2HLEB

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
138
structure length
133
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVQYEYYKVYMVDKDQADRCTIKPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
molecule keywords Ephrin type-B receptor 4
total genus 23
structure length 133
sequence length 138
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hleB00
2VM4A 1XB8A 1NIBA 4K9JA 2DYSB 2BW4A 2FWLB 1NIAA 1X9RA 2IH9A 4YSQA 4YSSA 4UANA 1PF3A 3WIAA 3T6VA 4GP4B 1EHKB 2MTAA 1E30A 1MZYA 1SDDB 4F2FA 3FPXA 3N2JA 3NJHA 3HB3B 3FSVA 3EH5B 3JT2A 5E9NA 4WTQA 3NSYA 3WNJA 1L9RA 1JVOA 1AANA 3S8GB 4BWWA 1WA1X 2EIKB 2VW7A 4A2FA 3AY2A 3JTBA 1BQ5A 2GIMA 3SQRA 1KDIA 3DKHA 1XMEB 1RZQA 4DP2X 2GBAA 4KO5A 2HZHA 1OCCB 4KNSA 1OE1A 1KV7A 1JOIA 2XU9A 3PCYA 1AS6A 1OCZB 2BP8B 2J55A 3CVBA 3S3CB 1XB3A 3V9CA 2UX6A 1EZLA 2YAOA 1YLBB 3NSFA 5I6LA 1GY1A 4KO9A 3WKQA 1SNRA 1JXFA 3FPYA 4M3HA 5I6NA 4BDVA 4A2DA 1L9TA 2TSAA 3MBWB 4NERA 3U25A 3X1EA 5AZUA 4BXVA 4YSOA 2IDSA 2XYBA 1I53A 2XXFA 2ZXWB 3T9WA 3WI9A 3EH4B 4DP8X 4G70B 3AG3B 4HHWA 3UAEA 5B1AB 4JKNA 4YSUA 5ANHA 4Q89A 1PAZA 2HX7A 4YSDA 2WSDA 1HAWA 5FC9A 3OD3A 3ASOB 3L45A 3OMNB 3FU9A 1W8EA 2EILB 1GW0A 5I6PA 1KBVA 5I6KA 3FQ1A 1PLAA 2GHZA 5I5JA 2YAEA 3AZUA 3T71A 2R7EA 1FWXA 2OJ1A 4E9WA 2DWSA 4E9QA 2FT6A 3T6WA 2XWZA 1AQ8A 4UAHA 2I85A 3SBRA 2W8CA 2YARA 1ZIBA 3C75A 2IH8A 1M57B 8PAZA 1CC3A 3GYRA 5PAZA 4AX3A 1MG2C 2QPDB 2X88A 3PXLA 1E65A 1BYOA 1AZRA 3CVCA 1M56B 1WS8A 2I7SA 4DP9X 1SHWA 1BEXA 2OCCB 1CURA 1F56A 2FT8A 2LLNA 1T5KA 2CAKA 1IBZA 4BK5C 4HCFA 2VSMB 1NPJA 4DPBX 4FAAB 2HX8A 1PNCA 2DWTA 3AG4B 2IAAC 3PAZA 5F7BA 1A4BA 2PP7A 1JZEA 1PLBA 4DP4X 4F2EA 9PCYA 3BVDB 3CDZA 3QJRB 2CBPA 1OE2A 3ABMB 3ZDWA 3GXUB 2TSBA 4BWUA 1SDDA 4GP5B 1RKRA 1MZZA 2UX7A 1OE3A 2HX9A 3ZBMA 1AG0A 1NIDA 2JKWA 4EF3A 2GI0A 4F7KA 6PCYA 1A65A 2FNWA 2DYRB 4A68A 4DP0X 2XV2A 1JXGA 4KOCA 1OV8A 4HIPA 1A4AA 4KNTA 4CSZA 1AIZA 2QDWA 2UXGA 1E5YA 2BHFA 3ABKB 4W9ZA 3UACA 3AG1B 3PPSA 2PCYA 1R1CA 1J9TA 3OQRA 4NB7A 4HCGA 5B1KA 3X1GA 2XV3A 3ZIYA 1J5DA 1JZFA 4N8UA 4YSRA 2PPAA 1PNDA 4E9XA 3FS9A 1WS7A 1BXAA 1L9OA 3NJFA 2YXVA 1ZDQA 1GSKA 1OCRB 4HZ1A 4A2GA 3UABA 3FQYA 3RYMA 3S3DB 1ASQA 1NWOA 2CCWA 1ASOA 5PCYA 5I5MA 2OV0A 3D12B 3FYIB 3TASA 4A66A 3KW8A 4DPCX 3ABLB 1ILUA 1NINA 4E9YA 2BZCA 2FJSA 4G7SB 7PCYA 2ZONA 3EHBB 3WKPA 2FQGA 2YAPA 4DP5X 7PAZA 1A8ZA 1X9UA 2IWKA 1ET8A 5I26A 1IBYA 4X4KA 5I28A 2XUWA 2Y1AA 2W88A 3QJSB 1NDTA 4YSEA 1OCOB 3FYEB 1FFTB 4PAZA 1JVLA 1L9QA 5LDUA 1JZJA 2ZWNA 5B7FA 1QNIA 1PZCA 1HAUA 4DP6X 1BAWA 2FTAA 5EHFA 1BQKA 1AAJA 1PY0A 2AANA 1AZUA 2IDTA 2HRGA 1BQRA 1JZIA 2JXMA 1GS8A 3NJNA 4L0PB 2YAMA 1J5CA 3HEIB 4KO7A 2XX0A 1DZ0A 2H3XC 2VMJA 1KDJA 4E9RA 1DYZA 3BQVA 2P80D 1NTDA 2QPEB 4KOBA 4N4YB 2VSKB 4YVUA 5B7EA 4E9SA 5A7EA 1ADWA 2BW5A 3EF4A 1AR1B 5IY5B 1E67A 3AG2B 5TK4A 3IN2A 2QDVA 2B08A 2YQBA 3ERXA 3T6XA 2H47C 2Y69B 4G71B 2J5WA 1WAEA 1GS6X 1FA4A 1NICA 1J9RA 4Q8BA 1ZIAA 1ILSA 1CYXA 3CZUB 3QPKA 1SF5A 1V55B 3FQ2A 1NWPA 1ID2A 4YSPA 2GSMB 4NAJA 1AOZA 2RACA 1B3IA 1NZRA 1A4CA 3S3BB 3NYKA 1V54B 2AFNA 3FU7B 2BZ7A 3EH3B 2BP0A 2EINB 2X87A 3KW7A 1WA0X 2PCFA 1RZPA 3TA4D 1ASPA 2FQEA 3NSCA 4GYBA 4E9TA 2EIJB 2BO0A 2UXFA 1W6WA 2E86A 1CUOA 3UADA 4DP1X 2FQDA 3PAUA 1URIA 2B3IA 3MX0B 1QHQA 5B1JC 2DV6A 1VLXA 1GYCA 2GB2A 3FSAA 1NIEA 1MDAA 1PMYA 3NJGA 4WKXA 2R7EB 4RH4A 2IDFA 2XV0A 1J9QA 1TEFA 5AFAA 1IC0A 2IDQA 5B3SB 2CJ3A 3S8FB 4AKQA 3N55A 1KCBA 4DP7X 3V9EA 2BP0B 2UXTA 3NJMA 5I6MA 1GS7A 4YSTA 4G7RB 1V10A 1ET5A 1PZAA 3QJUB 3WNIA 4YVNA 1TKWA 1SHXA 4QKTA 2PP8A 3CDZB 1AACA 2JFCA 1SJMA 1IUZA 2DY2A 4M4RB 1J9SA 5I5IA 3NJKA 3WG7B 3FU8A 1PCSA 5AKRA 2J56A 3CG8A 1OF0A 2CALA 2PLTA 2XXGA 1ETJA 3FSWA 2VW6A 1M9WA 2HRHA 3X1FA 3TBCA 2MRYA 3NJIA 1ZPUA 4E9VA 1N68A 3GDCA 4HAKA 3OM3B 3OMIB 1RCYA 5B1JA 1OOWA 3IEAA 3H4HA 1SFDA 4QLWA 3FSZA 4A2EA 4A67A 2Q9OA 3TU6A 2VN3A 3PAVA 2WO3B 1KGYE 3ZX1A 4BXSV 6PAZA 2PPEA 2H5UA 3CVDA 3IN0A 1SFHA 3G5WA 2A3TA 2XVBA 5D4JA 2AVFA 4KO6A 4AZUA 1JZHA 3QJTB 1BXVA 2WO2B 1GR7A 3AW5A 4GP8B 3QQXA 3UGEA 2GC7C 4PCYA 3SBQA 1AZBA 3H4FA 2AZAA 5B7MA 1NPNA 1L9SA 1ZV2A 2GC4C 1KYAA 1UATA 4TXVB 1A3ZA 1GY2A 4GXFA 4P5RA 4GY4A 1PZBA 4HCIA 3X1NA 4ENZA 2UXVA 1KBWA 1QLEB 2BP8A 4YSAA 4YSCA 3QJQB 3PLYA 4UF7C 1JERA 2PPDA 4FA7B 1L9PA 4JHUA 1AG6A 3T6ZA 4AKOA 2P80A 1HFUA 3NT0A 4ZK8A 3DTUB 2ZOOA 1AS8A 4AI7A 4BWTA 3TBBA 2YAHA 3NP4A 3UAAA 3ASNB 2IWFA 1CYWA 1ET7A 2N0MA 2BWIA 2PPCA 1SF3A 2YAFA 3NSDA 4AKPA 1AZNA 2YXWA 5TK2A 1PLCA 2Q5BA 3FT0A 2IDUA 1JZGA 1IKOP 3OMAB 1AZCA 3X2QB 1AS7A 1MG3C 3NP3A 4KNUA 2XLLA 2XX1A 2CUAA 2QT6A 3SBPA 3DIVA 2HLEB 2VW4A 5B1BB 4A2HA 4HHGA 2IWEA 2AZUA 3H56A 1XB6A 4HALA 4MFHA 3FU7A 4CSPA 4P5SA 1NIFA 2I7OA 4W1TA 1E5ZA 1JXDA 2EIMB 3X1BA 2J57A 1KCWA 2FQFA 5F7AA 3QJVB 4YL4A 3IBOA 1BXUA 4G72B 5I6OA 3ABGA 2HXAA 1W6LA 4BDVB 1TEGA 1BYPA 2NRDA 2YAQA 5D4IA 1ZDSA 2FT7A 3NJLA 1WA2X 4DPAX 5D4HA 1TU2A 3IE9A 3NJJA 2PPFA 2PP9A 2BWDA 1N70A 4G7QB 2VM3A 4JHVA
chains in the Genus database with same CATH superfamily
1G1CA 4YXLL 3A6CH 2Z9TA 3PE9A 4FNUA 2AJUH 3VWJC 2D4DA 1A8JH 1EFXB 3UBXA 1G9ML 3BHBA 3KVDD 3D39B 1K3IA 1FH2A 2ZXGA 2OXGA 2YPVA 4ZMYA 3MRHB 1S7VA 3TVMA 4WU7B 1E30A 2DKMA 3A4EA 1U8MB 3STZA 4PJEB 4YDLC 1D5IH 5DJXA 4TQEH 3DX9B 3B34A 3QG6A 4JO3H 4MWFA 4NQSA 5K59E 2W95A 2NCEA 4KKNA 5J6HA 4GW4B 1GGCH 3UDWC 3KGRA 2VXQA 1Y7VA 4S2SB 3FF7A 3KG5A 2ZOLB 1A7OH 3UGUA 3S35H 4U1IB 1IM3B 4J3WA 3L4TA 1FFRA 2CNZA 5FDWA 4UB0L 5IMKA 1S78D 4XPGH 2FIKB 1ZSHA 3F12A 1EDQA 2BZDA 2F54A 5D72H 1HINL 4DQAA 5BXFB 1CXHA 1GPOH 5BV7L 3EJSA 4PJBB 1WUZA 3DWTA 3AXLA 4V1DD 5F70A 3W39A 2VN6A 4U7SA 5JR1H 2F8IA 3DGGB 1VA9A 5D7SH 4YDZA 4HSAC 3EG9A 3BRFA 5KVGE 2BSSA 4M5ZH 4OV5A 4L9LC 1JXFA 4PP2A 4Q4EA 1RURH 2VR8A 4Y1SA 5EPMB 2VDQB 4UTAL 3G6AA 2FH8A 4JFFA 3VSUA 3IJ7A 3I2CL 4WGKA 4EI5D 2K3HA 3D87B 2NUTA 3CVHH 3LIZA 4P05A 3T9WA 5AYUL 4UCFA 4IRSD 1RJYB 2VZSA 4NYLA 3WFCH 5ITBH 3MNWB 3AG3B 2CO7A 3LIZH 2FATH 4U1KA 2Z7YA 4LVHB 4LLQB 4N85A 4OUUB 4XMKL 4NZUH 2GEQA 5L2KA 3WUWG 3MRFA 3W2DH 4TTDC 3QIWC 3GSXB 4JBSA 1TVBB 4X4XB 1LP9B 3KLAA 1W8EA 2D3NA 4JJ5B 3P77B 4FXGC 4MQTB 4WFEE 1KBVA 3KYOB 3JQOB 2GUOB 3BCFA 4UQIM 4KTEL 3SOTA 1P9MC 2Y5QA 3ARFA 4GNKB 3SHSA 3T71A 5I1GH 4KKBD 3TBYA 5AAWA 4LOEA 3OGCA 3SBRA 1IAIH 2W8CA 2OJEB 3M7FB 4GG6F 1F6FB 1W0VB 2W0LA 3ALWA 3KLSA 5C0FA 5MEQA 4XP4H 1T83C 3GBEA 3QIUA 1E65A 2C9UA 4HWEL 3X14B 1QKZL 2PABA 4XTRD 2IANB 1WS8A 2XN9D 1PSKL 4HP5A 3J27A 2NLJB 2EIDA 1K8IB 3BAIA 1LJMA 5HHQA 1LEKB 3GMNB 3SDAA 3CIAA 4ODHH 3MOBH 1YC8A 1SYVA 2LLNA 5C86A 4HWZA 4B53A 1JGDB 3BJ91 5I1EL 1RP9A 3MLXL 4N1HB 4HCRA 1ZLSL 4DKEH 2IFFH 3JV6B 1A4BA 1FDLL 1A6WH 1PLBA 5I0WA 1FZOB 3HAEH 5FECA 1AGFB 2D9CA 1UD6A 3DV4A 3FT3B 2B77A 3GSWB 3O11B 3Q2WA 2AV7B 4JM2A 1IEHA 2BJMH 5ANMB 3D39E 3V6ZA 4X7EC 4L8BA 2F53D 3EOBB 3LKQA 3PG2A 2D3JA 3O2VH 1FL6B 2XV6B 4GQPH 3LN5A 5D8JH 3HG2A 5ID0A 3BUDA 1RUAH 3M46A 1FZKB 3D51A 3FUEA 3FUFA 1A5FH 3P40A 4IMLB 3MYJB 3ETBJ 3KJ6L 1ONQB 3MR9B 2YKLH 4FKHA 3C5SA 5CU5A 4IEFA 1TQCC 4WJ5B 1PD1A 3N43B 3RI5F 5E2JA 2PCYA 4FQXA 4F7PA 3HCVA 4QEGA 4TOYL 3N91A 1BQUA 3OZKA 4HCGA 4XGZA 3X1GA 1NAKL 1ZRUA 5EN2B 1J5IA 5I17B 5CKGA 3IFNH 4V1DE 5FOBA 3HLAB 2DEYX 3TH3T 3VW3H 1BVNT 4P5TB 4IRJC 2WXGA 3ROLA 1JTPA 4KXZH 3AXIA 2JXMB 1CICD 4Z7OB 5E5UB 2JLLA 1TDQA 3KPMA 4KK9D 3WIIH 3ESMA 3Q9QA 1YNTA 4DPCX 4UILL 3KLDA 3RZCD 3FB7A 2ZONA 3L9EA 4NQDA 4NO0D 3HC3H 1NBYA 4FC3E 3TBTA 4HKBB 3BSGA 2Y4SA 4BCYA 3F7YB 4X4KA 1E9PB 2BLFA 4LVNB 4LRIC 3UBXB 1X5GA 1OHZA 4E9LA 1A6UL 5IOPB 3KPSA 1R5VB 4MZIA 2JI2A 3QUZD 5E4IA 1AKJD 4HIHA 5H2BB 3RDTD 1ZGLM 3GBNL 1JVLA 3Q6FA 5H37H 5B7FA 1Y6MR 1A2YB 3CD4A 3RWEA 4JG1H 3VNYA 1DVFC 4KRMB 4CADB 4U05A 5CJQH 4W9CC 1DQTA 1EAQA 3U4AA 2Z92B 1N0LB 5KYWB 1U58A 4NM8H 4L2LA 1UT2A 2C9AA 1WC7A 2VZUA 3KEDA 2VOTA 5BOJA 2C7UA 4JPKH 2XOTA 2F7OA 4WI4A 3MLZH 4GAJL 4N28A 2X4PA 5HHVH 2WLLB 4YDJA 2YQBA 1TTBA 5F6IB 5CWSB 5EF1A 2AERT 2GI7A 4G71B 1NBZA 1OD7A 4WEUD 4CUCA 4UM9A 2XA3A 4HUCA 3S88H 5I5RA 1CTOA 3RWHA 1NCWL 2XBZA 3L8QA 1KTDB 5A2IH 1EHLL 1V5JA 5A6LA 4XP9H 4KQ4H 3WL9B 5EF0A 1PLGH 2WP3T 2PYFA 2ARWA 2VKXA 3EXLA 3BPCA 2BZ7A 2C3XA 3NFNB 1DO6A 1T0MB 4P59H 2X87A 3KW7A 2X0VA 4XC3L 3BVVA 1KLFA 1IU1A 3GSNL 2HTLD 4XCEB 4G6FD 4NC1C 4GMTL 2WANA 3B43A 3MV9D 2SEBB 4GAGL 5C7XL 2F9BT 4MA8H 5I82A 5EA0H 2DDQL 1CUOA 4HSCX 3BQUD 4MZ2A 2ZX6A 4GUQA 3RY4A 4J28A 4HFUL 2WPGA 4L9LB 1MRFH 3FTGA 2IGTA 3WJLC 2KC0A 3QYMA 1DQKA 5FV2A 1KG0A 1NIEA 4X5XA 3OB0H 2E7BA 2ZQKA 2VXVL 4YDIL 5EZLB 1JPTL 1LDPL 4AV0A 3X14A 2IDFA 5EZIH 2WBJD 3TNNB 4YHLH 1BFSA 1P0SE 1J87A 3JWOH 4LO9A 2VLJD 4OKVB 1A3RL 2E56A 1AI1L 4AJWA 4JKPL 4X6DA 3MRHA 3AM8C 3BAEH 3EJZD 1MREH 1N7MH 1TFPA 4DVBB 4MMXA 4O4YH 1CFTA 1B88A 1DUYB 5IKCA 2MPVA 2N59A 4Q6YA 4JCLA 4C54A 3NZHH 1EFXD 1DCLA 3L1EA 3SPHA 1RZKH 2CQVA 32C2A 3B2MA 3BWAA 4P3WA 5E6RB 4GO8A 1J5OH 5EU4A 5DMGC 1K4CB 1SN5A 2FDBP 2P43B 4QRTB 4YX2L 4XCNB 5IWLA 2XC8A 4LK4A 3IMTA 3VXRE 4AIXA 3WEXB 1SOKA 3WS6A 4J7RA 3EJYC 4PRIB 4MVBD 1VFBA 1GZQA 1NM9A 1T2JA 4JFVA 2IBBA 2H26B 4X6CA 1ETJA 2HRHA 3B7RL 3TBCA 4R7LA 1I3GH 4PB9H 4FXKA 1KFAL 5D7EA 3GDCA 3C60A 4J3OG 4PJIE 1E4HA 3T8VA 2BH0A 2NY5L 4EI0A 5DA0B 2BVEA 1TF4A 4HIQA 2KPWA 4QRPE 1F97A 1X6LA 4X9GA 3IDJA 1BJ1H 4WENB 4JDVA 4NKQB 3ESUF 1KB5H 3EO9H 2FECL 3D2UA 5E8NA 1GYVA 3QVAA 3QJZA 4EVNA 5J9PA 1XIWC 3EYSL 1FG9C 3W39B 3ULVE 5CN1A 1IRAY 1OLZA 1C5CH 1ZA3B 1O6SB 1AD0B 3BGFB 1T5WA 5C6WH 4JRYE 1OK8A 3QH3A 2IBZX 1HOEA 5C97A 1SHMA 4U1JA 2EAEA 2XIDA 4LSUH 4ZRGA 3UGEA 2Z34A 5IQ7L 5EUKA 3JTTB 4GBXA 4JFEB 4PCYA 3VD5A 4GKLA 3UJTL 3DHMA 5B7MA 2IPKB 3NRFA 4GFXA 2WLZA 4TSBL 5CINL 2X6CA 1IKNC 1X5XA 5HP5A 4N6QA 5LN4A 3VFVA 1IAIM 1LO0L 2DBJA 4TXVB 1BIIA 3NN8B 1M6OB 1CI5A 4U6VL 1MAKA 1KTLB 2I69A 3FU0A 1TNMA 3HZYB 4R0LB 2BM3A 1KTBA 1VACB 4X99B 5GSRB 3T0DA 3RZCC 5C0JA 4BINA 4XB3A 5DDHB 4N8CL 1Q1PA 1U8CB 3NCBB 4AV5A 3IFLL 4FA7B 1QRNE 3CSTA 2GQHA 3L7EA 5SX4I 3V2AR 4GI8A 5GS1B 1MFDL 5HDBF 2YK1L 2DH2A 2R69H 4AENA 2BVTA 1RUKL 1AS8A 2I27N 3RTQC 4PSRA 1SLUA 4Y1AE 2ZOWA 4OJYA 1KCUH 3QFGA 4IMKC 4CNIB 1IM3D 4TVPE 1N2RA 4ZS7H 1VGEH 3LZOA 2ZUTA 2DEXX 4GKOA 4MD5B 4YR6B 3MVSA 4Y4FC 4O51A 3U1SH 4QHUB 2FYVA 3PWJA 3RWIB 5FA3B 4I3GA 3CZLA 1IM9A 1VEMA 2N56A 1E9QA 3LKNA 3QISA 4OZFG 4W9JC 3WXWH 4EEEA 1AZCA 4C4KO 1KPVB 1UZGA 4X5WA 1FL3B 5A2LH 4UIKH 1XGTA 2ZCLL 3SBPA 1FL5A 4EIZC 1YVLA 5AUMA 4G6KL 3MLRL 3HKZA 5JW3H 1BF8A 4W4NA 3ZTNH 1E4WH 3V8CA 3NACL 1XB6A 1ZT7B 4OW6A 5ELIA 1J05B 5FHBL 1CXIA 2UZXA 3FU5A 1RHFA 4Z7WE 4XN8A 4MA3B 1VZGA 5ITBL 4KKPA 1G9NL 4V1DB 1XGUB 2YXFA 5I0ZA 5EIQA 4OLVH 5F7AA 5E8EB 5L88L 3RNQB 3ARBA 4IOFC 4NKIH 3GO1H 3P3YA 2YSTA 3BUYA 4BDVB 1XH2A 2JKTM 1JE6A 4QTIH 4GO6B 4DN3H 4JHAL 2XPYA 4PWKA 3Q5YA 2X6BA 3IRCA 1CGVA 1J1XL 3PWPE 5D7SL 5EEYA 2G3NA 1YN7B 4LSTH 4RBPK 3GGWB 1ETZB 4P0DA 4LNRA 5GS0C 2CMRH 3WEMA 2CKBH 3LRHA 1EGJA 2Y72A 3BFWA 3R0MA 2CJTA 1KB9K 3RUGE 1A6VH 4JFHE 4YBLC 2AXGB 1ZCRA 1PF3A 4UT9A 5FDYA 1SUJA 3DVIA 1S9YA 2OFQA 3QWOA 3EO1B 3KPLB 3I9GH 3GHBL 1BZ9B 2C4FU 4F8LA 2ICEC 1ZGLB 4NKDB 4IGBD 2XTJD 2GBVA 5JHDE 2EDHA 3KPSE 5BMFL 1O9VA 4ZX5A 3CH1B 3VFUB 4MMZB 1CDCA 3RL2A 1BW8A 5GZOA 4L4VD 3HMXA 2B4CH 1GVIA 4M5YH 5D1ZD 1DFBL 3PUCA 3AY2A 5HGAA 1FSKC 2HVKA 2IMNA 2KLSA 4CU8A 3CU1A 3WDHA 3MROA 2H8PB 1L6XA 1Q0EA 2VM9A 4H5SA 4P2CG 4WEBH 5EORL 3WGUB 2KT6A 4AYSA 5IHZA 1I75A 1U93B 2A9CA 4P4KA 1OARL 2B2XL 3O8XA 4IBTA 5GS3A 1BAFH 4LLWA 3IGLA 1A9EA 4ATWA 2XKNB 2CLRB 5F1NA 1SBSL 1YECL 1VGKB 3LNFA 4NHCH 1ZVHA 3GUTB 5DUPH 1JN6A 1AZZC 2L0DA 2QMJA 2GW5A 1A7NH 1GZPB 1YLBB 3KYKL 3V7AE 5JUEH 1MHPL 1WLHA 1SQ2N 3ARGB 4PRIA 2ZXBA 4G1EA 4LCWD 4JQVA 3RAJH 1YY9C 1MELA 1JWUA 1AKJA 4FFWC 3VFPB 1L9TA 1F4XH 2R29H 1A6ZA 2P52A 4JX0A 3J2PA 3EZ8A 5MEND 3V52L 3IPBA 1HHIA 2BSCA 2WLLA 6CGTA 4NC1E 3Q8FA 5C70A 4JKNA 4TUOB 5DR5L 3RKDD 2VZVA 4MHHG 1EO8L 3QHFL 5ANHA 3EYQD 3WKML 3OKEB 3C6SB 3D52A 5CJXC 2WUBL 3VAEA 1CIDA 3WMSA 3LPGA 1MJUH 5AOJA 1N19A 5I6PA 1JNLH 3LXAA 4FJYA 1BJMA 1QSZA 4AGLA 3DJTA 3H9HB 3ML9A 4K7PL 4RMRA 3WAKA 4FYRA 3VGAC 4Y4FA 2YGOA 2ZD0A 4HJEA 3UPAA 1JUFB 4MNHA 2EEFA 2GG1A 3ZE0E 1KEGL 1XL4A 2EH7L 1AO7B 2DJSA 3ELAT 4LVHC 3HHSB 4P5MB 1FVDB 3ZTJH 4AX3A 1EEYB 3BZDA 4PRNB 2A9NH 4RNRA 3IE4A 4PTTA 5SWSD 3FTGB 3I02A 4JQIA 5FHAL 2F54E 1I85C 3GD1C 5EOCH 4DEUA 4CMHC 4PB0L 3DVGB 4NFBA 1QFHA 3L3JA 2OJZH 4MSWA 4BK5C 1NPJA 5DD1L 1O5PA 3PQYE 4QHPA 2J6EL 1FZMB 5B8CB 3CZJA 5DMKB 4ENED 1KIQA 2K6WA 4JFYB 5DD6A 3HRPA 5F7BA 1T80A 1BQLL 4GRWB 3H3PL 1OGPA 3HPLB 4TKWA 2EJ1A 5KOVC 3GMQB 2HT4D 4ABVA 2FLRT 3CHOA 4HAFA 4XOEA 4ZDHA 4H20L 3ZDWA 4EN3A 1BMWA 3PNRB 3O2DA 3BEWB 2J5LC 4JG0H 2J7LA 4YPGB 5BS0A 2QGEA 3O4LB 3BFQG 3MRCA 3QRBA 4WV1C 6PCYA 4WNQA 3LTVA 5H94B 2YEZA 1AJ7H 2Z31D 1RIHL 4K5LA 4M4RA 2MWCA 1WBYB 1KIUA 3IKCA 4NUGH 3WS6C 2HFFA 3T8XA 4AH2B 2F6AA 1SYVB 2BHFA 3GSOA 5D2NB 1IEBA 4MKTA 3KS0H 4TUJB 1RMFL 2ENPA 3BH9B 3E80A 3T77A 5GGVH 4JREB 3KLKA 3VDAA 2QPSA 1U8KB 5EWIL 1H0DA 1FZOA 3MLTA 1JV2B 3OKLB 3RRQA 1QRNB 1OCRB 1R17A 3LS4H 1U3HC 2OKMA 2E7DA 4R5XA 4A55A 1BQSA 4L4VB 2E0PA 2HG5B 1T20B 3ME0B 4K3JH 1U8JB 1NC4D 1YEIL 3NAAL 3H2QA 4JB9H 4MAYC 4XO3A 2LE9A 3OAUL 4I77L 3NQKA 4F7TA 1KLFB 4FNPA 2H2SC 1TG8A 2FQGA 1MOEA 3V4UH 2LTQC 1FGNL 1AC0A 2E9WA 2GSGA 3K2KA 3DXAD 4IHOB 3H3PH 5AVRB 3WJLA 5LGJB 5A2BA 1BFVH 2CJUL 5E9DE 1B0IA 2VABB 4ANUA 4TVSa 3FBQA 3VGBA 4BRVA 3L6FA 1WYJA 1XGRA 1I4FA 5MEOB 3FB8B 3FMGL 1QQDB 3K6OA 5DJDB 3V52H 4JY6A 2NY1C 2X89D 3PWVB 2L04A 9CGTA 4LCVA 3R06A 5E1QA 4UYQA 3TNNA 4QHLA 4X8GA 3U4KA 4PJHF 3MV8B 2JXMA 1FNAA 1GS8A 3KE0A 5KZCD 4KXZI 3N41F 4R4BA 4XP6L 1QUNB 3T1FB 2WGXA 5J1AB 5DK2B 1ZTXL 2J6WA 3RX7A 1AHWB 3BSHA 1CICA 2CLRA 1KDJA 2FIRT 1WE5A 2WSPA 1JTTA 4FQQA 3AREB 1NTDA 3CNKA 2Q10A 2HT3C 3PGCA 2WQVA 2IBZY 3T4AA 1GC1L 4NQEB 3AG2B 1UZ6F 3WTVA 3IN2A 4JMXA 4CBZA 4KK6D 2EP6A 1IGYB 1QABA 1XD0A 2H47C 2KZ1B 3P30L 5DVKA 5C07B 5I8EA 1IAOB 2A74B 4PRID 2EXYD 2V7HB 1ZIAA 3RA7L 2FWOA 1V55B 3FQ2A 4PV8B 4BZ2A 3MRIA 1ZHNA 4ZMOA 3GS7A 1CFNA 1PDKA 2FL5A 4FQCH 2RACA 4KKLD 4TUOA 3T04D 5BMFH 4HT1L 2XY1A 4K5MA 3CHPA 4XNDA 2A77L 4O2FB 3MTXA 1H3VA 1E3FA 2AW2A 3QCVL 2BP0A 4MA1C 3CVIH 5HDOA 2FIKA 1HL4A 2AK4D 2EVFA 2WXOA 4PMEA 4PJ6A 3F85A 3RAJL 3DBXB 3JWDL 4Z7OF 1LEGA 2APXA 3AREC 1AO7D 1FCGA 1IQWL 4NOBA 3EO0A 2Y7SA 4LMQE 4TRPL 2QSQA 1NCIA 1PIFA 3MAWA 3BN3B 5TF1H 1ZOXA 1BZ7B 4XP1L 4E41B 5CD5C 3MA7A 3PABB 3FZUD 1RQ5A 3V9FA 3UEQA 5F6IC 1DZBA 2B3IA 2LLLA 4GBXC 5FYKE 2UVFA 4UAOC 4N9GA 5F72S 4JHAH 1O6TA 1R46A 3SDCD 4YDKH 2G2PA 5HSFA 1G7IA 3Q3GB 1UFGA 4U1MB 5I8OH 4L0YA 1PX3A 3T0AA 1P84J 2XG5B 1TFHA 1QHPA 1WFOA 3CX2A 3TNMA 3MUJA 1EV2E 2NY3D 1QP1A 3GC3A 1C8QA 4YSTA 4FHBD 4Q6KA 4FADA 1XF3B 4J3TA 4KXDA 1J48A 3C5ZC 5J8OA 1OZTG 1I8MA 2DH3A 4G6KH 3SO5A 3GFUA 2X41A 1IUZA 4L8SA 5KVDE 3REVA 2ZCLH 3CZGA 4U1SB 1N8ZB 2WN2A 2C3GA 1OF0A 5CEXB 1A6VL 4GAYA 2XXGA 5J89A 2PCXA 5MEQB 4X8CA 4AIOA 4M48L 4MCZA 2WCGA 3QEUA 3GXTA 5HYEA 4FRWA 3IVKA 4FEMA 3ILQD 1U8OB 1X5HA 4GW5B 2NLJA 4UT6A 4KTYA 1OW0C 1LXMA 2BRRL 1A9EB 3IBEA 4PIBA 4S0SD 5TE7H 3WUZA 3MRNA 1M3JA 2CUHA 2GFBA 4I1RA 3P4OA 4U2YA 2GAZA 3IMSA 3RVVC 3VI3A 3M07A 1JN6B 2X4NA 5DRNA 1FNSL 3BC9A 2DMCA 3JWNE 1QASA 4G2AA 4N8CH 2HFFB 2YGQA 4AH2A 2AVFA 1D5ZB 1JZHA 3SDAC 2WIIA 2KL6A 2GJ6B 4LLDA 4UTBA 1NOLA 4TSBH 1U8KA 2JKSA 2QADD 3MJ8A 5CINH 5AZEL 5KJ7E 4G43B 2P8LA 3ARGD 3STBA 1EEUA 1NPNA 4P2QB 3RFZB 2H6PA 4XNMA 2RTTA 3BESR 1PS3A 2Z31B 1HYSC 5FECB 3D3VB 5AAPA 3QGVA 4P9HC 3DOSA 4OLZH 2FJUB 1CLVA 1KJ3L 4GRMA 4BD4A 4Q9RH 5ESAB 5KYXB 1RJYA 3DI2B 4LSSL 1IVLA 1KYFA 2EEAA 3CZFA 3EFDL 4IEFB 4NYLB 4PJHE 4WJ5A 5M94B 1S5HB 4YSAA 2YWZA 1CN4A 2L8AA 2PYEB 3QJQB 3B6SA 5JA8B 1VGEL 3WTXA 3EYSH 5D1XC 4LCWA 2XVGA 1KB5L 2MTPA 3EO9L 4LLYA 3QDJD 4HEME 4MA7L 4M6NH 2JCCE 4AI7A 4BWTA 4FZEH 3MR9A 2YQ2A 3UPRA 1SN2A 1L0PA 2ENJA 4DVRH 5D7JA 4PUBL 1T03L 5DJDA 5JIKA 3UZEC 4P2AA 5T1DL 1IGTB 4U6HA 2VAAB 2E8ZA 4IK6A 2OYLA 4ZMAT 1LVEA 2BHZA 1IKOP 3OMAB 4B27A 5EZPA 3L3JB 1WEJH 3ETTA 3GDBA 1DDHA 1OAJA 2XX1A 4F8NA 2QFRA 3RDTA 2WZ0A 1J5OL 4MCMA 1XCQB 2YGVA 3JTSA 4A2HA 1AGEB 5E6YA 4B7LA 5I6XB 5KBPA 2WLIB 2IWEA 3U9PL 1HT6A 3C9NB 3LQMA 2PWHA 2NY1B 1DVUA 3ZHDA 1JGDA 1PZUB 2EIMB 2JQMA 2CG9X 5AW3B 3S5ZA 1UWXK 1BFOA 1QPXA 4M6OL 4PJXF 3STZB 1FFPA 1B4LA 1W0WB 5E23A 1B9ZA 5TE4L 1A7RH 3NIDF 1FORL 2GJJA 2WXKA 1T6WA 5C3IA 1P4IH 5D4IA 3OKMA 4Y1TA 1H5BA 4LP5A 2XY2A 3GMMB 1WA2X 1ZA6A 2P24B 4A7GF 4D0CA 4HFWB 2MKWA 4PCSA 3VXNA 2DLIA 3I3DA 1I1AB 3MLYL 1XB8A 4WO4C 3MACL 3MI6A 4P2RB 3QFDB 5KS9F 2WWMD 2P8PB 3GBMH 3ULUF 4M6MH 3T8MA 2YLHA 1QSEB 1X9RA 2C34A 4NKMB 5JXED 4L3CA 1X5MA 3ATDA 3AMKA 2VDRL 4LFHD 2VDNL 2VXUL 2IEPA 3I3EA 2UY7B 4XPBH 1KB5B 1MRDL 2ORBL 2EDNA 3NZHL 3FT4A 2VJ8A 3I84A 1P5UC 5DJ6A 5GISL 4HXAH 4YHPB 4XNAA 4NN7B 5C0IA 3BZFA 1SVZA 4AG4H 1CLZL 2DQEL 4NJ9H 2C9RA 4EIUA 1XF3A 5I1KH 5CD3B 5ACLA 3PP4H 2LU5A 2ROXA 4Y5XB 4OIFA 4PRHB 1IBGH 4IYKA 1ZT1A 4JPVL 3SSGA 4GEIA 1QR4A 1I8MB 3MRDA 4R4FH 3I02B 4OLXL 4NOFA 3TJHC 3IF1A 1BREA 4XB8A 1JPTH 3CN0A 1XMEB 3Q8BA 1XGPA 4KROC 5CCKH 5DQJA 4OZGB 3G08B 4KNSA 2HUHA 3HE7A 1UKTA 4WTZA 2W9DL 1N64L 2OXHB 1IC4L 5FCSH 1HH6B 1NGZA 3MUHL 3V0EA 5LBSL 3E1F1 2XCMC 3L5XL 5FGSA 1IC4H 4Y2DA 2NUPA 1CLYH 3DRTA 1FVCA 3LD8C 1WCBA 5C3TA 3TT1H 4LHUG 4Z7UB 5IROA 4XPTL 5E8PB 4AV4A 1F6AA 5FO8A 1P7QA 3TBWB 3H2WA 3LB6D 4X6DB 4JFSA 4JN1L 4ADIA 2CIIA 1H3PL 2NTFB 3NUKA 5AZUA 4BXVA 1F00I 5HHPB 1CXKA 4O2EA 3AB0B 5FLUA 2A6IB 4HKZA 4NQQA 1ZSDB 4HF5L 1S7SB 1D5ZA 5CR1A 2NY4C 1S7RB 4AJVA 3II1A 3S6CA 1Y6KR 4PPTA 4CA4A 5L2KD 5GGVY 5F2FA 2NY5C 5CFHA 4JMNA 3FH5A 4FQJH 3RU8H 3HR5B 4ELMB 1W0YT 4DUWA 4F5CA 3WLBB 4MMXC 4KV5F 1S3RA 3HHMA 3JVGC 3GI8L 1IKFL 4PJ8A 3DOSB 2WIIB 2CWRA 4G7YH 1UACL 1N4XH 5LBVA 1E8ZA 4L1HA 1Z3RA 2H1LM 3QEQE 5JO5A 1M57B 4I0PB 3B37A 3TH2T 1IGCL 1Q0XH 4NRXB 5D70L 5DT1H 1HKLH 1M7UA 2J43A 5LAXA 5FAAA 1H9VA 4MQXC 4IOSA 3H6JA 1S9XB 2X88A 1HOCA 1T0MA 3ULUL 4OF3A 5EH1A 3MGOB 3MJWA 2AJXL 3F8UB 1P7KB 1SEBA 3DX1A 2MSPA 2AC0A 5CGMA 4P2OD 3KJ6H 1G7QA 2ZZUT 3SDDC 4R84A 3GWJA 4XZ4A 1QNZL 5I24A 1B0GB 3VG9B 3E6FB 3CFDB 2ESVD 4LL9A 1D7DA 5KSAA 4JFFE 5DEJA 4XN4A 5BUPA 2VWEC 4TSAH 3QJHA 3R06B 2OZ4L 4HV8A 1LO5A 3CDZA 3TESA 4UQAA 5FYJD 2WD0A 1SDDA 1Z66A 4LPUA 1CBVH 5C07D 3KS0J 3T4YA 1I8UA 3QZMA 5TDNA 1DQLL 5CMAB 3AREA 4OZGF 1COBA 2FNWA 3VMOA 3SDCA 2NY3B 3VFWA 3X3GH 3MRMB 4IHBA 1S8DB 4WI9A 4IBYA 4ODHL 2F68X 5DHVH 3O6FC 4DVRL 2G0KA 1NAKH 1L0QA 2WXRA 3ZDYF 2XWRA 3X11B 2EVGA 4FZEL 3I50H 2GY7B 3QNZA 2QFPA 3ARXA 4X9IA 3KLAB 1JZ3A 4N8UA 1B2WH 4UZGA 3Q6FB 3VNZA 2A1WL 1G1OA 3PWLA 4QHKI 5D93B 4JRFA 1MJ7L 4MNGE 1MVYA 4ZMPA 4YEFA 1M2OA 4NP4H 2N3JA 3GLAA 4PG9A 5IB3A 4G42B 4Y5VB 4R97B 1HEZA 4BH7B 3K0YA 1HXYA 3UBGA 4M43H 2W91A 3MRCB 2XIBA 5L0QB 3SPIA 1T66C 2EE0A 3L16A 4NQCB 2QKSA 1BWWA 3LX9A 3IDIA 2BJML 2AMGA 1HILB 5AZEH 5DJ0A 4XNYL 5J6HB 4HUXA 5K1NA 4DERA 1I9EA 3EO0B 3MKGA 1KY7A 3SY0A 3IU4L 5E4AA 5E5MB 4M5SA 3D0VA 3B2VL 4NT6A 1U3ZA 2X9ZA 5IMMA 2JJVA 2WMPA 4O00A 3OSVA 1Y0LB 4OZHF 1H0DB 3FXIC 4PRPB 2WKOF 4N20A 4PRDA 1BV8A 4JREC 4MQ7B 1EZUA 3C08H 4RESB 4KRPC 4D2NA 3DV4B 3FT3A 1CFMA 4LF3B 4O2CA 4HWEH 1ZD6A 2VN4A 3B6SB 1J1PH 5JR1L 3AWFA 3A5VA 3HEIB 3QUML 4XP4L 1HI6A 4CL7A 2WNXA 4LLYB 1G7MA 1F4AA 2CE6A 1HIML 1BX2A 3PWUB 5HYJB 4KKCD 2YPKB 2ZYSA 1QRKA 1DYZA 25C8H 3TXAA 1OAUH 1J10A 2XVKA 4EDXB 5I1GL 3QWQB 1N10A 4MS6A 4Z7NB 3ELQA 3N1GC 4O5LL 4OZGA 2QTEA 1AGBB 1ZHBA 5FKPA 4XMWA 1YEGH 2WBJC 1DQQA 1SJHA 1HE8A 4JK0D 2YPVL 2GJ6E 5EOTA 3MLUH 3GLDA 2CU9A 1S7XB 4JY6B 5GHWH 2BFVH 2X2IA 1SUHA 1ID2A 2V5SA 3L3OB 3WV0A 2FATL 4HS6B 5K9JH 4GQ9H 3QA3A 1AOZA 1CBJA 2I24N 3A4FA 3WFCL 5KG9B 4JFXB 4Y16A 4L8CA 4ZD3H 2DOCA 5HHNB 3HLKA 1V54B 3J7HA 2CIIB 4I4WA 2XVLA 4W4OC 1YQVH 3RWDA 1FL5B 5KS9B 4IRJA 1RZPA 4N1CA 4K8RC 3B1TA 4AYFB 1LEIA 4S1SL 2X4SB 4I18B 2P9RA 4DHLA 4F57L 3LYRA 2N7AA 4QNPF 2EUVA 5ICZA 5CJ5A 2MJWA 1ZV5A 5D5MA 1X5ZA 3TWCH 3ARDA 3BO8B 1H6EA 1X7SA 2V17L 5J12C 1T22A 3VFSA 2BIMA 3AWGA 2OULB 5CP3H 3MBWA 4FYSA 3UJJL 4J39A 3ISWA 1MDAA 2ZNWA 2HN7B 3BW9A 4R2GC 5TE6H 1GHFH 3VGDA 3VGEA 2H6PB 2R39A 4XNMB 3VU1A 1INQA 1KC5H 4JPSA 5I15L 4HS8L 1CFVL 1KGXA 2ITDB 3KPQA 4Z9KB 4IU2B 1UA6L 5DHDA 2J12B 3V9EA 2UXTA 1RUMH 3U0WH 5JIHA 3FW6A 4Z7QF 3CFEA 2NNXA 4FQIH 1HL8A 4XXDB 3BRGC 2A74C 3QORC 3LIUA 4JO3L 4PLKC 4DEPB 1PZAA 1WC7B 3QJUB 4P5TC 3ZKNC 4A38A 1EMTH 1D5IL 4MX7B 3WIHA 1QWHA 5KSAD 1LO5B 3CDZB 1ZA3A 5TTRA 1OQXA 1MJ8L 1IBBA 1MCEA 2DY2A 4ZFGH 1NFDA 3ZMEA 3OAWA 3EO1A 5I1CH 2E46A 2K78A 4TL4A 4HPOL 3CFDA 2VXQH 2BMKA 5IW1B 3WHE1 2ZOKA 3RGVA 3HHSA 3FT1A 4FJZA 1M9WA 1E28B 3VFWB 2NR6C 5GPRA 1FC2D 1N68A 3L3IA 3NTCL 2WZ5A 1NGPH 1ZTXH 2WAQA 5B1JA 2IG2L 1V3KA 1OOWA 3IEAA 4XNUL 4DGYL 3H4HA 1MPAH 1RULH 1S7UB 2IXQA 5D2NE 4HMEA 2X12A 1OP3K 2HRLA 3FF8A 3TO2B 2ATKA 4NUPA 4ZZKA 4EKXA 4KMLB 4ODTL 3TURA 3W9EB 3NA9H 3TPUA 4M1CC 4XN5A 1NJ9A 4PJEF 5ALBH 2CO6B 4Z3TA 3HPLA 1TTCA 3DX9A 2H9GA 3ZY7A 5KVEH 3MRKA 1T4WA 2CJUH 5FWRA 4JFZH 1PKQB 5FM5M 3BAYA 4RAVA 3OKYA 3GS0A 4ZPTB 1YPZE 4D8PB 2ZOLA 2ATPB 4Y1AA 2VDRB 4GRWE 4H25A 1YEFL 5C0BE 1G0YR 3UZVB 4I0KA 1ZLWH 4N2EA 1KYAA 1I9RH 1WGVA 3K3QA 1U8IA 5IB3B 4X5WB 5GGQH 4G9DB 1PZBA 1EJOL 2G2NA 2VAJA 4HCIA 5FKAA 1QLEB 4EI5A 3RPKA 5KBDA 1NDGB 4Z7AA 1AQKL 4W4OA 2G5RA 3GRWH 3MV8E 4KK5C 1BBJA 4TPRL 1CVRA 3TA3A 3FRPB 4M00A 4Y0GA 1LK3H 4IK7A 3RIAK 2F18A 5FYJH 3TYGH 4IRSB 4XNZB 5BJTB 1U8JA 4OGQC 1D3CA 2CHDA 2UYLB 3DJRA 4TLTA 3UERA 3SGDH 3U36B 3NDYE 2YR3A 4PJ8C 3WY3A 2GCYB 4YZFF 2HPTA 1UWEH 2VE6A 5GGQL 3UX9B 1QFUH 4IBQA 2JTYA 1M71B 2DQDL 3VCLB 1JPSH 5IEHA 3VXUE 4GRLC 1JYXA 3K8MA 3DK2A 4XMLH 4N0RA 3ZDYB 2R56L 4AEHL 3FCSB 4G9FA 1ACZA 4GSRA 4MJ5A 3Q2CA 4IHOA 3U6RA 4NHUB 2OQJB 4DWHA 5DZ9A 2PWDA 1NC4A 1VESA 4J1UA 2LQRA 4CVZA 2DMGA 5A2CA 2Z93A 4KBPA 1QBAA 4RRPM 2ED9A 1JP5A 4FEIA 4PS7A 2UY6A 3OL2A 2WV3A 1TPXB 1W8NA 4MXWH 3WFEH 4JHWL 2EZ0D 3A24A 2BWDA 3BVWA 5ECGA 2BSRB 4ZFQA 2Q6WB 2QKIA 3WMPA 5SWZD 5CBAB 3NTCH 4G7QB 2CBTA 5D5MB 1ZLUH 4BK8A 4G6MH 1ORSB 1ZTMA 1OPOA 4WNQB 5H94A 4YK4B 4P57B 3BO8A 4R0LA 1ESOA 1TJXA 3I75A 2DYSB 4EBQL 1DVYA 1KTJA 2VH5H 1OCWL 2BOBB 5FW6A 2VLKA 1OGTB 1PZDA 1F41A 1OAXL 2LVCA 3GSOB 4OCWH 2IAMA 2OTUB 4UM8A 2IQAA 1BF5A 1R3LA 1HN1A 1MJUL 3BVTA 5T1MA 1MJ8H 2CR3A 5E5LA 2NZIA 2NXZC 3T4AC 3KGUA 1UG9A 2BCMA 1AR1C 3FJTA 4XNBA 3FFCE 2OMVB 3UC2A 1EO8H 3QHFH 4XBMA 3V6OA 4K7PX 5DJYB 4OFYD 4P5KA 4FQIL 5E9NA 1RIVH 4L4VA 2IDCA 4I2XA 4WTQA 1N26A 4NZDA 1VJSA 3RTQA 1MXDA 5ABDE 1F6LL 1NCDH 2R1WB 4NO3A 1SOSA 5EN3A 4RAHA 5HDRA 4KZDL 2ZAIA 3ZLQC 2CKBA 1JK9A 2GIMA 4FN0A 3MN8A 3IGFA 4HK3J 2XJKA 1WTGT 2N7BA 2E7CA 2ZYHA 5JXEC 3P3SA 4ZUTA 3UJJH 3UTQA 2FSEB 2F53B 5GS2H 3C6LB 1AE6L 3QFJA 1M53A 2PW2A 4WEEA 4G6ML 4X4YB 5FOBB 3V0DA 1EZLA 4J3OH 3LRLA 3P0YL 1XGUA 3K6IA 5KOMC 3K6FA 1X4XA 4JCWA 1WBXB 2VZ1A 3DNKA 4DK5A 5I6LA 3NCCB 2F53E 4HJSA 2GIYA 1A66A 1KTCA 4PRBB 1BFTA 5T1KB 4WUUA 5I6NA 1ZWIB 3GZKA 4ZUVB 3W3BA 4BFFA 2XFXB 3US0A 4JCMA 4ZYKA 2WN3A 1I53A 4XPAL 3VWKD 4WU5A 3QQ9C 1N6QH 1PGRB 5LWYH 2OA9A 3QDGD 4X5LA 3GSRA 5I19H 4PBWD 3TIEB 1AMYA 2R56H 3T0BA 1FO0H 4U1SA 1SLWA 3GTNA 3MXWH 1HH6A 3S9DB 4JRXB 4BFGA 5C0JB 2CH8A 4HLZH 5FYKU 1SM3L 1T7VA 4JFHD 3DURB 3K0WA 3QQ3A 3CFBA 4M7ZC 2YRPA 1TZGH 1QACA 4W9IC 2EIEA 4GLRH 1JZDC 3S0PA 4UAHA 4HJIA 5J6GB 4Q74A 1RY7B 4HWBH 2AQ3A 5DLMH 2B9AA 2HH0L 2NDGA 2WXNA 5FYLE 3FL7A 3BLKA 5B39B 1DBKL 4N0CC 5EEVA 1RUQL 3MYZA 4JW3A 3CN3A 5DJAB 4EZKA 1I8LC 4ACPA 4XI5C 4JFDE 4WQOA 1RZJC 5DEGB 5DUML 1LNUA 3SYCA 1MCOL 1XR9B 4JHZA 4XXWC 4ZSOE 3BUIA 1XFPA 1ZXQA 3EGDA 4MCYA 5IK3B 5C0ND 3PGDB 1U42A 4DKTA 2A9AA 2IAND 2QSTA 1EZSA 2AAAA 4AGMA 5D1ZA 4XNXL 4Y4KC 5AVTB 4L8DA 5L2JB 1I7ZB 1R24B 2BIPA 2BNUB 2XWBB 2M83A 3ZUCA 3MLRH 1EJ8A 5JW3L 2JI1A 1JGUH 1QRNA 3GXUB 4NNPH 4Y2DC 4PJ8D 4WWID 3U7WH 2EDEA 2R8SH 4Y4HA 4WF7A 3P9MA 3EHBC 2EDYA 2VE6B 3U46A 4GKZA 2DMBA 4I0PC 5T3ZH 4L29B 4PJXB 4LCWE 5IBUG 2LGNA 4ADJA 5C0CA 3QAQA 5DEFB 4M8VA 4F37F 2VL4A 5IB5B 1N5YL 3CH8A 1R0AL 5JHBA 4L3EA 4UV7H 3ESNA 1LTXA 2G4GA 4HMDA 3FTSA 4ZJ9A 5F8RC 3M17B 4HC1L 2R69L 1MFCL 2XV3A 2P5ED 3JWNG 2ZKXA 2DQCL 3IJEA 5IJDC 3GZOA 5GRVL 4IM8A 1E0OB 3WHXB 4WWKA 5BUGA 4A2GA 1KTKE 4HUKB 1EEZB 1DDHB 1KCSL 5C0DB 2AEPL 3VWJD 4PJIF 1BVLB 3TASA 5IVXA 2HKHH 4MAUH 5B3SB 1EGJL 1JWSB 3GIVB 1OGAD 1AXSA 2WQXA 2ZUYA 1CBVL 2EZ0C 4YEEA 1NJ9B 1TQBC 7PCYA 3Q44A 2GITA 5FFGA 3BAKA 4CU6A 4GT7A 4P2QE 3OLIA 3GIZH 3HC0A 3TF4A 4L9DA 3AS3A 2RMNA 4UTBH 2NY0C 5C1MB 1FNEA 1Z9LA 3LQAC 3ARDC 3MFFA 4HUUA 4XMZA 4YSEA 1QEWB 4I2XB 3GXDA 5E8OB 5AEAA 4H26B 3HHRB 5FS5A 5GRUL 4UWQB 5T1MB 5T5NF 1RPUA 5C2BH 2XI9A 3FFDA 2ADGB 3CXHK 2ED8A 4PGCA 5BVJB 1HWHB 4BFIA 5GZOD 2FTAA 3D05A 3HZVB 2AANA 3HG1B 1XIWB 3VRIB 2GJPA 3GMPA 1NL0L 3NJNA 4P5KB 2NQDA 1I1RA 4WUKL 1DJXA 3BGFC 2R1WA 1QFWI 4NO3B 2H3XC 5IJVA 1J8SA 3NIFF 1PQZA 3CX5K 5CP7B 3O45A 3QI9B 4HC1A 5A7EA 5E5MA 4HETA 1BOGA 3FT2B 3RY6C 5GGTH 5HD8D 3T6XA 1NMCB 3NH7L 3CPLA 1D5BB 1I3RA 4ZQKA 2R4SH 1P5VA 3AUWB 3VFRA 4PJBA 1S9WA 1PEZA 4KFMA 4CMMA 3VCLA 2AEQH 3ESOA 4P99A 4LVEA 3MRQA 5D7JC 4LIQL 1YUHA 3UIZA 2AXHA 2L7EA 4IRSC 5FF6B 4RMTA 4RFNB 2KDYA 4RCAA 4LLQA 2X1QA 4QRPD 1XZ0A 1R3JB 3ME0A 4PGZA 3SQBB 2AV1A 4Q56A 2QJDA 2Z7UA 1F4WH 1HHGB 1WA0X 4QRPB 3VU2A 3U30C 4NHUA 2DRUA 1HNYA 2E9JA 4LPWA 4XPTH 1ASPA 5DMIL 5ITFA 4JY4B 4R9HA 3MRDB 3KXFD 3QR0A 2IGLA 3VQMA 5BQ7A 2QSVA 4OLYH 4TS6A 3FQUB 3LKSB 4JFPB 5J1TC 1J0ZA 4PJCE 3BLPX 1DJWA 5I1IH 4X9YA 1LE5A 3CU7A 2AXFB 1U3NA 2DDQH 3L4CA 3OKKB 1TTAA 3WE1A 5TDOA 1QHQA 5EO9B 3SPGA 3ZQ9A 5E2TH 4OI8A 3KDPB 3I6LD 3RILA 1OD9A 4RH4A 4YDVB 2ZP9A 4QXUL 3RWJA 3KPNB 3QDAA 2F19L 2OW7A 4DEWA 3N55A 1U30A 5IROC 3B9KB 4EO5A 4W9LC 3CDFA 2PWEA 3VB9A 2EIZB 4JZJB 5ERWB 2EVIA 4OY9A 2IV9A 5GIRA 5IMOA 2XT1B 3UZQB 5D2NC 4YVNA 3UO8B 3KPRB 4BQ6A 1SMDA 4YPGA 1YNKL 2HFGH 4ZUSA 5BS0B 1KJ2B 3SDAB 3P69A 1A6AB 5KZCB 2Y5EA 5IB1A 4PLOB 3TEYA 3KM1A 4G8FB 2ZCKL 3GM8A 3LPOA 1J0JA 1KZYA 1YN6B 3NJKA 5GGTL 3L5IA 5ISZA 4D0DA 4F2MB 4LSRH 2XWTA 2DN7A 3L9BA 3O8XD 3QPXL 2KZWA 3EOTL 3NFPB 4F80A 5H4ZA 3CCHB 4IRZL 4B41A 1XL6A 4G6FB 4LNRB 4E9VA 2XA8L 3SOBH 2VZOA 5C6PB 3SE4A 1RCYA 1P7KA 1B2WL 1SEBB 2GSIA 5F88B 3AGVA 1T5XB 3C6LA 4AIZA 1DBBH 4GRMB 5B4MD 4I0PD 4F93B 2VUKA 5FFOA 1E4KC 1HTYA 2VN3A 3FAWA 4K94L 3PAVA 4DJMA 1O75A 4PJ7F 5HI4D 5I8KL 2YD3A 3NGBB 5HJ3B 4WWKB 4LCWB 1EZVY 3NIDB 5ECJE 3C6LD 1FVEA 1IX2A 1I7RB 1DQLH 1XGQB 1G9NC 1A6UH 5DWPA 3TZVA 3C60D 4P2QD 1BQHA 4NSKA 2HLAB 5JHMA 1OB1B 1TYJA 3U9PH 1FE8L 4CRPA 3IXTA 3GMOA 2OS7A 3I9PA 3MJ7A 4RGOL 1FE8H 1GIGL 3MROB 2R2HA 4ONHA 2X4QA 4XMPH 4I5BA 1G7HB 5C09A 4FTDA 4TSAL 4UV4H 3MRMA 1NBCA 5I75B 1K5NA 2AEPH 4HKZB 3VSQA 5CGYC 2EC9U 4BSWB 2W9EH 1QUPA 3KPOA 3V5KB 5GRXG 2P49B 1S9VA 3QG7H 4KJQC 4LL1A 3ZTEA 1JERA 4HKBA 1EAOA 5I1DA 3SDCB 3TGXA 1R3LB 3L13A 1MFCH 3RWEB 3NIFE 1ZT4A 4NEHB 1TUPA 4W9EC 3GMPB 1VADA 5FM4A 5MENB 4CADA 4ZAKC 1HJCA 4WI6A 1DQJB 3W0WB 3HR6A 2H0FA 3REVB 5ACMA 3O3EA 2GYSA 3KCPB 2XA8H 3IS0X 5KYWA 4KJWC 3LNEA 4EZJA 1NPUA 4BGLA 5HHME 4QUOA 4Q9RL 2PUQT 3LN4B 2NY2D 3AU0A 3NCMA 3PGDA 4YS4A 2DM7A 4R26H 3DRQB 4ZX6A 5KW9L 3KR3L 2H45A 3L95A 3R18A 4JGJA 4PGBB 1N59A 5CEZE 1U95A 1UA3A 2G60L 5EDXA 1H3WM 3I85A 3KZ8A 1KELH 2VLLB 5AVXB 4ABUA 3D06A 1BOGB 3FT2A 4U6YB 3ZE1B 4FA8A 1HH9A 1WBZA 2F7RA 5DJZA 4HKXA 1OAYH 3TEXA 2QQNL 1TJHH 1I3RB 1Z3GL 2JIXA 4ZMQA 2AXJA 3LDBB 1OSYA 2ZT9C 3OAYH 1IQDB 2PR4H 3UJIH 5BOPA 2E9GA 2JELH 4RNRB 4FL4B 1IIIA 1RK1A 1SMAA 3CDGA 4RGMC 1DUZB 1UB6A 1KIPA 4FQ1L 4JHVA 2FWUA 3M1CA 2ZF9A 1HXMA 1U3HD 3OGOE 1JGEB 1WWWX 2X70B 1P5UA 2P26A 3F7VA 1CFQA 5IVXF 1J1OL 4AM0A 1NIAA 1XCXA 1BLNB 3FB5A 3O4OB 5ILTL 3N0AA 4KTEH 2MOGA 5CCKL 2X4UA 1S7XA 4W9FC 3T6VA 4YDVA 5FUOL 1WZ1H 5EUOE 4OLXH 3ZKXC 1W15A 2YUVA 4ZDHB 4PTUA 4JQXA 3UTOA 1U8PA 1U3HA 3W2DL 4AGNA 1AGBA 3DOIA 1M7IA 1SEQH 4FQ2H 4H88H 5GQBA 4JFXA 4JRYD 5IIEA 5HYSA 5F3HB 3EJZC 5CSZB 3HB3B 4Y89A 4EDWL 1OSZA 3ZKMD 4AG4L 2ICEA 1ND0A 1C08A 2QVFB 3DJZA 2YEVB 1DLHA 4V2CB 1L9RA 2W59A 5DVPA 1A1OB 3VWJB 4ZO8A 3ARFC 2IANE 2IANA 3I2CH 1LWJA 3ZJAA 4UTAH 2VQ4A 4DO6A 1N5AB 1U2CA 3EIFA 2VDRH 3W37A 3BQUB 4HUVB 1B0WA 1D5MB 1G1YA 3Q6GH 5ERWA 5C0BA 4L23A 1SJEA 1RSFA 3C2AL 3IT8D 4AL8C 1MVUA 3H1ZA 5C0AA 1BD2E 3L7FA 2JB6A 3DX6B 4WW2A 2Y1VA 2Z8RA 5EFIA 5CLYA 2BP8B 2Z0UA 4YNYB 1G5GA 2AJYH 3EYVA 3MNZA 3T2LA 4ODWB 5AB9A 2EH8L 5DF0A 5T3XE 5ICZB 2H32B 3Q8CA 4G8EB 3VGHA 3QHZH 2CBMA 2HT3D 5KTEL 3KPPA 1QVOA 3GHPA 2VO5A 4UB0H 5E6UB 3EH1A 4LQFH 3VH8G 3ARPA 4Y4HB 2NSXA 4JZJC 3MBWB 3CVIL 5IB2A 3O45B 3QI9A 4OF0A 3X1EA 1JF6A 1KBKA 2VERN 4RZKA 2RALA 2ICWA 4FXTA 2MPAL 3C60B 4GPVA 1E4KA 5GRUH 3FQTA 3KPRD 4Z3IA 4POZD 3FTZA 1SLXA 1NOFA 3OG4B 4EJ1C 4KJPC 4UZSA 4KUZH 5JHLA 5K9OA 3QFDA 3RA7H 1E4JA 4Q0XH 1HAWA 1KBGL 1OB0A 4HQQL 5D1ZI 2F8VA 3GMOB 4OM1H 1CT8B 4MX7A 2A38A 2WYZA 4HWNA 4FQLL 1W72A 1WBXA 2AITA 2M8XA 1LMKA 3CN4A 1R9FA 4EBQH 3MV7D 3QH3B 3T6WA 1KFGA 1NSNL 4FDWA 3LNGA 3O3AB 3L3OA 3NCYS 3PDDA 4NWUL 2XZZA 2G2RA 2DQCH 1YEDA 1B4JH 3N1PC 4AC4A 5K9QG 3FRUB 4UT6L 3O6FA 3CVCA 2Q8AH 1HESA 3OXRA 3S3SA 5CGYD 5E9DD 2RHEA 3ZGIA 5EF3A 3O3UN 1A6TA 1LP9F 4HA1A 4HOWA 1SZNA 4AW4A 3W1ZA 3KHQA 4LSSH 4P8QA 4XVJH 1PNCA 5DQDH 3BXNB 3SGKA 4NRZA 3ML8A 1IC7H 3HG5A 4PJEE 1IGJA 2B4CC 5EULV 4AEHH 4Z7WB 3B7UX 1XBDA 4FF9A 3ZHNA 1JGVL 4F2EA 9PCYA 4WU7A 4NN7C 4IU3A 3KYAA 4RFNC 4NNPL 3QIWD 5E1AB 4PJBF 5EBMA 4XCCL 3L5WB 3P3UA 4YHML 1SPDA 2GVYA 3VI4B 3BIAX 5EU6A 4N0CD 1I1AC 2HX9A 4LDEB 2FZ3A 2OL3A 4MWFB 4NQSB 1RK0A 1J0YA 4HXBH 5L9DH 5DS8A 3OLGA 2YBRB 4FYTA 4U1NA 5TFSL 4KXBA 1QBLL 4J6RL 3U4BH 3T0ED 1PW3A 4A68A 4DP0X 4XH2B 4KPHL 3RNQA 3O6KL 5CCHE 1A4AA 3JYCA 4M7ZB 4BKTC 5EU6D 4WFHE 3TYFB 5FYJL 1QWUA 4DSYA 1LK3L 1UJ3C 1J8HD 3QIWA 4WFFE 5IF0A 1MY5A 3BUQA 1NCUA 3WO3B 3F58L 3ZIYA 1J5DA 5J06A 2FD6H 1JZ7A 3OJDA 3QULA 4XX1E 3BVNB 4FJ6A 3CBRA 3NJFA 5E8EA 1DUZA 1UB6B 4JANA 3SPVB 4Y7OC 3P73A 2K6YA 2MCPH 4LPXA 1WGOA 3GSUA 4NBXB 5JHAA 4UOW1 3VB8A 1EJOH 1UASA 4JRYA 5B21A 3EHBD 3N44B 2E4TA 4HS3A 4PY8J 4F2ME 1F18A 5I5MA 1G43A 1MUJB 3LKQB 4LP4A 3QW9A 3FQXA 1I9RL 3NA4A 4YQXH 1MIEH 1ILUA 4P06A 3LD8B 5ITFB 3DJSA 4HYTB 4ZSOA 3D3VE 3VRLF 5HVHC 4Y4KB 3G9AB 2ATKB 1XHHA 2X3AA 3FZUC 3QE5A 5T1LB 1FO0L 4FNQA 5J7CC 1CZ8H 5BW7A 1T1ZB 3UBHA 1ZT1B 1NGYA 2QGBA 5DZLA 4ZTOH 2WZPD 3TONA 2APVA 1NDTA 4GAYB 4PS4L 4J3VA 3AB0C 1QBML 4PJ7B 2P3YA 3NA9L 5GJTH 5C09B 3GSXA 3THML 4O9HH 4N5ED 3WJJC 1CL7L 3WMQA 4YMPA 3ECQA 4WDIB 5FHAH 3SGDI 4L3ED 4J4PA 1NLBH 2PO6D 5CU9A 1AAJA 2IDTA 3BEVA 4HHAB 4I48A 3OXSB 2BXYA 2HRGA 5CBAA 1R6VA 4HV8B 1JZIA 1FFNA 1H9DA 4B3VA 2A9NL 2C3VB 1KPRB 4ODXB 1T7ZA 3RWGB 1JPST 4OIBA 4BQ9A 2EXTA 1WAAE 4H1LH 4PJCB 2WINA 4NNYA 4NAMA 2NY0B 2VLRA 2XZQH 3P9LA 5TF1L 4OGYL 3D4YA 3EYVB 5E2WL 1S3KL 2QPEB 5TQ0H 1SXBA 4P04A 3E1ZA 4HX1B 3QRLA 5BRPA 1FHGA 3ATFA 2I60H 2QBWA 3CVHB 3KL3A 4ZFGL 4CC4A 2KERA 3FRPA 3QXAB 4NDMA 4BQ8A 4B9ZA 4GXVL 1OIOA 4N22A 1HS6A 3B1UA 3PQYD 4JJHA 3A67H 1J9RA 3MLWH 2ADGA 4NQXB 5KANG 1MDTA 5BVJA 4XOCA 2ITCA 5H37G 4HT1H 1GZPA 5IM7B 1QVOB 5FA4B 2B7DT 4X8XA 2ZUQC 3ROOA 1YMMD 3B3IB 4MJ2A 4YDLB 3UC0H 3KDMA 3WIFB 5D96B 2B1AL 4U0QB 2WUCL 5F96H 1DVFA 4LEBA 5D1XE 1ADQA 1F4XL 2R29L 2VZ3A 3V6ZB 3VQ2C 4P07A 5IEHB 3TA4D 2OR8A 2JV6A 3O2WH 5DSCB 1Z9SA 2AK1L 3LVEA 5EB9A 5TQ0L 1GA2A 3CWGA 1JMXA 3TBSA 1HYRC 5D7JB 3UADA 4EN2A 2WVSA 3Q01A 2WKOA 5SWSE 5T1KA 4PS8A 1ZS2A 2O5YL 4UZUA 4AL8H 1KY6A 1KXTA 5DVOA 1F3JA 2I26N 2EXWC 1PD6A 3RB5A 2W0FB 3CQFA 3O6FB 4AVJA 2UWEA 4QTFA 3VXSE 4XN1A 1NGWB 3OR6A 3S8FB 4UQ9A 2PKDA 1MQKH 4UI2A 5EEZA 2UWEF 2HVJA 5IEKB 2JNZA 1C5DA 4GUPA 4RGMB 4GQ9L 1PL3A 1G9HA 2JKLA 3PV6B 1FLTX 5EOQL 3L5HA 1BFVL 4EN3D 4TV3A 1M2VA 2F8OA 5EBLB 2W07A 4M3JA 4PY7B 3FH7A 3QQDA 1VFAA 3WNKA 3V0HA 4A2MA 2IAMB 2R9HD 3CSBA 3KXFA 2CIKA 4PG2C 3ZL4L 1WFIA 3NPSC 2R15A 3W9DB 1DN0B 1EHNA 4O5LH 4YGAB 1Y18A 1QFUL 1PG7L 2J1WA 3FO9A 1PD0A 4MRBA 1MI5E 2OMNA 2OMVA 4F5CE 2EYTA 4KHTL 2E6JA 1RZJH 2PXYD 3RFZC 3ULAB 1E9QB 1XSIA 4JDEA 3S4SB 4EMZA 3BOVA 1M7DB 1ZPUA 5AW6B 2CO2A 3KD4A 3BKCL 3P4NB 5CZVL 4Z1PA 3QUMH 2RQ8A 1BJ8A 2R0KL 4GH7B 3F58H 3F00A 1LEKA 2SODB 5GGVL 4ZW7A 1KMGA 1N8OE 3WE6A 4XWGH 5DD0H 5ESQB 1ID5I 3DTXB 1CCZA 3CMOH 5C7ZA 1KGYE 2XBDA 3AM8A 3O0RL 2ADJA 2FUQA 1U58B 1PY4A 3DGCR 4NUGL 2PPEA 4CN4A 1KIUB 3G5WA 1JRHH 4DKAA 5JQ6H 1PTZA 4OJFL 5H37A 1XCTB 3K8KA 2BNUA 4OCXL 4YHPA 5TFSH 3LVTA 4H8VA 4CSSA 1ZLVK 1F8TL 3VQLA 1MWAB 3IU4H 3MZGB 4MAYD 4NLHA 1GR7A 4PWGA 3T0XA 5IUCA 1NOAA 3IMWA 1CD1B 3OKNB 5LXGH 5I16B 3OKLA 4OZHA 4WO4D 4FCAA 4WUUB 1T83A 1GMIA 4KUCD 4JFFB 2HTKC 5CN3A 4F7CA 4C59B 2Y2YA 1DTUA 4IJ3C 1NGYB 4GB9A 1MUJA 1NANI 3M8OH 1B3JA 2KBGA 2HP4A 1OP9A 4J2XA 3SKOA 4B9YA 3X1NA 2RGSA 2WXFA 2H3KA 4K5OA 1HC1A 1RFDH 2ZPKH 4X7SL 3O41B 1MY7A 3SDXB 4UF7C 5K59F 1HI6B 1YYML 1BM3L 2C9XA 2A9MH 1GL4B 2LOEA 1HFUA 2IH3A 4HEMA 3DTUB 1KENL 1RUKH 4D9QE 3I50L 3L54A 3P77A 4JG9A 1O7VA 4QGYA 4DGYH 3PHAA 4RFOH 1PG7W 4BSVA 1CTMA 1F3DJ 5FYLH 5D6CA 1JPFB 1MCHA 1CDYA 2NY4B 3BCDA 2DPKA 2ZYIA 2VLRB 4M8QB 3IFOA 2J73A 2WYHA 3CLFL 4Z76A 4QXTA 4ZXBA 2Z7WA 3ES6A 1RVFH 4GKNA 1K6QL 4BKSC 2X89A 4B9FA 2X2YA 3A4DA 4B0MM 3NP3A 1V8HA 2V9QA 4QF1A 3DX0A 4PVNA 4F9LA 2PWFA 4OSUL 5IFHH 2I9TA 2Y7LA 2DLEA 3L08A 4K2UL 1NCJA 3VI4E 4JFQA 2ZKHL 1FO0A 1JWSA 3GIVA 2P5EA 4QYOB 2I9LA 1QEWA 2ISDA 4Z7QB 2Y2WA 3N43F 2X4RA 2OL3H 1FI8C 4JFUA 3T4AB 2IV8A 2D0HA 3HN3A 5FA4A 3FCUB 3X1BA 2J57A 2AK4E 3GINA 4L3FA 5SX5K 3B83A 1C5CL 1KXVC 5I8EB 4AYDC 5A2AA 4IW4C 3O6FD 1CFVH 1QFWH 3RUGF 1WHPA 1DQDL 2AJXH 1G6RA 4K3EH 1F58H 4HPHA 3KNBA 5HDWA 5D4HA 4URTB 2CJSA 1JIBA 4Z3FA 2YSSA 2C7UB 5DT1L 1W80A 5GS1C 1I3GL 2CKBB 4PB9L 4PJGE 4XNQB 3QAZC 1DVFB 1SBSH 5F89B 1V7NL 5DEFA 2ICCA 4HBQA 2FWLB 2VC2H 2P5WB 2E7HA 4GBXD 3AWEA 2IAMD 3Q6GL 4N3UA 4UANA 2NNAA 3VXOB 2G5UA 4KK8C 1KTDA 1IIKA 3A6OA 2YJLA 3F83A 1PX4A 3NCJH 2AQSA 2YPLB 4E5XA 4FL4C 4L8SC 4N2IA 1CL7I 4M5YL 4DGVH 1J11A 2FNBA 3FSVA 4Z3EA 2APSA 2D03H 2JB5L 3FFCB 1EEZA 4F9PC 5K33A 2AGJL 3ZE1E 3I6KB 5GHWL 4F8TA 5C92A 3IETB 3HNVH 3IWUA 4IOFD 1EVTC 4IBLT 4PWIA 3SE8H 4J3BA 2HRPL 4NCDA 5IHUH 4JFPA 4XOBA 1S7TB 4I1NB 3T2NH 2KHAA 4QAMB 2DBLH 4U1GB 2IADB 4NZFA 4BFRA 1BJ1J 3TIEA 1JI2A 3Q9PA 2VMFA 3OKKA 4QRPA 3EFFB 3QNYB 5DDHA 25C8L 2QL1A 5LBSH 3KBFA 4YFLF 1UB5A 1HIMH 4LHQB 3FULA 3TEWA 4IOIA 2CRYA 3FQUA 5D7KE 1ZEAL 2YWYA 3BMWA 4OCNC 1ZGLA 5HVFB 2OQJA 1ACXA 1RZFL 1G4RA 3LEVH 4PJCA 3TO4B 3KYNA 5E2UH 3MRNB 1CE6B 4ODUA 2IALA 5AVQB 4XTRC 3HG1A 3K46A 2MHAA 5MENE 2CRIA 3K91A 3ET9F 3U25A 4OCMC 2Y23A 3ARFD 3WS3A 1FH5H 4LSVH 3U2IA 2VDLH 3WI9A 3PP4L 4BHUI 5DVLA 1MNUH 1JI1A 1CLZH 4QJ5B 1E27A 2F1BA 3R1GL 3G3LA 4QXWA 1GTFA 4KNQA 3NACH 4U1GC 1CI3M 2WSDA 1Q94B 3CQPA 2E9IA 1MW2A 3BH4A 5SWZE 5JDSB 4XPBL 4YNYA 3TJPA 5EU7C 4MAYA 1GW0A 2B20A 4BFBD 3L3GA 3NIGB 5I6KA 1IVTA 1MCPH 3WSQH 4PREB 1WITA 2LU4A 4ZUSB 2EO1A 1OTUD 5JPNA 3K4DA 5AW0B 4ZO7A 4HUWB 3BWSA 4LE8A 4JPKL 3UTSD 4M6ML 1T20A 4BM7A 3TO4C 2GSIB 2I85A 1EVUA 4HS3B 4J23A 3IMUA 5AZ2L 4K9EC 1R3IL 2HWZL 3EUDA 4MXQD 4APXB 4FFZL 5JYLA 2H26A 1ETA1 4X6CB 4ZS7L 4F15C 1FG2B 1D6EA 4LRNL 4ZMTA 3BPOB 2WZ6A 4GRLB 3KLHD 1KCUL 1MLBA 3MBEB 3U79A 4EIGB 4K8RH 4NJAH 1LO3H 3FN3A 1M56B 4IS6B 1MFDH 3UPRB 2V3EA 3GTTA 1E6OH 2L3BA 3VM5A 1CQKA 4JGNA 3IFLH 4WI0A 3FC8A 4I7ZC 3D48R 3SBWA 3V0FA 2F53A 4HIEA 3V6FA 1WF5A 4YHNB 3U9WA 5KVFE 3WIHL 3SDDA 4BZ1A 2M1KA 3PAZA 1UXSA 4MGXA 4A63A 4U49A 1VFOA 2BNQE 3VFVB 1IB5A 3OSKA 3G5ZB 2TSBA 4H2AA 3CHSA 1FO0B 1QUNA 3WIIL 2A0LC 3ZBMA 1AG0A 3LNIA 4PVLA 1S5IH 4GAAA 3AC0A 3JWOC 1TVHB 1QO3A 3G04B 3L2LA 4RMUA 1J88A 4CBPA 1KULA 1B9KA 4HW6A 5TD4A 2JJSA 2BS9A 5C07A 1DQJA 4K4KA 3R7QA 3W0WD 3NRQA 3UACA 1N2RB 4K94H 5EUOF 3DX3A 3QZOA 4JFDA 4NJAL 1OSPH 4U33A 3EDDA 4MA7H 1JHKL 4I0CC 1ZTXE 5AVSB 2Z8VC 3NIFB 1WS7A 5SX5H 2XKNA 1B4TA 1P1ZA 3DPBB 4KRPB 4WW1A 1A5FL 3MREB 2KZKA 4HZ1A 3QDHA 4QHMB 3RX8A 3B3IA 5DFAA 1MQ8A 2G3ZA 3EOTH 4ZFOB 3K1KC 4HUMB 1WIUA 4QHNB 4APQA 2J8HA 2XQYA 5F9DC 5CHNA 3RE0A 5FK9A 3RGVD 1WFNA 4AW7A 6FABH 4Z3GA 2P47B 1SYSB 4U1IA 2CK0H 2VQTA 2IWKA 3GK8L 4Z0XB 4BZ1L 4NQCD 5I28A 2E7LA 2K70A 1CD1A 3OKNA 5I71B 2W88A 2TRHA 3N42F 5TPWH 1KCVL 1T5WB 4X6DF 5FPIA 1D5BA 2DW5A 4ZQKB 1NMBH 5LDUA 4P46B 2VXSL 4FQHA 4Y2OA 5FIEA 3JWOL 4XRCA 3GI9L 1OB1A 1MAMH 5DZPA 1UZ8A 35C8L 4N86A 1BQRA 1LO3L 1I8IA 3G6AB 3TJHD 4EKJA 4YWGL 1NFIA 3LRGA 3ZDXF 1F1DA 4WFGD 4NPYB 3TNMB 3IRPX 3NK3A 1BG1A 3PY9A 2WXQA 1YEKH 1NKGA 5J0BA 5FGBA 3NABL 5DVNA 4LOVA 3UTZB 2GY5A 4M61B 3TPUB 4OUUA 2DICA 2DMKA 3S37H 3SKNB 3D8MA 4E9SA 3R4DA 4FZ8H 4ISVA 1ETZA 2QVIA 3JV5A 3S34H 3PP3K 3T2NL 1I82A 4FNLH 3T2QA 2CZNA 5IIEB 2ZAGA 2VDLB 2H2SD 4MNQB 2J5WA 1JHTA 2DWEB 5DRWB 2ATPA 3GZQA 4XHQA 1IAKB 2PO6C 1SF5A 2XG4B 4UINL 2BNQD 3ESPA 2B14A 1QFWM 5FA3A 4G8IA 3F5WA 4MNQE 3ASWA 1QI3A 2VQ1B 4DGUA 5C07E 2Y7MA 1G94A 2KQNA 1KF9B 1UH2A 3UTSE 3KBHE 4FG4A 1G6RH 1HNGA 2FQEA 5GIRB 1S7SA 2L4OA 3OMZA 4HZLB 4L4TA 4ZODA 4HWZB 1Z7JA 1A6AA 2Y07L 3MRLB 3SCMC 3QQ4A 1URIA 2A74A 5C8JB 4M7KL 4APXA 3QNXB 1NEPA 2OMZB 1UWGL 2DM2A 1QZ1A 1I7UA 3I6SA 2XN0A 5EIIB 2AQTA 5IM7A 3AS0A 1F58L 2HJLA 1U91B 4HUWA 2VIRA 2Y7OA 5ANMA 3SEPA 2GJZA 2CPCA 2JQAA 1KGCE 1FORH 2IDQA 3ARWA 3DARA 3TV8A 1A7RL 3FONB 3U2SA 3KDMB 3UBXI 5IVZB 3WIFA 4WLCA 3HNVL 1Q1JH 5E08H 2ILLA 1W72L 1FNGA 5JQIB 4QO1A 5IBLD 4PYHA 3F04A 1MIML 3OKEA 5I6MA 3G5XB 1V10A 2YC1A 3GSQA 4YGVA 3QRGH 3U7AA 3VXUA 3C8KB 3U46B 2ZKHH 5HGBB 4K2UH 5C9JB 3D39D 5I9QB 1E8WA 1LGVA 3PGFL 3O9WD 4ZMNA 1KWKA 2YRBA 3ZDZE 4OSUH 2XN2A 4ATTA 5I5IA 5JW4R 3JVGA 4LLUB 4PRAA 5D96C 4A7VA 4WHYG 3PREA 4CGTA 4HG4J 1REIA 2CALA 1BZEA 2YZ8A 1U6AH 2PLTA 3SYOA 4H0IA 2O6EA 3VSTA 1X5IA 4RFEA 5DGQA 3FB8A 1JHLH 3ROLB 4UUJA 4PGEA 1XXFC 3BE1H 3HMWH 3NJIA 4PJDA 3VI3E 2G75A 5KN5B 3U0TA 3E9UA 2G9KA 3UPCA 4Y9BA 4RFOL 2BVOA 2EXSA 2K1MA 4R83A 5LQBH 3QNYA 3MV8A 4HC1H 2BX5A 1KENH 4ZAKD 3MGTA 3FNKA 3TVMC 1QFWL 3F7YA 2WO3B 5AL0A 3ZGHA 2KPNA 2V2WA 3ZX1A 1MHEB 3ECBA 2CD0A 3MV7A 4Y4FD 4QRUB 1ZK9A 2A3TA 3O4LE 3IAPA 3OAZK 1BFOB 4W70A 5I9QC 1K8DA 1DN0A 5K5YA 4OKDA 1HE7A 3H0TB 1BXVA 4WJG3 1TZ8A 3MQIA 2MCG1 3TBVB 1UD4A 2PMZA 2CCLA 2ERJB 1E9OA 4C55A 3U7WL 4OFPA 4ZOAA 1DJYA 5EU5B 2Y25A 4QRSA 1JGUL 2C1PB 4JZNA 1I1YA 3BGMB 2YLKA 4LAJH 3LRSA 3EJYD 4UQDA 5JOFB 1TO5A 2R2CA 1A3ZA 1GY2A 3BZ4A 1MVFA 2FJFA 1RVFL 3CSYA 1ACYL 1DBJL 4XAWL 5DK0B 5F89A 2G3MA 3BEWA 3TJEH 2Z4QA 3LEYL 2ZOTA 5JIPA 4LBEB 2FZ3B 2F54B 2OL3B 4NPJA 1X5LA 3FQWA 1OM3H 5GRJL 4TNFA 1MCOH 2AAVA 1JYNA 2YGNA 2E7LC 3DECA 3UAFA 3ALPA 5B3JE 3K8LA 2D3LA 3BT0A 1I8IB 2YD7A 2EE9A 1UCBL 5JOPE 2X3BA 1YYMH 3WLWC 4J8RA 1YYCA 1PZ5B 4PJ9C 1CYWA 2BSEA 3BKCH 3JVFC 5DFVD 4J27A 5DHYA 1G7MB 5FOJA 2YAFA 5HHXL 3A21A 4AKPA 2YXWA 2D73A 1FLRH 5DZNA 2Q5BA 2HPOA 3T2PA 1ZHKB 3ZUNC 2XRAL 1HKFA 3CCHA 3N9GH 3QC5X 4PM1A 4H0GA 3LEXA 5I0DA 2HJKB 2A9DA 3UTSA 4G7VL 1RJZB 5D6DC 5HDQH 3ZL4H 4DKFH 1EDHA 1VEPA 1T1YB 1WAPA 5FO9B 2NXYD 4PTTB 3WBDA 1M05A 4Y2DD 4TUKH 3IFPA 1Z5LB 3CFKB 1MCDA 2QADB 4YHOL 5MEOA 3NCEB 1MHCA 3Q5OA 5LWYL 4PR5A 1ES0A 1T2QL 4NN6B 4JZOB 2Q7AA 2P48B 1A9BA 5DVMA 3DV6B 1M1SA 4LDCA 4JM2F 5IB4A 1U8PB 3A0OA 1OAQH 4PS3A 2XTJC 3VFMA 3ARUA 1NAMA 5J1AA 2EDBA 2R0LL 4LVOC 4B9CA 5IUSA 2Q3ZA 3BP5A 4GKNB 1CDJA 2PPFA 1XR8A 3BI9X 4Q6IB 2R0ZH 2ICWJ 4R5TA 1U36A 4LPVA 1EHAA 3DDFA 4AXWB 1GPOL 4TRPH 3UTTB 3IMRA 3RWGA 2EVJA 4TSCL 2W80C 3T1FA 1UD3A 3LV3A 4GI9A 1U2HA 4IDJL 1CGXA 1KGCD 4GKSB 4R96B 5D5ME 5E6IB 4ORZC 4NQXA 4AYMC 3L3GB 2HJLB 1A0QH 2WBWB 5GGRA 5C3LD 3L81A 1YY9D 4QRTA 4ZW5A 4ANKA 2F5AL 4BE6A 5AVYB 4RMWA 3ZN6A 2ITDA 4AWJC 2FRGP 5D7IB 1UH4A 4KZDH 5I18L 2N1TE 3NCYP 3UC0L 2XXMB 4DAGL 3X3FH 1EZVX 2YD6A 3RWCB 5F0PB 1MKFA 2DQ6A 4GS7C 1KLUA 1J0KA 3WNOA 3WNJA 2ITCB 1UVQA 2YPLE 4M1GL 4TQEL 3D25A 3DBXA 3L1OH 4OCYL 4X6FB 4JGMA 1N12A 4JFDD 4OJDH 1BF2A 3C8HA 4K7PY 2X5PA 2MQGA 2I60L 5J9PB 3MJ6A 3TN0B 1OAXH 1MHPH 2GBAA 1QSEA 1OCCB 1B0GA 5F88A 2EDRA 5DUPL 5DJ8A 2DM4A 3S3JA 1RSYA 5JW4Q 1I3VA 1UFUA 5I74B 1GCYA 3OPUA 1INEH 5GRWA 2LABA 5LXVA 1WD8A 5I71C 2J20A 1FNFA 3QUZB 4AQ1B 1WV7T 1HWGB 1ZJBA 1H3TA 1FF5A 2I5YH 2KS0A 3HUJA 1ZLWK 4EVNB 4XP6H 4RWYL 1DBAL 4PRAB 1RHHA 3QEGL 4F33A 3TO2A 4HHAA 2O5ZH 3WKQA 4AM0Q 4U7MA 4FMVA 2FCBA 3QNFA 5I75C 4OIAA 1M4KA 1GGIH 1F90L 3CXDH 2B1AH 3QCUH 3L3IB 4NSKB 4E42A 1UXWA 5AL8A 5I2IA 3TLRA 1TVHA 2UV3A 3G04A 4IIQC 5EBLA 4P23B 5AVZB 4IBWA 5GRZA 2Y7NA 4YHIA 2D9QB 1P5UB 1GC1C 4G8AC 4DQOL 2ZTBA 3VDBA 1A6TB 1CR9L 3KYMA 1F86A 4JR9L 1XCQA 3JTSB 3TZVD 1FFQA 3HE6A 5MERA 3QUYC 3FU9A 3UP6A 4H25B 4G8IB 3BWZA 5TDPA 1MIEL 3H3BC 1WCBB 5FFLA 1PLAA 2BNRB 2DQDH 1UM4L 2YAEA 3AZUA 2Q7YA 3K5SA 5I5JA 3NAAH 1KCRH 2NNCA 4TSCH 3T0EC 4QRBA 1F3DH 3HG3A 4Y5YC 5FKAB 5EBMB 4Q9QL 3S48A 3K6SA 5DLLA 1PZSA 4NQCA 2HT2D 2KQMA 3Q0HA 1S9KC 5F0LB 4XHJD 3QR2A 3HVNA 2X38A 4OJEH 2NXYB 3ZMNA 1XGZA 1Z0MA 2A6KB 4OR1A 3BZ4B 3CSYB 3SCMA 1HHHA 4QTIL 4DN3L 4YDJB 3ZL2A 4EE2A 5EDSA 4I9WD 1TR7A 5E6SB 1NBVL 3SY0B 4DP9X 2IIJA 2UZIH 2EACA 3QUKA 1IGML 1LMIA 2V2XB 5DD5H 4ALAH 4UM9B 3O4OC 3FQWB 1KPVA 3NCWA 1HHJB 1DANU 1F42A 4FTVE 4L3AA 4OLVL 2CAKA 4Y19A 5FB8A 1E4XI 3VI3B 1AJ7L 3EDKA 5AG9A 1KYDA 1T2QH 4HLZG 4ODVH 2QTVA 4HXBL 4LCUA 3V4LA 3WL9A 5JORB 2MOQA 2Z35B