2HLEB

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
138
structure length
133
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVQYEYYKVYMVDKDQADRCTIKPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
molecule keywords Ephrin type-B receptor 4
total genus 23
structure length 133
sequence length 138
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hleB00
7PCYA 3AW5A 2YARA 4TXVB 1SNRA 1ET8A 1NWPA 4BDVA 2EINB 3IN0A 1GR7A 2PP8A 1JZEA 1URIA 2XXFA 4YVNA 5AZUA 3NSYA 1HFUA 1JVLA 2AANA 3S3CB 2BP0B 5I5JA 1NPJA 1NDTA 1WA2X 2PPAA 3DTUB 1NZRA 3FU7B 3QJRB 4AI7A 1PLAA 4AX3A 1WA1X 2YXWA 1WA0X 2BZ7A 2WO3B 4DP7X 4KO5A 3UADA 3HEIB 3H56A 2XV3A 2BHFA 3CG8A 2QT6A 4A2EA 3GXUB 1FWXA 2QPDB 4HAKA 1AZNA 4NAJA 2WO2B 2CAKA 1ID2A 4KO6A 3FT0A 1GS7A 1RZPA 3JT2A 4W1TA 4YSAA 3EH5B 3FU7A 4N4YB 3UAEA 1PMYA 5F7BA 4BWWA 5I6NA 3FU8A 3S8GB 1CURA 4E9VA 1HAWA 4FA7B 5I6LA 5PCYA 3RYMA 1CYWA 1GSKA 2R7EB 3ABMB 4UANA 1IUZA 5F7AA 4KNUA 3SQRA 1GW0A 2HRHA 1DZ0A 1BYPA 1QLEB 1NWOA 2ZXWB 1XB3A 3OMNB 4HIPA 3WNJA 4AKOA 1BQRA 2PCYA 3V9CA 5I6PA 1W8EA 2QPEB 4G7QB 1E5ZA 3FYEB 2VMJA 6PCYA 2WSDA 2PPCA 1PY0A 1CYXA 1PLCA 3WNIA 2OV0A 3DIVA 2J57A 1AQ8A 3HB3B 4DP9X 1PZCA 3TBCA 2BP8B 2E86A 2UXTA 1ET5A 2X88A 3NSCA 5I6KA 5ANHA 4N8UA 3S3DB 2BW5A 1PF3A 5AKRA 1ZPUA 1ILSA 3NJHA 2FTAA 3ZIYA 2FJSA 3T6XA 3C75A 4KO7A 2FNWA 1ADWA 4HCFA 2BP8A 1F56A 2I7SA 3ABLB 2FT6A 4KNSA 1JXDA 2XX0A 4JKNA 2W8CA 2GIMA 1BXAA 1GS8A 2FWLB 4KNTA 2EIKB 2AZUA 2PLTA 1MDAA 4HALA 3U25A 2UXGA 3FQ1A 2MTAA 1ZIAA 5TK4A 4K9JA 2YAEA 3FPYA 2H47C 3T6VA 3ASOB 3X1FA 4JHUA 1WS7A 4A66A 2HXAA 1PLBA 3GYRA 3ZBMA 4E9WA 4A2FA 1JZGA 2ZONA 3IE9A 5B1JC 1X9RA 1RZQA 3X1GA 2Q9OA 4HHGA 1L9RA 3OQRA 2OCCB 2PP9A 3D12B 4HZ1A 4BWUA 1AS6A 1JZHA 1B3IA 1M9WA 4ENZA 2EIJB 1AZRA 3NT0A 4AKQA 4DP6X 1IBYA 1V10A 1MG2C 2HX7A 2Q5BA 1PAZA 3NJGA 1BYOA 1J5DA 1ZIBA 3OMIB 4E9QA 2Y69B 5B1KA 1BAWA 1QHQA 2VN3A 1NTDA 2QDWA 2VSMB 3ABGA 1JERA 3ERXA 4P5SA 2XXGA 3N55A 1ILUA 4BXVA 2AVFA 5IY5B 1NIFA 1PNDA 1A65A 1OCCB 2YAMA 2ZOOA 3JTBA 2GI0A 3FSZA 4A2GA 2IDTA 3NJJA 1IC0A 1SHWA 4GP4B 4BDVB 5B7EA 5AFAA 3TU6A 1QNIA 1AZCA 3ZDWA 2GC7C 3EH4B 3WKPA 1SFDA 2Y1AA 2HX9A 4UF7C 4L0PB 1GY2A 1M57B 1J9RA 4HHWA 3CDZB 4JHVA 1HAUA 1L9TA 1AOZA 1BXVA 1OE1A 2XLLA 3G5WA 5D4IA 3SBQA 1T5KA 2GSMB 4E9TA 3ASNB 4Q8BA 3X1EA 2GBAA 3SBPA 1PCSA 2IDUA 2XU9A 3NYKA 3AG1B 1ZDQA 4CSZA 2J55A 2LLNA 4NERA 4A2HA 1J5CA 1JXFA 2R7EA 3FU9A 2XX1A 1WAEA 4HCIA 2I85A 4F2EA 1PNCA 3QJSB 1NIEA 1OCZB 3AY2A 2CBPA 4YSPA 2J5WA 4DP0X 4F2FA 4QKTA 5FC9A 3CVCA 1AZBA 4X4KA 3NJLA 2IDFA 2P80D 2I7OA 2FQEA 5E9NA 3QPKA 3FSVA 3KW7A 1KCBA 1BEXA 2DY2A 3FQ2A 2YAQA 4HCGA 1BQKA 2MRYA 2HRGA 3AZUA 2DYSB 4MFHA 1OCOB 2PPFA 1KGYE 1JXGA 1L9OA 1KV7A 3PAZA 2IAAC 5B7MA 1JZFA 1CUOA 4YSQA 2IH8A 1JVOA 3FS9A 2VW4A 3NSDA 1CC3A 5I6OA 2W88A 3UACA 2FQFA 3V9EA 3QJVB 1SHXA 5TK2A 3X1NA 3GDCA 1KYAA 4RH4A 2FT8A 2XYBA 2YAOA 2NRDA 2XUWA 5B1AB 1XB8A 3MX0B 4PCYA 4BXSV 4GXFA 1KDJA 4A68A 1NPNA 2BW4A 5EHFA 3SBRA 2RACA 3FSWA 4KO9A 4W9ZA 4E9SA 1TEGA 1NINA 4YSUA 2PPEA 1L9QA 4QLWA 2H3XC 3BVDB 4A2DA 2GC4C 2B3IA 1RKRA 1VLXA 1SF5A 2P80A 4DPCX 1SDDA 4DP4X 2ZWNA 3PLYA 1BQ5A 1N70A 4PAZA 1JZJA 4BWTA 3IEAA 1OE3A 2CUAA 2UX6A 1GY1A 4YSSA 1N68A 5B7FA 3NP4A 8PAZA 2GHZA 2HLEB 3UAAA 3OD3A 1ASQA 2BWIA 3OM3B 4UAHA 3QJTB 1OE2A 2HX8A 1SF3A 3X2QB 2IDQA 2HZHA 2OJ1A 1ZDSA 4YSTA 1AACA 3S3BB 1EZLA 3T9WA 4G7SB 3WG7B 1JZIA 1SJMA 4YSDA 4Q89A 3TASA 3IBOA 1J9QA 4DP5X 4M4RB 1AZUA 4G72B 3FPXA 1W6LA 5I5MA 2UXFA 3FYIB 2BWDA 3BQVA 1ASPA 5I6MA 1PZAA 4WKXA 3WI9A 2FT7A 1M56B 1MZYA 1AAJA 1OF0A 2QDVA 1AANA 4YSOA 1SDDB 4YSEA 4DP8X 7PAZA 1ET7A 3FSAA 4KOCA 1PZBA 1IKOP 3FQYA 4DPBX 1BXUA 1GS6X 2X87A 1NICA 5I5IA 1AIZA 2XWZA 1L9PA 1A4CA 3NJNA 2XVBA 3KW8A 5B1JA 1V55B 1JOIA 4YL4A 2AZAA 3WIAA 2FQGA 2A3TA 1NIBA 1J9TA 1DYZA 1J9SA 1ASOA 2H5UA 3PPSA 3T71A 2PCFA 3TA4D 5B3SB 3NJFA 2BP0A 3CVBA 3ZX1A 3EHBB 3S8FB 1SFHA 1E65A 1MZZA 3PAVA 1OV8A 4E9RA 1AG6A 1NIDA 2CJ3A 2YQBA 2VW7A 2VSKB 4ZK8A 2YAHA 1AR1B 2IDSA 4A67A 2N0MA 1GYCA 1R1CA 5A7EA 4DP1X 4GYBA 4GY4A 2YAFA 2JKWA 3CVDA 1OOWA 3DKHA 3NJIA 4G70B 3ABKB 1A8ZA 1KBVA 5I28A 3OMAB 3WKQA 4DPAX 1UATA 2CALA 2GB2A 2XV2A 5B1BB 4YSRA 2EIMB 3EH3B 2IWKA 3CZUB 1KDIA 2BO0A 3QJQB 2IWFA 2CCWA 3TBBA 3N2JA 4DP2X 4FAAB 1TKWA 9PCYA 1AG0A 1TU2A 6PAZA 3QJUB 2YAPA 2B08A 3X1BA 1FA4A 4BK5C 4GP8B 3PCYA 2AFNA 1E30A 4CSPA 3NJKA 5PAZA 2DWTA 1AS7A 1NIAA 5D4JA 1A4BA 2XV0A 1XB6A 2EILB 2TSAA 2VW6A 1YLBB 3QQXA 4YSCA 2J56A 1XMEB 3L45A 3NP3A 1MG3C 2DYRB 1I53A 1A3ZA 1ZV2A 2VM3A 3CDZA 3AG2B 4AZUA 4G71B 4E9XA 1EHKB 2DV6A 1KBWA 4F7KA 1OCRB 4NB7A 3UABA 1FFTB 1E5YA 2PP7A 3PXLA 3IN2A 1ETJA 4M3HA 2IWEA 2JXMA 5LDUA 3AG3B 3PAUA 4G7RB 4EF3A 4WTQA 2PPDA 2TSBA 1A4AA 2YXVA 3EF4A 2FQDA 3H4HA 3T6WA 1E67A 2VM4A 3NJMA 4GP5B 1WS8A 3MBWB 1L9SA 2UXVA 2JFCA 5D4HA 3UGEA 1W6WA 1IBZA 3AG4B 4KOBA 1TEFA 2IH9A 1V54B 4P5RA 3H4FA 2UX7A 3NSFA 1RCYA 4YVUA 1AS8A 5I26A 4E9YA 2DWSA 1KCWA 3T6ZA 1X9UA 4AKPA 2BZCA
chains in the Genus database with same CATH superfamily
5DQ9B 3KWTA 2Z31D 4WO4A 3QJOA 3SZKC 2WKOF 3N1PC 1D5XB 3TJHD 5CJOH 4DFHA 2R15A 4GPVA 4PIRF 1BBDH 2NXYB 5C3IA 1AHMA 4JO4L 4KVCL 1U9KA 2NY1D 1TSHA 4JFDD 2OZ4L 4PPTA 4P2RA 4TVPH 1SJEB 1Z1WA 3IGAA 1DUYA 4JM4L 1FFNB 2BMKB 1NPJA 4W9CC 3T2NH 2OTWA 3I6LE 4NHCL 3MLXL 3POHA 3F58L 2AV1B 5MI0B 5EIVA 1ES0B 3H3PH 5KBPA 4PJDB 4FQ1H 4KJPD 35C8H 4GW5A 2QT6A 1T89A 4OD1L 4J6IA 5JMOC 1FVDB 4L1DA 4ORGB 1PQZB 1E5AA 4OFKA 4M9OA 2J73A 3GMLA 4AZ8B 5C2BL 3K71B 1KFAH 2YN5A 4W4OC 3QEUA 5EA0H 5F7BA 4H7VA 3GPEA 5ADPL 3BW9A 5LGYA 3IJEB 3MI6A 4WI2A 3WEXA 4PGCB 3T1FB 2E6JA 3FN0H 1DTUA 2J2ZB 2QHLA 3EFOB 5DLMH 5HGGS 3MBED 3NZUA 4RMUA 2PW1B 2EJ1A 5JDSB 4LF3A 2PCYA 4ODBD 4UM9B 1BVLB 4MVBC 4PRID 4HIXL 2CLVB 4M62H 4HQQL 1QW9A 2W94A 1PKOA 2FATH 2QELA 5T1KA 2VB5A 4LQ1A 3RNQB 1JZ4A 4C55A 1W8NA 1UGKA 2ED6A 1PLCA 5JDSA 3VGBA 4LCWB 3KJ6L 4KK9D 5HYSA 1A7RH 4M61A 4DOHE 5IMLA 1BHGA 2AJSH 1AQ8A 5TQ0H 3V8CA 3EO1A 2CKNA 5L8KB 1G6RL 4JO2L 2OP4H 4NGHH 4KQ3H 5TE6H 4ZZFA 1A3LH 3K6SB 1LTXA 1QATA 1V3MA 5ANHA 4UQ3B 3HC4H 3VFNA 1QLRB 1NCGA 2DQMA 4PJCF 4ZO8A 5IP4A 4JGJA 3L3KA 2HJFB 3OKDB 3FT2B 5D8JL 2R1XB 2XFXA 1XD0A 2WZPA 1IEAB 2P5WD 4N5UA 3FT3A 3RVWD 4X5XA 1FYHB 2H3NA 4L8SA 3DYPA 4Z3IA 4NC0B 3O9WC 4RESB 4XP1L 3QUYB 1I4FB 1NDMA 2ZPKL 1O7DC 1AI1L 1CYGA 4NQEB 5L2KA 1NMCB 4ONHB 4IRJA 2YAEA 4LLQB 2XTJD 5F88A 3RIKA 4U3SB 4YWGH 4PJDE 3ZDZF 2QVFB 2YPVA 2HKHH 2AQSA 1F58H 1DQJB 4LCIH 2XQYG 2A4EA 2O30A 1NSNL 4M7ZB 2DRUA 4IRSB 2DWDB 1WK0A 5I8CB 5J11B 4GBXC 1HCZA 3GBLA 3TWCH 4PY8I 1PFOA 4PWIA 4M7ZC 4ZUUA 5J11C 1XTLA 4P2OC 4N68A 3IJ7A 3QUXD 1T0OA 5AW2B 2OSXA 1MVUA 1ZE3H 2IVFC 2VUOA 2ZCLL 4JMNA 3NABL 2R56L 3TESA 4BZ1L 1OTTC 3KG5A 4UQ2A 3UTTE 4FNLL 5DD3L 1UH3A 3ELAT 4H8WH 1QUNB 2XKSA 3L95A 3UIYA 5JPNB 5GGVL 3W9DA 3B34A 1GPOL 1PNDA 5J12B 3LX9A 2G60H 3GSQB 3WHXA 5JPNC 2ISDA 1X4ZA 4ONGH 3ECWA 1I1FB 3NJJA 4PVMA 3ZVVA 3OZLA 4K71B 4BDVB 1WZ1L 5FO2A 4C8XA 2R83A 5B7EA 1QPPA 4K07A 3MLZH 3SKMA 4B9IA 2QTEA 3H9SE 5IQOA 3ZDWA 5J6HB 1BOGB 3ZL4H 1MREH 1N12A 1Q0XH 2RCSL 1HKLH 4YEEA 3LNDA 5BO1L 4ZOAA 1TSRA 5ETUA 1M57B 2CKBL 1AQDA 3L13A 4L3EA 4LLYA 1SDAB 3WFZA 1HHKA 2FECI 2VO8A 3CFKA 3OG6B 3GXNA 4QGTA 2XLLA 1RIVL 4TUKL 4MMZC 4F5CA 2YHGA 4K7PL 1JNNH 1RK1A 2SODB 4AK2A 5C0AD 5EFIA 1BVLA 3PFUA 2EEDA 2G3ZA 2Y23A 5AOZA 3T3MB 1C5DA 1T7VA 4U6HA 4GG6B 3U7WH 2YZ8A 4IKIA 3KD4A 4IKJA 1EEYB 2FLBT 3AG1B 1ETZB 2ALAA 4AG4L 1B0GB 3G04B 1PS3A 4OT1L 2KLTA 2EH8H 4ETQA 4F2EA 1FO0L 1T83C 4AZ8A 3MRNB 1BWWA 1RZ8A 5IFJA 2LW3A 1TDQA 4Z77B 2BVTA 1FC1A 5KSAC 2YOAA 3P9WB 2XN1A 2IMMA 1JF1B 2FWOB 4JW3A 1YQVH 5SWSA 2VZSA 1BEXA 1BD2E 2JKNA 3FQ2A 1NCCL 4FNSA 1WG3A 2V9TA 4JCLA 4M02A 2QV4A 4WTXA 1CD9B 4X9GA 1KTKE 2DYSB 2ZKHH 1F1DA 1XVSA 3WHE1 3RWCB 1JXGA 1FI8C 3P4LA 4M3KB 3ZMRA 2GQHA 3OSVA 3R8BB 3LB6D 3NZHL 3UJIL 1JRHI 4FNUA 4N2FA 3EGDA 2IGFL 5E8PB 3D3VE 1KIPA 2EECA 4RFEA 2GT9B 4ODTL 1WUNT 1FL6B 1NLBL 2OJZH 5FV2A 4OQ1A 4RH4A 1W72B 1ZHLA 4P2OD 2AP2A 4FQQB 3QRLA 3VFTB 3D5OF 3N06B 3ARRA 1A9EA 1SY6L 5D7EA 1HI6B 4Y8DC 1WRFA 3NAAL 3IDJA 3P0VL 4CBPA 1AMXA 4L1TA 4WIQA 1R3IH 4JRYA 1F86A 4LZKA 2AI0L 2PPEA 4P9HH 3RKDD 5D7HA 1ZVHA 4MBOA 2YGVA 4QLWA 1JPST 3PHSA 4XOBA 1YEKL 5EOQH 5F9WB 4L3FA 4NJAH 1LEIB 2F19L 2Z93A 3OZKA 4LHUB 4ZO6A 5DEGA 1JPFA 3B7UX 4JO4H 4KVCH 3AUWB 1CLZH 1YN7A 2QQNH 2LQRA 2C8NA 1A4KB 2AJXH 4M5SA 2D0GA 4FRWA 4L4VB 3RBSA 2JIXB 2ZF8A 4KZEH 3HS9A 1D6VL 4PVNA 4HLZH 2DH3A 4NO5A 5EV7A 4ELKA 1J1OH 3NEXA 1AVAA 1NM9A 5A2LH 5LAPA 4LPUA 1DLFH 3KPSD 3QVAA 3QJTB 4JY5H 2KL6A 4WFFE 5KSBF 5JW5A 4JREC 4TNGA 5F1SA 2J88H 4NZDA 3U30C 5TDOB 4H20H 1DBJH 1YYMH 3B5HA 3CBRA 3U4EA 4ODHL 4RGNE 2BZDA 3VXNB 5H37H 4C58B 4LDCA 4OVVA 4M4RB 4DP5X 1TZHA 4ALAC 3KYAA 1N5YH 5IQNA 4YFLF 3MBXL 1CFSB 4L9DA 2LAAA 2DQGL 2QFPA 1KB9K 1U0QA 4HFWA 2BDNH 3LAFA 3GGWA 3RWIA 3B5TA 1HQ4A 4EN3D 3VDBA 4PU2A 3BPNC 1N64L 1TYJA 4G7VL 3GSWB 4GKSA 1MJ7H 5F7FA 1M42A 3O6FA 3TTYA 2KH2B 2MCG1 5BQDA 4FZEL 3GI9H 3ULUE 2AERT 1DJYA 2NR6C 3UCQA 1ZVSA 5DO2C 2X87A 3HG1D 2BVQA 2QSCH 4BJLA 3GBDA 3ULUL 1JHKH 2ZICA 3RX9A 4OCYH 4FG2A 1XF4B 1J1XL 2GK0A 4PR5A 2F8IA 4QRUB 4YHNA 3BHBB 2VDQB 4NZ8A 5HGAA 4WU5A 1JGDA 5ESVB 1TJHL 1ASOA 1I7ZB 4MZ3A 3BD3A 3ZHDA 5LGJA 4P4KC 5FO9A 2MQCA 2VR4A 1XSJA 4YHIB 2R1WA 4UQIM 4Z76B 4P4KB 1SLWA 4NQCD 4ESKA 5CZXD 4ONGL 4XP6H 4X6BA 4R8WH 5DC4B 5BRZB 1XCWA 4YGVA 4HCRA 1EDYA 1SOKA 3ZGHA 4KKQA 2IO5A 2YAFA 4JQVA 3S4SG 1P7KB 3ABKB 1MWAL 1W8OA 4HPYL 4M29A 4QHNA 4XH2A 5I28A 3GXMA 2GSIA 3VXOA 4BFRA 4X6BB 3GM0A 2XV2A 4XXDA 2IBBA 3GO1L 1M2OA 1PKQB 4OLXL 2ADYA 3C6LB 4I9WD 4N1HB 4F8TA 1NCDL 3UBHA 1DUYB 3K0WA 5HI4C 1KIPB 3LTVA 3UAFA 3TEYA 1CIUA 2X6UA 3O11A 1XL4A 2OA9A 1BYNA 2R4RH 1VEOA 2JLLA 1OXYA 1G9HA 1WO2A 1K3ZA 2IQAB 5IG7B 4HAGA 1YCSA 3E9TA 3EG9B 4WHDA 4HP5A 2V4LA 2QFRA 4PREB 1J8HD 1KPRA 2VM3A 4O2EA 3PYCA 5D1XA 1QSFD 3HUJB 3HHSA 4WW2A 2FJGB 4JFZH 2UWEF 3EDEA 4XVSH 4AVJA 1EEQA 3NA9L 1IM9A 3KPTA 5J5EA 5E4EC 2JJSA 5TDNA 3G6JA 2BNRA 2JXMA 4K3DL 4U33A 1G9NC 2PO6B 2NPLX 4YDKL 3EZ8A 5KSAD 2XZCL 3R06B 4ALAH 4E41E 4GRMA 2Y2YA 3F6JA 4OLEA 4WTQA 1WEJL 4AWJC 4DEPB 2NUTB 2WYTA 4QHPA 5AB0A 5ALBH 5KYNA 2VLJB 2FZ3B 1WFMA 5ANME 1FFQA 5IZ7A 5KBMA 3QULA 4ECNA 2W80C 3BLPX 1BV8A 5KEZA 3UTSA 3PJSB 3ELQA 4JFDA 3F2LA 1KC5L 4YR6B 1I7TB 1I1YB 3U4EB 4GAYA 4K8RL 1VENA 4XNXH 1IM3B 3P0VH 1KEGH 4M56A 1MCBA 1JNNL 5EU4A 3RWDB 5F6IB 3HJEA 3PJSA 4JKPH 4WI9A 3OHXA 2WINB 4UDTB 3GLDA 1UJ3C 4F7PA 5IM7B 4I2XE 4NN7B 4LGPB 3G7TA 3MNWB 4LO9A 4XRCA 4RGOH 5AZUA 3SPCA 4QHUA 2AANA 5IMOA 3HN3A 2JB6B 2CCVA 4IRZL 4JMXA 1DEEB 1WA2X 4YUEH 1NZRA 2WD0A 3QJRB 3G5ZB 1Q94A 3EF7A 1DHKA 2MQ0A 2YXWA 3SO3B 3UADA 3QHZH 5DHVA 3ZU8A 3AQDA 4AYBA 4BRJA 3CFKB 2XV3A 2XPGB 5J7CC 2NLJB 4PJ9B 4OZIE 1JPSL 3SPVA 2X3AA 2Q2LA 4BZYA 1XF5A 4GUPB 4YJZL 3K1DA 1HEHC 1NFIA 5C09B 2YA2A 4PV8B 5FM4A 4PWGA 4OIAA 5BUPA 3KS0J 4KQ0A 1HYSD 1Z9OA 4YPJA 4FNLH 2QHRH 5I16B 3MYJA 2YGQA 3RYMA 1RJCA 5GGRY 2PO6D 4I0PA 3TBYB 3BPLC 5E6RB 3OMNB 4QRRD 4EPSA 4XVOA 1G7QB 3EGXA 5AWNL 4ZFGL 4G7QB 4G8FA 4RGMC 1S78C 4RFOH 3U9PL 2XKNA 3IDXH 3QRGL 2QQKH 4D0BA 3UYRH 4TULH 3VSUA 3BKJL 4U6VH 5I9QC 3MJ8B 1HI6A 1FVEA 2PTUA 2X6BA 4J3OF 3TIEA 3O9WD 1YMME 1FHGA 1G9ML 4JPIA 1JD7A 1V8HA 3MODH 5DZ9A 1BQSA 4X6EA 4AIOA 1WFJA 3LIUA 3EYOA 4W70A 4PH8A 4M1DH 3NFSH 4OJFH 4I85A 2AJXL 1O7SA 3T2QA 3DI3B 4N6RB 5IV2B 1QLEH 4KAQL 1PG7X 2LABA 1SBBA 3SDYH 4MA1B 1XCXA 2HH0H 2R4SL 2VC2L 4EI5B 1BXAA 3L4UA 2ZUYA 5CZXC 2VDQH 1U3YA 1MDAA 3NFNB 4PRDA 5GJTL 3ZW3A 2FECL 4X4XA 4LPVA 3RVXD 1UUNA 4BSWA 4K3EL 4K9JA 4GXUN 4H4NA 4C4KT 2Y7SA 3BWSA 2VJ8A 4S1RL 3TCXA 5CMAB 3QCTL 4CA4A 3ZBMA 2Q7YB 4XNZC 2N7BA 3UC2A 1L7TL 2BSCA 3IDMB 3QIUB 3Q5OA 4JPWL 3WLBA 3BE1L 2F7PA 2PP9A 3D12B 1N5YL 3KPRE 2X9WA 5DHDA 2BVOB 1I8AA 2EDKA 4KXZI 3L48A 1A64A 3OV6A 4MA8H 1X7TA 1J11A 1IBYA 4HYTB 3WFBH 4ZMNA 3ETBJ 5F7KC 2B59A 4M7JH 1TT6A 2VLRD 2Q5BA 3LQAH 4GRMB 2EYRA 1Z0NA 5EWIL 3ECQA 1QHQA 2VN3A 3RKPA 4L1SA 4OD3H 3TT1H 2AXGB 3VD5A 1HESA 5JTWA 2YZ1A 1TJHH 2DLFH 4PJIE 3RP1A 3V4VH 3EGSA 2ORBH 4GW4B 4L8CB 4NNPH 2WQUA 3PL6D 1KWKA 5IOPA 5L88H 4GAGL 4QLRA 1ZLWH 1LD9A 2FHCA 4FLHA 1A65A 2FBRA 3P9MA 1N6VA 2GI0A 2OMUB 3GBEA 4S0SD 4DO4A 5DRWA 1PZSA 1XH2A 4A7SA 1SHWA 3OHXB 2QSCL 3ES6B 4U6XB 5GSVA 4OIIL 3C2AH 3JZYA 2DN7A 3GMMB 3D39A 4KJPC 1F00I 1FHNA 2NY4D 5D70L 3RWDA 4X7EC 4WVRA 4H1LG 1TVHB 2P47B 5CJ5A 5KSBA 3MRRB 5M94B 3A47A 4XXDB 4Y4FC 3AY4C 4DEUA 1MCEA 1DQJA 4XVSL 5D5ME 4IBZA 1F02I 3MROA 4MAYB 4ZO9A 3RGVA 4DOHB 3KPPB 3MXWH 4RMVA 2AQNA 5GSVB 2R9HC 1T1YB 4R96B 1QFWM 3A21A 1HXYA 2EDBA 1OZUA 3O6LH 3ZKMC 3E2HB 4HJGA 2FEEI 2WSPA 1TVHA 4PJEE 3AAZA 3SBPA 5DQJB 3JYBA 3VSVA 3JV6A 1DVSA 3FB6B 1GCFA 3OAYK 4KITB 1HCVA 2X05A 2Y72A 3D85D 4V1DD 3WFEL 3FFCA 5FCUL 2F68X 3UERA 3ESVF 4Y5XA 3QNZA 4HCIA 1E4XI 3BVNB 4OR1A 4YGVB 4X80L 2WQAA 1J05A 4Z7UA 5E5LA 1IBFA 2WBWB 1A02N 2RJMA 4L18A 2OJEA 4EIBA 2DIBA 4QRRB 3UO1H 3CVCA 1XZ0A 3RTQD 4K8RH 2IOMA 4OGAD 3BAYA 2WAHA 5CEXB 2O5ZL 2ADGA 4G82A 1IGMH 3BGFB 4PV9A 1KCBA 4KX8A 4F7CB 1B9KA 4Q74A 1EV2E 4NAMA 3BGFC 4I0PD 5CKAA 4HISA 3K80A 4Z7UB 1T04B 3ZHFA 1VCAA 4L5FH 1JHLH 1WZAA 2HLAB 2JB5L 2YRZA 4R7NB 5EU7C 3C9NA 5BQ7B 1VPOH 3MCG1 4OGYL 5B7MA 3N41F 5C0DB 3FS9A 4L8DA 4B7LA 3DX6A 1QSEE 5K9OB 3N42B 4UNTA 3CFJA 3QFJD 4NXKA 4R0LA 4ADIA 1F4YH 3QDMB 3QJVB 3U6XS 4YDZA 3ARYA 4H8QA 5FO7A 4WNSA 4IK7A 5FCSH 3FMGL 4HQQH 2N7AA 4KKAC 5K1VA 1TFHA 5BZDA 5HYQB 4Y4FA 2DZEA 2YS4A 2J8UE 3C5SB 2DTSA 5C0AA 3SD2A 4AXWA 2P44B 1EZUA 2ZKMX 4AL8H 4Y2OB 3Q2VA 4Z0BL 1U8QA 4Y4HA 3MV7B 1Z32X 4YEFA 3O3EB 1PQZA 1OGAB 4NWUH 2EEBA 1HOCB 1INDH 5AYUH 5JHLA 3G6AA 1NINA 4JY6B 4EZLA 2VN5A 4AYGA 4NUJB 7FABL 5GISH 3RKDC 1QPKA 4KRPC 3BVDB 2NTFB 1QSVA 3RI5K 3FOMB 4QHUB 1IFGA 1NGYA 4C4UA 4H13C 4ZT1A 2PCFB 5BRZD 4XNYH 4Z76A 2X9YA 1YEDA 1KTCA 2CRYA 4F7MA 2UX6A 3SCMD 1Q8MA 3HTLX 3NJXA 3AMLA 4NM4L 5CEZD 2NX5E 4W93A 4NQUA 4TLSA 4U1GB 2DQCL 2V5SA 4ABQA 3CZNA 3QC6X 2XNAA 3CMOL 4UMGA 4U1GC 1UH4A 3FNKA 4JPWH 4DZ8B 1SQ2N 5AG9A 4W9DC 5T1MA 4LQFH 4H8UA 4ZYKB 4OM1H 4IKNA 3TBSB 1HEJC 1AACA 1S7TA 2NNFA 3ZN6A 5DRWB 5ICZA 1QRKA 3BFQG 1NGWB 3S5YA 3GJFH 4G72B 5HI3D 3DMMC 4OZFB 5B8CA 3IJHB 5ITBL 5A2IH 4YUEL 2NW2B 3IDJB 3DMMB 3RBGA 1WBYB 1SXZA 5F7NC 2YPKA 1HILA 4PJIF 3HG1A 2AAVA 5IROC 1ASPA 4V2CB 2JF1A 1E4XH 3AREA 3N6YA 3PE9A 4R7VA 2RR3A 5D6CB 3L3IA 4PRDB 1AAJA 1FYTD 1BQHB 5FW8A 4XBEL 3IJHA 4MXQD 2AAAA 4YSOA 4Y2DD 3KGRA 3K7UA 3PGDA 3BO8B 4JM2B 3CZFA 3WDJA 3V79C 1F6FB 1M1SA 1EXUA 2YPKB 3TXAA 3KH3A 2YA1A 3JWNE 4BUGA 1MAML 5BZWA 2GBUA 4KXZH 5DUBB 4LSQL 4KZDL 5T1JA 2YQ2A 3HC3H 3EZJB 1AIZA 4HWBH 3N40F 4HWEH 1UZ8A 2WGXA 1MCCA 1TQWA 1WAAE 3TA3A 2VZOA 4K2UH 4RIRB 1V55B 2YRBA 1XSOA 3O3BB 4GMTL 4P4RB 2A3TA 4XWOD 1GMIA 4I13B 5EU6B 3H53A 4H8WC 3BKJH 1M6UA 3DOSB 3O41A 3SOBL 2PKDA 3LEXA 3L9EA 2H5UA 3T71A 2OMVA 1YN7B 3TA3C 1KT2B 2DWXA 1A4KA 1DO5A 1UASA 2IQ9H 3DPDA 3K2IA 4F7CA 2Z0BA 3M7FB 3TA3B 4ES8A 1VJSA 3NCBB 1S5IL 2NY5L 1HL9A 1UWYA 5E6IA 1TZAA 1CLOL 1CFNB 2E9WA 1E3XA 2WCSA 4X6EB 2GI7A 5LNDA 1WAAA 1JFQH 2AV7B 3U7YL 4KK5D 3ATFA 1UD5A 2Q10A 1CLYL 3EJRA 4BFGA 2WSKA 2IFFL 4PGEB 1GGCL 4G70B 5BVJA 2C3VB 5LXVA 3S35L 4O2FA 3BRDA 1A5FH 1EWHA 1RUQL 3EDDA 1E43A 1KN2L 4RMTA 5HYFA 2BNQA 2ZPKH 1U42A 2CO4A 3I9GL 4HC1A 1WSST 1CIDA 2DTML 2KDGA 3DX6B 3V6FA 4GBXD 1LDSA 1TKWA 1DEEA 1KJVB 2H0FA 2R29L 4HFWB 3WL9B 3U1PA 3HHMA 2ICWI 3KWXA 3GS7A 2AABL 4L3EB 2YFOA 4F33B 3RHWF 1L5GB 4PGCA 3T1FA 1YNKH 3CQFA 1RZ7L 2BPBA 3CCHA 1H19A 2J8UF 4GQ9H 5DK0B 3GMRA 2EO1A 2QHRL 1AP2B 3ULSB 3OB0H 3TM6A 3VGGA 3LMJL 1SJVA 2J6EH 3CDZA 3WDIA 3FRPB 5EF1A 2EDTA 2VLRB 4KI1A 3C60D 2AQ3A 2VDML 3DRTB 4NB7A 5JA8B 2XNAB 2JB6A 4FXGB 1I3GL 1YNTB 1E4WH 4X6CF 4CC1A 2X4OA 4LVOC 2Q7NA 5F3FA 4UTCA 2G5RA 3D09A 3FB6A 3FCUB 1ROWA 4BINA 1NKOA 5KJRL 5HHOE 4EF3A 1KPUA 4KXBA 5D7IB 4XC1H 1PEWA 1A2YB 2J2ZA 3PP3K 2C1OB 4HK3N 2KPNA 1OHQA 1IBGL 3NJMA 4KK9C 4BKLB 4FXGA 4ZW5A 3FO0H 2VOTA 5D7LB 3UGEA 5JHDB 1KG0A 4IGBA 3RVTD 2WLLA 4P5TA 4ZG1A 4LASH 4ZJ9A 4YK4C 1Z3RA 1D6VH 1ZA6B 3H4FA 4HXBL 3C5SA 1UB5A 3L08A 4PLJD 1UACH 1PD6A 4YVUA 3MLYL 4HU8A 1BZOA 3QW9A 5B38B 5D7IF 3D39E 3NQIA 4P9HC 5T33L 7PCYA 1ICTA 5E94B 2X1OA 4ZMQA 4JK0D 2V8MA 2CLRB 5CJ8A 3HN8A 4MA3B 3SE8H 1QBBA 2VL4A 1S9WA 2V2WB 4BDVA 3IJSA 4HOZA 5A2JH 3AADB 1U30A 2GTWA 5EBMB 1URIA 2L7EA 3HB3D 5CFHA 4B9PA 4X4ME 4YBHA 1JPFB 1JVLA 3OKDA 3HBZA 3BVVA 3LEYL 4DW2L 4U1IA 4LNVA 2E76C 4GFXA 2AKRB 3KLKA 2ZOKB 2CJUL 3MRPB 2V2WA 1EGJH 3F7LA 3Q9PA 3CPLB 4PJBE 5FYKD 3HEIB 5T3XH 2CZNA 3F00A 3QCVH 2P1YA 2CRMA 5JXAL 3WTTA 4X7DC 3MRJA 5FUOL 1MQ8A 4OB5H 3JT2A 1SYSB 1U8KA 2EDDA 1CDJA 5KS9A 5E4EB 1RK7A 4GIAA 4DGYH 1PMYA 1VFOA 3FFDB 4Z95H 2YSTA 3CDGA 3KPQA 1ZTXL 4WCYH 4XPHH 5ICZB 3ABMB 4OVUA 4XNUH 4YIQA 2DLIA 3KM1A 3FFCB 4JPSA 5C71A 5DD5L 3DURA 4AKOA 1UEMA 1VRSA 5E6ZA 2A74B 2AJZB 3L6FB 4H5SA 1DUZB 4AVHA 1OEZW 1E4XL 1ZSDB 3K91A 5DZAA 1K2DB 2J5LB 2CWRA 4QIRA 3TEUA 3KGSA 1BECA 3UBFA 5I2IA 3MLWH 4OQTA 1DN2A 4ISVB 3AM8A 2APBA 3I50H 3RI5F 3VD9A 1ED3A 1VACB 2A4ZA 4OF6A 3QORC 4UIMB 1T03H 1IL1B 1TCMA 4OGAC 2XTJE 3VWKC 1Z9MA 1GGCH 2NTSP 1F97A 1OF2B 3WIHL 2WBJB 3MRDA 1FGVH 4M61B 2LU7A 4BH8B 3T3PE 2IAMD 3OKMB 1WVZA 2Q6WB 5IOPB 2VRAA 3GSWA 2BP8A 1OW0A 3V0DA 4BA0A 3QXTA 1M3JA 2FT6A 3EO0B 1N67A 4HU2A 3TN0D 5FUZH 1IFRA 3HG2A 5T1DH 3VX1A 5IMMA 4O2CA 4RISL 3UP1A 3KXFA 4NZUH 2R59A 3QG7L 3GIVA 3RX8A 3ZE0F 5CN3A 2VLRA 3APFA 3OGCA 3Q8CA 2P46B 1IGFL 3FTVA 2HTLC 3DHUA 3UGUA 2C9QA 3FPYA 5D93B 5K1JA 1BGXH 1JJUA 2G2RB 3IE9A 4L9LC 3B1UA 4N8VB 3MXVL 3FUDA 1I3RB 3P54A 3VJ6B 1JVKA 1Y1UA 4HEPG 1JGUH 2C7FA 4S1QL 4TPRH 3V5HB 4Z3HA 1C12B 1CN4A 5KVFL 2BERA 4OD1H 1P2CB 2IG2L 4HBQA 1NEUA 4CGUB 4MB4A 4K5LA 3ZK0A 4QXVA 1JK9B 4FG6C 4NN5C 3S6CA 4PV8A 5CD3A 5IFJB 3EYSL 2KYIA 3OMIB 2KI6A 2FGZA 2OW6A 2VDKL 2ZZUT 4RX4D 2J4WL 2VQ1B 1FG9C 4FTVD 3QJFB 4H0GA 1KT2A 3DBSA 3EYUH 2NY3D 3QPQD 4P2RB 3KWVA 1OTSC 4R26H 4PJXE 3IGAB 5I74B 4U1IB 1II4E 3BIBX 5FM5M 5F3BA 1OCCB 2J8HA 3D07A 5I74C 3AFLA 1E42A 1QYGH 2ZOWA 4X0KB 3WNKA 2YRLA 5LUMA 5C6TH 4WK4B 1IEHA 1RZ7H 2VAAB 3CFDB 4H26B 2YKLH 5HHQB 2Q76A 1M6OA 5JA9A 1UA6L 5C0RL 3NOIA 2L04A 3M17A 4PB9L 5EFIB 1INEH 3UPAA 4WKZB 3RLSA 3AM8C 5ICXA 1UKSA 2ZWLT 4B9KC 1A6TB 2IXQA 1RU9L 3D18A 4KKLC 1TQCB 4YL9A 2RB8A 5DMKB 3VTTA 1VFUA 3WENA 3OLGA 3LEXB 3U6RB 2WV3A 1CT8B 1RZIA 2OTPA 4R0LB 3RTQA 1JBJA 2EUVA 4C54A 1VB9A 1FG2B 5DK3A 5ALCL 1GGTA 1NC2B 5DFWH 1JZDC 1PCXA 4AGMA 2X2JA 5L6YL 4ONFL 4E41A 4ZX6A 3EDFA 4XR8C 1M7DB 4LBAA 4L4VD 5IK3B 2J55A 1BX2A 2AJUL 2XX1A 4WQOA 1C5CH 3G5YB 4DTGH 1A9BB 3NZ8A 4WSKA 1F3JA 2VQ4A 1SYSA 3QB7C 3WJMA 3JV0A 4CJ1A 4KH9A 1NMAL 1AZBA 1C8PA 2XWEA 3LMJH 1AYRA 5E9NA 3RHWK 2D7MA 5I24A 4IRJD 3WIHA 5BOZG 4ERSL 4EDXA 4HCGA 3AU1B 3MRNA 4WFGD 4XOAA 1K6QH 4HCRH 1A14H 3L3OC 1HILB 5LBSL 1E27B 3ET9F 2W0PA 3TJEL 1RPUA 4ATTA 4FQCL 1I7UB 4NIYE 3C09C 3CQQA 4OLZL 4B6ZA 3L7EB 1UG9A 1GMEA 1OWRM 4MQXC 5FGBC 3QIBC 3TC9A 5IGXH 1N9PA 4JN2B 5SWZD 3R18A 3PJLA 5TFSH 3IDYB 3QIBB 4R7DA 3Q8AA 2GSIB 4JRXE 3VXOB 4C83B 3TT3H 4DN3L 4E5XB 3FQWB 3SHSA 5EIIA 4LIQH 1A6ZB 4FYRA 2BNQB 1GHFH 4IIQA 4PRHD 4KNQA 4F9PC 4BXSV 1IM3A 2WM0A 3QP3A 5J0BA 1KDJA 5BW7A 3RGBA 1UYWH 2BW4A 3KPLB 4PVLA 3GSNB 3VRJA 3PQYD 5SX5K 4KH2A 4R2GB 2YA0A 4FQXC 2ARJQ 3T0EC 5BMFH 3UTSE 4KI5F 2DQ6A 5F70A 3B9KD 1A7PL 3W39A 2QV2A 4FXTA 4ZQKB 4HIJB 4N3TA 4JPVH 1S7VB 2OZ4H 5FDWB 3BAKA 5HVHC 4BQCA 2EKJA 3PRZA 1ZT1A 4JM4H 1E3FA 4UBDD 5B7FA 3K8KA 2VR7A 4K0OA 1CB4A 2R29A 3CLFL 3BC9A 2YLHA 1U8PA 3CMGA 3NJVA 4QHMA 1X44A 1UOVA 2D7QA 1KELL 4P2OA 1AI1H 2CHWA 3M17B 1T2QH 2XN0A 5KVDH 5GZOC 4G7SB 1V3LA 4KKBD 2A83B 5F44A 1KMGA 5AZ2H 5LWYL 3MYJB 4TF4A 1J9QA 3OQ3B 2MQGA 2CO6B 3CXHJ 4R4ND 1WP6A 1OL0A 2OX5A 1W0VA 4Y4KA 5CJXC 3ILEA 1L6ZA 4FLOA 4ZXBB 3O9WA 3UMTA 2B5IB 5T5NF 3SDAA 3A67L 3O2WH 4WWKA 4XP1H 3CVHL 1JE6A 2PWDA 5CILH 5SWZB 2WCGA 5JIQA 3KBHE 1VADB 5ITFA 1RHHA 5C6TL 1QA9A 2OX5B 3QDGB 2Y25A 4TVSa 1CTMA 2F5AH 3P02A 4HIQA 5ADOL 2XTLA 1CBVL 2FHBA 3MFFA 3D25B 1Q4NX 3VJ6A 4QGYA 1DJIA 4TUOA 3BSZH 1FPTH 4MS8D 1TXKA 3HE6A 4EDXB 4L4TE 4G8GA 1UM6H 1NAKH 3VWJA 5GS1A 5J13C 3BWZA 1NOAA 2O5NA 5EO1A 1TPXB 3E8UL 3MLWL 4UAOC 1L4IA 4JFQA 4LLMA 4NZTL 5C0BB 2CR6A 3QJFA 1S7XB 2C3XA 5EO9B 3PWPE 5E8OB 5C0ND 4B9JA 1YEDB 5BO0D 4TVPD 1MY7A 4X0NA 3VI4E 1TTGA 2YUVA 1PYWA 3DOIA 2AK1L 1CK0L 1EJOL 2CXKA 3DX8B 4JFYA 2AJVH 3B2VL 1M3IA 4DVRH 4OF8A 3L17A 1S7WA 1UVQB 3S96A 4PJ7E 3BOVA 4HLJA 2B14A 5GIRA 1T2XA 5DO2D 2GCYB 3HI6L 1HIMH 4FYTA 1G7PB 4FQPA 4KI5C 4NDMA 5T1DL 1TNMA 2OCJA 1LP9E 3WKQA 4DPAX 2ARWA 4QRQB 2WNWA 3SZ6A 2IXQB 3JZ7A 3QE5A 4GKNA 4NO3B 3STZB 2QVMA 2OI9B 4OFPA 2EIMB 5ANMA 3TNMB 5KG9A 3K6NA 1FBIL 4FAAB 3WXWL 2WIIB 3DMMA 3RY6C 3C60A 3VH8G 2KLRA 3QYCA 4RVBA 3UG3A 4P5KA 3RUGE 4H2CA 3C6SA 3IDIB 4X0KA 4ZMOA 2XI9A 3SODB 2WINA 5IJBC 3HNSL 3L5HA 1HS6A 1T20A 4CSPA 2EO7A 2E8YA 4QJ3B 1NFDB 2WBJA 4N6RA 4WUUB 2EILB 3ZE1B 3WYRA 3RGVD 2OMVB 2VISB 2X3CA 4OAWB 1G7IB 3IMRA 4RWYH 4XMTA 3FT4A 1DDHA 2A6KA 1P84K 4XHQA 2Z35A 4DK6A 4BRVA 4W81A 2FX9L 3NACH 2G0LA 4AQ8A 3X11B 1KBWA 12E8L 4JPKH 3BZ5A 1KWGA 2PP7A 2DYPB 1FAKT 1ETJA 1F4XH 3A0OA 3M6DA 1C8QA 1YNLH 2A5UA 3CPUA 1MUJB 3O0RH 1KTRL 1JZ5A 3VA2C 3EYFB 4NQDB 4IRZA 2WXKA 4PJHE 4U3CA 4QTHB 1C1EL 1KJ3L 2H1XA 4NO0D 2K45A 4Z7OE 5DA0B 1BX2B 5T1KD 5C86A 1WFTA 4Y89A 1GZQA 4GRLA 3AXIA 3L2MA 5IQ9A 3TOPA 4KMTL 2F1BA 4XCEA 3V0EA 5E08L 2BNRB 3GS4A 2OKMA 4GP5B 4K23H 5F1NB 4F7EB 3DUHA 2BHUA 1S9XB 1YEWA 3UTPD 2BVPB 1XCTA 2ENJA 1MW0A 4QYOA 4WNQA 4U7SA 2ZUTA 5DJ0A 4IHOB 5A2KH 5FYJU 1RSFA 1HSAA 4LHUG 3ILDA 4PJ5A 1QBLL 1DBAH 3RJQB 1U58B 4F7EA 3OKMA 2X70B 1M7IB 3QDMA 1CXLA 2YGNA 4TXVB 4W6XB 2C7UB 2X5PA 4EBQL 2F53E 3FTXA 1ET8A 3QDGD 1JZEA 1WD9A 4QRSA 4AQ1A 5K1NA 4JZJC 1TEYA 5AW9B 4YVNA 2Z7WA 3L3HA 4YLCA 1H8LA 2XQBH 3T4AC 4JHWL 1XSKA 2OMWB 2CLZA 2FJFA 4PN6A 4UM9D 1RZGB 2XSKA 3S3CB 5L2KD 2GAZB 1BF2A 3X17A 4PJCE 2EDHA 3NBNA 5C0CD 4N2CA 4GMSH 1H15B 3JV4B 1WA1X 1BVNT 1Q9OA 4HIEA 1AJ7L 4U1LA 2VXUH 3QWRD 1U8HA 2BHFA 2X4RA 4YHML 4PJGF 5C0BA 3VRLF 5EEWA 2OR7A 3L81A 2ZUWA 1VKXB 1XCQB 3FQXA 1E3ZA 9CGTA 5GS1B 2L7UA 4CUCA 4B9YA 1XF1A 3HS0C 1VFAB 1Q9LB 3PHQA 3VDAA 4P9HL 4KK8C 1NCCH 1C16B 2WQVA 3DX7A 2VLKB 1WCBB 1YUKB 5F7AA 2DKMA 4KNUA 4F2ME 2YPVL 2ZXWB 5FUCE 4LF3B 1CLZL 4JCWA 1OAXH 4YHKH 4I4WB 2WIIA 4TNFA 3VFVA 2DI7A 1OTUC 5ESQA 2APVA 4KKBC 4PRBB 4F58L 1RULH 5IT2L 1N59B 5CILL 5FA3A 2PYFB 4WJ5B 4Q58C 3DX4A 3FW6A 4M7LL 1H3VA 1T66D 3NTCH 4JDTL 3VH8B 1LQBC 3VI3B 3BPNB 4UOW0 4RSYA 3MCLH 4JAMB 1A22B 1X5YA 2I9LB 3ARFA 4W9FC 4KU1A 4WZ9A 4YN3A 3UAJD 5F0MB 2IQ9L 3UZEA 1R24A 2DJMA 5BMFL 1E4KC 1KJMB 3PQYB 1V05A 1TO5A 3T77A 3DIFA 4X8XA 3SKJH 2MQ3A 2N0KA 4PJ8A 2X6MA 1R5VB 5I8KH 2WMPB 2LR4A 5F9AC 3CC5B 4HMEA 5FYKE 3DYMA 1A4JA 3KNBA 4LP5A 3LKNB 2PO6A 4QRRA 4CDGC 3B6SB 2XPYA 5F6HI 3EJTA 2JH2A 1CS6A 3FU0A 2UXGA 1S9VB 1P6WA 2EDFA 3BUYB 2OMBA 4Z7WE 5HHXL 3UDWC 4XXCC 2JLPA 5E9AA 2GEQA 2IPTH 2NY0B 4RIRA 5KVDL 3FF8A 1LL1A 3D4GA 3P4OB 5FIEA 4LAQL 4EOWH 3LKOB 1MJ7L 3BAWA 2LFGA 1E5UI 3D25A 3GLEA 2E6PA 3PL6C 1P69B 1GC1L 2OCCB 5EZIL 5KN5B 2AV7A 1B3JA 4MS8C 1CE6A 4NBXB 4PWJA 5D6DA 1AO7D 2D0HA 5GJSH 3E8VA 3NIDF 2HX7A 2OPCA 1NCHA 1UM6L 1IJ9A 1N8ZB 1UA7A 1ACCA 4MNQB 1E6OL 5EEVA 4G80A 4WWKB 3ARGC 4Z3JA 3OSKA 1P4BL 3D39B 1FC2D 4RZCB 3SOTA 4GRLD 4P5SA 1BZ7B 1VFBA 2AJ3B 5K33A 1THCA 5DQDH 5HYEA 5ABZA 1GTNA 2OTUA 4YE4L 2DQJL 2NNAA 3JTBA 5E99L 3SDXF 2IDTA 5JHDE 3O6ML 3HC3L 4HWBL 1JZ2A 1QFHA 1KIUB 4PJXA 4AQ1B 3EGSB 3DO7A 2RBLA 4TSAH 1GC1C 3FQRA 3OB0K 3VMPA 3V6FB 5CBEA 4OCNC 1W80A 2C7UA 5D7JC 5E0QA 5I82A 5I1KL 1KPVA 2W65B 3MRKA 5L9DL 5CF3A 4Z7VE 4HULB 2DB8A 3WE1A 1E2VA 3VYOA 2CPCA 4PJIA 3MV9E 7TAAA 4DPRA 5FX3A 2BC4A 5IF0B 1J1XH 3QZNA 3LZPA 2ZJSH 4PLOB 4ELDA 3CSYB 2PF6A 3IXAB 5JQHC 2FR4A 3GNMH 1HH9A 2NYYD 3NYKA 5C0CA 5KBLA 2DLEA 5FKPB 3ARPA 3NDZE 4NERA 2XVGA 4QKXB 5HDBE 4OZ4B 5FHAL 2EXTA 3CZSA 1MCKA 3PUUA 1WAEA 5CUSL 4ENEC 4ZTOL 5GJTH 5IF0A 5L8JB 4M93C 4X2UA 4OZIA 2W07A 4FLQA 4YDVA 3K1KC 4PMEA 5JR1L 4G11A 4QKTA 3CN4A 4OZGE 5FC9A 1AC6A 3O3DA 3QDJD 4MLSA 4AVKA 2A6IB 1Z5LA 5K9JH 1HDMA 3FSVA 3DRQB 5LLIC 1QBML 4I4WA 1Q1JL 5EOCJ 2DQFA 1EGJA 2PXYD 4R97B 3OB8A 2K70A 1HOEA 4L4JA 1E9PA 2H8PA 4XCFH 2IAAC 1CG9B 2J21A 3BSGA 2WWMC 3L3HB 2NY2D 5IJKC 3IGLA 2CIIB 4AM0A 1UM4H 3WDHA 1WWBX 5AOMA 3WE6A 1QA9B 5K59E 4FQLL 3IWUA 3JWDC 2P24A 3G6AB 2PWGA 3INUH 5EUKB 2LTQC 3MCLL 2NZIA 3N91A 4Z5RB 1YMMA 12E8H 2LTQB 15C8L 4EKJA 1TQUA 4JUTA 5A3ID 1QSEB 5FGCE 1I7RB 1ZTMA 3P3TA 4GINA 4K3GA 4XN4A 1F45A 4V11A 4CVZA 1D9KC 2GEEA 1YC7A 3ALXA 1KYDA 4WEBL 1QLFA 1CFTA 2GW5A 2R0KH 3AQXA 1IKNC 3DXAB 4N2HA 3ZZ1A 2LV4A 1U2CA 4HD5A 2MNJB 3FJTA 1LWRA 4PV1C 1FE8L 1GSMA 1DVFD 1NC2A 4ANVA 5CD5D 4G9FB 3B5GA 3RPIB 4QRRE 4NRXA 1HSBB 4IIZA 1AIFB 1NA8A 2GHZA 4Y1AB 2HLEB 3HHSB 5CCHE 2VE6A 5F3HA 3TIDA 4LCIL 4WTZA 3RWEB 2CKBA 2MCAA 2GTZA 4TVUA 1PZ2A 5J06A 2YGOA 3X3GL 5F7MC 1DSFH 1E8YA 5EO1B 5TF0A 4LRNH 1AR2A 3BQUA 4F8QA 3PQYE 4JZOB 4GLRH 4XP5L 2UWEA 2WAQA 4KUZL 3CZEA 4V2BA 4X42A 4XCYA 3T77B 3QYMA 2YPLD 4OLWL 2AS5M 3QWOB 3IBOA 3NRPA 3M1BB 1XHHA 4J23A 3DYOA 5CJOL 3AUVA 1DQML 3FO9A 5GS2H 4X4ZA 1KIUA 2CA3A 3DO7B 3T08A 5FO8B 5IESH 3GB7B 5MEOA 5CJQL 2NNAB 1J8HB 2PYFA 5CBAB 3QUXA 4HUNB 2YMXL 3QHFH 2CHDA 1CICC 1MZYA 1U8HB 5HHME 1NCWH 2AQTA 4Y9BA 4R83A 5EU4B 3D85B 5KANG 3P40A 3KR3H 2HJLB 4OUUA 4FF9A 1C7TA 1BSIA 3GB7A 2ZYRA 2NYKA 2F1EA 5K39B 3W1ZA 5JIPA 2Y7LA 5EIIB 1IKOP 4FJYA 1RZKC 2NCMA 4IS6A 1K3IA 1L0PA 4BFBD 4PJIB 3S2AA 5C7XH 3AROA 3EH1A 5DEJA 5GHWH 4M1DL 2G2PA 2IANB 3IKCB 2PWEA 3P3SA 2PYEA 5HVHB 3ORJA 1VGKB 3UTPE 3E7JA 4YL4A 1E8ZA 1KGXA 3B6SA 4GUCA 1KEMH 5DLML 4O2CB 5L4IA 1C9SA 3QI9C 2NDGA 1J9SA 3SKNB 2Q8BL 3PWPA 4U1SA 2FBJH 4JG0L 4ZQKA 1Q38A 2AJSL 4K94L 4R84A 1EAOA 3BVNA 3BWUC 3Q8BA 4IBYA 4QTFA 4AC4A 4G6MH 4JO2H 4NGHL 4YBQC 1MF2L 3V4PL 4N0UA 1ZK9A 1A7BA 4N26A 1OK0A 1FNAA 4L4TB 3QDME 5HI5C 4F24A 3HR6A 2AXHA 3D33A 4HKXA 3TO2A 1R1CA 4Y0GA 4O02A 4HUVB 3O3EA 2OP4L 3OX8A 1C5CL 4ZD3L 5TE6L 5FF6A 2WQ8A 3IFLH 5D1QD 2Y6SD 5JXEC 4XVUD 4FYSA 5B39G 2HSIA 1GL4B 4JRXA 5E8NB 4ISVA 4P46D 1KULA 4B41A 1H6FA 4D0BB 1QLEL 1L3NA 4YSRA 3GFUA 1JHTB 4K7PH 1J10A 3D52A 2VR5A 3DETC 3PWVA 5E2VL 1DP0A 3VE0A 5E1QA 1CT8A 4LAQH 2R4SH 2X0UA 5JW4N 4G8GB 3VWJB 5I73B 1X5XA 3RWJB 2OSLB 4P0DA 4P2CG 4W9EC 3MRIB 3HOGA 3WTVA 4RMBA 4YE4H 1N19A 1VIWA 1CLCA 3QG6A 1NC4A 4IRSC 4XI5C 2DJ4A 3C08L 1DN0B 5KYXB 3QIUD 4LSVH 4QI3A 4QCIB 1M6OB 4G6AC 3S37H 1AKJA 3EW3B 1XMEB 3UZQA 5ADPH 1HHHA 2YMOA 2X4OB 3N42F 4XBEH 3MUZ1 3BZEB 3LKNA 1AO7B 2N1TE 1BIIB 4PTUA 8CGTA 1HHIB 2BFVH 2A6IA 1FFTB 1HHJA 4G6FB 2ATKA 2IWEA 4XPGL 3NABH 5D5MB 4QRUA 2OL3L 5I0ZA 3IB4A 4N8VA 3ZKSD 3RUGA 1FZJB 3WMPA 2KLSA 1BQLL 2GHWB 1I9RH 5DVKA 1MAJA 1UWXH 3H4HA 3IRZA 3D4YA 3CUPA 1ZAGA 3BEWA 5DD1L 2AEIT 2X1QA 4Y19E 4N0RA 4GT7A 2B4CL 5CKGA 5G4MA 5IB4A 5ACZB 4LLDB 1LP9B 5E5MB 1OHZA 4XPTH 3RZWA 1MCPH 2NCEA 4AT6A 4TUKH 4QD2E 2O5YH 2DWSA 3DDFA 3B83A 5J57B 2OI9C 4AKPA 2WQXA 4ABUA 4YHLL 4LDOB 5TDPB 2BNQE 3GMOA 1RXLA 4L2YA 3KCPB 3PWLB 1IIIA 1UCBL 5DC9B 3HRZA 1ACYH 1UGNA 3LKQA 1XH1A 3PWUB 4AVIA 4Z3TA 1NWPA 1LK2B 1TETL 3N50A 1KACB 4XRCB 1I8KB 3UZVA 5EMYA 4DO6A 4Z3FA 1PGRB 4Q0XH 4GG8B 3MV11 4ZFOL 3A6BL 5ISZE 1RLWA 1XD1A 2GABA 1PZ3A 1V3KA 4UT9A 4FQJL 3G08B 4PD4J 5EBWB 1WA0X 1HSBA 1UQSB 4FQXD 5EZIH 3FDWA 4Y19B 2Y5TB 3MSPA 4UU9A 4EI6A 1SMOA 2X41A 5GJSL 4E68A 3GSNL 1UJTA 3N9GL 3L2LA 4GI8A 2GIYA 4JFED 4YLQT 1MLBA 1G7IA 3C8KA 5GGTL 4RFNB 3UBXB 4YSAA 1YNKL 3D69B 4JJ5A 2ICEB 3VXRD 1CFTB 4TTGA 2Z35B 3VMNA 1I9JH 4CSSA 3UJIH 1T4KB 4F3FA 5DO8A 1SY6A 3UAJA 4HF5L 5IWLA 3U2SA 3VFUA 2EH7L 1AD9B 2WWMD 3I2CH 1N0LB 5HJ3B 4HKBB 3DV4B 4MMZA 1ZVYA 1DBBH 1R6VA 3DNKA 1TKWB 1KGJA 4JLRA 2HRPH 4RAVA 3VXUE 2M26A 4L8BB 2PXYC 3SGJA 3V8OA 5DEZA 5FW7A 4PRAA 2W0FB 3SDAB 4TSAL 4KX9A 2PETA 2XWTB 2JELH 5FS5A 3SB3A 4D3CL 3WNIA 5IQ9B 5KWYC 2J57A 2QADD 5JQ6L 4JY5L 5DFAA 5J9PA 2C3VA 3HB3B 1G7LB 4DP9X 4EUPG 1UXSB 2UXTA 3II3A 3DJRA 3QGVA 1TLMA 1OGAD 3ARQA 1X7SA 1W0YT 2HN7A 3WNNA 5DC2A 5DGRA 3B2MA 3CFDA 2ZXQA 3UBXI 3IMBA 1R3IL 1U33A 2R2BA 4YAQB 4AV5A 1TG8A 4JFVA 4IOIB 3LQZA 1KXVA 3LRHA 2DQUL 4Q7DA 3ABLB 4KNSA 4NJAL 4HWNA 4JO3H 3VXME 3BPCB 3IM1A 4WGKA 5DMKA 3ARBA 2PLTA 4BSVB 1IIKA 4TQ8A 4NN6B 1RIUH 1ZHNB 3FQ1A 4LFHG 2MTAA 5DHYA 2H6PB 43C9B 5GRUL 1YPZB 1F11A 1RH8A 4HXAL 3RY5A 1CD1A 3CN3A 3X1FA 4OJAA 1JYWA 4KKLD 5I1AB 1HINL 4NFBA 5GS1C 4JQIL 2FD6L 5MENA 2H1PH 4P5TB 3MFFB 1L9RA 2EUWA 5KS9E 5DC0A 4YOKA 4GUPA 5FXCH 4IRJC 1YNTA 2IALA 3IU3B 5KS9F 3TWYA 1VKXA 4ODHH 2AK4B 3MJ7A 5AKSA 2VTFA 5EU5B 4IU2A 3F7KA 5EZJB 4E5XA 3FBQA 4GW5B 2BNUB 4LLDA 1ZLVK 3CBJB 4MMXB 5D6CA 2EUXA 3T65B 3PV7A 5HD8C 4JFTA 4LCCC 2MCMA 1JGLH 5BS0A 4MMXC 4ANWA 2EDYA 3F6LA 3ESPA 2XXGA 4FNRA 4GFTB 3L7FB 4J3OG 4OQTL 1K5NA 1KLFB 1XZWA 3O0RL 3L3DA 3OC5A 2J7LA 2ZOKA 2YAMA 5B4MD 4J3OH 1J88A 5D2NE 4NQVB 4YFLI 3GRWL 1UC6A 2YUZA 4Z7AA 3WTUA 2F74A 1FQ9C 4P3DA 4KHTH 4U1MB 3ZKMD 4Y4HD 1TJMA 1SMDA 4P59H 1FG2A 2I9LA 3E8UH 1Q1PA 2Y1AA 4XVUC 5EOQL 4H1LB 1RUMH 4KZDH 2XTJB 2BXZA 5HDOA 4KKNA 3II1A 1YYLH 3AWFA 3KPMB 1GZHA 2BX5A 2DI9A 4DNLA 2ZWKA 4F9LC 1EUTA 4GW1A 3UBXG 1D9KD 4N2GA 3G5YA 2I07B 4FXGC 4E9TA 4WKZA 1MLCA 1ESOA 4LVOB 4MDJB 3RPKA 2WUCH 1D6EB 3CFCH 5FWQA 1MCLA 1DQDH 3I84A 5CGTA 4BV1A 4PS3A 4CSZA 1T80A 5AVQB 3IETB 4EN3B 1CL7L 2I26N 4ZUUB 5IB5A 3BUYA 3FFCE 2FIRT 4AQZA 4IJTA 2DD8H 4X4YA 1E8WA 3C08H 5AAMA 1JV5B 2NZ1A 2XXMB 1MUJA 2O6CA 2WKLA 3CFQA 3FQTA 3QNXB 4JFEA 3IPFA 5GS0D 3QAQA 4ZXBA 3WMSA 4ZX4A 4YBQD 1JYVA 1ND0B 2UZYA 2PN5A 3ME0A 2DMBA 3MLYH 4U1NA 4JQIA 1LGVA 4XXWA 5E0FA 3AQZA 3MO1A 4OU3A 2JIXD 2B9BA 2AQ1A 3HZMA 3KW7A 4XX1G 2LVCA 3WD5H 2FO1A 1LNUA 4AEIL 3GSUB 3C6LC 1H5BA 1C7SA 1OCOB 1K4DA 3VG9B 1WT5A 4J4PD 2MFNA 2MOQA 3MLRH 1R3JB 4PJ9D 2I24N 5GGSY 2CM6A 3E3QC 3ZDXF 3MLVH 5CEYA 3NSDA 4ZPTA 5I6OA 3AU1A 3SKUD 1SYVB 4N2OA 2A73A 4Y9CA 3FRUB 4LHQB 1OCWL 1SHXA 3PDGA 4C4BA 3TBWB 5EO0A 1HT6A 1FZMB 2V2XB 5E4AA 4JG9A 4BE5A 1A21A 1MHPL 3EJZC 2YAOA 3BP5B 4N0FB 3GGWB 3RDTC 3RWIB 2BS71 3TVMD 5E8NA 4HG4K 5C7ZA 4LCCA 2BCKB 2F6AA 3O8XC 2Q3XA 4KY1L 5A2BA 5IQLA 2VDOH 5IHZB 2XWJA 2F7RA 3BP6A 4YQXH 1UZ6E 3SBRA 3X12B 3C5XA 2ZTBA 5HVWA 1TEGA 4UI2A 2OFQA 3S5LB 3MV9D 3FQUA 4W9JC 1SVCP 4NQXA 4FLRA 4KJYA 4XBGB 5IKCB 1B0GA 1QTPA 3G04A 4DEPC 2UZIL 3GHBL 5GRVK 2QJDA 4OZFH 1A2YA 3WEBA 5LJYH 3BSHA 1YY9C 3IU4H 2HJLA 5C0BD 5IFAH 3PLYA 1JZJA 3U83A 5A6MA 5HHOB 2R51A 2XZAL 5DJYB 2EXWD 2A9MH 4FCHA 4GNKB 5CCJA 1A6VL 4I89A 1L7TH 1S7XA 4LAJH 5EO9A 4C4KO 1G9NH 3CFBA 1OP4A 2GJZB 1OE2A 1IGYB 2ENSA 3BE1H 2Y6TE 4RGND 5C07A 3RILA 2H41A 4L05A 4OLVH 4NKIH 4G43B 5HHMB 5EEXA 2CHXA 4OSUH 4JGNA 2WXQA 4YFDB 2FB4H 4BSJA 4QOKB 1IBBA 1OY3B 4NUGL 2P42B 3V6BR 4YSDA 4WTWA 1T20B 4P4KD 3VYNA 2R69A 5J4MA 2XY2A 4AENA 4XTRC 3V0VA 2ROYA 2Y24A 2MNWA 2HH0L 1RUPL 4K3HA 3GJEB 1V7MH 4OQTH 5IB4B 3QUZA 4X5RA 3HG1E 1W72A 4LVNC 4PWFA 2BP5M 3IDXL 3WUZA 1BQHA 1OANA 5J6SA 4F27A 4RDQF 3WELA 4DP8X 1IO4C 5GSRA 3BCFA 3RFZB 2Y9RT 1ET7A 3TZVB 4MB1A 4ZX3A 3BDXA 3NGBC 4M7KH 1KYOK 8FABA 3MNDA 2L7QA 1N5AA 4UV4H 4X98A 1T4KA 5HHPA 4OB5L 3COOA 1ITCA 2ITCB 5IWLC 1HHJB 4LEBA 4N2DA 5DWUH 1N6QH 5IVXB 2F54D 3RWFA 3CLEH 5B1JA 2XQYK 3DXAE 4U3SA 3U9PH 3V0JA 3GKWL 1BQLH 1ZLSL 1CLVA 4PB9H 4D0DA 5JHDD 2VDKH 3VCLB 4ZOCA 1O9WA 1ND0A 4JO3L 3SYAA 5KJ7E 4WSJA 1M7XA 3W11D 2PCFA 3BLKA 3CXFA 4X4MA 3SDAD 2CO7B 1F42A 4U0QB 3S8FB 1OSZA 1G43A 3HC0B 4DZBA 2ICWA 5BV7B 2A4CA 1AG6A 2W0LA 2ZP9A 4BHUA 4Z7NE 3E6FB 2CJ3A 4ZFOA 2LOEA 2XETA 5L6YH 5L2JB 5IVOA 1BDYA 2YAHA 2AXFA 2FYYA 1HCYA 2AXWA 5IR1B 2HN7B 3UEQA 2N0MA 4EJ1C 4JKPL 2X2UA 4GYBA 1RSYA 4HBCH 3SPGA 3DVNB 3GMOB 3GSNA 3VRJB 3F7VA 1NC4D 1S8DA 3L5XH 4DTGL 3E38A 3FOLB 1U93A 1UATA 1NCNA 4EI5C 5I2IB 1TQCC 3PABA 3WS6C 1Z9LA 3EOBA 5DU7A 1G1KA 5GZNA 3QFGA 3T2NL 3NEEA 5LG6A 1KDIA 4RLDA 5AZ2L 3UTZA 3V4VA 1D5ZA 4R0LC 4Z7QE 4FABH 1UXLA 5C0EB 3HG1B 5D7IE 5D72L 3ARUA 1PZ5B 4R7DB 5B4MC 2H1PL 3F12A 4LOUD 4Z7QF 5HHOA 5D7JD 3VRIA 2KMWA 4OZGB 5FHBH 4GP8B 4NT6A 1OO2A 5C0CB 4MCMA 1Y7VA 1L5GA 3GK8L 4CU7A 3R7QA 3H54A 2I32A 4EDWL 4KKRA 2WZPD 1C16A 3DX7B 3IXTA 3MLPA 4JFFA 3EYQD 3QFJA 4MJ6B 4PTTB 3SDDA 2OCFD 3JTTA 4X9HA 3QIUC 4YSCA 1VERA 1G1OA 2FO8A 1DE4B 2ZCLH 3D69A 4JJ5B 3EOAB 3VGHA 3GMLB 1NANI 1ZV2A 3NIFB 3O45A 4CMHC 5IOKA 3GHEL 3UMNA 1HK6A 5LGKA 1D5BB 3VB8A 3W0WE 1UZ6F 4FE9A 4IU2B 5IQ7L 4JNXA 1MCHA 1OCRB 3B9EA 4FFVD 1GGIL 2DKUA 4Y5XB 3BYYA 3VACA 3QO1A 3REVB 4HSQA 1CJYA 3FU6A 2UZIH 2EE9A 3CH8A 3G08A 4Y5XC 4XMWA 5LDUA 5ID0A 1CCZA 1NGPL 2Y7NA 2H2PC 1IX2A 1FAIH 1IBHA 4Y5YB 3VFSB 4LLWB 1JYNA 1PD1A 2WXMA 1KIRA 3GM8A 4LOEA 4KUCD 5CEYB 5JQ6H 5C09D 1EFXB 4Y5YC 2K4WA 1DLHB 4UTAA 1BF8A 3H9SB 4MZRA 3NPSC 1VADA 3B2PA 3QJHA 5HGDB 4ZFZB 3BH8A 3ZKXC 5BW7C 2P43B 5LAXB 1PU0A 3QUHA 5ACLA 3T0WA 5JW3H 1CXHA 3TN0B 4G8IA 1QQDB 5HVGB 1X4XA 5EU7E 2IPKA 3PDOB 5MEPB 4YHPB 3LPPA 4P3WA 2DQUH 4A6YH 4OD2B 3WXVL 2ZJSL 2CR0A 3K46A 4XPBH 5FF6B 1SXNA 3Q48A 3CIQA 3CJJA 1KTLB 2NT0A 5FO7B 1S7QA 3JWNG 2F53B 4DGIL 2ZP8A 2VJXA 4G5AA 3HMXA 4UTAL 3WFEH 2ZKYA 2OYMA 3WNOA 5IKCA 4HXAH 2VWEC 2XV6B 2XXFA 4RQQB 3NSYA 4WI6A 3FT9A 3MLVL 4XN8A 3SE4A 4KDTC 1SOSA 4N2MA 1T0NA 1T5XA 1YHPA 2D7NA 3FONB 4G3YL 4I18A 1TQBC 4TM9A 4Y2DA 4PLKC 1DBML 4CVXA 2CAKA 4NQEE 1QBMH 4PMFA 2D3LA 2B4CC 1E50A 3MV8B 5EZLB 1XSIA 1ZOXA 4ACTA 2I9TA 3Q43A 3BGAA 4JO1H 4RWYL 4BWWA 3MOBH 1FH2A 3T8VA 4J27A 2VMDA 4AYFA 4NQDE 1MWAB 4WFEE 3IJEA 4E9VA 4NP4H 4XB8A 2VLMD 3UTTD 3RZCA 1EEZB 1HQRA 1UOLA 1QR1B 1XIWD 2FYVA 4JFFE 1ODAA 5FYJE 2NY1B 3ULAB 4QPEA 3FHEA 1ZLUH 1M71B 3ZOAA 1JZ7A 1R4XA 2CA4A 2NY1C 3UROR 3P4MA 3FYEB 2OSWA 3IJYA 3F12B 4C83A 2G4EA 5FKAB 1T5WA 4N2AA 1JWSB 2EXYD 4V1DB 4PJEB 1K5WA 1CYXA 4IBQA 2HMIC 1QD0A 5C0FA 1T6WA 4Z78B 3DV6B 4CJ0A 4QRBA 5FO8A 3NUKA 1G7PA 4N22A 3D2UA 3LVTA 2ICCA 3GMPB 2P26A 3LD8C 4KRPB 3V0IA 4AYMC 2VZ3A 1PF3A 1B4RA 2AJVL 1N6QL 1JN6B 1I8IB 5EOTB 4HJ0D 3TBTB 3ESNA 3QUML 1ADWA 2NX5B 1BAFH 2CUMA 4G9DB 5CM1A 4NQDD 4WFED 3EDJA 1GS8A 5HHOD 2EIKB 4JANB 4MAYA 2DD8L 2RFXB 4Y7OC 2V7NA 3QUKB 4GG8A 1ZIAA 2BOLA 2CGZA 3D48R 3OJVC 2XQ0A 1DQLH 1GVIA 1IQWL 3E0GA 4PM1A 5LG1A 4P3CL 3SKOB 4A2FA 5BV7H 3QISA 5GXBB 5F8RC 3R8QA 1RZQA 1HH9B 2BSSA 3FTSA 2Q9OA 4NQXB 2KZBA 2HFEB 4DETA 1A25A 1I3RA 1CFVH 1UT2A 4JB9L 2VKXA 4KJYB 4WW2F 1MHEA 4XBGA 4G1MB 4MJJA 1HJCA 1H0DB 1AZRA 2WQSA 4I0KA 5KS9B 5DYFA 1GGIH 1MG2C 3P9LB 2EIZA 3M45A 1FV1A 5I66A 3D0VA 2BP3A 1SBSH 3UPCA 1EZVX 4R3SA 2GK2A 1BFOA 3BAEH 2GJJA 2DDQL 4G83A 4B27A 4MQ7B 1Q9KB 3RJOA 5KJRH 3S4SA 1OW0C 2JTDA 3FH8A 4LKXB 4PQXA 3WXWH 1DO6A 4JM2C 3FO1A 4OKDA 3LEVL 3WLWC 4YXKL 4BXVA 4RFEB 2EQDA 2R23A 2CIKB 2X89D 3H3BC 4MNGA 1GKEA 3CBKB 5HHVL 2AK1H 4O5LL 1FNEB 3QCUL 2APXA 5A6LA 1EO7A 2C9VA 2ZP0T 4XN9A 3SKMB 3TU6A 1OD7A 4QF1B 1BVKA 4BFEA 1KZQA 2WTOA 1LNUB 3EH4B 2YSSB 4NM8H 5F72S 1KTLA 4LL1A 5H2BB 5JXED 1YSOA 2JI3A 4UF7C 3KJ4B 4L0PB 1GOHA 1AO7A 1M53A 2YJQA 2W9DL 4N0CC 2J6EA 2MHAB 1QFWH 1WAAF 2I5YH 1BXVA 1F6AB 2R0WH 3SBQA 4MLIA 3MTRA 4P99A 1JGVL 2L3BA 1X9QA 3ASNB 2JMRA 5JNYB 3LQZB 1YEHL 2E9GA 2VIRB 1TTRA 1GCYA 2O6FA 3CN0A 4PGBB 4Z23A 1ORQA 4X7TA 4LGSB 2G5UA 2OSLA 3GXFA 1U91A 5DJZB 5E2UH 1J5CA 1XDTT 4TUJA 3QCVL 4F92B 1U8NB 2XWJB 2Q20A 1MW3A 4KI5E 1T22B 2P5WB 4ANKA 5HY9B 2AGJL 3DV6A 3I6LD 3A6BH 4HWZA 2XIBA 4R90H 2ENQA 2Y2TA 4GEJA 4O4YL 2WB7A 2VMCA 2I7OA 2BJML 2ZXDA 3EOYG 1FH5H 3HFML 4OCSH 3MOAH 5DJ2B 5AZEL 4F5CE 2JKRM 1KCRH 2NDFA 3GSNH 1CE1L 1ZMYA 3CFTA 2J8UA 5C0FB 1IM9D 2P8MA 4A6YB 3ZYJA 3UC0L 1KY7A 2Y36L 4FERA 4G5ZH 4KKZA 5FHBL 3U6XA 4FQHA 1PG7H 4NOBA 5KAQG 3QEHB 4LOUC 5FKAA 4JFYB 3OAZK 4LLWA 1IARB 4PRPA 2Y1ZA 3CFBB 4C56D 3SYOA 4P05A 3L3KB 3L7FA 3RVVD 3EYQC 1D7DA 5CLWA 1UKQA 2DQFB 5TPWL 5DD3H 5CNHA 3L4TA 1IGJA 5I30L 5BNXD 3QJZA 5KYYA 4XC3L 1RZJC 4E42A 1XGRA 1ETB1 2JQMA 1NQBA 4XXWC 1CMOA 3EAKA 4UQAA 3TBTA 1TTFA 1NPNA 2KQNA 4JO1L 3VFMB 2XKUA 3JUYA 1NGPH 4YHYB 5JYMA 3HRPA 4LL4A 2WGNB 4HWUA 1P5VA 3TTSA 4LPYA 3KZ8A 3WIFA 2BSSB 2H3XC 2KHAA 4NQQA 4Q6KA 4YE0A 4A2DA 5I8CA 5KYXA 2OK0L 4G1EA 2P80A 1Z9NA 4DPCX 3B4NA 1PVHA 3P3UA 3QDJE 3U0TA 2Z64C 1TTCA 3OKEA 5CIPA 2CUAA 5KZCB 1AYOA 1GY1A 1F1GA 4R8WL 5E9DE 2FJHB 4F80A 5LQBL 1FZOA 2QQLH 4Y5VB 4YLBA 2XA3A 3DTXB 2Q7AA 4ELMB 3HE7B 3TN0A 1NAML 3GMNA 3QDGE 1WZKA 4NZJA 3WXVH 2IV9A 3FO9B 1XGQA 3LN4B 3BX7C 4P49A 3CXDH 4X5PA 4I1PA 4UCFA 1OTSD 3SEPA 5KSUA 4TQPA 5DTFA 2YK1H 2HLAA 4KK6D 5I76A 5HGHB 1MWAA 5JIKA 4EQ2A 5IHBA 4PVBA 4ZMAT 3RL2B 2DTMH 1KNOA 1XR9B 3HZMB 2GTZB 3RNKA 1QVOA 1W6LA 4FFYH 4MJ5A 2W38A 4EUPA 3L3JB 1FVEB 3QJHB 5HGDA 1P5UA 2ICWB 5K9JL 4IBWA 4LB8A 1FIGH 1BAFL 3BUPA 1BEYH 3HLKA 4KK8D 3VFPA 1G4RA 5IHWA 1JTOA 1MRCH 3WI9A 3D3VD 3CSGA 4AYEC 2W1NA 2CBOA 5JUEH 4UQDA 1OSPH 3EYVA 3TPUA 5DJAA 5F2FA 4P9ML 1INQB 5AVSB 4R4FL 4S1DD 1WC7A 2WXHA 5FAAA 3P3YA 2PYEB 1UM4L 2WXIA 5GGVH 3JWNC 1TJIH 2V3DA 3I6GB 2UY7A 2Q3AA 5AKTA 2GG1A 1P7QA 4G1MA 1FP5A 1H0DA 1XGZA 1KUMA 3RAJL 4MX7B 3FU5A 1P4IH 1CD1B 4KJQD 2R1YB 2XVBA 3W82A 5K39A 3M1OA 5MEQB 3L3GB 4AJ0A 2GITA 2EE2A 4N0UE 4UU9B 2FQGA 4NO0A 2RCSH 2RIKA 4I18B 2V7NB 3QUKA 1JPGB 1FL3A 3TEXA 5LGJB 3DUUB 3LZRA 4QO1B 2QBWA 3D4ZA 4J3OC 2D0FA 2OTWB 3HNTL 3ZE2E 5DJYA 4I2XB 4JFWA 2JK5B 1MHCB 1EO8L 3H85A 1JNHA 1T0MB 3S7GA 1ETZA 1NDGB 1LWHA 3QEHA 4MA7H 5FM5O 4KZEL 4A67A 1NGYB 4HT1H 4OJEH 3REVA 1ZTXE 4M1GL 3KMDA 3VU1A 4DVBA 2KPWA 2V0AA 2YUXA 3MOAL 1VEMA 2JKXA 3M7OA 5FYJL 5I1JL 1A8ZA 1LD9B 1JNHB 1T0MA 2FRGP 3MJ7B 3FT1A 3KYOA 2F61A 4JFFD 5FYJD 2A6JB 3TBVB 1LP9A 4QDGA 2Z8RA 1WTGT 4G6KL 3L3IB 3LRMA 4J7RA 5E7FA 4AT6B 4OCXH 5I19H 4MQSB 2IWKA 4LVNB 2YC1B 3TNMA 5ANMB 3DDGA 2X7LA 3HR5A 4K5PA 2DPKA 3QJQB 2IH3B 4UM9A 1JZ8A 4J2XA 3KPOB 1O75A 5CIPH 3APCA 4I88A 3K0YA 5IVXA 4PJ9C 4XO8A 3EHBC 3Q3GA 4B3VA 4AEIH 5IESL 5D93C 3VCLA 3EG9A 4PY8J 2YC1A 2IDCA 4NSKA 3VFUB 1BD2A 3HCVB 2ATKB 3QQXA 3L45A 5GSRB 5KJ4A 4LSTL 2ERJC 1ZANH 1AC0A 4XHJD 1J0KA 1QFOA 3FB7B 2V2TA 3BPLB 5D1XE 3ASWA 2X6VA 1N5AB 1BG1A 1U2YA 5D1XB 3FULA 2VN4A 4G71B 1PTZA 5D1QC 2XYCA 4FI7A 3X11A 5GRVL 4GS7C 3VXQB 2ZUUA 1KN4L 4TL4A 2ORBL 4J3UA 4JRLA 2B3RA 5CLXA 2EICA 3BUDA 2VYRE 4HV8A 2D31A 3ARDC 3AG3B 4JFQB 4U1HB 3FONA 3CDFA 1QYGL 3DX3A 4N87A 4G9FE 3DBXB 4BZ1H 5BV7C 3QK0A 4BKTC 1CI5A 3H2WA 4JBSA 2YEVB 4JN1H 3DJZA 3IETA 4EN3A 2FQDA 4HS8L 1AGDA 1UA6H 3CK0H 3V52H 3MMEB 1ZV5A 2VM4A 1SHSA 4LBEB 4U1KB 2JFCA 4KDWA 1W6WA 3QI9D 5DA4A 2XRAH 1IBZA 5HGHA 3PWUA 3TYFA 1KELH 2IH9A 5CWSB 1F3DJ 3K72A 4PG2A 2A9ML 3QXAA 4QHKI 1B4JL 4ZUTB 1RZJH 1HSAB 1LO0H 1ZT4A 4PB0H 3NPZB 4KAQH 4DGVH 5FGCB 1KBBA 4Q9RH 2XACC 2BRQA 5ALCH 1T6BX 4NDMB 4PGZA 4FFYL 3MRFB 4M8QB 4LRNL 1QO3A 2TRHA 2AHIA 3L1EA 1GR7A 1EZVY 3TPUB 5D71H 1BGXL 1JFHA 1X5ZA 1HFUA 3WN5C 4PJBF 2NMSA 4J3XA 3UTTA 3RZCD 2Q1EA 3SDCD 4FQLH 4U7KA 2ZCZA 1Q94B 1JGIA 1MNUH 3ZHNA 4KO5A 4UZUA 5SX4I 4E2OA 2WO4A 4YHNB 2XFGB 5FHAH 5F0LB 3T0VA 1AQHA 1HQ4B 1YY8A 1H8NA 3JQOB 3CG8A 1WBZB 4MA8L 1G87A 3DA0A 3GXUB 4H44C 2QPDB 1GZHC 3CN2A 3BUTA 2WO2B 1OGPA 1GS7A 3MRHA 2WP3O 5AOLA 2A6KB 3IKCA 3O45B 2Y3AA 2P8LB 3EOAA 4FULA 3QIWC 4GRWB 4J3VA 5FA4A 1MQKL 4I3SH 3MLRL 1E28B 1YEEH 3BT2H 3UG5A 3S8GB 2YD5A 3ALPA 3PHQB 2D4FA 1U3NA 3D50A 1MCWW 2X4NB 5PCYA 1UWEH 2QTVA 2NXYC 3B3IB 3U2IA 4QNPE 4U05A 4KXCA 2X1WL 3HMWL 2XVKA 1UKTA 3FHQA 1W8EA 1G5AA 2Y06H 4KDVA 1CDHA 2BSBA 5HYJA 4OM0L 3FL7A 4XPGH 1IGJB 4YHZL 3BW9B 3T2OA 2XXCB 1I1AA 3QUZB 3QARA 5D70H 2HVBA 1VESA 4M8VA 4UIKL 5MI0C 1DVFC 1DLHA 1MDTA 2HJKA 3TX4A 5CD5C 4XMKL 3P3RA 1UCTA 4Y9GA 1BVZA 5D2LB 2WK2A 4WWOA 4Y4KB 5JW4R 3FUIA 2JE8A 3H2QA 4ZUSA 4L3EE 3P0YL 4Y4KC 5EB9A 1F3RB 1JWUB 2JTYA 3SDCC 1A7PH 2Z31B 4YDNA 4LEOB 1ZPUA 2W60B 1WF5A 2F2HA 3EYOB 4FQXB 5GHWL 2FTAA 3SDXE 1MJJA 3FHAA 4QXTB 1YAZA 4X4YB 1ZPLA 5DMGC 2F54E 1KEGL 3GXDA 1TUPA 1IGCL 4WEEA 3UYOD 5J3HD 2EXYC 2CMRH 3BP5A 4Y9FA 1JXDA 4NBYB 2D73A 1NUDA 4TQIA 3SN6N 2DM2A 5FYLL 4DN4L 3KPMA 1U41A 2WJ5A 1FL3B 4LLAA 4Y1AA 3CXDL 1IAOA 2AGJH 4ZQTA 1JDCA 2AC0A 3IMUA 2I07A 3MNZA 1Z66A 3IFNL 2BINA 1WS7A 4Y1TA 2HXAA 1KXVC 1PLBA 2N7SA 2PUQT 1L3WA 4O4YH 4MYPA 4AMKL 2ZONA 5B1JC 4DKAA 4YDIH 2X28A 1SMAA 4Q14A 1CBVH 3QDJA 2DLTA 3WLBB 2X9XA 5H37A 4M5TA 4NNYB 1KNOB 2XHNA 3EFOA 4GSXA 5DJ2A 5HHPB 4POYA 4X8CA 4WEMB 1B3IA 1DBKL 3MRBA 3NIDB 2NY2B 4R2GD 5DI8A 4DP6X 3X13A 1UH2A 4AQEA 2G3NA 5HPOA 2UZXA 2X38A 4L1BA 5AVVB 2H2PD 2ODHA 3O6FC 3CZJA 3B7YA 1T89C 1NCBL 3F84A 1WFOA 2VCOA 3N44F 4WI5A 4BFOA 3RX5A 5CBAA 5CWSA 4G80B 4ELMA 1OARH 3VXRE 1IT9L 4J12A 1WUZA 1ZLDA 3EOBB 2MKWA 3HLAA 1S7RB 32C2B 3ZDYB 2P45B 1CGWA 1FJ1B 1L0YA 3POCA 1CGXA 1MKFA 1MEXL 2EDQA 1CXIA 5JW4Q 3IRCA 4I1RA 2HFFB 2WLHA 1U3HB 3THMH 4HUXB 1DVYA 5IM7A 2ZCHL 4X6DA 5F1IA 3V0VB 1TZIA 3OPZL 5ISZD 2H4EA 3K2UL 5DVPA 3WKPA 1JMZA 1RK1B 2P8LA 5FA4B 4FFZL 4NC1E 4DCQB 2AMGA 3BFOA 3LPFA 1KJ2A 2ENYA 5TQ0L 4JHVA 4LARL 4L8SB 3WJLC 5TGBB 2M83A 5DVLA 1S5HB 3PGFH 5BS0E 5DDHA 4LCWE 3RVXC 3PHAA 2GPZA 4PD4K 4X9BA 3X1EA 4F7MB 1A3RL 2E5EA 4U3XA 5F21B 2J72A 2VUYA 1H8SA 3QUYD 2D7PA 3L5IA 4NT6B 4S2SA 1QLRA 2LLNA 2X12A 2XTSA 5LBSA 3OG4B 2OMYB 3NSJA 3U0PA 5C6WH 2VXSH 3CSTA 3LS4L 1KENH 4P06A 1OTTD 5SV4A 3QJSB 2EE6A 2EDLA