  3K3N A;  4QPG A;  3K51 A;  1PVC 1;  1SLC A;  1WKY A;  3C8X A;  2EIG A;  4P9I A;  5F1R A;  2BOJ A;  2NZ9 A;  2FDH A;  1WCD J;  2BYV E;  4Q0P A;  1CAV A;  1K45 A;  3EHK A;  4PBP A;  3RZG A;  1HRV 1;  3ETP A;  4P9L A;  4RHV 3;  4LBQ B;  3NRU A;  3PL0 A;  1JZ5 A;  4JZR A;  3VUO A;  3BU7 A;  1AR7 2;  3IPV A;  1QJU 1;  4FP3 A;  3KV4 A;  4BWO A;  2WO1 A;  2WO3 A;  4N53 C;  4XET A;  1D4V B;  1OBN A;  3NAP C;  4HK9 A;  3E5Q A;  4RQP C;  3DPR A;  3MZH A;  4MVT A;  2A6Y A;  5FZK A;  4A3X A;  2AGS A;  2PMW B;  1NCQ B;  2WWS A;  2XJU A;  3C7G A;  2AYH A;  4RGA A;  5DDJ 2;  4EV0 A;  3R4U A;  4GMP 0;  3KS7 A;  4ASK A;  1DGW A;  3K48 A;  1UZW A;  3POG A;  5CIS A;  2G9F A;  1NT0 A;  5LBF A;  1TEI A;  3P3N A;  4L92 A;  3MW2 A;  2DTW A;  3D0J A;  1HXS 3;  2A3W A;  1QOO A;  3OD4 A;  3V65 A;  1HB2 A;  1GQP A;  3FJS A;  4Y33 A;  1NX9 A;  3VHP A;  3S7I A;  1RUF 2;  2YFZ A;  5JAX A;  1CAV B;  2Q0A A;  4LQR A;  5FLI A;  5K7P A;  5L7O B;  5LRS A;  4AQT A;  3S30 A;  4X6Q B;  4FT8 A;  5SV8 A;  1FXZ A;  3BVC A;  2RM2 3;  1VPH A;  4RR3 B;  4CE8 A;  2R1D A;  3BOP A;  1CAW A;  1BVV A;  5BNO B;  1JUI A;  4CYD A;  5H9P A;  4AK3 A;  3NJV A;  3PUQ A;  5FYM A;  3WW3 A;  2R04 3;  1Q5O A;  3KQR A;  1ZBA 1;  2UY9 A;  1QQP 1;  5DAQ A;  5L19 A;  5HCH A;  1LOD A;  1QJX 3;  2HWF 1;  3BU0 A;  4Y1U A;  3HT1 A;  3SH4 A;  2BBV A;  3WY6 A;  1RUG 2;  2I74 A;  2WBK A;  4Q4W 2;  1KJL A;  3OUJ A;  4R8H A;  3OPZ A;  1ODN A;  3IAQ A;  3BB6 A;  4PDW B;  3FZ3 A;  4CDU A;  3NNF A;  1OUX A;  3ZYI B;  4C8D A;  2CTV A;  2VTX J;  5EP9 A;  1MS4 A;  1NAE A;  3GDB A;  1UPI A;  3SMH A;  5EZW A;  1LAJ A;  5C9A A;  4EJR A;  2DU1 A;  2WQ4 A;  2WNV A;  1UZ0 A;  1NCR C;  4QU2 A;  3V0B B;  4CCJ A;  1VBB 2;  1C8M 2;  1W0N A;  1DZR A;  3P3P A;  3LA7 A;  1LJ7 A;  5A7N A;  1RXF A;  4F7Z A;  1YEW A;  2WFF 1;  4HMZ A;  2ET1 A;  3JD7 2;  1UOB A;  3MO4 A;  3MIG A;  1W0O A;  3PLQ A;  4QWN A;  3OGV A;  1WCU A;  2QQN A;  1ULP A;  1N1V A;  3GHM A;  2XBO 1;  2ZX2 A;  4DRV A;  3JZV A;  2ZX0 A;  1H8T A;  4ZZ8 A;  1LR5 A;  1V00 A;  3AL5 A;  1ACC A;  5A6X A;  5I8Y A;  1KFX L;  1H6X A;  1UXZ A;  1REE A;  2GNM A;  3AZW A;  2YUE A;  3BN6 A;  3MIC A;  3OOX A;  3VD5 A;  2BU9 A;  1XNK A;  4AR2 A;  1OA3 A;  4FQ4 A;  4QX2 A;  1VMJ A;  2XL9 A;  4AFD A;  1W90 A;  4PI2 A;  2RR1 1;  1QJY 1;  2J1A A;  1UN1 A;  3AP9 A;  5FBJ A;  5D21 A;  2HLE A;  3VD3 A;  2NPI A;  4BZ4 A;  3S0M A;  2CL2 A;  1XND A;  3AZZ A;  1W99 A;  1UOG A;  1DYP A;  1ZZ6 A;  4OCT A;  4UW3 A;  5F32 A;  4NII A;  3FMG A;  2JDZ A;  3V64 A;  2ZHM A;  1F2N A;  1POV 0;  1KS4 A;  1SDD B;  2V72 A;  3BPS A;  3C7E A;  1SPP B;  1HB4 A;  1ZNP A;  1NLR A;  1GLH A;  4O7X A;  2DCZ A;  2CDO A;  5A7Q A;  1V6O A;  1ZBE 2;  2RS3 3;  3DUI A;  3OBZ A;  5EJ3 A;  4DXZ A;  1QEX A;  1S0D A;  5FZC A;  1GZT A;  2YRO A;  5IK4 A;  2YU1 A;  3ZPO A;  4XJU A;  1W9Y A;  3FHI B;  4EWA A;  3QAC A;  4GH4 A;  3H8O A;  2JKX A;  4FVV A;  3U14 A;  2ZGT A;  1SBD A;  4COZ A;  3CJI B;  5FP4 A;  2CGO A;  3ZXK A;  1JYX A;  1WMX A;  5DPN A;  1US2 A;  5FPZ A;  3GJB A;  1CD3 G;  4PF1 A;  3N3H A;  5A3P A;  2HWB 3;  4A7Y A;  3DYM A;  1SLA A;  2HKX A;  2Y26 A;  2AAC A;  3H7Y A;  3ZFG A;  1VMH A;  3HNB M;  5FWE A;  1Q56 A;  2YPD A;  4D69 A;  1F5J A;  3WP5 A;  3ZYJ B;  2ORX A;  4FPO B;  1K3I A;  5C70 A;  2IFW A;  3IWZ A;  3TYJ A;  1TME 3;  5T50 A;  4B4Q A;  1OLQ A;  1ZZ7 A;  1W04 A;  1GWK A;  1UF2 C;  4S2D A;  5LW9 A;  4Q4Y 2;  4JRL A;  5KHK A;  5A7W B;  2R06 2;  3BUC A;  1ZRD A;  3T0A A;  4C0H A;  1ZZ8 A;  3NV4 A;  1VBE 1;  4XQ4 A;  3MYX A;  4FAG A;  2WR9 A;  4Q4X 2;  2LRP A;  4NWW A;  5FYV A;  5FZO B;  2WS9 1;  3GBG A;  3LB9 A;  1S0G A;  2DV9 A;  3SIS A;  3KSC A;  3WP3 A;  3LFI A;  3ZFF C;  1LGB A;  1K5M A;  3U1X A;  2JG8 B;  2PTM A;  1LOE A;  3FN9 A;  4QHO A;  3WDW A;  4UWD A;  4PLO A;  3ZXL A;  3PUH A;  1IS5 A;  4A4A A;  3W20 A;  1E5H A;  4RS5 A;  1NE4 A;  5HCB A;  1W6P B;  1UX7 A;  3T1M A;  5KHJ A;  4EZ4 A;  2F6B A;  4FCA A;  2JB8 A;  4Y4R A;  3RYK A;  2LTN A;  3TWI A;  2ZGQ A;  1AUY A;  2FBE A;  1V9U 3;  3IDB B;  4FPH A;  4ITC A;  3AVR A;  2JB4 A;  3ZN6 A;  1W6M B;  1XXN A;  1C57 A;  4HT1 T;  4CCL A;  4CDQ B;  4ZZ5 A;  2YMZ A;  3I3Q A;  2EAK A;  1DCS A;  1SEF A;  5FRE A;  1POV 1;  4LHN A;  3WW4 A;  5E6H A;  4NAM A;  1DIW A;  3VBF C;  5JPN B;  1BMV 2;  3GBW A;  5KC6 A;  4JGZ C;  1LOA A;  1JOP A;  1LOF A;  2Y8K A;  3B94 A;  2ZX3 A;  4MO3 M;  5DQ0 A;  1W2A X;  3VBO B;  4CSW A;  4FPK A;  3H8X A;  3ZX7 A;  2IXL A;  4DUX A;  4JGY A;  2C24 A;  2Z42 A;  4L2N A;  4MGY E;  2R07 2;  3VBU C;  4XBN A;  4DY3 A;  3EJK A;  2DYC A;  1V6M A;  4AVS A;  2WS9 2;  3FLT A;  2JX9 A;  2O14 A;  3T09 A;  4IL7 A;  1AL2 2;  5HV0 A;  4BQW A;  5B4X A;  2A6X A;  3MI8 A;  3KT4 A;  1KQR A;  4EWD A;  1Q8S A;  1CES A;  4AEM A;  1H4H A;  2J22 A;  1UZV A;  4FTS A;  3FBM A;  5IK8 A;  4ONU A;  1POV 3;  3ZKY A;  1HQL A;  2I45 A;  2ARC A;  4UI9 L;  1HQN A;  3ILF A;  5FXV A;  1LNS A;  1W3X A;  3LFM A;  4XF1 A;  4LBL A;  3ZSL A;  4Q8L A;  5HCF A;  4HFS A;  3MEP A;  1EV1 1;  4IEP A;  5E16 A;  4IEZ A;  5FLJ A;  1VMF A;  4IE5 A;  1RGS A;  2AC1 A;  3AB0 A;  3PVN A;  4OZX A;  3ZYP A;  3M8L A;  2AEY A;  1I9R A;  1VB2 A;  3Q8C A;  2G4I A;  4BYY A;  4YG3 A;  2VH9 A;  1MQT A;  3MIE A;  4LTA A;  1DF0 A;  4QX1 A;  5D2A A;  3JCI A;  4C1W A;  1V6N A;  1LEC A;  2WIN B;  3AP4 A;  3P1I A;  3VHN A;  1O8S A;  2ZKN A;  3B69 A;  4LLF A;  3MIH A;  5D8A A;  2RMU 3;  5DUX A;  5LBB A;  3W58 A;  3ZYR A;  1XYO A;  1D4M 2;  4HSL A;  4XQW A;  3VL9 A;  1J84 A;  2IXJ A;  4MXW A;  4KG8 A;  2Y0O A;  4QDS A;  4BIF A;  4OUL A;  4YVW A;  1MZF A;  3I7D A;  2XUE A;  3AKR A;  3UK9 A;  1W3V A;  3FFQ A;  3N9P A;  3MV0 1;  4ZU5 A;  3WNK A;  4XJ8 A;  4D3W A;  2VZ1 A;  4FPF A;  3T2P A;  5KBF A;  2D7F A;  4JCK A;  1G9F A;  1U5Y A;  1ZA7 A;  1G86 A;  5I0U A;  3W5M A;  3GZU C;  1L7L A;  3AYD A;  2R16 A;  3MGU A;  4N8M A;  2DCJ A;  3FBY A;  3MID A;  4I3P A;  4RFT 0;  5FLH A;  2VY0 A;  4CCN A;  3U78 A;  5FQ0 A;  2QJV A;  3NMB A;  4HL0 A;  2CU5 A;  2WNO A;  3T2Q A;  1RUE 1;  1VAK A;  2Z69 A;  4GZ9 A;  2OT7 A;  4F83 A;  2R07 3;  1N3P A;  2R49 A;  4WVM A;  3RJR A;  3POS A;  3C7H A;  4YPJ A;  1AR9 1;  3JBG 3;  1JZ4 A;  3TOJ A;  5F5I A;  4QX7 A;  4IEX A;  3K77 A;  1H0B A;  1ULG A;  4QMA A;  3RGB A;  4L99 A;  3ZIW A;  5ANQ A;  4CCE A;  2IZW A;  3W59 A;  3CL1 A;  3A22 A;  1MS1 A;  2W2I A;  2WZR 2;  1BK0 A;  5GLU A;  1VP6 A;  1O91 A;  3SKV A;  3O0X A;  3RZK A;  1YYN A;  1N47 A;  3O0W A;  1FI2 A;  5F3E A;  2D97 A;  5A3W A;  4AZZ A;  4COW A;  3VDB A;  2CWM A;  4W8J A;  2DCT A;  5HXM A;  5FTT C;  2GU9 A;  1FMD 2;  4BIO A;  5FZE A;  5FMD A;  3SCF A;  1OI6 A;  2D5F A;  4UFI A;  2W08 A;  3UT0 A;  4LUK A;  2RJK A;  4GJY A;  4OYU A;  5EV7 A;  4AFM A;  4AOC A;  3AZV A;  2HWE 1;  2VME A;  4E27 A;  3I2O A;  1WMD A;  1ENX A;  2Q1M A;  3JXS A;  1UKR A;  4K3U A;  3LD8 A;  5FCC A;  4ZXK A;  3WW2 A;  4H55 A;  4XC9 A;  4URA A;  3K4Z A;  4A3Z A;  4QQP A;  4GKX A;  4EN6 B;  2XVL A;  2BNM A;  2CWS A;  3VKO A;  3WHT A;  1HN0 A;  3ZO0 B;  1U0A A;  4NVP A;  4KU7 A;  1DLC A;  4WVM B;  1AJK A;  2IVI B;  1SBE A;  2RM2 1;  1VBD 1;  4Q27 A;  3WNO A;  4E4Z A;  2GSY A;  4NPL A;  2HWF 2;  3KHB A;  1WME A;  5EJZ B;  1H8T C;  3WG1 A;  1RTV A;  1BZW A;  4HON A;  2DVG A;  4KWU A;  4UW4 A;  5JIU A;  2DU0 A;  3N9L A;  4ZPI A;  3ZMO A;  4LEJ A;  3CKH A;  2IXH A;  2P37 A;  4DIN B;  1W9W A;  3VKM A;  3WDU A;  4ZY9 A;  5DN2 A;  2XON A;  3PMS A;  2ZML A;  1CJD A;  1Y43 B;  1IHM A;  3AP5 A;  4ZU7 A;  3AYC A;  5C3R A;  5C7G A;  1G9C A;  2R1B A;  4M4R A;  5T3N A;  3NWK A;  5IK7 A;  4KWL A;  1AF9 A;  3O1O A;  4LO5 B;  1BXH A;  1UU6 A;  1JN2 P;  1HDK A;  2HWB 2;  4OHX A;  5C4W B;  1Y9Q A;  3A0K A;  1Z7S 2;  4QB2 A;  2ZGO A;  3UL2 A;  1L7Q A;  5LCW L;  4EE2 A;  1IS3 A;  1REF A;  4HG6 B;  1STM A;  1YFX A;  1DG6 A;  2DVA A;  2EIC A;  1W6Q B;  2J1V A;  2VCB A;  2YGM A;  3BPZ A;  5H9S A;  2XLG A;  1GZW A;  5GLT A;  4X8N A;  3D3A A;  4MAD A;  5A3T A;  4MGQ A;  5HPO A;  5DDJ 1;  5IVC A;  1ZBE 3;  3BKZ A;  2OXB A;  3D5O A;  5A7S A;  1GZC A;  5CZK A;  4FPE A;  4LBN A;  1OA4 A;  2QDN A;  2VU9 A;  1NZI A;  2ETE A;  1GU3 A;  3SH3 A;  1GNH A;  1VBE 3;  1ZBA 3;  2PQQ A;  5F3G A;  3RQ0 A;  3WNN A;  4CXY A;  2NP0 A;  3N7M A;  1CZS A;  1S2E A;  4D7S A;  2QQW A;  5JZG A;  2HWD 3;  1UX6 A;  3BTZ A;  3I3D A;  4X6R B;  2PQS A;  4N9I A;  2DUQ A;  2C26 A;  2QTW B;  4LBM A;  4PLN A;  2OZ6 A;  2A70 A;  2ZMN A;  2ZOE B;  1BJQ A;  3MW4 A;  4PIY A;  5FUP A;  2UUR A;  3AYA A;  3RZH A;  5APA A;  2VZO A;  3KV9 A;  1FNY A;  1LGC A;  1SMV A;  2IXI A;  4B7K A;  2IWG B;  4AI1 A;  2ZXQ A;  3VL8 A;  1S0E A;  3S7E A;  4ARX A;  3I2F A;  1LHO A;  3AMH A;  5A70 A;  4P9G A;  5FZM A;  5CVR A;  3WP4 A;  2P5B A;  4ES9 A;  3G7D A;  2VOT A;  4MUV A;  2ZS6 B;  3VDD B;  1IPJ A;  3OY8 A;  3PVO A;  4AQS A;  2QZ3 A;  3N9M A;  5T5L A;  4NIG A;  2VG9 A;  3KWV A;  1T6G C;  4I30 A;  3KCY A;  4N43 A;  3TEY A;  1KJR A;  5CNA A;  1R08 2;  4DMI A;  3PIG A;  1J1L A;  1C8M 3;  2QVS B;  3POI A;  3W9A A;  5LA2 A;  5DAX A;  3Q8B A;  3CBN A;  2HWE 2;  3T2T A;  4FPY A;  1CGP A;  2R30 A;  1JTZ X;  3I2H A;  2BNO A;  3U4S A;  3J8F 3;  2VMC A;  5CA6 A;  4MGT A;  3LOI A;  1WUV A;  1OOP B;  4KWK A;  5T5O A;  5CFD B;  5JOX A;  4EN8 B;  1OPM A;  4Z82 A;  3H3L A;  1MEC 3;  2GAU A;  2WN3 A;  5J7M A;  4HKL A;  2ZEX A;  5G04 L;  2VNR A;  1FV2 A;  1J83 A;  2G9G A;  1RJ7 A;  3VHR A;  3HQR A;  2OVU A;  1LOF C;  4PHZ A;  1O3S A;  3AKP A;  5KXB A;  1OLM A;  1W6M A;  4AVT A;  1VBB 1;  3B7M A;  1QH6 A;  1IKP A;  2QUO A;  2AEZ A;  4D6S A;  5FZ0 A;  4IV3 B;  4QB1 A;  4QPI B;  2W1W A;  1RUI 2;  2X5I C;  1O5U A;  4COU A;  2XJT A;  3HPN A;  1ODM A;  1RUE 2;  1H4G A;  3ZMN A;  3TEZ A;  1RUF 3;  3WEZ A;  4BM8 A;  4QHZ A;  4XFF A;  3J7M A;  3VBO A;  1KEX A;  1RUI 3;  3CNA A;  3T3Y A;  1URX A;  1KFU L;  1ND2 B;  1EP0 A;  3VGI A;  1GUI A;  2ARX A;  2OPW A;  3DL3 A;  3KV6 A;  5BNN C;  1H2N A;  4L11 A;  3WW1 A;  4CCO A;  3T0B A;  5JSO A;  4BQ2 A;  4GMP 3;  3I4I A;  1FOD 1;  1CAU B;  1FPN 1;  5AVP A;  5K8S A;  5A1L A;  4FSJ A;  3RDI A;  1O4Z A;  1FNZ A;  4Z92 B;  1SAC A;  2BRT A;  2OKX A;  5ERL A;  3WSO A;  4IEY A;  3CJI C;  3MW3 A;  5CKN A;  1DQ2 A;  4FOY A;  3RS6 A;  3WV6 A;  1JZ8 A;  3N36 A;  4JVA A;  1UW8 A;  3BIE A;  2QBX A;  1RIT A;  2RDN A;  2YHJ A;  3V56 A;  1PO1 3;  4QQL A;  2RR1 2;  1WD4 A;  3VB9 A;  1AX1 A;  4M0N A;  1R09 3;  3GBF A;  3N7J A;  2V5D A;  2VC9 A;  2J1U A;  4CP0 A;  4KNC A;  5B2G B;  1ZM1 A;  5K0U C;  2QQK A;  1NQD A;  2Y6L A;  4Y22 A;  2BV4 A;  3WD5 A;  1DDL A;  4MV2 A;  3HBZ A;  5KHG A;  3B9I A;  4FOV A;  1CPN A;  1XNC A;  1HW5 A;  2XBO 2;  4N43 B;  4XF0 A;  4XHB A;  4DXT A;  1AR8 3;  3III A;  4K7J A;  2E7Q A;  4M01 A;  3K75 B;  4LO7 A;  4BIS A;  1HJG A;  4AI2 A;  5DUW A;  1DGR N;  4KGG A;  5IK5 A;  3O1T A;  4K9S A;  1YQ6 A;  1ZRF A;  5I0D A;  3VD9 A;  3TN9 2;  1JH5 A;  4XFA A;  3U75 A;  1SFN A;  1OD3 A;  5FYU A;  5JOZ A;  1AR7 1;  1YRZ A;  3WQ7 A;  2UYA A;  5FOJ B;  4Q0V A;  4GXL A;  4IER A;  2O8O A;  1EAH 3;  4IND A;  1HRV 2;  2WT0 A;  2VZP A;  3N9N A;  2D98 A;  1LEN A;  4QU1 A;  4Q1P A;  4YRD A;  3V0A A;  3LA3 A;  4XEZ A;  1GYK A;  4XAE A;  5GLZ A;  2Y0I A;  3OCP A;  3LPF A;  4K21 A;  4Q4W 1;  4CU8 A;  3LE0 A;  5BY5 A;  4FOQ A;  1BK1 A;  4MX3 A;  2LM3 A;  4R4Z A;  2EVX A;  1QOS A;  5AFE A;  3KV5 A;  1NCR B;  3IKW A;  3WF4 A;  4LBJ A;  1TE1 B;  2FDG A;  3U37 A;  4A6S A;  4D6Q A;  5DZF A;  1LKN A;  4KU8 A;  3F2Z A;  1X8M A;  2D40 A;  3KQ4 B;  3O1V A;  4WVW A;  2TUN A;  5F6K A;  2DUP A;  4LIU A;  4QPI A;  4H3W A;  4DZG A;  3RZL A;  5LB6 A;  3ELN A;  2P6H A;  4RD7 A;  4FO9 A;  1OUR A;  3RWN A;  5CFC A;  4YW7 A;  4IE7 A;  2VNV A;  1JU4 A;  5FMO S;  1CAW B;  4XPV A;  3S5Q A;  1E5R A;  1VBA 2;  5A3M A;  1A3K A;  3OY8 B;  2ZTN A;  5BNO A;  5L36 A;  1V70 A;  2Z4F A;  4IV1 B;  5C4W A;  1W8H A;  1GNY A;  5LBE A;  3BIW E;  4N7I A;  5EYX A;  3ZN4 A;  2Q5T A;  5DXD A;  3I59 A;  4QPG B;  1GQH A;  1NY7 2;  5BNO C;  3VBR C;  4ZS2 A;  3J7N A;  3ZPY A;  3CEW A;  4RR3 C;  4MHR A;  4BA6 A;  2C1F A;  2W46 A;  5FYH A;  3B9C A;  4Z1V A;  4XTM A;  1R09 2;  4YGB A;  3J7H A;  4BQ4 A;  5F8P A;  4OVE A;  4CDQ A;  1X8E A;  3VBR A;  4IGO A;  2VO5 A;  2FMY A;  3H42 B;  1DBN A;  5DZG A;  4RR3 A;  4PDW A;  5L73 A;  3OG2 A;  2E53 A;  4OHZ A;  3ZR6 A;  1SCS A;  2MEV 2;  1B35 B;  5I0S A;  5JDB A;  3RJ2 X;  1A34 A;  4JDM A;  2ZHK A;  1N1S A;  4I0W B;  4Q4Y 1;  2W94 A;  4XOG A;  1KS5 A;  4E4H A;  2WNU B;  2VR4 A;  1DFQ A;  3QH7 A;  1PVX A;  1UY2 A;  2H6C A;  3AC0 A;  2ES3 A;  4KWJ A;  4GAL A;  1C1F A;  3KM5 A;  3OEA A;  4UF0 A;  5JR7 B;  1V9U 1;  2GNB A;  1X7N A;  4KL1 A;  2RS5 1;  1PK6 B;  1TMF 1;  4AHW A;  3H0O A;  1IOA A;  1VAM A;  2DUO A;  4CU6 A;  4XJA A;  3ZSJ A;  1DZQ A;  4LK7 A;  3ZXA C;  1JMU B;  4XDO A;  1OQ1 A;  2O0O A;  1PO2 2;  2QQV A;  3SXW A;  2XJQ A;  3OPT A;  4XFB A;  4C0B A;  3S5A A;  4DO0 A;  2WNU C;  2AZ5 A;  4NHY A;  3GJA A;  3KF3 A;  2RJL A;  3ZXG A;  3AKS A;  4OQ8 A;  1WA4 A;  1H9W A;  1RUI 1;  3P6B A;  4IEQ A;  4XFI A;  1H1I A;  5LY2 A;  1EUT A;  3ZOI A;  1JU3 A;  2GND A;  4QKB A;  1FMD 3;  4ISQ A;  4BXS V;  4EQV A;  4HKO A;  1CWP A;  4NRP A;  2GMM A;  4XZU G;  5BUV A;  3VBR B;  4HET A;  2XJP A;  1QXP A;  2JDY A;  4R9A A;  4IV1 C;  2W95 A;  2WZR 3;  3DYO A;  3LIH A;  4NRM A;  3T4V A;  3FUQ A;  3LOB A;  2C9A A;  5FY0 A;  4OI1 A;  2LRO A;  1Q8Q A;  1UWW A;  4RYD A;  5FYC A;  1BBT 1;  5FYT A;  1RUH 2;  3O12 A;  1YHF A;  1UOJ A;  3PUI A;  3TEX A;  2XL7 A;  2DUR A;  1MS3 A;  1YQ5 A;  1D0G A;  1RUJ 1;  2JKB A;  2CNA A;  4LKS A;  2BNN A;  4NRO A;  4PIZ A;  3GM8 A;  5FZ1 A;  1F8V A;  2IVJ A;  4ORF A;  5JSP A;  1O3T A;  3AMM A;  1ULO A;  4KGQ A;  1V6L A;  2XOM A;  3FL7 A;  2Q8C A;  2X29 A;  4N7U A;  1QDO A;  1G9B A;  1IG0 A;  5J98 B;  5F3C A;  1O59 A;  4GUL A;  4AWD A;  2HWE 3;  2YB7 A;  4Q5O A;  4OHW A;  2TBV A;  5FRA A;  3AX4 A;  4HPK A;  2GC3 A;  3T08 A;  1MVE A;  5CAZ A;  1AVB A;  2PLV 1;  3O1P A;  3VV1 A;  3WNX A;  5J36 A;  3F95 A;  4GB3 1;  2DBI A;  4KG0 A;  4OUS A;  4YW6 A;  3BAL A;  4PCR A;  1J3P A;  3N7L A;  1NYW A;  2AH2 A;  1RL3 A;  1DQ1 A;  1XQN A;  5A7W A;  5JPM B;  3ACL A;  3ZFE B;  5JOW A;  5IVV A;  4XMA A;  4A2U A;  5IVJ A;  1IZ3 A;  1DGR A;  1OKO A;  4K1Y A;  3WIN E;  1SLL A;  4ATF A;  5CKM A;  2Y38 A;  3GGL A;  4GH4 B;  4JQR A;  4W6X A;  2EXJ A;  3WCS A;  3ACH A;  1C4R A;  1JOJ A;  1W28 A;  4LBQ D;  5FZB A;  4XJW A;  4CEY A;  1XYN A;  1SHW B;  3JB8 A;  3LAG A;  3GHN A;  4Q0U A;  1SCR A;  3NJX A;  1W6N B;  1HB3 A;  3ZFE C;  4UBG A;  1PNG A;  1W8Z A;  2JG9 C;  1DQ0 A;  5A80 A;  4FTB A;  1W39 A;  3FWE A;  2DVB A;  4LHK A;  2W1Q A;  1DYK A;  1IS6 A;  1W8N A;  3ZFE A;  1CAU A;  1HN1 A;  4OLL A;  2A73 B;  2JG9 A;  2XHN A;  1KDM A;  1ZBA 2;  1VBE 2;  5LAS A;  4BQX A;  4P00 B;  5K0U B;  4M4P A;  1RUN A;  1WLW A;  1V6K A;  3ST7 A;  3NNJ A;  1K5M C;  1ND2 A;  2XVG A;  2V4A A;  1CX1 A;  2D6M A;  3H7J A;  3CQO A;  3JQW A;  3CJX A;  2RG4 A;  5IAX A;  2OQ6 A;  5FPA A;  2BPA 2;  1XPW A;  3OBR A;  2VQ0 A;  3I2I A;  4OZO A;  2Y64 A;  1QY4 A;  1GWL A;  3CZU A;  3OPW A;  5CBL A;  5LK5 A;  1VBC 1;  3E5U A;  1CAX A;  1AR9 2;  1XRU A;  3ILR A;  5E1R A;  4NJ4 A;  1EY2 A;  1APN A;  4XBQ A;  2XB6 C;  2OS2 A;  1MPX A;  1DHK B;  5FY5 A;  2PHT A;  2E51 A;  4MGI E;  4CCM A;  4Z2W A;  1W6N A;  3LEI A;  5EIY B;  5D8A B;  4CCK A;  2B4K A;  2ERF A;  3KGZ A;  4RHV 1;  5CFD A;  4YAR A;  4UFH A;  1XU2 A;  2XJS A;  1VLN A;  1RVF 1;  4O61 A;  2VZQ A;  2XXZ A;  3AXD A;  1OFN A;  3MBW A;  4E2Q A;  1V9U 2;  1JYT A;  4Q26 A;  4CRQ A;  3PU8 A;  2ZJC A;  4FAH A;  2ZZJ A;  4V1P A;  1JYV A;  4KI5 M;  4HZF A;  4QPI C;  1AR8 1;  3DEC A;  1W2T A;  1OLM E;  1SFY A;  1O8P A;  2QNK A;  4JAA A;  4OHY A;  1POQ A;  3A4U A;  3RZZ A;  1XSR A;  2ZGU A;  4QQ2 A;  3ALQ A;  5FYI A;  5C8C C;  1X9P A;  1UYZ A;  1UXX X;  4HAN A;  3M4F A;  4XDQ A;  5FZF A;  4F8A A;  1PK6 C;  3I2K A;  4HPK B;  5HI0 A;  4IGQ A;  4H7M A;  1QHD A;  1HV1 A;  1OOP A;  3I2D A;  4LOT A;  1C1L A;  4U2A A;  2C5D A;  2EXK A;  1AX2 A;  2BFU S;  3DCQ A;  3FC0 A;  3HVD A;  2GC0 A;  1EPW A;  3RVH A;  1PK6 A;  4QXB A;  2A7A A;  2XML A;  1HV0 A;  3AZX A;  1OH3 A;  1OOP C;  4R9D A;  1Z0H A;  2W47 A;  4UFM A;  2HWC 3;  1O5L A;  1O4Y A;  2EF6 A;  5BNP A;  3ZM8 A;  3N9Q A;  3WNL A;  4BLI A;  2WQ8 A;  2VMI A;  2VZ3 A;  2UWA A;  1JZ7 A;  4G9S B;  2P34 A;  3NST A;  2P3J A;  4TXW A;  3IM0 A;  2GMP A;  5L9V A;  4X8P A;  2W1U A;  5FV3 A;  2WZR 1;  2NM1 A;  4FTE A;  3O1U A;  1WZX A;  2XJR A;  5HBA A;  2RS3 1;  2BVV A;  3V0B A;  2XG3 A;  1MS5 A;  4YM1 A;  5FZA A;  1YCI A;  4OFG A;  3K4D A;  1EYB A;  2D93 A;  4LR4 A;  4YW4 A;  5FP8 A;  5BPX A;  3SCG A;  1N1T A;  4AG4 A;  1W2U A;  2VZT A;  3AVS A;  4NUB A;  2BBA A;  3DYP A;  5HCA A;  2A75 A;  4L0P A;  5A6Y A;  5KXD A;  1UU5 A;  2P3K A;  1HLC A;  3VDD C;  1AR9 3;  1MQT B;  2J1E A;  4XUR A;  4E8D A;  4HXC A;  1LUL A;  2RJ2 A;  2YC4 A;  4YM0 A;  1F15 A;  2DVD A;  4NHK A;  1Z78 A;  4AGV A;  3BI3 A;  1R08 1;  1UY1 A;  2VVD A;  3RYP A;  4D6R A;  5F37 A;  3E6D A;  1XE8 A;  1JYW A;  5F7U A;  3LEK A;  3AKQ A;  1J59 A;  4LBQ A;  3H8U A;  4LMF A;  3WUD A;  5LA1 A;  3I59 B;  2VW2 A;  3AMP A;  2IXK A;  2P2K A;  2VE1 A;  4IDZ A;  4NHX A;  1W2O A;  5A6Z A;  2YC0 A;  4NHL A;  3QD6 A;  3P5B A;  2G9Z A;  3OUH A;  3ZKU A;  5DUV A;  4IEU A;  5JMC A;  3CIH A;  5FZH A;  4E8C A;  4I02 A;  5KXC A;  4PLM A;  4TSV A;  1G8W A;  3QCW A;  2F17 A;  4S2G A;  1CZT A;  1LHV A;  3THC A;  1A8D A;  2XUM A;  4TWT A;  3NKT A;  3NJZ A;  2XKP A;  3PVB B;  2JD4 A;  4P5Y A;  4CP2 A;  4LIV A;  4ERO A;  1BQP A;  3LSD A;  4IW3 A;  4CZS A;  4ZHN A;  4CDW C;  2YBK A;  3J7L A;  5C8W A;  2RHP A;  2LS6 A;  3ZFG C;  4QHB A;  5FFO C;  1YWK A;  2VL4 A;  5BNQ A;  1COV 2;  2PHL A;  5I0R A;  1UOF A;  5C9A C;  5T54 A;  2A5Z A;  4LOS A;  4XCB A;  1TQ5 A;  3NV3 A;  4N43 C;  4A6O A;  5FZ4 A;  4BME A;  1W06 A;  4Y5S A;  3AMQ A;  4YG6 A;  4D0Q A;  4DNY A;  1AJO A;  2DWR A;  4XDP A;  2R06 1;  4COV A;  5GLV A;  5B4N A;  5FPV A;  3HQU A;  2BWC A;  4J25 A;  2WT1 A;  4QT6 A;  2A3X A;  3OGG A;  2I07 B;  4UFL A;  5GLW A;  5GZG A;  4P9X A;  4TYS A;  2D6N A;  4Y1V A;  3WF1 A;  2GP5 A;  4P5H A;  2W52 A;  2B45 X;  2VW0 A;  1GP5 A;  1O6U A;  4K6B A;  5A33 A;  4CUA A;  2WLP A;  5JI7 A;  3ZDV A;  1PO2 3;  4Q4W 3;  1H8T B;  1IQD C;  2JIG A;  4GJZ A;  3EMR A;  3AFK A;  2W9X A;  3M7A A;  3QBQ A;  3OF1 A;  1D7P M;  5I91 A;  4W65 A;  3ZIX A;  3HNM A;  5FXZ A;  4KH9 A;  5FZ3 A;  5AFB A;  5DG1 A;  1H2K A;  3VKF C;  5A1F A;  5JIA A;  3D0S A;  4AVA A;  2WAA A;  1SG3 A;  2XJV A;  2JDM A;  2HYX A;  1XC6 A;  4R9C A;  4DXR A;  1IKQ A;  1SQ4 A;  5FYB A;  5IW0 A;  5JXJ A;  2FZ2 A;  1DGW X;  5FY7 A;  1ZVF A;  3T1L A;  1QQP 3;  4IE6 A;  4WVZ A;  4XUQ A;  4PIX A;  1T6B X;  1UO9 A;  5LA9 A;  3NNL A;  4YG0 A;  3VZM A;  2X5I B;  2ZA9 A;  3NVC A;  5IVE A;  4IV3 C;  1F35 A;  4M3C E;  2JIJ A;  4M3C B;  4FI9 A;  1ULC A;  3MDP A;  3URF A;  2CAU A;  3WDT A;  1QJY 2;  3SKJ E;  1W6O B;  5FPL A;  1J1T A;  1JI6 A;  1EAH 1;  1XNB A;  4AEK A;  4I2O A;  2P4E A;  1SBF A;  4YW5 A;  4BXF A;  3HMY A;  3OUI A;  3WG3 A;  4GIQ A;  5GZD A;  1RUH 1;  1AYN 2;  2EXI A;  2QQO A;  4ZS3 A;  2AUY A;  4P9Y A;  5CFD C;  3UJQ A;  3FLR A;  3I2G A;  3VBU A;  3UES A;  4AHY A;  4OUE A;  1CPM A;  1M06 G;  2R06 3;  4P02 B;  1S2K A;  2E33 A;  2K2S A;  4QKF A;  5DG2 A;  1OUS A;  1ZZ9 A;  4UT5 A;  3EB7 A;  2WJS A;  1R1A 1;  3KZ4 C;  3M3C A;  4XAC A;  3VBS C;  3ZXF A;  4ISR A;  5J3U A;  5LWB A;  1ZRC A;  1VRH 3;  3WHU A;  1K42 A;  3H8R A;  4LHS A;  5CAD A;  5FKB A;  1JZ6 A;  4AL9 A;  5A32 A;  2ZKL A;  1YI9 A;  3HJR A;  3Q8A A;  5JZG B;  3D8C A;  4NE9 A;  1E5I A;  3SCH A;  2KXL A;  5FJH A;  1WLT A;  3VZN A;  2YV8 A;  1WD3 A;  4DS0 A;  2WFP A;  1VBA 3;  1HRV 3;  2HJI A;  4BQ5 A;  5K9Y A;  2DF7 A;  4QM8 A;  1HXS 1;  1MZE A;  4RFR B;  2B7Y A;  1YUD A;  3SH5 A;  5IT6 A;  2Y60 A;  1NXM A;  4CDX B;  4GWN A;  3NL1 A;  1OSG A;  5CFC B;  3E97 A;  3MIB A;  4O65 A;  4LXL A;  1W6Q A;  4Z2A A;  4N90 A;  5C6C A;  2D3R A;  5IVB A;  3H3U A;  1JYI A;  1PHM A;  4N53 A;  1QXR A;  2C9K A;  5IVF A;  4TTG A;  3ROU A;  3ACF A;  2EID A;  1D4M 1;  2ZMK A;  4QKN A;  2X09 A;  3JD7 3;  4QGL A;  5CYY A;  1O3R A;  3O1R A;  3PUS A;  2BZD A;  1PGL 1;  1K5J A;  3QH6 A;  4HSJ A;  1UL9 A;  2W0X A;  4CUC A;  2ZGK A;  4FPL A;  2BOI A;  1US3 A;  1Z7S 1;  1RUF 1;  1U5I A;  1NY7 1;  2BVB A;  2VJX A;  4Y26 A;  5FMO L;  3ZN6 B;  2A6W A;  2YG0 A;  3JU9 A;  2VVF A;  2ZZQ A;  3IIA A;  1NQJ A;  1I5P A;  4MXV A;  2HWB 1;  5FR3 A;  4YNI A;  4FXK B;  3U11 A;  1V6I A;  1CJP A;  1NLQ A;  3SC7 X;  2HBU A;  4ZU4 A;  4P08 A;  5FIX A;  1JOB A;  2EIE A;  2H0V A;  5CFC C;  1DQ5 A;  2GAL A;  3UGH A;  5KXE A;  3D82 A;  1I1E A;  3HBK A;  4I01 A;  2YBP A;  1GSL A;  4XMI A;  1QJX 2;  4LA2 A;  3UV9 A;  3VBO C;  3EYP A;  5F5A A;  3OGR A;  2DCY A;  5JXI A;  2BGO A;  2JDH A;  2XBO 3;  3M3Q A;  4JGZ B;  1UY0 A;  5C4W C;  1W03 A;  3IZO A;  5IAT A;  3JB4 C;  2ZAC A;  4XE9 A;  4UBH A;  2Z2S B;  3H9A A;  2B5H A;  2BDR A;  1Q3E A;  4KBZ A;  2VNO A;  5FY8 A;  3USS A;  4QX0 A;  2RM2 2;  3N7K A;  1RUD 2;  2PHX A;  1JUH A;  1NCQ A;  3J26 N;  4CDQ C;  2UY8 A;  5C3P A;  5FOB B;  2XKO A;  5FBZ A;  3G6J B;  2N7G A;  3GZE A;  3NW4 A;  4IEW A;  1RUJ 3;  4YZ5 A;  1FAY A;  1RUE 3;  4NPR A;  2RR1 3;  5GKA C;  1ULF A;  4PT6 A;  2B46 X;  2Y33 A;  4BJ0 A;  4DY5 A;  3R6S A;  4UXA A;  5GJ6 A;  4MLO A;  4O9E A;  2XLA A;  2MHF A;  2PHF A;  3LIG A;  3BTY A;  3AKT A;  3N4M A;  4ASL A;  4LIT A;  1AYM 3;  2EAL A;  3FUO A;  1RUG 3;  1A8M A;  2QQM A;  5JWP A;  1L3J A;  3GF6 A;  3RI9 A;  1F9K A;  4JKL A;  2A6Z A;  4B4R A;  5CG9 A;  5EXO A;  3WNP A;  1OQD A;  3IAP A;  1MEC 1;  5FO7 B;  1CR7 A;  3USU A;  2HYK A;  3QOP A;  5DDJ 3;  3RNS A;  3RI8 A;  5I8T A;  1ENQ A;  1Y3T A;  4DFS A;  1LU1 A;  5K4L A;  4DRR A;  1ALY A;  2MEV 3;  1XYP A;  2ZX1 A;  3BYW A;  4J1X A;  1ASJ 3;  1AYN 1;  2GN7 A;  3O5S A;  4OMD A;  3ZXJ A;  1QDC A;  5A3N A;  3WG2 A;  3MF6 A;  4XF3 A;  4I0A A;  4HVR A;  3WF3 A;  3ZSK A;  4UW5 A;  1WLC A;  2WDB A;  1GKB A;  4S2H A;  1UKG A;  4AI0 A;  2RE9 A;  4FBF A;  1RUD 3;  2FDF A;  3HD8 B;  3IDC B;  4Y5Z 0;  3T4H B;  3C7F A;  3OGJ A;  1S55 A;  3WDX A;  5JR2 A;  3DKW A;  2JG8 A;  2V73 A;  4AE2 A;  2VQA A;  2JIC A;  1D2Q A;  1GFF 2;  2HEV F;  3M3I A;  3ZYH A;  4Y4Y A;  1ZA4 A;  2RS1 3;  5T52 A;  1LHN A;  2GH8 A;  3M70 A;  2WC2 A;  2RDS A;  2ZEW A;  3LQC A;  3NV1 A;  3OD0 A;  2VD7 A;  1QNY A;  4QXC A;  3ZR5 A;  2OII A;  3DF0 A;  2WAB A;  4NHM A;  1YNA A;  3Q8F A;  2A71 A;  3KMH A;  2ZAA A;  4Q8K A;  2WZ8 A;  4F3J A;  1QJU 2;  3J8F 2;  1A78 A;  3CU7 A;  4QAW A;  4M0H A;  1AR6 3;  1HIX A;  4NRQ A;  2W1S A;  4E2G A;  3H1W A;  3HOB A;  4YGC A;  4NMI A;  3AYE A;  2VBB A;  2ZEY A;  3AK0 A;  2VCM A;  4TN7 A;  4UW6 A;  4RHV 2;  1E57 A;  1QF3 A;  4OMC A;  2WII B;  2GP3 A;  1QIQ A;  4IET A;  1PGW 1;  3RPQ A;  5GZF A;  1DP0 A;  1RMU 1;  4IGP A;  2MNG A;  4XUT A;  5T55 A;  4B1L A;  1AYM 1;  3I3B A;  1UMZ A;  4MYE A;  2GNT A;  4GB3 3;  1B35 A;  4FPC A;  1VRB A;  3I97 A;  2OQ7 A;  4XBL A;  2KM2 A;  4DB5 A;  4YM3 A;  2PXJ A;  3ZFG B;  4RGG A;  1HRI 3;  1XOY A;  2HH9 A;  3AJZ A;  4YVS C;  5EPA A;  4IXL A;  1S4C A;  2VMH A;  4GWM A;  3RFR A;  3THP A;  1VBC 3;  3WQ0 A;  2RVA A;  1QGL A;  1QOT A;  3AM2 A;  1SPP A;  1G6N A;  1PMH X;  4BLJ A;  2WLQ A;  4CEW C;  4YVS A;  4SLI A;  4AI8 A;  4PI0 A;  2BTV C;  4XIK A;  2R32 A;  4PJY A;  1X36 A;  5EYY A;  2R07 1;  2OX0 A;  2NN8 A;  5HXV A;  1LED A;  5AC9 2;  1L7R A;  3UYJ A;  5JLV A;  2PA7 A;  2K0G A;  2VMD A;  4E2S A;  4DUW A;  3NNG A;  1Y9G A;  3DN7 A;  5BV6 A;  2RDR A;  1O4T A;  4DOU A;  1VRH 2;  2A6V A;  3OJB A;  1RUC 1;  3GZT B;  3ZSM A;  4M3C F;  4XXA A;  2UU8 A;  5L9B A;  1PO1 2;  2VZR A;  4GA9 A;  4SBV A;  1SDW A;  3MFA A;  3JQX A;  2WNU A;  4XAB A;  1J3R A;  2C0Z A;  1FPN 3;  4LPL A;  4E4D X;  5FXW A;  2PAE A;  4P9W A;  3NKG A;  4KQ7 A;  4AFA A;  4CVU A;  3L2H A;  1GMM A;  1ASJ 1;  1AYN 3;  4YGE A;  1RC6 A;  1W05 A;  5FUI A;  3UGF A;  3A7Q A;  4CCD A;  2YPJ A;  4CP1 A;  1Z7S 3;  1ZZC A;  1H9P A;  4KMQ A;  5A3O A;  3ZYF A;  5IHR A;  3VBF B;  2VUJ A;  4RGK A;  4FFF A;  4GD4 A;  1RUC 2;  2EA7 A;  5C33 A;  3EXU A;  1QJY 3;  2VMF A;  4JKK A;  3WZ1 A;  3ZYB A;  1PVC 3;  2TNF A;  2C4X A;  2VUD A;  2WWU A;  1ZX5 A;  1PIV 2;  4LLO A;  1D0H A;  2ATF A;  4HLT A;  3TRS B;  3HT2 A;  1RUG 1;  2X10 A;  1OVS A;  4DQA A;  2PHR A;  1YJK A;  4TLF A;  5L7O C;  2W5F A;  3A21 A;  1GOF A;  4FFG A;  3Q8E A;  1WCQ A;  1QQP 2;  2J1S A;  1ZRE A;  3LGR A;  1WLD A;  5G05 L;  3O1M A;  1CON A;  3VKL A;  4BQ1 A;  1LB2 A;  3I49 A;  2FDK A;  2HEW F;  2Q8E A;  1FT9 A;  4QX5 A;  1NZC A;  4DIQ A;  1NA1 C;  5F9T A;  1QJX 1;  2HWF 3;  2GC2 A;  3KVB A;  2EXH A;  2WN2 A;  5SV5 A;  5LK7 B;  2R04 1;  1JHJ A;  1OD5 A;  3ZFF B;  4COY A;  2XWJ B;  4BK4 A;  3LEG A;  3JBG 2;  1LU2 A;  4CDU B;  2VOW A;  4FFI A;  4HVO A;  4E4S A;  2FCV A;  3BCW A;  4ES8 A;  3IN9 A;  5JOY A;  1NCQ C;  4FP2 A;  3IPV B;  4I3G A;  5AVA A;  5FYS A;  4RQP B;  2UWC A;  3L2Y A;  3NAP B;  3L9J T;  4ATE A;  3NAP A;  3K46 A;  3VZO A;  3DPR C;  4RS5 B;  1W9F A;  5DMY A;  3THT A;  1JW6 A;  2XQX A;  5CB7 A;  1P8J A;  1GZW B;  2CGN A;  1R08 3;  2XVK A;  4QM9 A;  5FK8 A;  2RS1 1;  3MIF A;  1R64 A;  3VZK A;  3K4A A;  2FCU A;  4YWA A;  1UMH A;  1WA6 X;  5JI9 A;  5D8A C;  1RVF 3;  3VBH A;  1ULD A;  1ZBE 1;  4LKD A;  2ADD A;  4L97 A;  2VZV A;  2HEY F;  4XQD A;  4XFC A;  3VDD A;  2WA3 A;  3PNA A;  1WMF A;  3BTX A;  4MZU A;  3VD7 A;  5FMB A;  1RHI 3;  4W4Z A;  2VAU A;  1C5H A;  2RMU 2;  1AXY A;  2UWB A;  1S0I A;  1VIW B;  4XUN A;  4WM7 A;  4YW2 A;  3VDA A;  4B3N A;  2X5I A;  5EQU A;  4CEY B;  5FKC A;  4D94 A;  3O1S A;  4LJH A;  5C5T A;  1FV3 A;  1XNT A;  2DDU A;  1IPK A;  1ST8 A;  2CSG A;  1XSQ A;  4FPG A;  1QJE A;  4GQ7 A;  2FZ1 A;  4QXH A;  4O9G A;  4M00 A;  4LKF A;  1GIC A;  1W8U A;  4IQP A;  1X82 A;  4MGS A;  1K5M B;  2Y6H A;  1PIV 3;  2HWD 2;  3OB8 A;  2VEC A;  1J58 A;  1W9S A;  1UZZ A;  5ACA 3;  4S2F A;  1HKD A;  2F4L A;  5J96 B;  3C2U A;  4NOT A;  4CCC A;  1M4W A;  2Y6J A;  4H7L A;  4GWI A;  3ZN5 A;  1JXN A;  2BJS A;  2SBA A;  3HN3 A;  3EQE A;  3LF7 A;  2NMO A;  1JZ3 A;  4A41 A;  1DYO A;  5BXX A;  1AL2 3;  5FZ7 A;  5L9R A;  4BH9 A;  1BEV 3;  4OHV A;  3SEP A;  1W6O A;  1TNF A;  3IB3 A;  1UY3 A;  1LGN A;  4CDU C;  1AL2 1;  1ENR A;  1Q8V A;  2ILM A;  3LEM A;  3M3O A;  1R1A 3;  4JV4 A;  1IS4 A;  2P6C A;  5FZ9 A;  2YFU A;  5ANN A;  3RSJ A;  2HWD 1;  2VUL A;  2Z5W A;  1KRI A;  5DAB A;  2VPV A;  2WUH A;  2VGD A;  2JDP A;  3POW A;  4MH0 E;  3ORJ A;  2PFW A;  4BHP A;  1V0A A;  2AEN A;  2IXC A;  2TEP A;  3KT7 A;  1BLZ A;  5K0U A;  4Z07 A;  2VZU A;  4Y22 B;  2CAV A;  1S2B A;  3E6C C;  2ADE A;  2B9V A;  2ZCW A;  3VZJ A;  4LK6 A;  1U5Z A;  1OXC A;  5I0T A;  4URT A;  4CXW A;  2WA4 A;  3ACG A;  3WLU A;  4BOW A;  1BMV 1;  4XW3 A;  1WWY A;  1X9T A;  4MXW B;  4AEJ A;  2QQU A;  5E8A A;  3WQB A;  3HQX A;  3RMX A;  4JHZ A;  5A7O A;  1HJF A;  1NE6 A;  1WW7 A;  2BUK A;  4Y1X A;  5EJ1 B;  1GOG A;  4RL7 A;  1FOD 3;  1OF4 A;  3DV8 A;  3PHM A;  1OT5 A;  3WQ1 A;  4Q4V 3;  2QQP A;  4V2W A;  4PDW C;  4B8E A;  4MET A;  2J1R A;  3QLQ A;  4GB3 2;  1DQ6 A;  1YC6 1;  4A7Z A;  3TNQ A;  4W50 A;  2JDK A;  2JWP A;  2Q1Z B;  2SLI A;  2WSU A;  4QPY A;  3ZYG A;  2CGP A;  1H30 A;  2ZHL A;  4FOW A;  1MAC A;  4CEW A;  1CN1 A;  1KGY A;  3O0V A;  3OEB A;  5CU1 A;  2WQZ C;  2H0B A;  4YZ2 A;  1KXG A;  3HIF A;  3OBA A;  3RMY A;  3FLP A;  4Q4X 3;  4XYX A;  5ISL A;  2CHH A;  1UY4 A;  4CU9 A;  4CP9 B;  5F3I A;  5EHD A;  5JXG A;  1Y4W A;  4DPN A;  5FXX A;  3HNY M;  4K8R B;  4RS5 C;  3TAY A;  3DPR B;  1H1A A;  4Y20 B;  1Q8P A;  1RIR A;  4WV8 A;  4CPB D;  2QQL A;  2V4V A;  3N35 A;  4Y20 A;  3IDE A;  4P9J A;  1QJU 3;  1TME 2;  2ARB A;  4QKD A;  2VOV A;  5C71 A;  2Q8D A;  4HN1 A;  5FPB A;  4Y1Y A;  1NG0 A;  2E32 A;  3OTF A;  1MR5 A;  4IEV A;  5A3L A;  4UAP A;  5FY1 A;  4QD2 A;  1PGW 2;  1E5S A;  2E6V A;  4GWJ A;  2GME A;  2NMN A;  1ZZB A;  1NA1 B;  3DKQ A;  4XAA A;  4BDV B;  1Y7B A;  1YQ2 A;  1UPS A;  3WF2 A;  4JGY C;  1GR3 A;  2B39 A;  4LO8 A;  3M2M A;  5I93 A;  2ET7 A;  3LA2 A;  1B35 C;  2D6K A;  3KD4 A;  2OUH A;  1C3H A;  2OW4 A;  4HK8 A;  4N53 B;  3CHX A;  3ZXE A;  5FWJ A;  5GZC A;  4UFK A;  5LZ6 A;  4Q4Y 3;  3BGA A;  1LCL A;  1ASJ 2;  2MPF A;  5F5C A;  1PX3 A;  2WFF 3;  3POJ A;  1XE0 A;  5LBC A;  4DEQ A;  4QPG C;  3WP6 A;  3R05 A;  2YXS A;  4LHL A;  4YFZ A;  1F31 A;  1PNF A;  2VW1 A;  4IEO A;  5KHH A;  1S0B A;  2YYO A;  2PLV 2;  2P3I A;  2QZ2 A;  1NKG A;  3PVE A;  3MF9 A;  2YDE A;  4NN0 A;  4Y3O A;  3NNM A;  4B4P A;  1C8N A;  4LE3 A;  1VRH 1;  1D4M 3;  4RSU A;  5C3Q A;  3FX3 A;  4P14 A;  2JE7 A;  2WAO A;  2W3J A;  3C3V A;  2EAA A;  2Y34 A;  5FPX A;  4QB6 A;  4Q2F A;  2WWJ A;  3MLJ A;  1F4H A;  1PZ9 A;  4GAZ A;  3RWK X;  3VDC A;  5FP9 A;  2YGL A;  5E89 A;  2ID4 A;  1XBF A;  5ACA 1;  2VM9 A;  3DEM A;  2WL1 A;  1RUJ 2;  2WO2 A;  4Q0S A;  1HQW A;  3T30 A;  3TBD A;  3I8T A;  2FQP A;  1KIT A;  1FMD 1;  1IPS A;  1LHU A;  2WYS A;  1AZD A;  1YO8 A;  4LKE A;  3ABZ A;  2C6S A;  3LCP A;  4FQZ A;  4A44 A;  1TNR A;  5F6L B;  1R1Z A;  3VBH C;  4A42 A;  4AHZ A;  5IFP A;  2JE8 A;  2VCC A;  2YC2 A;  3LDK A;  4CEW B;  4UOJ A;  2G1M A;  1UYY A;  1YIF A;  4BE3 A;  1SLI A;  2XPJ A;  3PTR B;  1GWM A;  3N9O A;  3PJQ A;  3T2O A;  4YVS B;  3JUU A;  3UJO A;  5J37 A;  4XUO A;  1DU3 D;  2YZ4 A;  3ETQ A;  5FZD A;  4EN7 B;  5L7O A;  1Q8O A;  2X8K A;  2P3Y A;  4K1Z A;  5LY1 A;  5FY4 A;  4LBO A;  2IC1 A;  3KF5 A;  2IUW A;  1KD7 A;  4YYO A;  1RUH 3;  5KWR A;  4NID A;  3OYW A;  4I0B A;  1K12 A;  1YXW A;  2J7M A;  2RS5 2;  2RV9 A;  3ES1 A;  2OPK A;  2ARA A;  4XF9 A;  4JHT A;  1AHS A;  2DVF A; 
#chains in the Genus database with same CATH homology
 4Z2A A;  3C7G A;  2OKX A;  3WSO A;  3CDZ B;  5IYY A;  2C9K A;  4TTG A;  3ACF A;  2EID A;  5CYY A;  2X09 A;  2E26 A;  1JZ8 A;  2QBX A;  2BZD A;  4AAX A;  4CUC A;  2BGP A;  1US3 A;  2VJX A;  2V5D A;  2YG0 A;  2VC9 A;  3WF0 A;  2J1U A;  1GQP A;  1I5P A;  1NX9 A;  2QQK A;  2Y6L A;  3ACI A;  1TG7 A;  2YFZ A;  4P08 A;  2EIE A;  4LQR A;  5JUV A;  4DXT A;  3VDB A;  3E1F 1;  3III A;  1UYX A;  3EYP A;  3K75 B;  3OGR A;  5JXI A;  2BGO A;  1UY0 A;  3NJV A;  5I0D A;  3VD9 A;  5J1X A;  1OD3 A;  5JMO A;  4QX0 A;  2CDP A;  3I3E A;  2VZP A;  2WBK A;  3IAQ A;  4ARY A;  4CU8 A;  4PT6 A;  3LPF A;  4BJ0 A;  1NAE A;  3GDB A;  3LE0 A;  4QDQ A;  2BER A;  3WF4 A;  2KD7 A;  1UZ0 A;  2QQM A;  2X05 A;  3U37 A;  1W0N A;  4XUP A;  4JKL A;  3F2Z A;  1XNA A;  3WNP A;  3IAP A;  3MO4 A;  2JDA A;  3OGV A;  1OF3 A;  2QQN A;  1ULP A;  1JU4 A;  4ZZ8 A;  5IJR A;  4DXS A;  4OMD A;  4IUG A;  1H6X A;  1UXZ A;  3BN6 A;  2Y6G A;  2Z4F A;  3A23 A;  3VD5 A;  3WF3 A;  1GNY A;  2WDB A;  4QX2 A;  3C7F A;  5JR2 A;  2J1A A;  2W46 A;  2VQT A;  3J7H A;  3VD3 A;  2HLE A;  1W99 A;  2VO5 A;  3OG2 A;  2ZEW A;  3LQC A;  2V72 A;  1SDD B;  2W94 A;  3C7E A;  2WAB A;  4CUB A;  3MUY 1;  2VR4 A;  1UY2 A;  2CDO A;  3AC0 A;  3OEA A;  2WZ8 A;  4QAW A;  2W1S A;  3HOB A;  4CU6 A;  2JKX A;  2ZEY A;  4DEV A;  1JYX A;  5DPN A;  1US2 A;  4OMC A;  3CZJ A;  4A45 A;  1CIY A;  4PF1 A;  3P6B A;  3DYM A;  1EUT A;  3HNB M;  1DP0 A;  1JU3 A;  5JXH A;  2ORX A;  5C70 A;  1K3I A;  4BXS V;  4XUT A;  4XZU G;  4QX3 A;  3I3B A;  3I97 A;  2W95 A;  3DYO A;  2W87 A;  1UWW A;  4RYD A;  3T0A A;  3PUI A;  2W92 A;  2RVA A;  4LKS A;  1PMH X;  3GM8 A;  1ULO A;  1H6Y A;  2XOM A;  3FL7 A;  2EIB A;  2VCA A;  1O59 A;  1L7R A;  4DUW A;  2VMD A;  3FN9 A;  3NNG A;  3I2J A;  2YB7 A;  4A4A A;  3PUH A;  4QDR A;  1W9T A;  3T08 A;  2VZR A;  3UET A;  1UX7 A;  2ORZ A;  4LPL A;  4CVU A;  1GMM A;  1TVG A;  5FUI A;  3A7Q A;  4ZZ5 A;  4KMQ A;  3GGL A;  5IHR A;  3ACH A;  3UNP A;  2Y8K A;  2VMF A;  4JKK A;  4MO3 M;  5DQ0 A;  1SHW B;  2C4X A;  3NJX A;  4MOA A;  4DUX A;  1CZV A;  2X10 A;  1T2X A;  1OH4 A;  3A21 A;  1GOF A;  2W1Q A;  1W8N A;  2W5F A;  1HN1 A;  1WCQ A;  3T09 A;  2J1S A;  2XHN A;  1EUU A;  4P00 B;  1W8O A;  4M4P A;  5G05 L;  5B4X A;  2J22 A;  1CX1 A;  4ET7 A;  2WN2 A;  3CQO A;  2E31 A;  4ZXE A;  1JHJ A;  2JD9 A;  3OGS A;  1XPW A;  4BK4 A;  3I2I A;  4UI9 L;  3LEG A;  1LNS A;  4DUV A;  4OZO A;  2Y64 A;  3CZU A;  3WNM A;  4QPW A;  4RN5 A;  1MPX A;  2WO1 A;  3MUZ 1;  4QX1 A;  3K46 A;  3LEI A;  5EIY B;  2B4K A;  3P1I A;  1O8S A;  5DMY A;  2XQX A;  1F4A A;  1P8J A;  2VZS A;  1RYY A;  2VZQ A;  1J84 A;  1R64 A;  3K4A A;  4QDS A;  1UMH A;  3MBW A;  2VZV A;  3MV0 1;  3WNK A;  4D8M A;  1JYV A;  4KI5 M;  3VD7 A;  2VZ1 A;  3DEC A;  3T2P A;  3CMG A;  1O8P A;  4W4Z A;  3W5N A;  4XUN A;  3VDA A;  1UYZ A;  1UXX X;  2DCJ A;  3I2K A;  2Y6K A;  3ECQ A;  1XNT A;  2DDU A;  3T2Q A;  3FHA A;  4GZ9 A;  4MGS A;  2Y6H A;  4YPJ A;  3C7H A;  2W47 A;  3OB8 A;  1JZ4 A;  1W9S A;  3ZM8 A;  3K77 A;  3WNL A;  2WQ8 A;  2VZ3 A;  1JZ7 A;  1GOH A;  3VD4 A;  3A22 A;  2Y6J A;  4GWI A;  4TXW A;  3HN3 A;  5IFT A;  1JZ3 A;  3SKV A;  4A41 A;  2W1U A;  1DYO A;  5A1A A;  2DCK A;  4W8J A;  3C7O A;  3SEP A;  5HXM A;  3IB3 A;  1UY3 A;  3K4D A;  4AG4 A;  3FHQ A;  2VZT A;  2YFU A;  2BBA A;  3DYP A;  3LPG A;  5LA0 A;  4L0P A;  2WUH A;  4OYU A;  1PX4 A;  2QQJ A;  2VME A;  3IDA A;  3JXS A;  2J1E A;  4XUR A;  4E8D A;  2RJ2 A;  2VZU A;  2YC4 A;  3K4Z A;  4A3Z A;  2B9V A;  2R7E B;  1UY1 A;  1DLC A;  3ACG A;  4JKM A;  1JYW A;  3WNO A;  3NQH A;  3LEK A;  5F7U A;  4PQQ A;  3WQB A;  5LA1 A;  5EJZ B;  4JHZ A;  5EJ1 B;  4KWU A;  1GOG A;  4CU7 A;  1OF4 A;  1OT5 A;  3CKH A;  2VQU A;  3CIH A;  2QQI A;  2J1R A;  4E8C A;  1W9W A;  4ZY9 A;  1CZT A;  5DN2 A;  3THC A;  2XON A;  3W5M A;  4W50 A;  4P5Y A;  5C7G A;  4M4R A;  2LS6 A;  1KGY A;  1NUK A;  3HEI A;  3OEB A;  3OBA A;  2VL4 A;  1BHG A;  1UY4 A;  4QB2 A;  4CU9 A;  5JXG A;  1L7Q A;  5LCW L;  3HNY M;  4A6O A;  4HG6 B;  2EIC A;  4D0Q A;  2J1V A;  2VCB A;  4XVH A;  5B4N A;  2QQL A;  2V4V A;  3D3A A;  4MAD A;  4MGQ A;  5HPO A;  2L9L A;  5CZK A;  5C71 A;  3THD A;  1GU3 A;  2E32 A;  1PMJ X;  4BK5 A;  3WF1 A;  3WNN A;  4UAP A;  1CZS A;  4GWJ A;  3T0D A;  4CUA A;  3I3D A;  4BDV B;  2PQS A;  2C26 A;  1YQ2 A;  1IQD C;  3WF2 A;  2W9X A;  4JX0 A;  2VZO A;  2J1T A;  1D7P M;  3HNM A;  2ZXQ A;  1UMI A;  4ARX A;  3I2F A;  3BGA A;  1JZ2 A;  2WAA A;  1SG3 A;  1PX3 A;  2HYX A;  3MV1 1;  2VOT A;  1XC6 A;  4DXR A;  4DEQ A;  5JXJ A;  2LW8 A;  4XUQ A;  2W91 A;  3SEE A;  1NKG A;  2WAO A;  2WZE A;  4FI9 A;  2W3J A;  5LA2 A;  3SKJ E;  4QB6 A;  1F4H A;  3GXU A;  1JI6 A;  3VDC A;  2ID4 A;  2VM9 A;  2WO2 A;  3I2H A;  2VMC A;  2WYS A;  2QQO A;  3I2G A;  3UES A;  4OUE A;  2WN3 A;  3ABZ A;  2VTF A;  4P02 B;  2ZEX A;  5G04 L;  4A44 A;  5IFP A;  2E33 A;  4A42 A;  2JE8 A;  1J83 A;  2VCC A;  2YC2 A;  3EB7 A;  4UOJ A;  1UYY A;  2ZEZ A;  1K42 A;  1JYN A;  4LHS A;  1JZ6 A;  3T2O A;  4XUO A;  4QB1 A;  3HJR A;  2W1W A;  3HPN A;  1WKY A;  3C8X A;  3WEZ A;  1KEX A;  1K45 A;  1GUI A;  3ETP A;  3NRU A;  1K12 A;  1JZ5 A;  2J7M A;  2RV9 A;  3T0B A;  2WO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...