2HLEB

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
138
structure length
133
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVQYEYYKVYMVDKDQADRCTIKPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-B receptor 4
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
total genus 23
structure length 133
sequence length 138
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hleB00
1N68A 2DWTA 3UAEA 1URIA 4YSDA 3X1GA 1OCOB 1NIFA 2XVBA 1AS8A 2VW6A 5EHFA 3CZUB 5B7EA 1A4AA 3NSDA 3EF4A 3CVDA 3EH5B 2J55A 1V54B 5I6OA 1ASOA 2HX8A 4YSRA 3T6WA 2BW5A 3OQRA 3H4HA 1QNIA 1XB3A 4JHUA 4KNUA 1BYPA 2HRHA 1L9QA 2VMJA 1FFTB 5B1AB 2IDFA 4F2FA 2H47C 5AFAA 4UANA 1NZRA 1JZEA 4G7SB 5D4JA 2CBPA 4KNTA 5AZUA 2WSDA 1E67A 2BHFA 4DP0X 4W9ZA 2UX6A 4CSZA 1PZCA 1SJMA 3WG7B 1A8ZA 2FQDA 2B08A 4GY4A 4YSAA 2Y1AA 2IH8A 2GIMA 4NAJA 4A68A 2IDUA 2WO3B 2CJ3A 1NICA 4YSPA 2FT7A 2VW7A 3T6VA 1PLBA 4KOCA 4M4RB 1A4CA 4HHWA 4P5RA 3WIAA 3AW5A 4N4YB 2VSMB 2AVFA 3BQVA 5B3SB 2YARA 2BW4A 1SFHA 1J5DA 5TK2A 3HB3B 1PLCA 3X1FA 1W6WA 1OE2A 1AZCA 4E9RA 1ASPA 3DIVA 1J9RA 1KCBA 1AG6A 2YXVA 2XU9A 1JXDA 1SNRA 5ANHA 3FS9A 5I6KA 3X1BA 3T71A 1CYWA 1ET8A 2GC4C 3PLYA 1SDDA 2EIKB 3CVCA 2GBAA 4RH4A 2PCYA 1KBWA 2VSKB 1GS7A 1NWOA 3ZX1A 1W8EA 4A2HA 2XLLA 2BP0B 5I6PA 1BXAA 1IC0A 3FSZA 3SBPA 3TA4D 2CCWA 4DPBX 1WS8A 3FSWA 4DPCX 9PCYA 4HCFA 3S3BB 1JXFA 1WA1X 5LDUA 1WA2X 3KW8A 1JZFA 2I7OA 2AANA 4YVNA 3IBOA 1FA4A 2GB2A 1T5KA 3EH4B 1PCSA 2IWFA 4KOBA 1HAUA 5B1JA 4L0PB 2VN3A 1GS8A 3OMAB 1RCYA 2PPAA 1CYXA 1PNDA 1ZV2A 4P5SA 2CUAA 1FWXA 2AZUA 1J5CA 1E5YA 1ZIAA 3NJIA 1SF3A 1PF3A 2JFCA 1B3IA 3IN0A 4JKNA 3TASA 1M9WA 4HHGA 1X9RA 2ZOOA 1ZIBA 3FSAA 2FQFA 1WA0X 1QLEB 1PNCA 2CAKA 3NP3A 1AANA 3ABGA 4YSTA 1GSKA 3FSVA 3NSYA 4YSSA 1JZIA 2HX7A 4E9VA 2PP9A 3CVBA 4KNSA 4X4KA 4G7RB 1JVOA 2IWEA 4E9TA 3QJQB 1KBVA 4DPAX 4YSEA 2PP7A 2TSBA 4WKXA 4M3HA 2X88A 1NWPA 4UF7C 2HLEB 3CDZA 4BWUA 1GR7A 1ZDSA 2YAQA 4DP2X 5B7FA 3PAZA 2PLTA 2UX7A 4A2DA 4BDVA 1JZGA 2I85A 1A4BA 2XUWA 2FT8A 5F7AA 4A66A 4G71B 3EH3B 3WKPA 1WAEA 3PCYA 3V9EA 3ABMB 3L45A 3UADA 1NIBA 4HAKA 4KO9A 4DP8X 4NERA 3AG2B 3GYRA 1OCRB 4Q8BA 1SHWA 2DWSA 1SHXA 5E9NA 1TKWA 6PAZA 2HZHA 4ZK8A 3H4FA 4BK5C 2EIMB 1AACA 2ZXWB 2YAMA 5B1JC 3DTUB 1KYAA 2VM3A 3ERXA 3T6XA 1CURA 1L9SA 1BQRA 1AZRA 2DV6A 1BQKA 2UXFA 2EINB 1GY2A 1J9SA 2BO0A 1ADWA 4GXFA 1GS6X 1TEGA 2XV2A 3TBCA 2FTAA 4YSQA 3OMIB 4F7KA 1IBYA 3X2QB 1EHKB 1QHQA 2DYRB 3NYKA 2E86A 2DYSB 4HZ1A 4BXSV 4GP8B 3NJMA 3TU6A 5I6MA 2OV0A 2FNWA 2TSAA 1PZBA 1PY0A 1JOIA 1ZPUA 2X87A 2IDSA 2PPEA 3NP4A 1OE3A 2R7EA 5PAZA 3SBQA 1OF0A 2HX9A 3QJSB 1EZLA 2BP8A 3AY2A 6PCYA 1NDTA 3ZBMA 3WNIA 2IH9A 1L9PA 4QKTA 1GY1A 2VM4A 4HALA 2BWIA 2XYBA 3OD3A 3NJJA 4G70B 3FU7A 3UACA 2I7SA 4FAAB 2XX0A 1NINA 5F7BA 4DP1X 5I5IA 5IY5B 1N70A 2PPDA 2PPFA 5I5MA 2PPCA 1ZDQA 3ABLB 4E9WA 2IDQA 4QLWA 4ENZA 1MZZA 4W1TA 1TEFA 3JTBA 4AKOA 2FWLB 3MBWB 4E9QA 4DP7X 1SDDB 2R7EB 4E9SA 5I6LA 4DP9X 2H3XC 1AZNA 3HEIB 1ILSA 1ET7A 1DYZA 4E9YA 1BXUA 1ILUA 3GDCA 1NTDA 2BP8B 5I5JA 1AZBA 1PLAA 2A3TA 1OE1A 4HCIA 3ABKB 3H56A 1MDAA 1RZPA 1GYCA 4BWTA 4A2FA 4AI7A 4GP5B 1BEXA 5I28A 3AZUA 2FJSA 2GSMB 3V9CA 4AKPA 2HXAA 1J9TA 1JZJA 3UGEA 1AG0A 2BZCA 3FPXA 3FQ2A 5FC9A 1AR1B 1BYOA 3NJNA 2HRGA 3AG4B 1M57B 2PCFA 2QPDB 1UATA 1L9OA 3AG3B 1BQ5A 1PAZA 4AX3A 2DY2A 3OMNB 1OCZB 3QJVB 1BXVA 3BVDB 4FA7B 5I6NA 2EIJB 1WS7A 1E5ZA 1KGYE 2J57A 2RACA 3ASOB 1L9RA 2WO2B 2H5UA 1V55B 3CG8A 4PCYA 2AZAA 1IKOP 2EILB 4KO5A 1AIZA 3NJGA 2YAFA 4YSCA 1XMEB 1A3ZA 5B7MA 3NT0A 5B1BB 1BAWA 2UXVA 2ZONA 1VLXA 4HCGA 3PPSA 3FT0A 4CSPA 1PZAA 2GI0A 3CDZB 4E9XA 3FQ1A 1AQ8A 2YQBA 1RZQA 1OCCB 4YSUA 4BDVB 3WI9A 1IUZA 3MX0B 2IDTA 1MG2C 4EF3A 1ID2A 1AAJA 4DP4X 3PXLA 4MFHA 1ETJA 2MRYA 1NPNA 3NSCA 2YXWA 3WKQA 1JERA 1M56B 4F2EA 2OJ1A 2YAEA 1MZYA 2XV3A 1E30A 1CC3A 3IN2A 5PCYA 2J5WA 2IWKA 2BZ7A 2JKWA 4G7QB 2YAOA 5A7EA 1JZHA 2GC7C 2N0MA 5D4HA 5I26A 1NIEA 2BP0A 4YSOA 3AG1B 3JT2A 4YVUA 4JHVA 3DKHA 3SBRA 4WTQA 1JVLA 1KV7A 4BWWA 1E65A 1V10A 3FPYA 3IEAA 3S8GB 3KW7A 1AS6A 2FQEA 4K9JA 2QT6A 1NIDA 1J9QA 1SFDA 2UXTA 3QJTB 3S3DB 2P80D 1OOWA 2GHZA 2QPEB 1IBZA 3PAUA 1W6LA 2XWZA 3OM3B 1X9UA 4G72B 3NJFA 2QDWA 1SF5A 2YAPA 4A2EA 5D4IA 1AS7A 4N8UA 3S8FB 4KO7A 3FU8A 1KDJA 1PMYA 3TBBA 1OV8A 4KO6A 1NPJA 4AZUA 1XB6A 2J56A 4TXVB 3SQRA 2Q5BA 1ASQA 3U25A 3QPKA 4YL4A 1KCWA 1AZUA 2IAAC 2BWDA 2LLNA 1ET5A 2W88A 1AOZA 2AFNA 2OCCB 3NJLA 2MTAA 4A67A 3X1NA 3N55A 1R1CA 2NRDA 1HFUA 2FQGA 2VW4A 1L9TA 2FT6A 2P80A 2JXMA 3NJHA 1JXGA 3PAVA 2B3IA 1CUOA 1F56A 1I53A 3NSFA 3FYIB 4A2GA 3UABA 4HIPA 4GYBA 4Q89A 7PAZA 1HAWA 4GP4B 3UAAA 2PP8A 2UXGA 2W8CA 3WNJA 4DP5X 3D12B 3C75A 3FQYA 1A65A 2QDVA 1GW0A 3S3CB 3ZIYA 8PAZA 3QQXA 2XXGA 1NIAA 3T9WA 4BXVA 1XB8A 3N2JA 3FU7B 3G5WA 3NJKA 3ASNB 3X1EA 4AKQA 3RYMA 2YAHA 1DZ0A 2XXFA 2Y69B 3ZDWA 4UAHA 2ZWNA 1RKRA 5AKRA 2XV0A 1MG3C 4PAZA 4NB7A 5TK4A 3T6ZA 3FU9A 3QJRB 2XX1A 4DP6X 2Q9OA 2CALA 3GXUB 5B1KA 3IE9A 1TU2A 1YLBB 1KDIA 7PCYA 3FYEB 3EHBB 3QJUB
chains in the Genus database with same CATH superfamily
1QO3A 2C9RA 3X3GH 1HCVA 1F4YH 2CD0A 3GI9H 1JK8B 2I07A 3ZKMD 4UAOB 2ZOLA 3ZRFC 5G4MA 5F72S 1JVKA 3QEQB 2EUVA 4F15B 5DWUH 5I1IL 3C5JA 1MFDL 1KNOA 5ADPH 5TDOA 1J05B 1UOVA 4OM0L 1S9YA 4TSCL 1W80A 4P59L 3O3DA 1L9QA 4DSYA 2FJHA 3B9VA 5B1AB 1QVOB 3SZKC 4EUPH 4R5TA 1KEGH 4LCWD 5AVZB 4C8XA 2BVOB 2YZ1A 4RSYA 3HE7B 1U8KA 2PR4H 1OSPL 1XDTT 2E0PA 3TJHD 2BHFA 3GSRB 1ZHKB 4FQPA 1L9NA 4F8QA 2J12B 5J0BA 1YMMB 3WGVB 4CC4A 3HRPA 1TSHA 1AE6H 2H3NA 3MRMB 3OWEA 2VQ1B 1YY9C 3IDGB 4Y9EA 1J1OH 1DO5A 4F8PA 3O4OB 5D70L 4P3DA 3K5RA 4ADGA 2Y7MA 4MXVF 1G9ML 1FYTB 4WU7B 5FK9B 4XP9L 4QOKB 3BQVA 2B1AH 1K2DB 4ABVA 2AJ3B 1H6UA 3B7UX 4PJDB 5HPMA 4YIQA 5TK2A 2P8LA 3VH8B 4HS8H 4L37B 3VI3B 4TLSA 3UBXB 1U3ZA 1OE2A 3P9MA 1G7IA 4WKZA 3VJ6B 2UYLB 1G6VK 2X4PB 1RZFL 1T21A 2YXVA 2VN5A 1Y07A 4YNYA 1UJ3C 3BUIA 1NGZA 4DAGH 5IWLC 4Y9CA 1FFQA 4CVWA 3GPSA 4FHJA 5CEYB 4KHXH 1GS7A 2D7MA 2EKJA 3QC5X 1JP5A 1A6WH 2QL1A 4HBCH 3MRCA 4JPVH 4WFFE 1F4AA 4LSSH 3NCMA 3MFGB 3AJ7A 4GMSL 1WS8A 3FSWA 4H8WH 3EBGA 1ZHBA 3O3BA 3MDJA 3DX8B 1HXYB 2OMVB 4ZOAA 3ALXA 2EDEA 3IBOA 1F42A 4X6BA 4ES8A 2VDQB 4Z3TA 2FSEA 1ODUA 1IKFH 1A7NH 3PHOA 1JF5A 1P5UA 3KEDA 3QG7H 4UM9B 4YC2B 1JHKL 2AEQL 5IB3A 4OLWL 4HIHB 4HPOL 4HK0B 4NQSB 4YDVA 4W9KC 4PM1A 2W5PA 5AB0A 1IGML 3SE9H 3LOWA 1NDMA 1OAXH 5I1JH 2IQ9H 3EJZC 1CIUA 4CSTA 4D9QD 4QXWA 3MACH 1A6VL 2W0FB 1WA0X 2BFVL 2YD2A 1DQKA 1I9RL 2IBZY 4O2EA 5DUML 3DXAA 4ZQKA 1HSAB 1B0RB 1VRSA 4LBAA 4JPQA 1A6TB 2ICEA 1YYLH 4KK8C 3RX7A 3F6LA 3EBAA 5DDHA 4J6RH 5A2CA 4OIBA 2EIZB 4JHBA 4LESA 1YG9A 3B34A 3IDMB 2WLIB 1L7IH 1YEGL 4JM2F 5AKTA 5JHMA 1HH9A 1KZYA 4LSPL 1KUMA 4BWUA 3I9IA 2O6DA 2EXYD 2YAQA 4XN8A 2NZ1A 3L3KB 2VDML 2Y1YA 3DIFA 3FB8B 4BDVA 3V6OC 3BQUB 2ARWA 1QLFB 4PB0L 5JW4M 1HQRA 1JPSH 2IAND 2XUWA 5IR1B 4TUUA 3FFDB 2DWEB 3GZKA 1WAEA 2YRPA 2WXOA 3FO2B 4XPTL 2KZWA 4WHTB 4PJGF 3ML8A 3BWUC 1CE1H 5J56B 4H4NA 5DFTA 4X5LA 2WB7A 1XZ0A 1QABA 2V2WA 4JLRA 2EDWA 5DRZA 3GRWL 4ZK8A 5EU6D 2WP3O 3ALPA 4NKDB 3D4GA 3NIGB 3HG1E 3VA6A 1XHHA 1AI1H 2ZUQC 2VSCA 1G0DA 2CCVA 3PDGA 1F6AB 2YAMA 5E4IA 5FHBL 2VXTL 2YC1A 5EN2B 3QUZB 1IBGL 5AWNH 3WBDA 1E4KC 4XNZC 3KH3A 3JVFC 1WFOA 1AIFA 4KZEL 3JUZA 2GK0A 4RGMC 5B8CA 3DJTA 1KIUA 5GRVK 2BC4A 1A0QH 4BH8B 2HFFA 1DVXA 1RZJC 5EWIH 2FR4B 2ITFA 2ITCB 2VCOA 2OS7A 3L4UA 2AQQA 1J5OH 3ZKSD 2IFGA 1E3XA 1FH5H 1F1GA 4ZI8A 3ZSTA 4N1HB 3RI5K 2CPCA 3N50A 5ANMA 1N4XH 1U8PB 4RQQA 3LKPA 1IBYA 4L18A 1CXIA 5ACLA 3HAEA 5AW5B 2YUZA 3QORD 3MRIA 3F62A 3OBAA 1KGIA 2DM3A 3DUSA 2O61A 3I2CH 3QDJD 4PFEA 4PRIE 1A3QA 4G6AD 3VFGL 3LZNA 3U6XA 1AGEA 2IDSA 5J11C 3R4RA 4JY5H 4HHAA 1OWRM 3NP4A 2D73A 4LT7A 3CN4A 1B4TA 4JVPA 4WWOA 1G87A 4HKBB 5IW1A 3GF8A 1KMGA 1Q0EA 1R3JA 1I1YB 1D5BA 1NDGA 3MLSL 5TQ2L 3RU8H 1NC4A 4I8DA 3V4PL 1DBMH 3HFML 4JQIA 2H9GB 4K5NA 2CKBB 4JHAL 3LSOB 4UDTA 4TRPL 2ZPKL 4LXFA 4HC1A 4LHUA 5TPWL 3ML9A 1I1AD 3WS6C 1EK3A 4JMNA 4OIIL 2EVFA 4I1PA 4NWTL 5F7HA 5ABDE 2CXKA 3KM1A 1SXSA 1SXZA 4CJ0A 4GUQA 1A9BB 2IVFC 2X4TB 3EYFA 3IFNH 5L9DL 3BIKB 4S1DD 1KN2H 3E6HB 1RZJL 5IHZB 2OSWA 3OXRB 2OW7A 4ZFFA 5BQ7B 2GAZB 4HCRL 2MPAH 2EEAA 1ED3B 5CJ8A 4DERA 4DQOL 1OAKL 3B3BA 4LMQI 1FNSH 4DP7X 3PV6A 1N5YL 1EJOL 4F58H 4B7IA 4Y8DC 5CZVH 2Y7SA 1YNLL 2BINA 3EO0B 1UH2A 1BXUA 3GDCA 1T66D 4ODWA 2Z31A 3HVNA 3CZKA 3UTPE 2CG9X 3NCEB 2AABH 3NIFB 4GRWH 3LNGA 3HZVA 2VWEC 2MCAA 3IYLW 2F8VA 3NDYE 4H1LH 1CE6A 5GJSL 5I0YA 4YEEA 2VDRH 2PYEE 4N0CC 1MDAA 1RZPA 3NACL 4MJIA 3NIDF 1KLFA 3QWRD 4CMMB 3QARA 3D0AA 2R23B 2M8XA 2F7PA 2J88L 2H0JA 3MX0A 3CU7A 1LEIB 2XA3A 2XZAL 3RB5A 1TCMA 4MNQB 3RTLA 1DJHA 2C9PA 1Z2KA 1ZANL 5IW3A 3N06B 3UGEA 3X3GL 5B38B 4CDHA 3CIAA 3NJNA 4DT2A 4TNFA 1WFUA 2X2YA 2V6HA 2ZJSL 4G82A 1BYNA 5EO9B 3T1FB 5ETUB 3D5OF 3DETD 1T20B 2F53A 1OGPA 4PJ7A 1ETZB 1RZ8A 4Y8AA 5E2UL 5HD8C 5ABAA 4Z9KB 4E42B 1YN7B 1T6WA 1XGUB 3C6LC 4YHZL 1RK0A 5KVMC 2BM3A 4RAHA 1WWWX 2MFNA 5AAMA 3MV8D 2JKRM 3OJVC 4JO4L 1IKOP 4M4RA 5EZIH 5DGQA 1PKOA 2DMGA 2V3EA 1UOKA 4C56E 4A04A 3NESA 1UD5A 1XSJA 1BGXL 2NNAA 2DM7A 5LGYA 4X5XB 4IEFA 1RZKH 4JUSA 3U2JA 2XPZA 3WKQA 2CWRA 5BRZD 3ZTDC 1AE6L 1XSIA 1RH8A 4WI6A 1UUNA 4TNVF 1E6OL 4XC3H 1J1OL 2Q3AA 5BVJA 2F15A 1OSYA 3V5KB 1KEMH 5E9DA 3BD3A 3IKKA 2L7JA 1YEIL 3QZBA 3B5HA 1ZLVH 1UFGA 2H26A 2PN5A 2QFPA 4XX1E 4JHVA 2BJMH 5LVEA 1JPGA 2X4SA 3ZHDA 1G7PA 3LKQA 4DUWA 3MLPA 4HS8L 3O3AB 4O4YH 3CZFB 4PPTA 5GRWA 1NIDA 2G9HB 4FQXC 4K3HA 1UT9A 4M56A 2EDKA 4EDWH 2X6BA 1JTTA 3DV4A 1X9UA 5B8CB 1UG9A 4G72B 3QO0A 4QXGH 4X4YA 2AP2A 2QDWA 5BV7B 1KFAL 1YEJH 3V7AG 1A7PH 2ADJB 4Y4KB 4HD5A 5CLXA 1MVUB 1RMFL 4ZMPA 2G5RA 3HNTL 2LAAA 3WXVH 1QBAA 3PP4H 1X5IA 5A6IA 3OKYA 4HBCL 1UB6A 4HGMA 4LLVA 2MSPA 3V0AC 1Z0NA 3LPFA 4EI5B 3FB5B 3DGGB 1HOEA 3ESNA 4NQQA 4YAQB 3PWPB 3LQAH 5E56A 2BHZA 1ONQA 4HJJH 1UYWL 1U93B 1F97A 1GZHA 2LLNA 2UV3A 3M8OH 3QFJD 4RETB 4UILH 4ZTOH 1E0OB 1IKFL 2FE0A 1A7NL 1REIA 4PVBA 5IVXA 5GS3A 3MXVH 4WLCA 2JXMA 3NJHA 2EEDA 3AU1A 4K71C 3WE6B 5AW7B 1MFAH 1UACL 4I1NB 3LKNA 4QGTA 1A5FH 3N91A 1F56A 2AQSA 3NSFA 1HT6A 4NM4H 2Y5EA 5CBEA 5E94B 1EBPA 3LXCA 2IQ9L 2YMXH 4OCXH 5GGTH 3L7FA 4ZPVB 4PLKD 1JL8A 1WZKA 3N1MC 4Y2NA 1M05A 3WNPA 3Q7JA 4OZGF 2P5EB 3ZE2F 3LZOA 3LH9A 4NENB 3PIQA 3WN6A 4OFQA 3R19A 1KGJA 3K4AA 4M62L 5ALBL 2C9QA 1G7HB 5GSRB 1DANU 3S88H 1DJXA 3OZ9H 2DLGA 3IU4L 5FF6B 1BG9A 4RGND 1TZHA 3CDCA 3ZQXA 5F6IC 2BOCA 4ORGB 3UBFA 3S37H 3K1DA 2CUMA 1NGPH 4CU7A 1FO0L 5GJTH 2F54E 2K1MA 2VDNB 4A7SA 1WZ1L 3QZMA 5EZOL 2YBGA 5HJBA 1KCRH 5FECA 2XTJC 1MFBH 4PI2A 4WSKA 2EDFA 3QEHB 3TNNA 1X5XA 1JPSL 3IE9A 6TAAA 1YLBB 3ATEA 3PWVA 1XGQB 1Z3GH 3WY4A 1DANT 4LASH 3ESOA 4I18B 4QHLA 2YUVA 2F8OA 4YHPB 3RGVB 4OF5A 4XBEL 5C3TA 1KN4H 2Y2TA 4YFLI 2OI9C 4HJ1A 4OI7A 5DEGA 1TQBB 4OM1H 5E8PB 1JD9A 1ZS8B 4AQEA 3CC1A 1ASOA 4MS8C 1FFNB 3O6LH 3RZCB 3QQ4A 1R9FA 2WXPA 4LRNH 3TCTA 1GZPA 4NBXB 3FB6B 2Y25A 2JKSA 2AK4B 3INUL 3N40F 2QHLA 5D96B 2CJSA 5BZZA 3A6BH 3FQWB 5DHMC 1KSRA 3VFVB 3GSXB 3BUTA 1AOHA 4X9IA 3TT1L 4IBYA 4MYPA 3RKPA 1INQA 3BMVA 3HHSB 1AGCA 1J5OL 2AVGA 5FW8A 4N28A 2FX8H 3G6JE 1DUZA 1W0WB 4AK2A 5FO8B 5KVDE 4GY4A 2FLRT 1VCBC 3FQTA 2NNFA 3EDJA 1OCWH 4OD2B 4KTGA 3T6VA 2IANA 2J8HA 4MXQC 4UTBH 4YN3A 1THAA 3DJSA 4Q9RH 5AAWA 5AOJA 4WWID 4IJTA 2VSMB 3NZ8A 3V6ZA 1MLCA 1HX0A 3T8VA 4N2LA 2ZWLT 4LVOB 4LNVA 2BMKA 1E2ZA 3IGAA 4FQ2H 4PJ8C 1KTCA 2I9TA 1WQVT 4HIEB 4XO4A 2Q8AH 1XMWA 3T4YB 2P5WE 3MQIA 2VO8A 4JO3H 1HC1A 2A6IA 2XU9A 3GBEA 4FJZA 5EU6A 4J2QA 1CXKA 4C47A 5A2IH 1FVCB 1VAHA 3RU8L 1XH3B 1VSCA 3HG1D 3PLYA 3KXFE 3QB7C 3P3YA 2PCYA 2VDOL 3B9KC 5INCB 4D0CA 3ARFD 4AUYA 1NWOA 5KVGL 2WK2A 3WLBA 3BD4A 3T3MB 4JO5A 5I66A 5ID1A 2LTQC 2X4RB 3GNMH 4X8JA 4AMKH 1CLOH 4JY6A 5CAYB 3FDWA 3SPCA 4U4BA 1NMCB 4FZEL 2CM5A 2YEVB 1IVTA 3L5XH 1F90H 2OMWA 2KUTA 1CK0L 2VZSA 2Z1PA 3CPUA 2QKIB 3HUJA 2H45A 2D2OA 2I7OA 3BWSA 4G80A 4O02A 1T5KA 3DO7B 1ULVA 3B2UD 5KVFL 2WINB 4HU2A 1KB5H 3QORA 2C9XA 2MOGA 2Q76A 1NMAH 2XQBH 2EDBA 2XZCH 4IBTA 1BOGB 1FNSL 3NQKA 4ONGL 1J5CA 2WWKO 2F61A 4JDVA 1TO4A 3IT8D 1EA9C 4PRID 3STBA 3V2AR 2YQ2A 3DX6B 2QADC 1PNCA 4OI8A 3G04B 3QXAA 1CGSL 5LBSL 5T1KB 1IFRA 3EJPA 5E6YA 4FNSA 3HOGA 4FQIL 4POZC 4XPAL 4JG5A 1PG7H 1EH9A 4PQXA 2ZUSA 1K6QH 3OAUL 5F1NA 4P2YA 5IVZA 4L2YA 5KSBF 7TAAA 3FUHA 1FFOA 4CVZA 2X70B 1MCPH 4X8GA 5HHOE 4XNYL 3SYAA 3UP6A 3TO2A 1I1AA 3IJSB 1ZDSA 2A1WH 4XWGL 3Q1EA 3UZEA 3PAZA 1TTGA 1WGOA 1BZ7A 4GI6A 4QXTA 2VNCA 1JWSB 4MCZB 3DA0A 4JZOA 4Y4FB 4AYEC 4AXWA 5GS0C 5I8KH 1TTFA 2J8UE 4K9EC 5IQLA 3X12B 4U6TA 3M7FB 3RI5F 3G5XB 4XGZA 3ABMB 2N4IA 3VRIA 5H2BA 4HAKA 1SOKA 3OJDA 4HS3B 2B1OA 4CSSA 3S36X 2GJPA 4FEMA 3CH1A 1UCBL 4NDMA 3U7WL 3ZZLA 2V17L 2H32A 3S2AA 4L8SC 3VXMB 3Q2WA 3GD1C 3KH4A 3B9AA 3K80A 5HHMD 4GSRA 1NEPA 5CLZA 5DJYB 1S6NA 5F8QC 1H8SA 5CJQH 3W39A 4HUCA 4QEGA 1E5AA 1IGJB 5IF0B 2WUCL 5K9OB 5KWYC 3CZGA 5BOPA 4ELKA 3QWRA 4XNAA 1Q72L 2WC7A 1TZIA 1NBYA 3LZFL 3NG5A 1S3KH 2YGVA 1KEML 4AG4H 4JFVA 4UQDA 4L3EE 4PJCB 4PUBH 3L5WA 5CSGA 2VLLB 5FLUA 1ZVNA 2Z0UA 2BJML 5F7NC 4FZ8H 1SRDA 3BN3B 4MHHG 2K70A 3X2QB 3RY6A 2XWTB 2OX5A 5EUOF 3U4AA 1I7RB 1UZGA 2DYSB 4UI2A 3KPSE 2NY2C 2OFQA 1A3LH 3P30L 2E7DA 3ZDXE 1XF2B 4LDCA 4NPYB 4V11A 3NCFB 4PH8A 2Q86B 2X10A 3FB7A 4TLKA 4KFMA 1A7PL 5CZXD 2C1OB 5J3HD 1DQVA 1A8JH 2ARJQ 3RG1C 2VABB 4YDIH 3WXVL 1EGJL 5GS0L 3BP5A 1CICC 4K9EL 3UEZA 3F58L 3BKYH 2B14A 3EO9H 3P0VH 3Q43A 3P40A 1RI8A 4Z78A 3MV9A 3IJEA 1L5GA 3C60B 3BO8B 1J0HA 2SEBB 2FAUA 1L4IA 3BAEH 2PYFA 3LQAL 5BRZA 2CK0L 1CZ8H 3RWEA 3IB4A 1NFKA 4OUUA 3M8OL 4UILL 1S7UA 4JJ5B 3V0FA 4OQTH 2WVTA 5C2BH 3CFBB 3KPRD 5I71C 4XVSH 2V2TA 1KJ3H 4Z3FA 5FKPA 4KXAA 1MFAL 2O6FA 2X44D 3QZPA 1A7QH 4FOMA 1E43A 4ZD3H 1Q9KB 3V4UH 4HIXL 3H9HB 4ZW7A 1MNUH 4U7SA 5F70A 4FI8A 3U79A 3ABLB 3LN5B 4OJDH 1MAML 4OCXL 2IDQA 2G5BA 3DSFL 3PABB 4LVNB 1FNEB 1R47A 3VD4A 4OF0A 1ZGLP 4E9QA 2N7BA 4F3FB 1KG0B 4M1DH 4M48H 5KUKA 3RNKA 3LHPH 4JRYD 3J7HA 3V6OE 4ZO8A 4APQC 3RX8A 3VDAA 4FLOA 1B9KA 5D7JB 3SDAB 4J4PC 4AZ8A 1UEMA 3S88L 3GS0A 4H8VA 2APWA 1QG3A 4KKCD 1RIVH 2OAAA 2GW5A 3VQMA 3LRHA 2VLME 5EU4A 5MERA 1KJVB 1U8IB 1TMCB 4PGDA 2DQTH 3UG5A 3AZUA 3CV5A 3CQFA 2NXZD 4NRZA 4HH9A 1Z3GL 5FW7A 3GXFA 3HHRB 4XNMA 4XHJC 3VFMA 2PW2B 3MZTA 1JBJA 4YLQT 1XZWA 3I6KA 5BZXA 3BXNA 4LSQL 3HR6A 5DYOA 5D2NB 2H1XA 4OM1L 5CNHA 5J6HB 3MBEC 1U8CB 3N1QC 5ISZE 2W94A 1QPPA 1JMZA 3OSVA 4G42A 2DJSA 3ZRCC 1A64A 3U7AA 5E99H 3K6OA 1KGYE 4X9YA 4FNLH 2Q7YB 1R3IL 3O6LL 4R7VA 2GY5A 1PKQB 4J3XA 4QRRD 2DKUA 1PPIA 2FJUB 5HDBE 2VLRD 3BWUF 4EI0A 1IGIH 3U6RA 3OHXC 4QRQA 4CADB 4LGRB 2AXGB 1AQ8A 4LSTL 5FDWB 4FULA 4AK1A 5LQBL 1SDYA 1E90A 1I8MA 3KGSA 1EMTH 3QQ9C 2DS4A 2NNCA 5LBGA 3US0A 4PB9L 4R3SB 4Z3EA 4BFKA 5F3FA 5GGUA 2ENJA 4DVBB 1JPTH 3QHZH 4FXGC 4ZBJA 2V37A 1EEZB 3QDME 4KUZH 3EHBC 5TQ0H 4ZO9A 1MZYA 3EO1B 2I27N 4JY4B 1SVZA 5DSCA 2F54D 3OQ3B 4G8GE 4HD9A 4MVBD 4G7QB 5A7EA 3EYQD 2GC7C 3N44B 4BQ6A 3H53A 2ADIB 2CU9A 4R7LA 1S7WB 2YFNA 3FU5A 3GSUB 1D5RA 3GRBA 4XCNB 1R5WB 4K5LA 4PJ5E 4FQ2L 5I0WA 4ZUWA 3GMNA 4JFSA 32C2B 3F6IA 5EEZA 2BNRB 2KS0A 5JOFB 3LZLA 1IBZA 4FP8L 4ATWA 4KJWD 4PGEB 1EUUA 1YEHH 1GAFL 3IMSA 4AJ0A 3CQQA 3HC3H 2PXYD 1BREA 3BSGA 3U0WH 3NEXA 3OB0K 2ZX7A 3ISWA 4KO7A 2NUPA 1R5IB 3EYSH 4LEEA 4HIIB 1PMYA 4AYID 4PI0A 4ZNCD 3U83A 4A7VA 4WW2B 1NPJA 4JG1H 4CNIA 4KHTH 5HHNB 3C12A 1VHPA 2QGBA 1CFQA 1MCLA 3GNML 2EVJA 3BEWA 3MODH 4AMKL 1XB6A 3MN8A 4H5SB 2O5XH 5I1EH 1ZHNA 4HWBH 2C4XA 5BOJA 3RWCA 2EDNA 3OLEA 1M71A 1L6ZA 3ZN6A 3L5XL 2XSKA 3KE0A 3HG5A 3MJ9L 1K4CB 4HKJB 4Y1SA 5E9AA 4Y9FA 2IAAC 2HRLA 4FQCH 4LLAA 1I8LC 2X05A 3CMOH 2WP3T 1J8HE 3VCLB 4A67A 1I85A 2XWDA 3P9LB 5AZ2H 4OY9A 1NMAL 4EKXA 1F02I 3SDXE 4OKVA 3WO4B 1QRNB 1N6QH 1T80A 3IDNB 3OKEB 5DQDH 3TBSA 4BUGA 5FYLH 3BW9B 3S7GA 3KM2A 3VI4F 4JFWA 3KD4A 1HDMB 3CXHK 5KBNC 3UJIH 4HBQA 2X89D 2UXGA 3VXUE 1CPUA 2DLFH 3BH8A 4Q4EA 4ZUUB 3RL1B 2KC0A 2R1WA 3ZL4H 4GAGL 5AD0A 4L29A 8PAZA 2CDEA 4P5TD 3L9RA 5J13C 4OJFH 2P5WD 4Y2DC 2QTVA 2X7LB 1JV2B 3G5WA 4HKXB 1FNFA 3HG1A 3WEMA 1I3RB 3VD5A 4AKQA 1RJLB 1DBBL 4KNQA 1KPVA 3LEXB 3V4VL 1O75A 3ARFA 4U6VH 2CH8A 5JOPE 1JDCA 2B9BA 5LXGH 3MLWL 4R4BA 4KJYA 4M03A 5TK4A 1QBLH 3ARDC 3SQOH 4IJ3B 2AJXH 3QH3B 4XMUA 1PAMA 3FU9A 5ILTL 3KJ4B 3QJRB 4KRPC 2Y36H 4B53A 2XBTA 3C5ZC 5C2UB 4TOYH 1S7QB 1DLHB 1HSBB 2F8IA 2I69A 2N0KA 3T0WA 2YBRA 1UT1A 3QUMB 3QG6A 4RDQF 3WTSA 1FE8H 4EPSA 4PD4J 3V0DA 5CN3A 4ZX4A 3CZUB 3MNWB 3NFSH 1G7JA 3MRDA 2DM4A 1UADC 5DVNA 5EEVA 1NAML 5DJCB 1J0YA 3SO3C 3O2DL 4WFHE 5FFLA 5DZJA 1IM3D 4AIZB 4JHUA 4PRIA 4LGPB 2VAAA 3HE6C 3OKOA 3QR0A 4BUQA 3BGMA 5CJQL 4OFDA 4P46B 4X9GA 1U92B 5AFAA 2CJTA 5DRNB 5A40E 3IDYC 2XN1A 3B7YA 4IKNA 1EHXA 2X28A 4B0MM 2CUIA 4LNRA 1G9HA 4KY1L 2AKRB 3WG7B 1Y6MR 4PUBL 2G75A 2ITDB 4S1RH 3VGDA 3WFHB 2MJWA 1AJ7L 2XPYA 4BRVA 4IKIA 1MCKA 4OCRL 5D7IE 2WO3B 2IDUA 4JKLA 3IWVA 3JWNH 1FGVL 4UWQB 5FA4A 1SY6L 5FGBC 2QEJA 3MHZA 4N85A 1H9VA 3QRBA 3BSZL 5CD3B 3PHQB 4KOCA 4AW7A 3QCTH 1MVFA 1DVZA 5IEKB 1QR1B 2CIKA 3VU2A 3FH5A 4LKXA 4PRPB 2WW8A 1SYSB 4F7CA 5D4QA 1X6LA 1RUKL 1T6VN 5C0BB 4Z7IA 1KCUH 1F3JA 4LEXL 1MWAH 5JYMA 1AG6A 3IETB 4TUOA 4DZ8A 1NGWA 2PW1A 3P0VL 1QSFE 1SNRA 1SBSH 4W6YB 4BFRA 2WLNA 4QNPF 4PN6A 1KGUA 2VDLB 4GUCA 4YR6B 4NZRL 4AYBA 5CGYC 3BAEL 5J6SA 5IEHB 1JXJA 4UT6L 4GQ9H 4QT5A 1CZ8L 1ZA6B 2VSKB 4FTDA 1P7BA 3MROB 1W8EA 4ELDA 1I8IB 1D5XB 3HAEG 4I3GA 2PYEA 1YEDA 1JNHA 2BSRB 2CO7A 2Y72A 3CX5K 4NQDE 3GXDA 5ESQA 3V0VA 3PFUA 1TO5A 1B2WL 2A74A 2IXQB 2P52A 5C71A 3T0VA 3V10A 1KJ3L 3RA7L 1N7MH 5LDUA 3S0PA 2GFBA 1HQ4B 3DMMC 4GRLB 5J57B 4L3ED 3KPPA 5D1QE 1WFNA 3BLKA 5EOCJ 3VFSA 2JVUA 2NY4C 2P4AB 5BRPA 1TYEB 4ANKA 1DP0A 4OSUH 5KS9E 1M3JA 3VFUB 4B9ZA 4YK4C 4G6KL 4AC2A 1AGDB 5ESVB 4Z7OF 5DA4A 2FYYA 3FUKA 5IB4B 3GHEH 2NT1A 4P5SA 4KKLC 2DM2A 4M48L 3KPSD 4NOFA 3LHPL 1H5BB 3I9GL 4Q74A 4E5XA 2CLVB 1CFVL 1NEUA 5H94B 4HVBA 4XH2A 2FQFA 2W59A 3FRUA 4LHUG 1RIVL 3BPCB 3FCGA 2WNWA 1T3FA 4XZUA 4C56A 3IMUA 3U82B 3MOBL 4DUVA 5I74C 3IXTA 4KNSA 4RIRA 3BKCH 5J1SC 2IAMB 3EADA 4OZIE 1E8WA 4ZSOA 2DQTL 4DTGL 3V5DA 1YSOA 1G6RH 1YEKH 2VXUH 3MJ8A 3M88A 5IV2B 2YGOA 2APVA 5F9JA 1UXMA 5KVGE 1GOGA 3HFFA 3MUGB 3KPRA 3B2VL 4F8LA 1KYFA 2Z9TA 3FAWA 5TE4L 5IFHL 2BSSB 5EZJB 5CIPA 3UYRH 3HRZC 4WV1B 4KZ0A 4NXKA 5DJXB 3SDCA 2E9GA 5KVFE 3UTOA 4FNLL 2HVKB 1A1NB 2ZG1A 4KK8D 2XFXA 3D18A 5GRXG 1NIBA 1IZJA 3S98A 2EVGA 4JFHD 4RZCB 2DLEA 2GSGB 4OCSL 4JRYA 3MRGB 5HYJB 5LKNA 1OTSC 5E9NA 3EH1A 6PAZA 4NHCH 3FCTA 3TP4A 2IPUK 2RHEA 3ZR5A 3QULA 1W2KT 3VFRB 5E2VH 1JPTL 1XD1A 2DW5A 3WKNA 1UOLA 3ARQA 2R2BA 5JHLA 3QQ3B 4PJ9B 5ESAA 3L3IB 5ACZA 3CUPA 3UTQA 2D3VA 1T89A 2VLMD 3T5WA 2EZ0C 3CSTA 1QHOA 5J8OA 2ZF9A 4IGBC 4G43A 4JPKH 1J1PL 4ODBD 1EHLH 2FL5B 1HWHB 7FABH 5CBAB 4BKLB 4NEHB 2WQRA 3C5JB 2D3LA 1KNOB 4MB3A 4PRBB 2DWDA 4ZX5A 4FMKA 1TFPA 1MHEB 3O3DB 2FJHB 4AYDC 1SMDA 2WQAA 2CQVA 5G2NA 2DQHL 4OU3A 4I9WD 1T2JA 1U8KB 2KERA 2BY2A 3U0WL 5IUCA 3CGTA 3MCYA 1JGVH 4QAWA 1IGFL 3EJCA 2OL3H 1ACCA 3BN9C 3EYSL 4JREC 2VMFA 3GM8A 1OE3A 2PO6D 4QAMB 1RERA 4UZUA 5C3IA 1TJIH 1IQDB 2CLZA 2A4ZA 2PWDA 5FKAA 5HGAA 3KPNA 5EA0L 2WVUA 2WXLA 2CRMA 4J3TA 3MA7A 1JWUB 5I1EL 4WEBH 3RPKA 3AMLA 3OXSB 2R4RL 1PJWA 4JS7A 3SCMD 2C7UA 1BF5A 3WE1A 1YEEH 1QBML 4RGOH 2F54A 2EE0A 3FN0H 2H1PL 4HJGA 3QDMD 4LSRH 2I7SA 4N5UA 2GBUA 1UURA 1Z6JT 4YIQB 5DVOA 3L08A 2G9KA 2V9UA 3NUKA 4G8GD 1OB0A 4JBSA 4PJXF 1J11A 1DEEB 4WK2B 3P9MB 4YHLH 1G7IB 3DVGA 1N6QL 3H9YA 5HVHC 1MKFA 3T77A 2DN7A 1G9NH 1N70A 1T7VA 1FGNH 4YNYB 2HH0H 5SWSB 4NZFA 1KLUA 4NNPL 2YK1L 1NGZB 4M5SA 1ZE3C 1J8SA 4P48A 1AZZC 2DQCL 4BM7A 1T2QH 1F45A 1W0VA 1KTDA 4KKBD 5JIQA 3JTBA 4L48A 3EYUH 4UIKH 3VFOA 3OKKA 5I1AA 1RJYB 3QR2A 4OJFL 2PXYA 4JDEA 2YPKB 3W2DL 2C3VB 4JO2H 4HJ0C 1NTDA 2K4WA 3GT6A 4IU2A 4WWKC 4XPBH 3DX1A 1ZHBB 3KPMA 5KN5A 5LNGA 5LXGL 4OF3A 2DL9A 5MENB 1KJMA 3SKMB 4WQOA 4JFEE 4NP4H 4ENEC 4X6BB 4NQUA 2ZUXA 1FFRA 1PLGL 2FSEB 3HS0B 3LKSA 1PFOA 2Y36L 3PHOB 1JHTA 2YFOA 4ODTL 5C0RH 2JQMA 1KYOK 4NM8L 1T0NA 3G6JA 2XG5B 3N42B 4PLOB 2PTUA 2ZP9A 3L7EB 3W3BA 5J5EA 4L9LA 3SE3C 2KHAA 4UQAA 1Q9WA 4AIOA 1M57B 2BIIA 4WI0A 1L9OA 3NFSL 4GFTB 4PCKA 4OZ4A 3AG3B 1ZLSL 2CBTA 4K3DH 1AHWC 1KTKE 1OCZB 4IKKA 4NN6C 3ZGHA 3DXAB 2IG2H 2G3NA 2UWEB 3O0RL 1FORH 4N0CD 4UT9L 1JHLH 4RDBA 4NJ9H 5B1CA 4M02A 1OTUC 2DQGH 2Y7QB 3CFKA 2WKOA 4X8XA 5D6DC 2ICEB 3TBYB 1Q0YH 1FZMB 4FTVE 3UDWC 4IBQA 2P5WA 3I6SA 3NT0A 3PPSA 1HH9B 3FQ1A 1NGQL 2YD8A 4XN7A 3QQNA 1IIKA 1OCCB 1N26A 4BDVB 4PYHA 3KXFA 3LXUX 5KOMC 3IKCA 4KVPA 3FMGH 5AW2B 1ODAA 1KIRA 3FJTA 4LCCB 5C70A 5JXEA 5M95B 1RK7A 4B95C 1GTFA 1LDSA 1WIUA 1M56B 3WUWG 5DZAA 4Q9CA 5IBLC 3C6LD 1WD8A 4WJG3 3ZJAA 1U8MA 2OTWB 2B1HH 2UZYB 4HEPG 4RISL 5A1AA 1CBVL 2JKWA 1RFDH 4MA3A 4JB9L 4PMEA 4NGHH 2JK5A 2ZKYA 5MEQA 1XCQA 3VM5A 4YSOA 3TT3H 3SOBH 3ZUCA 2IPKB 3LVTA 5GGRA 1W8OA 1A7RH 2V2WB 3GMMB 4JLRB 5DRZB 1C7TA 1I1FA 2RGSA 3VMPA 1SJEA 5ICXA 3WHE0 1KCUL 2OW6A 2WZPD 4X8CA 4PV8B 3INOA 5GZOC 1MWAL 3L17A 3IE4A 1IM3A 1DQJB 2YC1B 1LEGA 2VIRB 4XXWC 5I16A 5J6GA 5EU3A 3L4XA 1ZSDB 1HCZA 4G1MB 4XP6L 2W9DL 3MNDA 4FLSA 4HJIA 5EO0A 3WIIL 2YEZA 2HFFB 3CZLA 3EUUA 4QRBA 5B3JF 1N0XL 1VFBA 2B4CC 3AQDA 4BZYA 1V5JA 2YPVA 3X14B 1IGYA 4X6CF 4CW1A 4BA0A 1H9DA 1FI8C 1G0XA 1V7MH 3LJ3A 4RQQB 3LKPB 3RNQA 4QRPE 4HOXA 4JG0H 4FQXD 1HL4A 4L8BA 4YXLH 1HEZB 5E2WL 3HAEB 3RWFA 5HHOA 1F3DH 3VXQA 4KKRA 2CO4A 5AVSB 4BQCA 2M1KA 1TPXC 3AT8A 1WZMA 4DKEH 2QSCL 5E7BA 1MIMH 3MRFB 1OAJA 4GS7C 4AL8H 5F88A 3D6GA 4L0YA 1OZTG 3SODB 3OMZA 3ZT5A 1RHHA 3UJJL 4X5WB 3O6FC 4AM0Q 1YECH 2FWSA 1EHNA 2R15A 4RNRA 3UABA 1RP8A 2J8UA 1CD9B 3JVGC 4CGTA 3IMBA 1AKJD 2OYMA 5SX4H 1R3JB 4BH7B 3MLUH 4O2CA 1NC4B 2SODB 3TBWA 3OKNB 3VI3F 4XNXL 1PFCA 2DTMH 4UDTB 4ESKA 3EF7A 3VFNA 4XNUH 4BE5A 4V1DE 3BAIA 4J3OF 4LHUB 5DUBB 2W92A 3ASNB 3U7YL 4B6ZA 5CR1A 2BSED 5D2LF 3TLRA 5CJ5A 2A73A 1G6RL 1E8XA 1ROCA 1YEKL 4J39A 4I9XA 2NYZA 4AC4A 5GGVY 1NCWL 3EFFB 5C08D 3TN0C 4IHOB 2X4UB 4NRXA 2W0PA 1SUHA 1ZXKA 4PTTA 4ZDHA 3L6FA 4XPGL 1CN4A 3V8OA 5C0CD 3BC9A 4L3EA 2B4CL 2OLDA 2M83A 4APXA 5IWLA 1P5VA 2Q3XA 5GGSB 4R2GB 3HI1A 5DJ0A 3BP7B 4WVRA 4ODWB 2Z31B 2IV8A 4TVUA 3DI3B 3QR1A 2VMCA 2PETA 3KPSA 4N20A 4U6YB 1VGKA 1JJUA 4MQ7B 2BW5A 2WTOA 4N8VG 4ODHL 4AQAA 2R69L 2XXCB 1KYUA 1IC5L 1NC2B 5DWPA 4N8CH 5I73C 4FA8A 5G5DB 4MJIB 2EEBA 2XTJD 1KLFB 3IJHA 1SJHA 2HRHA 4HSQA 2L7QA 3HCVB 4LKCA 3OF6A 4M7KH 2XTLA 1YN6A 3QJHA 3KPQA 5JIPA 1V05A 2IDFA 4I0PB 1ZVSA 7CGTA 3GRWA 1DQMH 2OMYB 5HSFA 2E27H 4X9HA 1JZEA 4F33A 4JM4H 4MB5A 1E67A 1FG2B 4J27A 2NY0B 3BESR 3FO9A 5CSZA 3CVHH 1E6JH 4PHXA 1IQWL 1TZAA 1TU2B 4Z5RA 4F8TA 7FABL 3TJEL 1FRGH 4K3JH 4YWGL 4KX7A 4MS8D 2F53B 4PJ7B 4A68A 4X7FC 4QD2E 4MMXA 5JDJA 3BHBB 1HL8A 3UBXI 2HJFB 3PP3K 3T09A 3TONA 4H25A 1MVYA 4M4RB 1X7TA 2G30A 4PTUA 5AW1B 1J0KA 2Y6SC 2EYTB 5DQ9A 4YFEA 4CBZA 1FHNA 3G5VA 4HUMB 5GIRA 1NCBL 2Z7WA 1AZCA 3WKYA 3NA9H 4IBLT 1TT6A 3K2MC 4H88L 4BQ8A 4EIUA 1AGBA 2VXVH 3GIVA 4L5FL 1TJIL 4GAJH 2X9WA 4FYQA 1A14H 3QNYA 3V6OA 1KULA 2XBDA 3NEOA 1KJ2L 4MXQD 4WEBL 1FDLH 5BVJB 1SPDA 3NIGF 2GC4C 2ENSA 2GJ6B 5E9DB 2VC2B 1KBWA 3BAJA 3HVDA 3PREA 1MFCL 1YEEL 3NIDE 4A2HA 5ALCL 4RGOL 4YDKH 3B6SB 3V4PA 4PJ8D 1JCVA 2CCWA 4Y4HB 1EANA 1RULH 4LEOB 1G7PB 1TVDA 4EZJA 4YZFF 1AHMA 1DN0A 1YJDH 3RUGB 2WLKA 4YHLL 5BS0D 1JZFA 4HETA 1CG9B 3O81A 3U9WA 3W57A 5F8RC 1T0MA 1ZA3B 2HH0L 2V4LA 1SVBA 5I1DB 3GBMH 4X4YB 3Q8EA 2H6OA 4L0PB 3LPGA 4Q14A 3CBKB 5LWYH 5C0EA 3B9KD 1QRKA 3AS0A 4KDWA 5JHBA 5ISZA 4LCWB 4N2EA 4OLVL 5CCKH 1KLGB 2R1XA 2R56L 3FHAA 3IDIA 3N43B 3QUXA 5DK0B 4AJVA 4WNQB 1RZ7L 4Y5XC 4HCRA 3HNSH 1U21A 4JO2L 4J8RA 4OCNC 5IIEB 2HFGH 2DEXX 4ZAKD 4A2FA 3IDJA 2ZOOA 5CEZH 4XPBL 3SOTA 2PO6A 5AKVA 5CMAA 2R0ZH 3NP3A 2E8YA 3K91A 1MUJB 4U1JA 4Q6IB 1K5WA 1OEZW 5C8JA 2YGQA 2ZX8A 3LV3A 4ECNA 4BFIB 4H20H 3EFDH 2BY1A 5C0AB 3DNKA 1FSKC 3GJFB 5C0RL 3SCMA 3QZNA 2PP7A 1Z32X 3AU1B 5KSAC 3Q9PA 3I9AA 3LKNB 3PWUB 5EBLA 1NWPA 1NCOA 2ZWYA 3QDMA 2PKDA 5A6MA 1XL6A 4RBPK 1UZ6F 1Z3RA 4ZMXA 4G8GA 1KIPA 1JZGA 3AU0A 5CU5A 1CO1A 2F1BA 1XIWC 1W15A 2BXZA 4X4XB 1J9CT 3QT2A 2QADD 2I85A 3VD7A 1M05B 3OSKA 1RK1A 3CMGA 2DWYA 2EDHA 3MKGA 2ETWA 2IG2L 4POZD 4BSWA 2QELA 1K9TA 4PJ5A 1FCCA 3D2UD 4LZKA 2X6MA 9CGTA 3G9AB 2OK0H 3QPXH 2QVIA 5EN3A 1M7IA 4FYSA 2HRPH 3ZYOA 3I6LD 3JV0A 4HOWA 5F7UA 4BELD 2AXWA 4WUUE 3L54A 4QRTB 2AERT 4BQ9A 1AACA 4KI5C 4MYWB 3RWHB 4KQ0A 5FECB 1HI6A 4LF3A 2FJFB 3MGAA 2AJSH 4EUPA 5KG9A 2EO7A 1CS6A 2EAEA 2HA1A 3I6GB 3PWVB 5GS0D 1L9SA 5JLZA 4Y2LA 4NUMA 1LEKA 4PJAE 4HKZA 1BQKA 3AB0C 3FH7A 4LLDB 3VD0A 1YYMH 3F85A 4O2FB 4MTMA 1QZNA 3STZA 3BIBX 3PNWA 2AXFA 5E6ZA 3WUWB 4FA6A 1J9SA 4NGHL 5DEGB 1WC7A 4NT6A 3IFLH 4KJPC 5ICUA 4JFPA 4KC3B 3TT3L 3IJ8A 3SOBL 2HG5B 1J8HA 3AROA 3VGAB 2ZXQA 4PIRF 3V0HA 4GUOA 1SOQA 1J0IA 3SDXA 1QHQA 4NN7C 3ZZ1A 3QQ4B 4C4KO 4WDIB 1ORSB 1SQMA 4GLRI 1CLZL 1U2CA 1XCTA 1TKWB 5JYLA 4G8EB 2Y06H 4MX7A 1UVQB 2DPKA 4PV9B 3MCG1 1BHGA 5C9JB 2G2PA 4HW6A 2WBJA 4NIKB 2ZSVB 3VXUA 5K5YA 2DD8H 2OKMA 2VE6A 3UMTA 1KGCE 1DVFC 2RAMA 4FTVD 2R7EA 2MQ0A 2E7LC 4UTAL 2ZAGA 1DUZB 2XN2A 3MLZL 2IH1B 2FIRT 2YD3A 1F3DJ 2BIQA 2BS8A 3BX7C 1CLYL 3SPVA 4YXLL 3ECBA 5HY9B 2IANB 2NY2D 2BXYA 2DQUH 4KTDL 3C6LA 3W56A 3V6ZB 5KYYB 1JGUL 5CJXA 4D9RE 2VISA 3L9EA 2IPTH 3SPJA 4ALAC 2I9TB 5D1XC 4S2SA 1CICD 2BFGA 1F2XK 3HZMB 2B2XH 2NSMA 5IY5B 3OAWA 2A6IB 5FO2A 1MJ7H 5EU6B 1H6EA 2F1EA 2JJSC 1AO7E 1OHZA 1Y7VA 3E3QC 4E9WA 5LJYH 1A6AA 2WZPA 5FXCH 3VX1A 1J5HA 1QLRB 1S7SA 2VITB 2G4GA 4D0CB 2DTML 2H3XC 1AFVH 3VXPA 3CVIL 1DCEA 4HULB 2D03H 3LCYA 5I66B 2HKHL 5ID1B 4X8JB 2XY2A 1XSKA 4DK6A 1P7QD 5CILH 2A3TA 5JTWA 3O3EA 2VAJA 5INDB 4YHKH 3KLHC 3ABKB 4G80B 4BZ1L 4W4NA 4MAZA 1TUPA 5FYJH 3OAZH 4FQXA 3GS7A 4G9FD 4OFVA 3QORB 4Z3IA 2Q76B 3SO5A 4P4KB 3QZOA 5HJ3A 4B27A 1UM4H 3ZIMA 1S9VA 4APQD 3QDJB 2QPSA 3MJ7A 4YXKH 3VRJB 5F9DC 4J4PD 5ENWB 4JDVB 4OIFA 1V3LA 3PGFH 3VXRE 2AF2A 3TURA 3ILPB 5I0VA 1C5CL 2UZXA 1DCLA 1WBYA 1BVLA 3QXAB 4FA7B 1LILA 3M17A 1AKJA 2YRZA 2J57A 1ZV5A 4ALAL 3BWAA 2H5UA 2WZAA 4PCYA 4M7KL 5F1NB 5IVZB 3FO1A 5KBDA 4N8VB 3I3DA 1FFOB 4NKMA 4XHJD 1A3ZA 4J12A 5HHXH 2ZONA 4Z7WE 1QSFA 4LDEB 2E27L 4J3OH 3TO2B 1JFHA 3FT0A 1I1AB 1R3KA 5AALA 5E8OB 2BSEA 3ESPA 3VWJA 1DJWA 3PDOA 1IVLA 2NY7L 3WI9A 4ONOA 5I2IA 1HN1A 1MG2C 3E8VA 3IWUA 4RWYL 4F92B 4FQQB 4N1CA 4X7CC 3HN8A 3MBED 4FKEA 4DP4X 3RDTC 4KAQL 4WTZG 4K3JL 2A2QT 2X53A 4JZOB 3ARPA 2YAEA 4TL5A 4NQDA 3IN2A 1E30A 5JXAH 4OCWH 4LSDA 5IGXH 2B39A 4LPYA 5H2BB 4GXVL 3TBTA 5GS1C 4AQ8A 1ZLDA 1S9WA 3L9YA 2OSYA 3IF1B 4KI1A 4NDMB 4XMKL 5D1QA 2FZ3B 2QVTA 3EOAA 2VDQH 2NYYC 2B20A 2H32B 4JDZB 3VX0A 5KS9A 1UM5L 3KW7A 1AS6A 2F5BH 2FQEA 5IBTH 1NUDA 3T2NH 1EZSA 3MLRH 1J9QA 2CMRH 1WSST 3T4AC 1YQ2A 3NA9L 1I9EA 3NJXA 3S5ZA 3W39B 2CXGA 5JHAA 3UZVB 4N0YH 1GC1C 2GBTA 3EHBD 1A14L 1NUNB 2DTSA 2P26A 4EXPX 2WVVA 1SF5A 1TZIB 1I9IH 4A2EA 3R0NA 2AS5M 1ZSHA 4MJ6A 3DI2B 2FEEL 4MXWL 4XNQA 3CDYA 1M1XB 3QC6X 3GZPA 4PBVC 1OV8A 5F7YC 3MYZA 4RMUA 4KO6A 3N41F 3MREB 5A2KH 3FFCB 3WTYA 3JTTA 5KSBE 4ZUVA 4OZIA 2OSXA 2O30A 1HWWA 4AOFA 2FX7L 1RULL 3B5TA 4F7EA 1GGCH 4GG8B 1GTNA 1B0WA 3H55A 1AD0A 5JQHC 1YJDL 1JK9B 1JNLL 2YWZA 1KCWA 4Q97A 4AVJA 5D7SH 1NUGA 1IFGA 4GB9A 3T65A 3JWNE 4W9HC 3VG0L 3DBXA 2VXQL 2Z7YA 3FB7B 1UC6A 3MV8B 4BSJA 2HJLB 2FT6A 4QTFA 5FUCC 1C12B 5T3ZL 2KPWA 3WFZA 2ODIA 3OLDA 3DVIA 4LARL 1FIGH 1I53A 4LOFA 3V4LA 4TSAL 3W81A 2NQDA 2BVUA 5DZLA 3K46A 1N6VA 2RQEA 1CCZA 3HNSL 4U0RB 4XOCA 2VDPB 2HFGL 1KCVH 1JXKA 3HG0A 3H3KA 3IJEB 1L5GB 3FOMA 3JWOH 1LWRA 5F44A 1X9LA 4NQTA 3KHQA 3SGEI 4M4PA 2C3XA 4CC4C 4L8CA 5KBLA 1S7UB 4P23C 1LDPL 1ZLWK 1HXMA 2V2TB 5M94B 5LBSA 1UWYA 1GC1L 5FKPB 4H1LA 4OT1L 1MG3C 2LABA 4TMPA 3FRPA 4AQZA 2OJEB 4PJ8A 5EBWA 3O4LE 1PCXA 4JKKA 1BA9A 2BRRH 4TV3A 2G5BB 4PJEE 4K8RH 4BFEA 2WNXA 3CFUA 3CSFA 4QRUA 2D7TH 3H2PA 3PFQA 1AYRA 4P5RA 4Y2DD 3UAEA 3ULSB 4XXCA 2W9EL 3M1BB 4XMPH 3RNKB 1OCOB 1WH0A 1NCUA 1FBIL 2RJMA 2WN3A 4J7RA 3B9KA 1A4AA 4AZ8B 3QPXL 3EH5B 1EEYB 4YSRA 3ARDD 5JW4N 1MQ8A 1URLA 2N3JA 5FFGA 1PIGA 4ZAKA 3KCWA 5EU4B 4QUOA 3DYOA 4KRPD 4N9GA 1YC7A 1I31A 2WUBH 1E2WA 1T1ZB 2WJ5A 3C5ZD 5CWSA 1MCFA 3HMWH 2PTTA 2H0EA 4KVCH 5DFWH 1H6TA 5DJZA 4H2CA 3ZDYE 5JW5B 1M6UA 1AXSA 4AENA 4F2FA 1XQ4A 3SEPA 5IJVA 2H47C 3M45A 3B83A 3QFJB 4HH9B 4K94H 4XNMB 4ZMVA 3VFMB 3UOAB 5D71L 5AZUA 1NAKH 2BVPA 2WSDA 3I6KB 3BXNB 1P5UC 3PJSA 4XODA 1NL0H 1A8ZA 4MAUL 2CKBH 2ZOKA 4I2XE 5TD4A 2FEJA 1MFUA 4X0KA 4XRCA 3X13B 4YSAA 1X6NA 1SLUA 3NJVA 1WFJA 5E5MB 3U9PH 4GAYA 1D9KD 5J1AA 2FT7A 3HE6D 5F7LB 3JXAA 1ZJAA 4UV7L 4AEIL 4M5TA 1NGXB 3CN3A 4YE4L 3RL2B 2VTFA 4N9OB 5C3LD 3U6RB 4QJ3B 4JFDD 3D2UA 3IPBA 3RVVC 3UAFA 2BSDA 2BW4A 5BO1L 2EE2A 2D0GA 3DRQA 1J5DA 2JELH 2DD8L 2IMMA 3GMQA 1MXDA 4MA8H 4RGNB 2X4OA 1ASPA 4HF5H 3PL6A 4R7DB 3G7TA 4OQ1A 1U33A 1GGBH 2EADA 4ZFGH 4OCYL 1QNZL 4Y1TA 2EDOA 5GRJL 2X4NB 5DUJA 5I6KA 1I7ZA 5AOLA 5KVEH 1I1CA 1U3NA 4G6JL 4KQ4L 1EGJA 2X9YA 4XAKD 5AOKA 2NX5E 3AWFA 2DQUL 4YHIA 3PS6A 3DX3A 2XLLA 4LOVA 4JFEA 1BSIA 2WAHA 1OW0A 3MLVH 1IAIM 2GJJA 2HWZH 1TVBB 4GMTL 4XMXA 3ZE1E 3FO0H 4ZUWB 5DS8A 5IQ9A 4CVUA 1XGYL 4PJCF 3RHWK 5E08H 3S34H 2QVKA 4IRJA 5DD6B 3D25B 1G1KA 4F27A 2VN3A 1UWFA 3K72A 2R0KL 5CGYD 3O41A 2APBA 4XB3A 1DDHA 1BXXA 1UTDA 1CYXA 4G7YL 4RESB 2K8QA 5DC4B 4UQ3B 3WLWC 1OXYA 3PU7A 4MAYC 3VD2A 2YR3A 4AT6A 1H8OA 5GGTA 2D03L 4CNIB 5B8CC 3MV7D 1CFQB 4HHGA 1X9RA 3T0EE 3NTCL 4BSVB 4FTVA 1ZHNB 4PY8I 3DMMD 3ET9F 3PXHA 1KGCD 1M71B 3QI9C 4L5FE 4MJ5B 3ZZQA 1KGWA 2DZEA 3RVXC 3W0WE 4P9MH 5FYJL 1AMXA 4Y5VC 3A6CL 4JFOB 3HN3A 1IGCL 4YSEA 4OKVB 1LE9B 4KKLD 2A77H 2NR6D 3OR6A 3TBSB 2O26U 1COBA 2W1NA 4K3EH 1N0LB 3FXIC 4OFIA 4DP2X 3LIUA 2WWOA 3L48A 4ELME 3PGFL 1CICA 1CFTB 1NCNA 4D9RD 2VO5A 4R6UA 5EFIA 4PRNA 1LP9F 2FT8A 3L9BA 3VB8A 1TYJA 5AD0B 5E6SB 1XF5A 3QUKB 2B77A 3CZJA 1A6PA 5E8NA 3CHPA 1RZGB 1MRCL 1LO4H 3HG1B 5CZRA 4Q8BA 4QI3A 3FT2A 3SKJH 4LBEA 1KPVB 5E1HB 5IK3B 2XWBA 3ARFB 5CHNB 3S35L 4KJYB 4IRSB 3VG9B 3H4FA 1SYVB 3CSPA 2Z4QB 5IQOA 1UA6H 1P7QA 3MUZ1 4H8QA 3D48R 2IBBA 1TZOA 4X5QA 2AXJA 4HFUL 4RX4D 4ACTA 3D85D 4QO1B 3BEVA 4ZT1A 2MIZA 2OTUB 2YBRB 1BQHG 3QG6B 5JXAL 5FYKL 2X3CA 2WSKA 2LGNA 4QRPA 4Y7OC 4JM2A 3UAJA 1G7JB 2Y3AA 3HZKA 1OTSD 4APQA 5FPIA 4CN6A 1E9OA 4PP2B 4S1QH 3S6CA 1INDL 1M6OA 4WEMB 3TBCA 3F7RA 1WG3A 5GRYA 1P9MC 3DVNB 3BKMH 3IFPA 4H2AA 4PRIB 4KKAD 5IBTL 2JF1A 3KPOA 3MLRL 1S9KC 2CMRL 1F4WL 5JR1H 2WCPA 1MI5D 1IEHA 2H2PC 4R0LC 4KZDL 4BXSV 3GLDA 1XF3B 3BP4A 3ULUC 3OGCA 1XH1A 2ZYIA 1VACA 1I9IL 4UNTA 3DV6A 1KACB 2WQ8A 5I30H 4IGBD 2NY3C 5LGKA 3MGOA 1CFSA 3JBG7 5DLML 4M61A 4M29A 3BVUA 4Y16B 4HPHA 1VFAA 1ZT1A 4V1DA 3RFRA 1R6VA 5FEBA 1EZVY 2HVBA 4TQEH 5FA4B 2CHXA 1D7BA 4HPYL 2JJUA 4XCCL 4HWEL 3OG6B 3CX5J 1SJXA 1RLBA 2FBRA 3OD3A 4IOIA 4E41D 4OJYA 1TVHA 4LLUB 1E9QA 2CIKB 4P2OA 3LB6C 1DSYA 1G4MA 1U8QA 3FU7A 2VDNH 3S2CA 5I1LA 2C4FU 4F7CB 1DVUA 3WFEH 3OHXA 5AAMC 3MJ9A 1OGAE 4DH2A 4FFZH 4IHBA 5C86A 1SOSA 1F3JB 3N44F 3I02A 1FIGL 4GUPB 2OCJA 1Y1DA 1SJVA 3PWJB 2PPFA 4OKDA 8FABB 4AV0A 1GJIA 1KB5A 3SGJA 2KQMA 1KCVL 2Q3ZA 2C9VA 4D2NA 5HHMB 4ENZA 1WAAF 2FD6H 3F7YA 4PVMA 4B9FA 1U3HC 3QO1A 1FG9C 4AKOA 5DUPL 3S8FB 3D7PA 3VWKB 3BUDA 4I5BB 1RPQA 4W9GC 1QZ1A 1Y18B 2C4FT 4QT5B 3KYOB 2X2JA 4U1NB 3VXOA 4NO5B 3UTSE 1DYZA 2YD0A 3MRPA 3P73A 5EZLB 1YEDB 2WBXA 4FRWA 1VEPA 2WNGA 2A74B 5AZEH 1IAIL 2APXA 2WHVA 1CDYA 4NRYA 1GGIH 1QSEE 1B88A 3ULUL 2GFBB 2Y07H 2JJVA 2A4EA 5DHVB 2BNQE 5BZWB 1FZJA 2P7TA 4WW2F 2BRRL 3LYRA 3D69B 3L3DA 3RIKA 5I28A 3DSNB 3CHRA 1HHKB 5K69A 4OTXH 3CDFA 1TJHH 1BOYA 1JZJA 3PJNA 4CKQA 1FN4A 3BPLC 4KI5E 4HJ0D 4JPSA 2QSQA 4WWKD 15C8L 3F04A 3GPEA 1BD2E 1AQKL 3RIFK 2KH2B 3FRUB 3OMNB 2CHZA 1QHPA 4I4WA 2E9WA 4IU3A 4XZUB 5C07D 4ZTPL 2V7HA 3IXTB 4RIRB 2WUBL 4LCYB 1CD1B 1H3XA 2FBJL 4KVCL 4ZSOB 4ES9A 3OX8B 1J7VR 3V5DB 1NAMA 1XMEB 2RCSH 2RA1A 5HHPA 1XWVA 3L1GA 5F9JB 4DO6A 1JZ3A 1Q9OA 2EDYA 4M93B 4UM8A 2R29H 1GZHC 1NAKL 3KPRB 2VN4A 2XQYA 2Z4TA 2ZNWA 2Z91B 1IMHC 2CO2A 1E28A 1E9PA 1TQSA 4FNQA 1QD0A 4R4FH 2YXWA 4Y89A 1JERA 1NCJA 1S7XA 3SN6N 5LHDA 3FT1A 4MQXD 1OTUD 4HEME 4YHML 2J5WA 2IH3B 2AQNA 3EXLA 4QY8A 2XFXB 2NQCA 4UDUA 5D4HA 4YX2H 3EGDA 3RGBA 3VUAA 1BF8A 1O7SA 4U1HA 5LDSA 3D0LA 4JRYB 2IOMA 3KLKA 1ICTA 5LAXB 2YUXA 3ROOA 1ZLUK 3IEAA 4PS7A 3ZYJA 3HC0A 3FCTB 3TYFA 4N0FA 1IFHH 2WQWA 4MA8L 3S3DB 4OGXL 4HF5L 4NUJA 3PAUA 1WCQA 1GGBL 4MD0A 2XKUA 4ZFGL 3U2SB 5B3NA 5IBLD 4H0LC 4D7BA 3QJFB 1YYCA 5ACZB 1O7DE 4OZGB 2YAPA 3C5ZA 4HUXA 2KBGA 5D4IA 2ESVE 5KVEL 1B0GB 1B4JL 3W38A 3GSOB 2NXZB 4X80L 4GOSA 1D2PA 3H3BC 4G7VH 4G43B 5FGRA 2E4TA 1M4KA 2JB5H 2WXFA 4CC0A 2OULB 3S3JA 2I25N 2HWZL 1CFMA 2FWUA 1EEQA 3K3QA 2J56A 3FO0L 3ZHKA 4O5LH 3UTTE 4PG9A 5GZOD 3ETBF 2UY6B 1BVZA 2DMKA 5E08L 3QBTB 5SWQA 4AGQA 1D9KA 3S34L 2J5LB 2DMHA 3APMA 3H7LA 3HE6A 5I1GH 4QRRB 4M7LT 1G7LA 4B50A 2VLRB 1C08B 1MSPA 3AAZA 3T3PE 4JFDA 2QQKL 3AACA 3FKUS 4XPHL 4Z0XB 4JFUA 1VDGA 3GSNB 2CLZB 3KPNB 3VQLA 2ZUTA 4D0DB 1VB9A 3JYCA 3C75A 1YY8A 1S5HB 1A65A 2QDVA 2XN9D 3MA7B 4XBPB 4QLRA 4JDTH 4BEIA 3CPLA 3BVNA 3FOLB 4K23H 4TS6A 4MBRA 1PZSA 1NIAA 2X6UA 3VXSE 3MUUA 4WUUA 3MRNB 4P9ML 3N2JA 2NLJA 4PWFA 4HJGB 3BAYA 2EVHA 2JCCE 5FO9B 2ICES 2VR6A 4R83A 3T0AA 4C4KT 4Z7UF 1C1EL 2W60A 3E8UH 1LO2H 1PZ2A 3DVGB 4IBZA 4BA8A 1KYOJ 3EKCA 4PJAA 2NY1C 1HL9A 2YO3A 2LR4A 3FW6A 2YOCA 1E4JA 2DYPA 5E1IA 4DOHB 1PU0A 2CALA 3GXUB 4GKNB 2FYVA 1W0VB 3FU3A 1KTDB 3FUJA 5AYQA 1VZIA 5I8CA 1P4IH 4QF1A 1UENA 1SZNA 3OKKB 5I1AB 3WJLA 2R83A 3RTQA 3O6KH 3VTTA 3DX4A 3PWNA 2XVBA 3MV01 3DJZA 5HI5C 1FZKB 3QDGE 4FNPA 2MQGA 4XMLL 2GKIA 5T3ZE 3TN0D 3GBNH 1OARH 2AI0L 1DBKH 4OFYD 5H35B 1KJMB 5DJ6B 4F2ME 2FECI 4B97A 4GG6F 1UA6L 2A9CA 4JO1H 2DQDL 3LKSB 2W80C 5LXVA 5EC1A 4JVUA 4AUJA 5L2JB 3A67H 1T0NB 4MMZA 4Y2OB 3L3HA 1N64L 4MDIA 1UXWA 4PJHE 4RMQA 3W0WD 4L9LB 2YXMA 2NR6A 3GSQB 4R7NA 2IO5A 4YL9A 1RVFL 4KUCF 2VERA 1BQHB 2G0LA 4P2QD 3UJTL 5EF1A 1BFOA 2FDBP 1LO3L 2CJ3A 4NHUA 4G6AC 1YAZA 2XETA 5GQBA 1NICA 4BYHA 3CFKB 3BKML 4N87A 1B4RA 2VLKD 5AB1A 4HK3N 3DROB 3NN8A 4U49A 4MKTA 1MN4A 4NKQB 1NBZB 4Y1AD 5F3BA 4P5TB 4WJ5A 3SE8H 4NQXB 3S5LA 4HQQH 3RHWF 1AO7A 4AGOA 4YMPA 1QYGH 5E8DL 5KSUA 2ZUUA 3Q01A 4F37F 1ORQB 2IALA 3PRZA 1INEH 3M6DA 4CVXA 4GEJA 3LEVH 3DIVA 2BP5M 3U6XS 2Y1VA 1R0AH 1KIRB 2K8MA 3H9ZA 5AG8A 5FUCE 4Q4IA 3BFOA 4YHYB 5HVGB 3TXAA 2COVD 2ZCLH 2QQLH 4RX4A 3C9NA 3D85A 3RPBA 5MEQB 4LU5H 2Y6SD 4S1DC 4I3SH 1NMBH 5F0LB 2VDNL 1E5UI 3NZHL 2WLJA 4WGWB 1MH5B 4XN4A 1I1FB 3BGFC 1VJSA 1S7TA 4PYGA 3FQXB 5ICXB 2AJZA 1GIGH 1U8JB 5HXMA 5DXWA 2Q1EA 1OALA 2QKSA 4JZJA 4G8IA 3HS8A 3UBGA 4O02L 2DQIH 1IM3B 1JYXA 1U58B 1CF8H 4RDQG 1G0YR 4ZYKA 3PQYD 1I7TA 4W4OC 5AVXB 3VXRA 2HFEA 2FD6L 5EO0B 5ICZA 1RCYA 4ZUTB 5TF0A 4ODSH 4X6EB 5KBPA 3C2AL 4U3SB 4GIAA 2GJZB 4U1IA 3D05A 2HPOA 4IGBA 5E70A 1IGYB 1C8QA 1QQDB 5EORL 4WI7A 2EYSA 2Q7NA 3B4NA 4H0GA 3RWFB 1B6UA 1DVYA 1Q1JH 3HHMA 4QRAA 4Z7WA 3VXQB 3MOAL 2WXGA 3Q3GB 4KPHH 2P42B 4OAWB 1WO2A 1Y1UA 1URZA 3FBQA 3RY6C 4OTXL 1S9XB 2N1TE 5ID0B 3DETC 1GHFH 1F3RB 1OD9A 3F7PC 3CBJB 3CDZA 3JV5A 1OK0A 4RNRB 1OAQH 2CKNA 3TA3D 4MCYA 4BD4A 1C5BH 1TTCA 1U91B 2X6AA 4O2CB 2F58H 2PUQT 3HI6H 4YUEH 4UTCA 1OGAD 4HUWA 2DQEH 1PZUB 4EN2A 5IW6B 3EH3B 4DGUA 2ATPB 3U4BL 2DQJH 4IKJA 1EZVX 3MRJB 1F6LL 1AQDB 2QR0A 4PRAB 3GYRA 1OCRB 1S5IL 1QKZH 5KSAD 2CBMA 3QEQE 1J10A 5IESH 4UT9A 4C54A 3PWLB 1ID5I 4B9CA 4Q2ZB 3CD4A 5CEXA 5ECJE 4JFQA 1XAUA 3LZRA 3UTSD 1XIWD 4BRJA 5B3JE 4I3RL 4ZDHB 4DN4H 3VSTA 4FERA 4L3FA 1O7VA 2DBJA 4L3EB 4EMZA 1EBAA 3W5MA 2AC0A 1UJ3B 1L3WA 2AAVA 1QSED 3L13A 4KTYA 2AMGA 3N6YA 3FQRA 1LK2B 3MSPA 3KS0H 5FYJE 3RRQA 3VFPA 5KSBA 5EEUA 2VDMB 2EINB 2AQPA 2VUYA 3AQXA 1KWGA 2BNQD 1O9ZA 2VZTA 4YX2L 3HI1B 4QYAA 5H37A 4JHWH 2WOYA 1K3IA 1VGKB 3DO4A 3TVMC 3BT2H 3ZDXB 2AJUL 3AREC 3N42F 3SBWA 1I3UA 4OF7A 4ZW6A 2P9RA 1LK3L 4KI5D 1I8KB 2V7NA 4ZX6A 2ZWZA 1GW6A 3IJHB 3U0PB 3NYKA 3SKOB 4DGYH 1N8OE 4LKCB 4W9DC 1YN6B 1BD2D 4PWHA 2WSPA 1NCIA 5C07A 2TSAA 1NH6A 2B59A 4PG2C 4PJDE 1M53A 4RSVA 3BJLA 3UO1L 4F33B 5CFAA 1T04A 1MHCB 1RHFA 3FO9B 1MWAA 4NNXA 1XVSA 4KJPD 1Z66A 2XPGA 3GTNA 2JB5L 2PWFA 2XVGA 2W07A 2OPCA 1A3RH 3W9DA 1EZLA 1WK0A 3NCJH 3QNXA 2YD4A 1NDTA 2V2XA 5AW3B 2IDCA 2OP4H 1P4BH 3WIHH 2YJLA 1NCHA 1OT4A 2KKQA 3D9AH 3L95A 5E4EC 2X2IA 2WXKA 1G7MB 2AK1H 3Q2CA 4WI9A 2UUDK 3G5VB 2XX0A 4KMQA 4AVHA 5MI0C 5GIRB 1DVFD 4PJEA 1XH2A 1BBDL 2I5YL 3D4CA 3EJRA 5I5IA 3DHPA 4G8AC 2BCKA 1H8NA 1D6VH 3F3HA 3GIZH 1N59A 3GIVB 3QUMH 5K1VA 3ZQWA 5J4MA 4KFZC 4W9LC 4QLWA 4XN1A 3L4ZA 4D0BA 4W1TA 3CHQA 2ZX9A 4B3EA 2QVMA 2FWLB 3CXDH 5F9OH 2EUZA 2FB4L 1JGDB 3RIFF 1FHGA 2QGCA 2X9XA 4K23L 3TNMA 4HLZG 1N10A 3U4EA 1PBYA 4KWUA 1ILUA 4U3XA 3IRPX 5I8EA 1AKPA 3V4PB 3BYYA 3O6ML 2WLHA 5TFSL 4K2UH 4M8QA 5CLYA 3E8UL 4P2RB 1FV1A 4ZFOB 1CLVA 5C0FA 1OOAA 3IVKA 4LEBA 5JPNA 1MW1A 5AEAA 5DK2B 2ZUQB 3X11A 5GZOA 1G6RA 4HS6B 2JJWA 3KMDA 5LUMA 3B37A 4XXWA 2VZVA 4N2GA 1E8ZA 3Q48A 4XNZB 3WAJA 4D3CL 5IB2A 5G4OA 4I2XA 3UTTD 4RGMB 5EOQH 3DURA 2R1XB 2OZ4L 3A3YB 1OSZA 1JF1B 1PD6A 1JZ2A 4MGXA 5FUZH 1T22A 5CCGE 4BFGA 1BQ5A 3D52A 3NH7H 4KVNL 2VERN 4J8QA 5HDBB 1PDKB 4PS3A 3GBNL 4HX1A 2ZXAA 3VRLF 3KLHD 1ETA1 4U1JB 2HLFC 1JNJA 1JRHH 2WBWB 2A83A 3LV3B 1BFTA 3FRPG 1HVXA 4WHCA 3IAGC 4OI9A 2VL5B 4DWHA 1VLXA 4HCGA 3WL9A 2R69A 5EBLB 1OO2A 2NZ9C 3GMRA 1VFOA 3NIGE 3MRQA 1I85C 4KXBA 5F1OB 2VDLH 5DMKB 4R26H 1IUZA 5J11B 5A2BA 4EF3A 2NX5A 4WO0A 3HIZA 2BWQA 2DICA 5ADOL 3JVGA 1MDTA 1RK1B 3EUDA 4I87A 4JN1H 4L4TE 1O5PA 3F65A 1FL3A 3X3FH 3ARTA 4HXAH 1M7DB 5FA3A 3FCSA 5IMMA 1M7IB 3BZ4B 1QACA 4LVHC 4RRPG 5I18H 1KF9B 4HQQL 4JE4B 4OGAC 4OBSA 5L0QC 1OF2B 2VH5H 1QTPA 4B60A 2B15A 4IIQA 4ZXBA 3R8QA 2YPLB 1UJTA 2BH0A 4Y5YA 1HI6B 3QDGD 2DOCA 4LF3B 4OFYA 4A6YB 4EUPB 3QZWA 5T3ZD 4GSDL 2NUTA 3FTXA 4E9LA 4G83A 2BHUA 1QEWA 3IU3B 1LEKB 5HYQA 1WISA 2LW3A 2HG0A 3L1OH 1XGRA 4L05A 3T0EA 3ETSA 5HDLA 2AHIA 1T1YB 2E6JA 4P9HC 2QQNH 2OL3A 4ODVL 3V0WL 5DC0A 2GCYB 2AJVL 1LNUA 2AXFB 4FLQA 3DPBA 4LU5L 3QYCA 2KDYA 1P4LB 3W0WA 4I3SL 2NYYD 3BVXA 4KX9A 1KJ2A 4Q6KA 1LD9B 3RKDC 3SDDC 2HLAA 3MYJA 3QEUA 1VKXB 2AW2A 1LWHA 2K3HA 3ZW3A 4NQVB 4G8FA 1GIGL 1KC5H 3CZEA 8CGTA 5TE6H 4LSVH 1MXGA 3ETTA 2WCGA 2YA1A 2HPTA 2VJXA 4KXZI 4M8VA 3NJLA 4MX7B 4PJ7F 3N55A 1KWKA 4MWFB 2QV4A 2VW4A 3QIUC 4ELMA 4PJFE 4Y1AA 2XICA 2BIMA 4YDJA 5AVTB 3UX9B 4ZMNA 2VE6B 4ODSL 5FS5A 2H0PA 4IDLA 2BOBA 1RL1A 1Y0LB 1EFXA 4NO3A 4OZHE 43C9B 4GP4B 4ZX3A 3SPVB 1ZWIB 3ULVF 2J21A 4HUUA 5IQ7L 5KJ4A 4OBRA 4IBVA 1I4FB 1IC4L 2ZXBA 1Q1JL 4HWNA 3QIBA 2GABA 3C6LB 1RZIB 5BRQA 2P44B 5FCUL 2E74C 4AY0A 5KVEE 1ZK5A 2HJKA 3DO3A 3NIFE 3KPLB 5EIIA 4PJIE 4FD0A 1GHFL 1RKRA 1U8LA 3BJ91 2DI9A 4S2SB 2EH8L 4UU9A 2ROYA 4PWEA 1OAQL 3HPLB 4P9HL 2MEJB 4JG9A 4DP6X 1QFOA 1C5BL 3N9GH 3HW7A 4I48A 1S7SB 1IAII 3NQIA 4YLCA 1DQQA 4NPJA 4N0RA 2DQEL 3RUGF 3U46A 1EO7A 3QW9A 3LRSA 1N68A 1URIA 4IDJL 3KLDA 2DQJL 1TZGH 3ZU8A 4P23D 4TVPH 1CGTA 3ARGA 1AS8A 5GGQH 3A0OA 4PR5A 4WSJA 2JI3A 1QKZL 2YEQA 4H8UA 3EF4A 3MRBB 5EF2A 4IBUA 5I6OA 2HX8A 5IESL 3WTTA 2XA8L 3WTWA 1XB3A 4O9HL 4XMZA 4FQXB 4IS6A 4DN4L 1MFEH 3VE0B 3ZTNH 3R1GH 1FFTB 2F7OA 3QYNA 5DD1H 2AV1B 2F7QA 3ASWA 3EOTH 5HJ3B 1Z9NA 4JGUA 1FO0B 1S9VB 4ZFZA 3RIAK 4AM0B 1P2CA 2J6EL 5C0IA 2A9NH 3N1FC 3ECVA 4JHWL 3RBSA 3KCPA 5AOZA 5IVXF 4LQFL 3VQ1C 3FAXA 4GW4B 1A4KB 1MREH 1D6EA 1WBYB 2AJYL 1BVLB 3BT2L 3V0JA 3VMNA 1LL1A 2YA0A 3M17B 2JKXA 1JE6A 2P24B 3TA3A 3Q6FA 1AKJB 1KXVA 1DE4A 5DFVC 5CZXC 2A6KB 4OD3H 5A6LA 4LOEA 3BWAB 1OGAA 5EPMA 1HZHH 2MCPH 2P28B 4XP4H 5AVQB 4DZBB 3ILDA 5E03A 4YPGA 4LL1A 4HT1H 1BIIA 2BS9A 1R3KB 4JFXA 4K71B 2E8ZA 5KSAA 4F80A 1UHVA 4JPWH 5FYKU 2KLSA 4LLQB 4DGVL 1OP5H 4LDLB 4YDZA 1MHHA 2H8PB 2FO8A 3HZYA 5C08B 1TTAA 3ESVF 3DGDA 5EU7E 3UTSA 1XIWA 4XVTH 1A3RL 5F2FA 2HMIC 3NCJL 5IVOA 3TWYA 4XP1H 5C0CB 2VN6A 1P4BL 4XCYA 1QSEA 1PS3A 2AMUA 3VNYA 3O2VH 3RVVD 3SDCC 3D9AL 2BNQA 4OIAA 2ZYHA 3HE7D 1QFWH 2EKSB 4B9YA 4P57A 5FYJD 4DPBX 4FXKA 4NO2A 3PWPE 5F6IB 2VR4A 1CWVA 3KW8A 3IGLA 4WJKB 4TF4A 3WCYA 4X98A 1IAMA 4I88A 2AEIT 2ERJC 4J28A 2Y7LA 4CKVX 2XTJB 2IIJA 4HWZA 2XKNA 4A63A 5HI3C 3E9TA 4GO8A 5I19H 4R96A 5AW4B 4GW1A 1BD2A 3ZHNA 4MJ6B 2J1ZA 2PPAA 4OW6A 4A7UA 3EDDA 1PNDA 4XNQB 3ZYZA 1SEQH 4S11A 4YGVA 1OANA 1LO0L 3TZVC 4XN2A 1XF4B 2JFCA 1KENH 3D39B 1FNGA 2YD9A 3DDGA 3C8KA 3CSYA 2OI9B 3GHBL 3JTTB 1M9WA 2D7NA 4BKSC 4D8PA 5C92A 4OZIB 3FSAA 2GIXA 1XGPB 12E8H 2P5EE 4F7EB 4UNUA 1XGTB 2Q0ZX 2VDOB 5HI4C 5D6CA 2VMDA 2HX7A 3GJEA 4U1MB 4MMYA 3ETBJ 1T0OA 2DF3A 4ETQA 4Q7DA 5FOBA 1JVOA 3T65B 1U8OA 2XVKA 43CAA 2BIPA 2Z92A 3ZPDA 3IGFA 1JF6A 5DS2A 3ZL1A 1RURL 4WKXA 4M3HA 2F74A 2IJ0C 3WLWD 1NCCH 1E4XH 3K8LA 2MHAA 2P3YA 1JWMB 4MAYD 4UF7C 3DPDA 3TM6A 1ES0B 5ITBL 3KYAA 1HNFA 2PLTA 4HEMA 3RWJA 3KYMB 1IL1B 1N2RA 3GXNA 5FYKD 1K8IA 2XZZA 2E7LA 3TIDB 1FVEB 3QI9D 3SGDI 1PJ9A 2B5IC 4YHNA 1HHHA 3V6FB 2XFGB 3RVXD 3D51A 5IHLB 3BFWA 3EYOB 3Q8CA 2ZKHH 5TE7L 4B9IA 2OXHB 2VQ4A 1D5MA 1KGXA 1IE5A 3AADB 2OTPA 5F0MB 4FQ1L 4U1KB 3P3TA 2DWSA 4EI6A 4PJ6A 3L1FA 1USZA 2ZCHH 5JMRA 3DRTB 1OQXA 2PCPB 1B6DA 1M7XA 3FRPB 4PJ8B 4HMCA 2F1AA 5EBWB 1TENA 2WGNB 3EGXA 2MTPA 1UD3A 2ESVA