2HLEB

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
138
structure length
133
Chain Sequence
b'IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVQYEYYKVYMVDKDQADRCTIKPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-B receptor 4
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
total genus 23
structure length 133
sequence length 138
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hleB00
3CZUB 1BQRA 2FNWA 3EH5B 1A65A 1PY0A 4A66A 4AKOA 1CYXA 3IE9A 2XUWA 1PZBA 4W9ZA 2OV0A 2DY2A 3PAUA 1DZ0A 1N68A 3NJMA 2B3IA 2VN3A 4YSPA 1PZAA 3QPKA 3X2QB 2TSAA 5I6KA 1XB6A 2BW5A 5I26A 4KNSA 2DWTA 1ASOA 3UGEA 3SBPA 4E9TA 2FT6A 1WA1X 2IH9A 3V9EA 1L9PA 2MRYA 1N70A 2X87A 1GS6X 2MTAA 2PPDA 4JHVA 2BWDA 3G5WA 1CURA 5B1AB 3OD3A 4UAHA 2XX1A 3X1BA 2AANA 2J56A 5I6MA 2FQGA 1MZYA 1SDDA 5EHFA 1RZPA 3T6XA 2R7EA 3OMIB 2YAHA 3NJNA 3SQRA 1AS7A 1JXDA 1TEGA 1JERA 1V55B 3PAZA 2Q9OA 3GDCA 2PP9A 3OQRA 2EINB 4YSDA 2QT6A 4AI7A 1JXFA 1MG2C 3AY2A 5F7AA 5F7BA 4BXVA 1GY2A 1PF3A 3AG1B 3X1EA 1BQKA 1ZPUA 1PNDA 4DP2X 1PMYA 2ZONA 1GSKA 4N8UA 2VW6A 1JZHA 3V9CA 4DP8X 2YXVA 2LLNA 5TK2A 4KO7A 1AZCA 1OCRB 3FU7A 2EILB 1L9OA 2HX9A 2Q5BA 3WKQA 2AVFA 1QNIA 1F56A 2PLTA 2GB2A 3T71A 1CUOA 1BXUA 1ET8A 2CAKA 3ASNB 1GS7A 3AG2B 3ABGA 1CYWA 2P80A 2IAAC 1ID2A 2XLLA 3QJQB 1AAJA 1IBZA 4KNTA 3TA4D 4F2FA 2H3XC 1OCCB 1AZUA 2P80D 1RKRA 3ERXA 3WNJA 3H4HA 2ZOOA 2Y1AA 2N0MA 3FQ1A 4A67A 3L45A 5IY5B 5B7MA 3CDZB 1JZFA 3UADA 3TASA 1GYCA 2UXTA 8PAZA 1OCZB 4UF7C 2CUAA 2WO3B 1KBWA 1M57B 2UXVA 1MDAA 1BAWA 1OCOB 1A4CA 2H5UA 3WKPA 1JZGA 4HAKA 1VLXA 4BWWA 4BXSV 3T6VA 3UAAA 2HX8A 4GP8B 1J9TA 3JTBA 2IDUA 1AG6A 4RH4A 5B1JC 1L9SA 4HCFA 4KOCA 1KDJA 3CVCA 4K9JA 3X1GA 1NIBA 1SHWA 3ABKB 2YAOA 1W6LA 3FSZA 1ET7A 4DP4X 1J9SA 3HEIB 2ZXWB 1YLBB 4N4YB 2E86A 3WNIA 2BHFA 1NDTA 1SF5A 2DV6A 3DIVA 3FPYA 2XYBA 2YAPA 5E9NA 1BQ5A 4KO9A 4JHUA 2GHZA 2IH8A 1PLCA 1RCYA 1IUZA 2PPCA 4DPAX 2VM4A 2GI0A 3AG3B 5AZUA 1FFTB 1IKOP 2VSMB 1WS7A 4E9QA 1ZV2A 5D4JA 3ABMB 1SFDA 3IN2A 2XU9A 3OMAB 2IWKA 1L9RA 4PCYA 3NJIA 4M4RB 3S8GB 1JZEA 3HB3B 1V54B 2BP0A 3TU6A 1X9UA 1KV7A 2QPDB 1I53A 4L0PB 1PCSA 1AR1B 3FSVA 3FQ2A 1RZQA 2CJ3A 4HZ1A 4DPCX 1M56B 4NERA 2IDFA 2WO2B 2X88A 4F2EA 4GXFA 2HX7A 1ZDSA 4AKPA 3QJSB 4TXVB 3NSDA 4KO5A 1FWXA 3AZUA 3S3BB 5TK4A 5I5JA 4HCGA 5I6NA 2J57A 1TEFA 2EIMB 1QLEB 4YSSA 2IWEA 5AFAA 1OF0A 1GS8A 2HZHA 1BXVA 2B08A 3H56A 1AQ8A 1AS8A 4P5SA 2FJSA 2FQDA 3WIAA 9PCYA 1JVLA 1WS8A 3ZX1A 4KO6A 2GC4C 2JKWA 2BW4A 3NSCA 4PAZA 1A8ZA 1MZZA 3CVDA 1HAUA 1L9TA 1PNCA 4YSUA 1XB8A 4JKNA 3NP3A 2ZWNA 2JFCA 4BWTA 1T5KA 4FA7B 1V10A 4A2HA 2QDVA 2VM3A 1PLBA 1CC3A 2GBAA 1E67A 3QJTB 2JXMA 4GP5B 5B3SB 5I5MA 5I6OA 2YAEA 4F7KA 4YVUA 3FPXA 2PCFA 1SFHA 4YVNA 3QJUB 1SDDB 3EHBB 1QHQA 3NJJA 1AIZA 2IDSA 5I6LA 2I7SA 1ASPA 1EZLA 2R7EB 1KCBA 1NPNA 4HIPA 2FQEA 2Y69B 4A2EA 2XV3A 1GW0A 1KDIA 1AZNA 2HLEB 3D12B 1OE3A 3RYMA 2EIKB 3OMNB 2DYSB 3PLYA 4QLWA 1X9RA 1KYAA 1NWPA 2IDTA 3ZIYA 4YSRA 3FU9A 3UABA 2DYRB 2YARA 5PCYA 3S3CB 3TBBA 4BDVB 3ABLB 4CSPA 5B7FA 2UX7A 3ZDWA 1GY1A 4E9RA 1W8EA 4ZK8A 1AANA 4GP4B 3IBOA 3WI9A 2AFNA 3SBRA 2BZCA 2BO0A 4MFHA 2BP8B 1EHKB 1DYZA 1E5YA 3CG8A 4AX3A 4BK5C 4G7SB 5FC9A 3T9WA 4A2DA 4DP5X 5B1JA 1FA4A 1E5ZA 1AZRA 1AZBA 3DTUB 3FSAA 2GIMA 2FT8A 2IDQA 3NJKA 2A3TA 3T6WA 1NWOA 5I6PA 4Q89A 2HRHA 1B3IA 4E9SA 4HHGA 4M3HA 4QKTA 1OE2A 1BEXA 2PPFA 1GR7A 1URIA 1OE1A 2PP8A 1PAZA 4AZUA 1J5DA 4P5RA 3NP4A 3PAVA 1ASQA 1W6WA 3BVDB 2I85A 3ASOB 1SHXA 4DP1X 2GSMB 1PLAA 3BQVA 3CVBA 2VSKB 2CBPA 4E9YA 2XV0A 1ZDQA 2AZAA 3DKHA 2FQFA 2YAMA 4DP6X 2PP7A 2YAQA 1ILSA 2XX0A 1M9WA 3QJVB 4YL4A 2HRGA 2UX6A 4X4KA 4G70B 4DPBX 2FTAA 3FU8A 4HALA 4G72B 3OM3B 3SBQA 5A7EA 1PZCA 3NT0A 1NIFA 1XB3A 2OJ1A 2XWZA 3FYIB 3AW5A 1KBVA 2UXGA 3FQYA 3NJGA 4WKXA 7PCYA 1HFUA 4YSAA 1A3ZA 1WA0X 3X1NA 3NJLA 1NZRA 3NJFA 2WSDA 3H4FA 1KCWA 2UXFA 2VMJA 1SNRA 1JZIA 4E9VA 1UATA 1J5CA 1A4BA 3T6ZA 3KW8A 2TSBA 2HXAA 2J55A 2OCCB 2BP0B 1IBYA 1L9QA 7PAZA 2W88A 3WG7B 4ENZA 3FS9A 3NJHA 3CDZA 5LDUA 1ETJA 3MBWB 1XMEB 4YSEA 1NICA 3IN0A 4UANA 5AKRA 2J5WA 3N55A 1J9RA 2XXFA 4BDVA 2YQBA 4YSOA 4GY4A 1WA2X 1J9QA 1BXAA 1WAEA 2PCYA 3GYRA 4KNUA 4DP7X 2VW4A 4HCIA 2CCWA 3IEAA 1AG0A 6PCYA 2BP8A 1E30A 4YSQA 3S3DB 4AKQA 4EF3A 1JXGA 4FAAB 1AACA 1ZIAA 2CALA 5B1KA 2FWLB 2YAFA 2BWIA 3EH3B 3AG4B 3PPSA 1NINA 3X1FA 1JVOA 4YSTA 1ILUA 1NIAA 3FSWA 2RACA 2XVBA 3GXUB 5D4IA 5B7EA 3FYEB 5PAZA 4DP9X 2DWSA 3QQXA 1KGYE 3NYKA 3ZBMA 4YSCA 4G7QB 2GC7C 2W8CA 4NB7A 1SF3A 3NSFA 3FU7B 2XXGA 4Q8BA 2AZUA 3TBCA 4A68A 4A2FA 1A4AA 1ADWA 4GYBA 4W1TA 2IWFA 4G71B 1JZJA 1R1CA 3UAEA 4E9XA 1ET5A 4NAJA 3JT2A 3S8FB 1AS6A 4DP0X 3U25A 4G7RB 4BWUA 2XV2A 1ZIBA 3PCYA 2PPAA 2FT7A 5B1BB 2BZ7A 1E65A 4HHWA 5I28A 3MX0B 2H47C 3C75A 4A2GA 1OV8A 1SJMA 2VW7A 1BYOA 3EF4A 4WTQA 1TU2A 3KW7A 1AOZA 1MG3C 4E9WA 1JOIA 2YXWA 1HAWA 1TKWA 1BYPA 2NRDA 5ANHA 2QDWA 5D4HA 4CSZA 1NIEA 1IC0A 5I5IA 3UACA 2QPEB 1NTDA 2PPEA 2EIJB 4KOBA 1NIDA 3PXLA 3QJRB 2I7OA 3EH4B 3N2JA 3NSYA 1OOWA 1NPJA 6PAZA 3FT0A
chains in the Genus database with same CATH superfamily
3ZKNC 2O5YL 2D7QA 1G7LA 3BDXA 5DUPH 3UROR 4YZWA 2B14A 2H6PB 3D2TA 2B3IA 2ZXAA 3X2QB 1NEPA 2VB5A 3OG4B 1KFGA 2IG2L 3DUUB 2JI3A 3IDXH 3LNEA 4UTAH 3VGBA 5FAAA 4O2EB 4Q52A 4PRPA 2JK5A 4XB8A 1CLOH 4QRBA 1L9PA 1HHHA 2MRYA 4YL9A 5HI4D 4ZUVA 1UWEH 3EGDA 4FD0A 4XO3A 5BOZG 3LRMA 1MI5B 4ZO9A 5DCCA 3WFCL 4F7PB 4UZUA 5BS0A 1PYWA 5T1JA 4IBSA 4YE0A 4HWNA 3T6XA 2Y0SA 2R7EA 4A63A 1F8TH 1QA9A 1KTBA 2BSDA 4FQLL 5IJCC 1ONQA 4LCUA 1CXFA 4FNLH 5M7QA 1S6NA 2F5AL 4ZUTA 2Z7ZA 3JT0A 3QUKA 4G8GE 1FHGA 4C4UA 2PUQT 1JCVA 1PF3A 3X1EA 1GGIH 4NJ9H 2MCPH 5I76B 2WYZA 4OH2A 4FJ6A 3N3EA 2AK4E 2Q86A 3OKKB 4UINL 1UM4L 3DMMA 1M2VA 4UUJB 1BLNB 1EWHA 1VZGA 2PF6A 2YXVA 4H0HB 5E08L 5L2KE 1YNLL 2LGNA 4UTBA 4RLDA 3QWOA 1BSIA 4KVCL 3NCMA 3WN5B 4WEBL 5IKCA 2HX9A 1T1ZB 3C08L 3LQAC 2CNZA 3L48A 3VD1A 1F56A 4UM9A 2CRMA 4TVPL 4Q56A 3BW9B 5DO2D 1BXUA 1O0VA 5JXEC 3W1ZA 4R7DA 1YY8B 3FH7A 4OLYL 4H88L 4QHPA 4WY7L 3I6GA 4J4PD 4MYWB 2ADIA 3UTSA 3KWUA 2JQAA 5EUKA 4LEXH 4R6UA 2LAGB 3CFQA 2GW5A 1RU9L 4JM4L 1YJDH 1JGUL 1OAZH 2YGNA 3AMLA 2M2DA 2QGCA 3QDJB 1FLRH 2AXWA 5C86A 5H37G 4DN3L 3DROA 3OJ2C 4PIRF 3QNZB 4DGIL 1H9DA 3DA0A 1RUAL 1NCDL 1MCLA 2VH5H 2HX8A 3P11H 5AVVB 1L0XA 1BGXL 2ED7A 2N56A 4PFEA 2VZ3A 1TVHB 4LNRB 5DMGC 2HKAA 3CFJA 4YNYB 5E2TL 5SWQB 4CW1A 4Y16D 3D4YA 4WCYH 1WTLA 3KPMB 2ED6A 3AQXA 1IGIH 3SGEI 1CLVA 4U1JB 2EZ0D 1XD0A 1KFAH 1BREA 4B9FA 4CVWA 1C1EL 3WE1A 3JV0A 3DNKA 3TP4A 4EAEA 3F7YA 3Q1SL 7TAAA 1ZA6A 3WNIA 4QRUB 4JL2A 4ISVB 2BRRH 1PFCA 4LCWD 2PXYA 4N0CD 1OGSA 1M71A 4GAGL 1MJ7L 4QWWD 4N8VA 4AUYA 2X6VA 1JYNA 1BVKA 3WKML 3SDCB 3ZE2B 1PLCA 4X5QA 5JR1L 1SN2A 3L2LA 1K72A 3L3OA 2AEOA 4Y2OA 2VSMB 4QHLA 3MLYL 3ZHDA 4CKQA 4YHKH 4MDJB 2D8KA 1HHGA 5FA3B 4PB9L 4YHYB 4C56E 3V5DB 1SM3H 4PJAA 4DGVH 1SBBA 3BIAX 3SCMD 3QORD 1PKQB 3OWRA 2CBMA 2D9QB 4P23C 2FVNA 2VISB 4XE0A 1F2QA 5D2NC 5C0AA 1DEDA 5JHDA 4JFOB 4O02B 3GRGA 3QQDA 2NQCA 1DDHA 4MB4A 3GSVA 4P9HC 3W0WD 2PTUA 3GHPA 4QRQA 5MERB 1X5LA 1HKFA 4N0RA 2JH2A 4YDVA 3MR9B 4A7TA 3WNNA 3CSGA 1T20A 4MNHB 3JV4B 1I9IH 4JPVH 1I1FA 3KJ4C 1WUZA 2X1PA 2KDYA 5BVPH 1ETZB 5TF0A 3J07A 3ZE0E 3Q3GB 5IG7A 1WP6A 5E9AA 3IPFA 2VE6A 2DQUH 5G5DA 2J57A 3TBYB 2R0KL 4PJIB 1UB6B 1MVFA 4YSSA 2ZSWB 3D2UB 5GRWA 4CGUB 2EC8A 2QVMA 5E5RB 4UDUA 1VFUA 4N1HB 1F3JB 1IM9A 2FJSA 2FQDA 3HCVB 5D1QC 3SDDC 1XSIA 4IRJB 4XBGB 5DMYA 3ILPB 4KV5F 4RGNB 2EEDA 3P9LA 4XMVA 3E6HA 5IQNA 5AL0A 5T1DH 4OKVB 4KTYA 4A1RA 2ZUVA 4IBUA 3RVVC 3NPSB 2WZPD 3F6IA 2B4CH 4LAQH 1IGYB 1A3RL 3HG5A 4D0DB 5AYUL 1OAJA 4XVUD 1XCXA 4LVHB 4XC3L 3SIKA 5FO8A 3F2LA 3C60D 4U4IA 2QDVA 2FX9L 2WZAA 1UZGA 3UYRL 1IT9H 3L16A 2JXMA 2ZXBA 3QFJA 4JFPA 4OVVA 5I5MA 3NQKA 1ADQA 1XXFC 4CC4C 2XN9D 3AREA 3SGKA 3O9WA 1SDDB 4D0BB 2X1QA 2IDSA 5C09B 1ZVYA 4YLQT 1OP3H 4PVNA 4PJHB 1XTMA 5CJQH 1JHKL 1IEBA 1YNTB 1KGIA 4X80H 4AQ1A 3L4TA 1QACA 1JI2A 3LKOB 4NYLB 3C5ZD 3SQOH 1EBPA 1KB9J 3KCPA 5DJ2B 1A7RL 2N1KA 4UYQA 4M6MH 5T1KD 5B38B 1DFBL 3LRHA 5FFLA 1LDSA 2ICWB 3SYQA 3SE6A 5IVXB 5EZLB 5CJXC 3MCKA 3GJFH 5SX4I 2GK0A 5CUSH 4GS7B 1NGXB 4IRZH 3MYZA 2VRAA 4AENA 3IU4L 4ZUSB 2IOOA 2ICWJ 1F1GA 4NC0B 4YHML 1GZHC 5GGVY 1ZLWH 2AKRA 4IRZA 3LSOA 1OTUD 3MBEB 2B5IC 5C3TA 2KH2B 4AX3A 2NY5C 3T9WA 1JZDC 1NCIA 2H6PA 3THML 3O4LE 3GDBA 3VU1A 4BRVA 4M5SA 2OSLB 3DUUA 5D7LB 2I27N 2NXYB 2UZXB 1FNLA 4O2FB 2CHXA 3BAEH 4FFVC 1JVKA 2G3NA 3HE7A 3GBML 3L13A 1IL1B 4NN7C 5IROD 2D7MA 3EJPA 2NX5E 3VW3L 2P5EB 4PG2A 4JFFB 3U36B 1JMXA 3C6LD 5GS0D 2Y7QB 1IKNA 4GG6B 1G9MC 4F7PA 1IAOB 2Y1YA 5J1AB 1T2QL 3D3VD 4QXTB 3CGTA 1NGZB 3FU6A 3QUZD 5ICXB 2N3JA 2I85A 3QZBA 3BXNA 3NSJA 4GAAA 4WO4D 1D9KD 2D2CC 4NM4H 4NO5A 2JSFA 3PFQA 4R3SA 4GPVA 3ZKSD 3KGSA 3WN6A 4GW4A 5D4QA 1HT6A 2CRYA 5I76A 4I77H 3C87A 1J8HB 3OKKA 3H2PA 1BLNA 4P2QB 4UUJA 2UX6A 4YDIH 2G4GA 2V2WA 3ZPDA 3OGCB 3MKGA 4H40A 5ADOL 4OUUA 1A64A 1BBDL 1QW8A 1T1ZA 4EIUA 3S34H 3V4VH 1BD2E 1IZJA 1PZUB 2XQYK 3IMBA 4U6TA 3BW9A 4YDZA 1KEMH 3AW5A 3PP4H 5DJ6B 5E8DH 4FQ1L 1A3ZA 5JNYA 5D72H 1YY8A 1IC5L 3OTTA 5AW8B 3V2AR 1YVLA 4ZO7A 2LTQB 3NJLA 3EYUL 4UV4L 1MCWM 2VQ1B 2VMJA 5FGSA 1B0GA 5HDWA 1KN4H 2XZCL 5FUZL 5KSBB 1L0PA 1L3NA 5K9QI 2TSBA 2HXAA 1T5WA 1UYWH 3QDJA 4EEEA 4NKMB 3LNFA 1S5IL 1OF2B 2X2YA 2EE2A 4M7ZB 3PWLB 3IU3A 2NXZB 4K7FB 1NICA 1UOWA 2AABL 2A4ZA 2YGQA 3WEBA 3QNZA 4HQQH 2R0ZL 3P1VA 2YQBA 4P4KB 1WA2X 1FPTL 4JM2C 1JWSB 2CH8A 4OLXH 5CZRA 4BSWB 4LNRA 1TVHA 4AYFB 2JB5L 5SWQA 1HHKB 4M43H 4DT2A 2VDPB 4HOWA 4AEHH 3KPMA 3ULUL 5L6YL 2FWLB 1U95A 3L9RB 2K8QA 3FSOA 4U1JA 3RX8A 1CDHA 1EIBA 5AVZB 1NIAA 2YGOA 3TCLB 4MWFB 3UDWA 2W94A 2WJ5A 4YSCA 2R8SH 3ZE0F 3BN9C 4EUPG 4PYGA 3BUIA 1KTRL 3NSFA 2VDLB 2ENPA 2OW6A 3DO4A 2WWMD 3VM7A 1PCXA 5CSZB 2Y7LA 1AC6A 4MTMA 1HCYA 4GAFB 2MNJB 4LSRL 4P57B 3DX3A 1AQKL 2FH6A 1N7ML 2VSCA 4GIOA 5F2FA 2EC9T 3BKCL 1TTFA 2RCSH 4MDJA 2QADD 4PLOB 5FA3A 5J4MA 1VGKB 3CLEL 4HD9A 2FDBP 3KYMB 1XGTB 4F58H 4UNIA 3GBEA 2DDQH 5I28A 1F02I 2OZNA 5AG9A 3HMWL 4NWUH 2WMPB 1F42A 1PKQA 3T8MA 3LTVA 2HFEB 3L9BA 3UZEC 2VISA 3A6CL 4MYPA 4YEEA 4JFOA 4M48H 4O02A 4G1MB 4XPBL 3NCJH 4ZMNA 2J1XA 3KW7A 5FM8A 3FH8A 5D7SL 4JL1A 2DLIA 4D2NA 5L0QB 5JLZB 5MERA 3TF4A 1DBBH 4YXLH 1SQ2N 3MR9A 2YEZB 1MHPH 4FNQA 4JKPH 4MNHA 1TTBA 2YD8A 4J3TA 1HEHC 4P46C 5J6GB 3ZTJG 3KYOB 4CADB 1ETZA 3Q3GA 2H45A 1MY7A 4M7LT 2NNRA 1NCUA 3TBYA 4PJIA 4OQTH 1UB6A 3BFOA 3OSKA 2ZSWA 1G94A 3D2UA 3DGGB 4MQXD 4DN4L 1FNHA 3BPLB 4HXAH 1EH9A 1F3JA 1I1AC 1XF4B 4H8HA 1URLA 4JVPA 3TVMD 4Z7VB 1I3UA 4IRJA 3SKUD 4XBGA 3ILPA 2HFFB 5LCVA 2R4RH 3SY6A 3IVKB 2DF3A 2IF7A 4O9HH 4OKVA 3OSVA 1HWHB 1JNNL 4D0DA 2WXNA 1U8HB 2EDNA 3Q5YA 3P2DA 3CXHJ 5LAXA 3FRPG 4KKZA 5CLZA 1QEWB 1H19A 3WTYA 4JKMA 3RKPA 2VLLB 4JUTA 3PYCA 1H3TA 2AANA 4PRID 2FQGA 2AC0A 1ZTXH 2XWEA 2XHNA 1SDDA 4D0BA 1A7OH 2DQCL 3QA3B 4KQ3L 4A7SA 3QG6A 5C09A 5KVGH 4E68A 4CN1A 1BQLL 4PJHA 4APXA 1LYQA 3BI9X 2K70A 5KYUB 3EYQC 2WLIB 1YNTA 1N5AB 3LKOA 4NYLA 5HY9B 4BXVA 4OZHB 2ZCKL 2YN3A 5DJ2A 3LQAH 5B38A 1O5DT 5B4MD 3O8XD 2H1PH 1SJEA 4TLUA 1PZ2A 2EDYA 2ICWA 3MUJA 3W39B 3WFHB 2BSRB 3N1QC 3G6JE 2N0KA 1XBDA 4HD5A 5EZLA 1E9PB 1L9MA 4M29A 2A74B 4YX2L 1URZA 3MROB 1NGXA 1FYTD 1RLWA 3NCFB 4KO7A 5A3ID 4K73A 5F0LB 2XJKA 4ZUSA 5E56A 5GGTL 2PLTA 3MBEA 4K4KA 4Y9EA 5DQJB 2CUMA 2OQJB 1OSZB 2VXQL 5I0XA 1T0MB 1OW0A 2CKBL 3SKJL 2HKHL 2NY6B 2VDOH 2F53D 1CLYH 3IRZA 2QSCL 4M6NH 5D7LA 3SZ6A 4ZX3A 2UZXA 4O2FA 1DP0A 4NQEE 4QTIL 1IL1A 2ZG3A 3T0BA 1TQWA 2P5EA 4JFFA 2GJRA 3NA4A 4M56A 1RH8A 4G9FE 2OKMA 4JDZB 3IWUA 2Y7QA 1NGPH 2ADFL 4GG6A 3CFDB 4KROB 1Z9PA 4R90L 4QXTA 3QQNA 4Y4HC 1A7NH 5LUMA 3POHA 5ICXA 5KYNA 5IMLB 1U8CB 4MA8H 3WHE0 2FATH 3GMLB 3VXSD 2W07B 4KI1A 4HWBA 1HN1A 4WRLA 3N40F 2QR0A 4IRSC 1E4HA 5L88H 1CK0H 3FAXA 1OGAB 2P42B 5FYKL 1BJMA 2IXQB 3KAAA 4P2QA 2FGWL 2X38A 4L23A 3W37A 3MOAH 1J9SA 3HEIB 1R3KB 3NZHH 2J5LC 2KT6A 3OGCA 1QG3A 3O3UN 4I0PC 1WWBX 3X3GH 2DV6A 2ZCHH 1MF2L 3SDAC 1G87A 1IBDA 4K15A 1G7JB 3RWDB 1BQ5A 4PM1A 4X98B 3L5XL 2OP4H 3FCGA 5DJ6A 1IAIL 3MGAA 1A5FH 4AYSA 3N44F 3UYPA 1S9WB 2L7JA 5LGJB 2FSEB 2VQ1A 5EO1B 2IAND 3MJ9H 2AP2A 1MCNA 3IFLH 4NC2B 5DURB 5HP5A 5KSBA 2IWKA 2XN2A 4U0QB 5E51A 3EJCA 1TQCB 2WXPA 3B83A 4H13C 3VDAA 5HGHA 5E8EB 3QNYB 2XWCA 1DANU 5F0MB 2OJZH 4NKMA 2QPDB 1OF2A 5E24E 1WV7T 4NIYE 1SEQH 2YOCA 3PWLA 4OCXL 1QASA 1D5IL 2NZ1A 4X9IA 1CBVL 4K7FA 4F3FB 4HETA 3MODL 5FYJE 2CU9A 5FYLE 3CZFA 3WIFB 2AJZB 4P4KA 5F7KC 4HT1H 3ZL4L 1TSRA 3WGVB 5ADPL 3LQMA 2QVTA 4M03A 1JWSA 2JVUA 4JQIA 5EFIB 3TYGH 5E00B 2FHCA 4TXVB 4BSWA 4AYFA 3S3BB 2O26U 1HHKA 2EO7A 3CDFA 4YK4B 1R19A 1MRCH 5KW9L 5AFAA 2QHRL 1JD7A 1N0XL 3L9RA 3SE9H 4U1IB 4K94C 4GLRI 3TCLA 1TJHL 3EDKA 1X44A 4MWFA 3VD9A 2R4SL 5I1JH 4JRLA 1GW6A 2VDLH 2ZXGA 2QSTA 3MYJB 4OF7A 4B0MM 3KPSD 2NY1D 4LZKA 1USQA 1JRHI 1WWWX 3FC8A 1A8ZA 4RX4D 1QSEE 4U0RC 4L4VA 1N4XL 4D9LL 3PQYB 1TQTA 3NZUA 1DBKH 3NRQA 3PGDB 1FJ1B 5CSZA 1JYVA 4EBQL 3MCLH 5KVMC 4BWTA 4P57A 1NEZG 3PFUA 4ATTA 4JDVB 1OANA 3DHMA 2Z8WC 1NM4A 4F7KA 5DYFA 3GB7B 4MAYA 1VGKA 4MHHG 3KYMA 3NJJA 1XGTA 5EO9B 3UTPE 2W59A 1RUKL 5KG9A 1NGQH 4PI2A 4ETQA 2QPUA 1U91A 2HFEA 3P3SA 4BZ2A 3QCVH 2DBJA 2AMUA 5HSFA 5HGAB 4OIIL 4G1MA 1KGCD 3MVSA 4JO4L 4MJ4A 4NQDE 2J21A 3EO0B 3ZL1A 5JLZA 2YARA 1CD0A 1AHKA 3GTVA 3OXRB 5HBBA 1MJ8L 4G82A 3IDIA 2XTJE 4J1UB 5J6GA 2YLKA 4CADA 2KZBA 3WEOA 2VLMD 4ZZKA 1OK0A 2JKJA 1WBZB 3BH9B 4NBXB 5DI8B 3KYKH 5DZLA 1UM6H 2M8XA 1CPUA 2NLJA 2OS7A 4RIRB 2BP8B 3ASWA 3DGGA 3RTQA 4FP8L 3FHEA 1RUPH 3DVFA 1XF4A 1CLCA 3G6JF 3DJ9A 2B2XL 1P6AB 4Z7VA 4DP5X 2WUBL 2HFFA 3U82B 1A4KB 4WTZA 1OKEA 1X6LA 3HE6C 1J8RA 4KK5D 1G9MH 4J6IA 4N0YL 5SWSD 2IDQA 5GS2D 3IVKA 4Q0XL 4JY5L 3HHMA 4X9YA 3ZDYB 4LIQH 2CR3A 1Z9SB 4OF5A 2VN4A 4I3RL 4B9YA 2WVVB 4ZS7H 4NXKA 2VLLA 4ERSL 1D6EB 1YEGL 4RBPH 1J5DA 1TO5A 5KVFE 3ZUCA 1C12B 2AJSL 2D3LA 1K5NB 1OB1B 2CIKB 5FXCH 2R56L 1RZJL 4AM0Q 3KWVA 1P7HL 4NKDB 2QLVB 4BFJA 1MW1A 3ETSA 3HZYB 3ASOB 3FT1A 5KYUA 1SY6H 2WLIA 4KWUA 5MI0B 3VFMB 1N5AA 1RZKL 5HY9A 3OZ9L 3ETBJ 4QOKD 3UTTE 1PVHA 3W39A 2C7FA 5F7EL 3WFHA 1KENH 1NFDB 4AIZB 3DRQB 1E9PA 4KKAC 4OB5H 2A74A 5GISH 4EQ3A 5GGRB 4YXHL 3MROA 3HUJB 2F18A 3S4SA 1BJ1J 3T0EC 4LRIC 3BFWA 1QFUH 3LIUA 1X5GA 2IJ0C 4P2CG 3K2KA 5D70L 2A4CA 4ZODA 4AGPA 1KEGL 1UEMA 5DQJA 1MIMH 2OQJA 1OSZA 2XWZA 1GYUA 4GRWH 1T0MA 1NCWL 1NCBL 3SE8L 1UB5B 3AB0B 1QSFD 2A9NL 3M8OH 2OYMA 4RVBA 3DVNA 5T5NF 5KBNC 3GRWA 2AAAA 5AOJA 2O61B 2HWZH 3ESPA 2Z92B 3BZEB 2ZKMX 4XXCC 1NH6A 5DS8B 1FBIH 1Z3GL 3BPNC 2NY3D 3GZPA 3OVUB 4I18B 4OF6A 1KIPB 2HT2C 2Z34A 3D4GA 1T03H 3DMMC 5GGRY 1A6UH 4JDZA 3FTUA 4W68A 3QDGB 4XMKL 4Y2DA 2J25A 2MTPA 3ECUA 4EXKA 1OD9A 5I1HH 4BQ9A 4PGDA 3ILQD 3VFVA 2DS4A 4LVEA 3DX1A 3MUZ1 2VXVL 4CDHA 1J9RA 1QX1A 3LPPA 4OR1A 2KPNA 1U8OB 4PMFA 2B0SH 4MDIB 2IEPA 5IMLA 1U8CA 4K3DH 4OFPA 3B2DC 3GMLA 1WZMA 3N41F 3HN3A 2W07A 1UFGA 3EBHA 3CTTA 3QP3A 4ZMOA 2DQHH 1NEUA 4V1DA 4LSUH 4OGAC 4XMPH 2H0FA 3RWJB 1QTYT 4I2XB 3VG0L 1QKZL 1G1CA 1EDHA 3BP7B 2WGNB 3CN1A 1OGAA 2IXQA 3GBDA 4N2BA 1U8IB 5JZ7D 5CD5D 1JVOA 3B34A 4F33B 1I1YB 1A7PH 3L4UA 1ZTMA 4KK9D 1R3KA 5KANI 4PLJD 4BQ8A 4WEUD 1T1XB 2JJTA 1HNGA 3BH8B 1SYSB 1RPQA 4ZFOL 3V0JA 4NENB 3VYPA 5EUOB 1G7JA 3REWB 4H7VA 3B3IB 3RWDA 2UWEB 2N7AA 5C92A 4M93B 4X98A 5J6SA 2DI7A 4R2GD 5EG6C 3SD5A 1S9WA 4W1TA 3VXMD 4ZW3A 5LGJA 2VIRB 2ZYIA 1JZJA 2FSEA 3UAEA 3RTLA 2J12B 5IFHL 3GXFA 5EO1A 4E9XA 1QFWH 2X40A 4KPHL 3A4AA 2ZOWA 4UM8B 1HOCB 2BNQB 1M05B 1N26A 3U25A 3BUYB 3O6LH 2ESVE 2XVKA 2ZCLL 3MX0B 5E8EA 1V3MA 5JPNC 2APBA 4FQIH 3VGEA 2VLKD 1ZLUK 5EA0L 4B0MB 8FABB 3IS1X 2VKXA 5JOFB 1MCIA 4DZBB 4K3JL 3WIFA 2PXYC 1FVCB 5DD1H 1EK3A 5EFIA 1WJ3A 2CO7B 3B4NA 4DVRH 1CWVA 5E00A 2XIBA 5AVUB 5E0QA 4KKPA 5LN8A 3L3OC 4BINA 1LP9E 4ELME 1O7DE 4BFFA 2CBOA 4HZLB 2IGTA 1TCMA 3CSTA 5KSUB 1IV8A 4JPWH 2EDMA 4Y9CA 4M1CD 4X7SL 2V37A 1G1KA 2PO6B 1PZBA 3B5HA 4X4ME 4L3EA 1DVQA 5GSRB 3QPKA 3DJSA 3QEQE 4MJID 4FN0A 5I26A 1BZEA 4KNSA 2AVGA 2ARJA 5KVDE 3EJRA 2VN5A 1RIHH 5KTEH 4WFFE 5EOQL 3PQYA 4PD4K 5IK3B 1FJ1A 1M7UA 3V9EA 1MCFA 3WENA 4J3OF 4DGWC 2IPKB 1A6TB 2I5YH 4OF8A 4XWOC 3TJEL 2WXJA 1R3IL 4JHVA 5F72S 4P2OD 1KPUB 5AVRB 4JDVA 1OAQL 3MLZH 4Z9KB 4LDLB 5GS0L 1ZHNB 3GB7A 4QT5B 1MZYA 2VLRE 4NJAH 1TF4A 5ACZB 3DETC 2W91A 5EO9A 1E27A 1U3HC 3C8KA 3OX8B 3L5HA 5DHVB 3PAZA 1D7CA 1XIWC 5C07D 2CRIA 4O00A 5TE6L 3EHBD 4OJAA 5HGAA 4Y19E 1KIQB 2PWGA 3WS6C 4PJDE 1BQKA 1PNDA 1YAZA 4YBLC 2AQ1A 1P84K 1M3JA 5D93B 1S9VB 4WUUE 1EFQA 1BPLB 3OXRA 5E95B 2VABA 2VW6A 3APNA 3TFBA 1VZIA 5DUML 4J1UA 4PJ8C 1E7VA 4DAGH 3MRQA 3T0AA 1Y18B 4YAQA 1WBZA 4N5ED 3BH9A 5DI8A 1U93B 5C0IA 1NC4D 5EWIH 4RIRA 3S97C 4B7IA 4ZDHB 3SGKC 4A6YL 1CUOA 3CBJB 1C5CL 4PEEA 1ET8A 4ZQKB 2QV4A 2M83A 4CDGC 4WFEE 1A4KA 4NQCB 1YMMA 4AQ1C 1U0QA 3EG9B 4XNUH 5C6TH 4AEIH 1C5BL 1R46A 1Y6NR 2WLNA 1WFJA 1N6QH 1Z9SA 3V79C 2HSIA 3H4HA 35C8H 4HGWB 2DB8A 2R1YB 3GGWB 4Q9QH 1PS3A 2X0UA 2WVVA 5F9AC 3VQLA 3L45A 1MUJB 3GXNA 3CDZB 3VFOB 1D6EA 4N8VG 4NPJA 2UXTA 3ZT7A 4N28A 2CUAA 1C12A 2VDRH 2WO3B 1P1ZB 1R6VA 1K5NA 1OB1A 2CIKA 2AHIA 1JZ3A 3ISRA 3QDMA 4XPGL 1PX8A 2CHZA 3I6SA 3ZRCC 4WTWA 3AT0A 4NKDA 1ZCRA 3E9UA 3Q06A 1SN0A 3HZYA 4ODSH 5ALBL 4HJ0C 2RR3A 1BJ1H 3VFMA 1DEEB 4ZYKB 2HT3D 5IHLB 3JWDH 1EHLL 2A38A 3TA3C 5E99H 2I32A 2WXIA 5F9JB 5MEQB 1CFTB 4ZTOH 1WT5A 4URKA 3MUGB 2DQGL 1H6EA 3O6ML 1NFDA 3D05A 3DRQA 4AIZA 2Y22A 3HE7C 3FHAA 3UBHA 1CE6A 2DPKA 5GGRA 3D06A 3MLRH 4TULH 4DW2L 1YPZE 4JFZH 3LH2H 1YEKL 4YUEL 1B6DA 2AJXL 3L2NA 1I8AA 2GPZA 4ZS6D 1AR1C 3I9PA 4FYRA 5IJVB 1AHWC 3FPYA 3K4DA 1QOKA 5SX5K 1DJXA 3GS0A 2Y6SC 1LD9B 1KTJA 1GOFA 3APDA 5IQLA 1BJ8A 1UB5A 2NUTA 4BZYA 5L8KB 4R8WH 5C6WH 4H20H 3JWNH 2IPTL 1KXQE 2F7PA 2O61A 3QZWB 2Z92A 3HMXL 3BZEA 1KOAA 3QGVA 5DS8A 3U9UB 1T21A 1MI5D 4WWKD 5D96B 2KLSA 1XH1A 4I18A 2H41A 1FNFA 1KIPA 3RQ3A 3FQUA 3QDGA 2WQRA 4FOMA 3FOMA 3TCTA 3ZW3A 4I8DA 3MBXL 4Z7UE 3D7PA 3NTCH 2ORBL 2WUCL 3EUDA 4FFZA 4U1LB 2MNUA 1U8OA 2Y2WA 3UPRB 5AW3B 4JANB 3MV9D 3QNFA 4EI5A 3K4AA 4F2EA 2AQQA 1KJ2B 4Y4FB 2W0FB 4PW4A 3ROLB 2JMRA 4JUSA 4H8WC 2EUWA 4EN2A 1PKOA 1KBGH 3LH9A 2EACA 1K6QH 2EDDA 2CNYA 4WI2A 3D39E 2VC2H 2EE6A 3RWJA 5EIIA 4I2XA 4P5KB 2BVQB 1IBGH 1EXHA 3BP7A 4RZCB 1Y0LB 1U8IA 2HZHA 2I9TB 5K9KB 3D4CA 1I1YA 4P5SA 3MHZA 9PCYA 3IDNA 3L4ZA 1UWGL 5I1KL 3G7TA 1T1XA 1MFDH 1SYSA 4ELMF 1LP9F 5CCKH 4NENA 5IGXL 1HDMB 5EUOA 1IGFH 1H8LA 3B3IA 2UWEA 3UC0L 5IESL 2VDKB 2W0LA 1CFMA 4GUCA 1CFBA 2GBTA 5IBTL 4FA7B 2VIRA 3LZRA 5E6YA 2GBAA 4X6DB 2G3ZA 2ZOKB 2EH8H 1UJTA 3VUAA 4UM8A 4YS4A 2BNQA 1M05A 2PWFA 2R29H 4I5BB 3DHUA 3AGVA 1UD4A 2I7SA 1E4KA 1ODAA 4ANKA 4LESA 3QT2A 4BGDA 5FHAL 5EEVA 3MLSH 3UDWC 1RJYB 1E28B 4P4RB 1CZ8L 4KX8A 2P5WE 2VMEA 3EADA 4G2AA 2IH3B 5JOFA 3HC2A 1L7IL 3BUTA 2NY2C 4DZBA 2DYRB 4BFIB 3OPZL 4PSRA 1UXWB 2CO7A 5E4OA 2EIEA 3QNXA 3RDTB 4HZLA 4IK6A 4PJDF 5E0FA 3QEGH 5KSUA 3TNMA 3MRFB 1WK0A 4LHUA 4RDQF 4F9LA 4AMKH 4YGAB 3L3IA 2PO6A 5EOTB 2P43B 1IAII 4CNIB 4PGBB 3TZVD 1MEXL 5ID1A 5GSRA 3A21A 4M1DH 4H0GA 5ANME 4NCC2 2WQAA 4HCRA 1E43A 1BBJB 1NDGB 1MFUA 5DQDH 1SMOA 4PLKD 4DIXA 1X7QB 5IK3A 2A3TA 1OAKL 3MDJA 4OLUH 2IPKA 4FG6C 3ZK0A 4B6ZA 1Z9OA 5GRUH 4QY8B 3L2MA 3HC3H 2DKUA 4XPTH 1KPUA 4UOJA 1URIA 4B5EA 5C0ND 3DX4A 3D34A 3FQTB 1ZHNA 2NZ9D 1UURA 5CN1A 1QRND 3ULVC 4QT5A 3LKNB 4JRYD 3CHRA 1N6UA 5ACZA 3RB7A 4V2CB 1CE1L 1SMAA 3SOBH 2ZPKH 2VXTL 3OX8A 5DHVA 3TPUB 4AYID 3QI9B 4FQ2H 1WEJH 2O6PA 4DP1X 1ZGLM 3IDYC 2CGRH 1X5IA 2YMXH 1KIQA 4IRJC 2YR3A 4HK3N 3ZKND 1WGOA 2XWTB 1UCTA 1S9VA 2WLYA 2XX0A 4JO3L 5E4EC 2CKNA 4PWFA 3BGMB 1NC2B 4OD1L 3MV8D 3KLAB 1U4EA 3GLEA 5LQBH 4U33A 1WHOA 3ARFC 4U6YB 1Y18A 3RL1B 1NKGA 2WVTA 3TIEA 2X6CA 3NIGB 4MAUL 1U93A 3JWOH 4CU8A 4RGND 1MCOL 3ECQA 2VQUA 3LZPA 4ZDHA 4B27A 4WKXA 3NJGA 1LK2B 2H0PA 3O6FB 4ZQKA 4JG0L 5J11C 4G9DB 2OR8A 1QFOA 1AGFB 2CPUA 2ZKHL 1YPZF 1F1AA 5DWUH 4NQCA 3LIZH 3PG2A 2BY0A 1T66C 4J2XA 3II1A 5AAMA 2ZG2A 5D5ME 2VJ0A 32C2A 3CFUA 1F4WL 5E2JA 1Q8MA 2R1YA 3GGWA 3HAEB 4H5SA 5BOPA 2X9ZA 2ZOLB 4G5AA 2RAMA 1V7NH 4HA1A 1MUJA 3KPOB 1BVLB 3CDZA 1M6OB 3GFUA 3I2CH 3VFOA 3IDMB 3QJXA 4GS7C 1ETJA 1P1ZA 3MLWL 1OLLA 2WWNA 4YSEA 1OPGH 3GS4A 4TRPL 5GGQL 1ZPLA 4N2CA 4E41B 1G6RB 5JDSA 3I3DA 1H15B 1W72B 5I82A 3O3BB 3H42L 5K39A 3EBAA 5INCB 2G5BB 4LPVA 1DEEA 4ZYKA 4HCIA 1A21A 4G3YH 2BNRB 1AG0A 1PY9A 4XNYH 1FGVH 2ZT9C 3G6DH 3P77B 4PJCB 5F9JA 5MEQA 5JXED 3PV7A 3MUGA 4Z7UF 5E9DB 4BCXA 3HJ0A 2ICEC 2AQPA 1I4FB 2NXYC 4MZ3A 2UZYB 3ZKMD 4YC2C 3NBNA 1F58H 1ILUA 3IJ7A 5I0ZA 3A0OA 3QAZB 2H32B 5B7EA 3MACL 1S7QB 4W9CC 1KGYE 1AMXA 2AJUH 5IJVA 3VX0A 4IDJH 4ENEC 3CJJA 1HH6B 3EFOB 3B37A 1CGVA 3DLQR 1AGCA 1LD9A 3TF7C 1HL8A 4QNPE 4KUZL 4NKIL 2Q8BH 1CU4H 5EEWA 2F1AA 3T0DA 5I1CL 4B3VA 1AS6A 4XR8C 4PI0A 3QZWA 1I31A 2FX8H 4BWUA 4JFWA 4W4NA 1F18A 2QQLL 3U9UA 2BZ7A 2WZ6A 4KTDH 4B9JA 3QXWA 5DMGD 4KKCC 5FHBL 1M3IA 2QFRA 2H6OA 4XMXA 3NCCB 5D7JD 3VE0B 5JO5B 1W16A 4OGXL 2C9VA 4PWIA 4R97C 4RWYL 1KJ2H 5LKNA 1HAWA 4U1LA 1QUPA 1OY3B 1MOEA 5DTFB 3UPRA 2OLDA 5CGYC 1DJIA 3OB8A 1I8IB 1B0IA 3CX2A 3CN0A 3EH2A 4Y4FA 1J8HD 2W0FA 5TFSL 5DZJA 1B0WA 2XKUA 4N2GA 4KRLB 4R96A 2EXTA 5IB3B 5HD8D 4DVBB 2LTQC 2DYPD 5D1QE 1UWXK 2BVQA 2FCBA 4G83A 4RZCA 3CZUB 5F7LB 2FNWA 1Y0LA 4N9OB 2R51A 1CYXA 1QYGH 5K9KA 2I9TA 4W9ZA 1FRGL 3LXUX 4G8IB 3VRJB 4RMWA 5B38G 2DQTL 5DMKB 2DY2A 5AVSB 2CMRL 2BLFA 3EDEA 4OM0L 3P4MB 3U46B 4L37B 1P6WA 3U4EB 4U1GC 4IEFB 1HDMA 1PFOA 2EKJA 4TM9A 3K6SB 4P23D 4HW6A 4N6RB 4E0RB 4M62H 1WA1X 2E7LC 1KJ3L 3MJGX 3G04A 4P4KC 1QBAA 5BQDA 3TURA 3EJTA 4J3WA 3GK8L 4KDWA 4L0ZA 4X6DA 2ZOKA 1C7SA 1NKOA 4YDKL 2F1EA 2X6AA 4JFUA 3BE1L 3J2PA 4L05A 2XWDA 1DBMH 3B9KD 2Z91B 4I5BA 3F85A 5BV7L 4TQPA 1AE6L 2L7QA 3D85B 3GM0A 4ZJ9A 2YAHA 3NJNA 3QUYB 1JXDA 2HLAA 2ZX5A 4F8OA 2PP9A 1HE7A 1RJYA 4GJTB 1E28A 3T2OA 1UA6H 1H6FA 2BVPB 2IH3A 2BVYA 4XGZB 3LPFA 1BM3L 4X7TB 2ZONA 4XTRC 4BFIA 2A4EA 2J8UE 1IKFL 1NCCH 4PJ7E 2GYSA 1RZ8B 1JZHA 1UXWA 4DP8X 3BDYH 3B8YA 2MFNA 3BWZA 1AXTH 5DUBA 1F86A 3RVVD 3RDTA 3KCWA 4Z78B 2W9EL 4KZDH 3V9FA 2EILB 1BZQK 5FS5A 1P84J 4NM8H 4HAGA 2AVFA 2Z9TA 2XZAH 3MRFA 3FBKA 1FI8C 4L4TB 4MAYC 5DUPL 5FF6B 5IW3A 3E80A 4MNQE 4M3KB 3ASNB 5EOTA 1H3PH 4FFYH 4CNIA 4PGBA 2GTQA 2H0EA 3IDXL 4UTAL 1ZGLB 2P80A 2HT4C 4S11A 3SSGA 3QS3A 1BBJA 1NDGA 4ATWA 1CLOL 1KCSH 2JNZA 4KNTA 1X7QA 2H3XC 4HWUA 4KKLC 5L0QC 1UWEL 5EZIL 4FKEA 4JQVA 3QW9A 4QY8A 2XG5B 1GIGH 3KBEA 1TPXC 2JCCE 1JZFA 1A47A 1BHGA 2HN7B 4JW3A 4PJEF 3BLBA 8PAZA 3FQTA 4UF7C 3X12B 4GBXB 5CJBA 4DERA 3KLHC 2Z64C 4JB9H 3LKNA 5D5MF 1F8TL 2A2QT 4HAKA 4J3SA 4FNLL 3RTQC 3TPUA 3QI9A 1SXSA 3BKJH 3UAAA 4TNVF 2IDUA 4B41A 5C9JB 1GGIL 4OFYD 1WITA 2MCPL 4X99A 2XWTA 4HJSA 3I3BA 3KPRB 2JKXA 3T4AC 1CL7I 4KOCA 4UQDA 5T5FH 2MIZA 3GNML 4LVOC 4U3SB 2F68X 1NIBA 4AVKA 2IV9A 3W5MA 4XAKE 3SKNB 3FSZA 1NC2A 3KLAA 2AK1L 4U6YA 2EJ1A 4ICWA 1BA9A 3RL1A 5EV7A 2CGYA 3SQBB 2PCXA 4QXVA 1QLEH 2WSKA 5LGHH 3TC9A 4P2RD 5DWPA 1P4BH 5F96H 5HPOA 4JHUA 2FE0A 4QO1A 4G6JH 2VZOA 3O6FA 4WVRA 2DD8H 3QE5A 4G9DA 1RCYA 4I89A 4TLSA 1AGFA 3VXPB 2Q8AH 3OHMB 1FFTB 2V2TA 3M1CA 1ZV2A 4LEXL 2PW1A 1XR8B 4JFTA 1YJDL 3IAGC 5I71C 1OAZL 5A2BA 1DJYA 3KYAA 3CQPA 3HAEA 2Y9RT 1FLRL 2ZOLA 4QNPF 4U6HB 1MNNA 3KPOA 3A4DA 1I53A 3PNWA 1BVLA 4H8WH 1M6OA 4L0PB 2A74C 3AROA 3IDMA 2GEEA 1S4IA 5ELIA 3VWKD 4JRXD 5HYJE 1BVNT 3WEAA 4KRPC 2EDQA 4TTGA 3VGFA 4Q9RH 4DPCX 4Q74A 2EXSA 1M56B 4E41A 3P11L 5I0YA 1G6RA 4XBMA 3BT0A 1W72A 2E5EA 4ANXA 3O3BA 5INCA 1F4AA 2G5BA 1E4XI 1FL3B 3ZKXB 3QJSB 4J5VA 1PGRB 4PJCA 4WCYL 4HG4J 2J1YA 3NIFE 1E6OH 1IGIL 2OMVB 2EVGA 2K4WA 5E9DA 5AW4B 2H32H 1KFAL 2Y7NA 3BQUD 3DX6B 1OF0A 1OSEA 2UZYA 2VLJD 3QXAA 4G6AC 5F21B 3VG9B 1I3RB 3IMTA 4L1SA 5I0VA 1AQ8A 3DOHA 4XHJD 3WEMA 1PSKH 1H3WM 3SE4A 2ZUSA 1S7QA 2GC4C 2BRRL 5MENA 1BFVH 4LNVA 3HTLX 5EZJB 4RRPM 4IBZA 4Y2DC 1HH6A 5EU7C 2OCFD 3EFOA 1QWNA 2IPUK 2JFCA 4GO8A 5IBUB 1Q9WA 4UQ9A 4L8CB 1KB5H 4YHKL 1CC3A 4Y5XC 3VA2C 4EZLA 5B3SB 1KJVB 3AS1A 5I6KA 1NDMB 1SM3L 4DGVL 2E9WA 4ZMQA 2BFVH 3VNYA 4MASA 4I0CC 4WTZG 3RWGB 4KROD 1KCBA 2G60H 1DSFL 4JAMB 5SWZE 5DXWA 1ZLUH 3SGDI 3SJVB 4XVTH 4Z8FH 2WLHA 4LPYA 5EF2A 1S9YB 2P46B 3NIDE 1OL0A 2WOBA 3OMNB 5HHOD 3VE0A 3D09A 5JO5A 3AS0A 4JZOB 3BT2L 4WNJA 1I85A 2DKMA 5F1IB 4DGYL 1I9IL 1I8IA 3ARDB 4JPVL 3R8BB 3TBBA 2DEWX 5BVPL 1JZ2A 1GC1H 1WTGT 3GHEH 1CICA 2RJMA 4AE1A 2DQUL 2YPLB 1YQ2A 4X6EB 4MFHA 2D0GA 5JHAA 1VCBC 4MBOA 4WHYH 5C08B 5K59E 4BK5C 1IGTB 1CGUA 4I1RA 4G8IA 4PJ7F 3VRJA 2FWOB 5DMKA 5JA8B 3ABZA 1E5ZA 3ULVH 5T1DL 5CFHA 5I8KL 3SDXE 3P4MA 3U46A 5AAPA 4OLVH 3U4EA 3BPOC 3NJKA 4IEFA 3K6SA 3N6YA 2I26N 4R4FH 2V3EA 5F7UA 4ORGB 4N6RA 1I8MB 3OHXC 4E0RA 3S4SG 4GKOA 1HXMA 1UADC 2OTUB 2OTWB 5DVOA 5I6PA 2CPCA 5DURD 3M1BB 1XVSA 2FJHA 2K78A 1HJBC 3Q6GH 4C4KO 1MCJA 1GR7A 2PP8A 4L8BA 3D0VB 3T3ME 4AZUA 4DO4A 5AW5B 4AY0A 2Z91A 3FB7A 3H9SB 4P46D 3D85A 5CJQL 5FDWA 1W8NA 1FG2A 3NEEA 3QUYA 1QHOA 5J3HD 1V5JA 4X80L 1CR9H 4N1EA 1TQUA 2LV4A 2QPFA 3SQOL 5FW6A 5HYSB 2JCCF 3GSRA 4M6ML 3G5ZB 3MV01 4E9YA 1I1AD 4XGZA 2IAMB 1J87A 1DO6A 4X7TA 1VKXA 3TEWA 1SJXA 5CUSL 4FTVD 5ITFB 4IRZL 1RZ8A 3PWPE 1EZUA 4XNAA 1BZ8A 3CSFA 4ZTEA 4EIZC 1SMDA 3W9DB 1TLMA 4Z78A 3U2IA 4DPBX 1EZVY 2BMKB 4OV6F 1H9VA 1VPOH 4TL5A 4Y9GA 1R3LB 1OPOA 1WO2A 2JF1A 4POYA 5FF6A 2ZWSA 4L4TA 3HS9A 5I6XC 4LGSB 1D5BB 4EO5A 1QW9A 2ZAGA 1JGUH 3FQYA 4PJ9B 3I6LD 2F54B 2LLLA 3O81A 2PYEE 5IB4B 1MCWW 1Q1PA 3K1KC 3UEQA 1ZGLA 4DF9A 4ABQA 3IMVA 5I24A 1JPEA 1YEFH 3ZRFC 2YD4A 3L1OH 3BAEL 3F7KA 4JFEB 4ILDA 3L7EB 4PVLA 1UATA 5GS3A 3RY4A 1UTDA 4RSYA 4DEPB 3BRDA 4OVUA 2OMTB 3WUWB 5B8CC 1L9QA 5KOMC 2XG5A 5HDBB 3PUCA 1QAWA 2AJ3B 2HN7A 3EZJB 3RVTC 1KXTB 1U3NA 3DECA 1XMEB 2X4SB 3PV6B 4GBXA 4PRHE 3X12A 1JZ8A 1OWRM 4BHUI 3JVGA 4Q58C 4BDVA 3GXDA 5I75C 3KWWB 4O58H 4NM4L 3SYOA 2DN7A 1DJZA 5C9JA 4BH7B 2YSSA 2BY2A 2DM2A 1U30A 1RVFH 1YQVH 4JM2F 2K3HA 4GRLC 4I77L 4U3SA 4IBQA 4TS6A 4ZSOE 5E1HB 1TZGH 1T04B 2CALA 4YDIL 3ZDXB 2RGSA 3SKNA 3PPSA 3AG4B 2AGJH 3X1FA 3MV7B 4AQEB 4GINA 3UO8B 1B4JH 1VEOA 1KNOB 2MCMA 1IRAY 3ZYOA 2H4EA 5PAZA 5A2IH 4FXKC 3SQBA 3OZKA 4ZXBB 3S34L 2FYYB 5SX5H 3V4VL 3LPGA 5IJDC 2A7BA 4UNTA 3NIFF 5J5EA 1J1XH 1KEML 2XC8A 3PP4L 1K8IB 1QWUA 5E8DL 5D72L 1TZOA 5KSAD 4IGBD 1OQXA 3C9NB 1F41A 4A2FA 3VI4B 3J8F7 1KN4L 4Y4HD 3N40P 3VRLE 4DP0X 1XR8A 3JSSA 3UOAB 1MAMH 1CCZA 4EXPX 1WT5C 4IOFC 1UYWL 2BIIA 1J88A 4Q7DA 1CXKA 1DVSA 4U6HA 1BQUA 2D7TH 3C75A 1T3FB 4IRSD 2B77A 5F7HA 1AY1H 1SOXA 4HQQL 4QRRE 1JI1A 1JOIA 1XSJA 1PTZA 4R7NB 1EAOA 3P0GB 3QRGH 1AO7E 5IQ9B 1E8WA 4MVBC 1MCRA 3G6AB 4OLXL 4I0PD 5FGBA 5I74C 3VGHA 1FL3A 4IU2B 4WI7A 4M43L 2WW8A 3AM8A 3NIDF 4MHHI 4AEHL 2ZYHA 2OMVA 5DMIH 2D0FA 5F70A 3QQ9C 3DX6A 3UZQB 1A3RH 3WCYA 1TSHA 1I3RA 3APMA 3MRJB 5HI3D 1P0SE 3L7FB 3CDYA 5F6HJ 2OV0A 2R8SL 5AZ2H 2VN3A 2C4FT 3FFDB 3UYRH 2J4WH 4JFDB 1JNHB 4Z7AA 5EZJA 4QRPD 3D30A 4H0LC 3SO3B 3VXUB 3SBPA 5FEBA 3FDWA 3RGVB 1C7TA 1N70A 4OCSH 5K59F 2AITA 5CZVH 4Y5VB 3GQFA 4KXCA 4EI5C 1S5HA 4CBZA 1R3JB 2RCSL 1KJVA 4ZX4A 5IT2H 1NDMA 3SDXF 1S7TB 2DDQL 5C0DB 1QHPA 3U30C 1WWCA 4NWUL 3TN0D 2DI9A 3RWGA 3WMSA 3HKZA 1I82A 1AS7A 1HIMH 3R4RA 4JAMA 1RK7A 5HYEA 4M48L 3SJVA 3TT3H 3NCJL 4YSDA 5KUMA 1TYRA 5IMOA 4NIKB 1S9YA 5F7BA 4JO2H 2ZYRA 3T3MF 3KXFE 2QJDA 1DBBL 4YXLL 3ELAT 1MHPL 4JZOA 1J0IA 4FQXD 4WV1B 1B4RA 3WDHA 4U1NB 5F1IA 1PMYA 5C3LD 4JKPL 2W0KA 4D3CH 4R0LC 2IALB 2DQEL 3ARDA 4M93C 3WL9B 3KPNA 3V9CA 4JY6B 2CO4A 2FEEI 1I9RH 2YMOA 3RFRA 1YCSA 4JEGB 3RVWC 5J0BA 5FCSH 2DJUA 2MMXA 2YPLA 5DSCA 4OQTL 4OZGE 3FU7A 4X6EA 4M3JA 5BRQA 2D7NA 1K5WA 4HXAL 3WIHH 3FFCB 3GI9L 1FZMA 3BX7C 4H44C 1QBBA 2BM3A 2FWOA 3K6DA 2R4RL 4ES8A 1G7MB 4WDIB 5D1ZI 4O9HL 4DOHB 1OSPH 3QJQB 5TPWH 3VTTA 3MRRA 4KZCA 5ISZD 3TA4D 4ORGA 2X4NA 1I8MA 4PQXA 1G43A 2FNBA 4Q97A 1BAFH 4KDTC 4XMLH 2OTWA 2OTUA 4DCQB 3M1BA 2Y1AA 5FWQA 2BK8A 5D1XE 1TYEB 4LBAA 3DYMA 4WENB 5IY5B 3RHWF 3D0LB 4LSVL 1ZTXL 3D0VA 3DUSA 3I9IA 1RURH 2Z8VC 3QCUH 1A7OL 5KVGL 4XXWC 1XAKA 5C2UB 3H9SA 2BIPA 1A4CA 3BIKB 2J1WA 1G0XA 3VXRD 4H25A 1IEHA 3RFZA 4F9LC 3D9AH 1XSOA 5F7YC 5A2LH 1QI5A 3G5XB 2G3MA 4OCMC 2ZQKA 4EI0A 1LVEA 3LQAL 1FN4B 4PRPE 4RH4A 5IQOA 2MNWA 3G5ZA 4FQQB 2H1PL 4TQEH 3WY3A 1X4XA 4AV4A 1J5HA 2IAMA 1XFPA 3GSXB 5DVMA 4N2EA 2B9AA 1I8KB 1F45A 1EO5A 2FK9A 2VERN 3HB3C 4U2ZA 5ITFA 3P9MB 3SKOB 5E8PB 5BS0E 4EN3C 5EF1A 4FFWC 2OZ4H 3W9DA 4XCYB 4LOUC 2BMKA 4AMXA 2KERA 2BHFA 1R3LA 1LEIA 3OR6B 5CLWA 3GMRA 1D5BA 2GHZA 3V0WH 4JFSA 4PJ9A 2F54A 2WXLA 3L08A 4A7GF 4XE5B 2VDOL 4LGRB 5EIIG 5IB4A 3QR1A 3BIBX 1SN5A 4A2LA 4DPRA 2IIJA 2GABA 3L7EA 4J39A 3HZMB 4F2MB 2CA4A 4Y1AB 1YYCA 5D93C 2WOYA 4UIKH 3WUWA 1ZWIB 3WNLA 4C57C 3FUIA 4ZZFA 3R7QA 2GBUA 4OQ1A 1NGPL 2AJ3A 4KVNH 4KKBC 3C2AH 1KXTA 1YMHB 2FB4L 3PV6A 2X4SA 4TV3A 3UJTH 5E70A 4PJXE 3VRLF 1A7NL 4KKAD 4GQQA 4MA8L 4MJ6B 2K6ZA 3T0ED 2WGXA 2FATL 2D9CA 2N59A 2WN2A 3L6FB 4Q4IA 4Z23A 5KBMA 2WSPA 1AQDB 1WAAE 3UTSE 5GZOA 3II2A 4HX1B 1BOGB 4BH7A 1S7SB 4NQXB 1R75A 2Y07H 3VXME 1EA9C 2ZUTA 5L88L 2QGDA 1CK0L 2YD0A 3DXAD 1EEUA 2EDLA 5AAMC 2IWEA 1MVYA 1T04A 1OP5K 1LM8V 2DQIH 3MOAL 1GS8A 4UT6H 3MV7A 3NZHL 4AQEA 1HSAA 1S9KC 1JG9A 2GJ6B 5CIPB 1WS8A 3ZX1A 4KO6A 3X3GL 3D8MA 4Q6KA 2ZCHL 4HLZG 4ZXBA 2FYYA 4PAZA 1P5UB 1MZZA 4N26A 5KBDA 3KPQB 3IK2A 4IJ3C 4ZBJA 2HT2D 1K8IA 2OP4L 3CLEH 4QEGA 4NZ8A 3V6OE 5IWLA 3FONB 1PNCA 2V3DA 4YSUA 1A5FL 4JVWA 3N9GH 4E5XA 3C9NA 4OJEH 2YEQA 3VI4A 5A2KH 1J0ZA 1XSKA 2YFNA 4N2IA 3MJ9L 3QQ4B 4LHUG 3IFLL 2YAEA 1SDAB 5DK0B 1SFHA 3TL5A 2FQEA 5CKGA 1SEQL 2NT0A 1VGEH 4MMYB 4N2OA 4OGAD 1T3FA 1B90A 2YRLA 3K0YA 4XAWH 5LBGA 3VWJC 5I18H 5T3XH 1TXKA 4NRXA 5BRZD 3LEXB 3ZMNA 2AEQH 4HT1L 4R7NA 2IDTA 1F13A 3ARBA 3BD4A 1IQDB 1HCZA 5IQ9A 2F7IA 2VLRA 3MNMA 4D8PB 2J20A 4RGOH 3TYGL 3WLBB 5D9SB 4ZW7A 2CGZA 1OEZW 4TSAH 3ETTA 4IU2A 4LCYB 4MKMA 4N85A 4CSPA 3TEZA 5EOCJ 3QPQD 4PJAE 1CO1A 5FV1L 1Q0YH 2WZ0A 3U4BH 1MRCL 3APFA 4YGVB 3V6ZB 3CV5A 4GO6B 3QISA 2ETWA 1KPRB 3SE9L 2JV6A 4AGMA 4PJDA 1EHKB 5JHDE 5C0AE 5KWYC 1MLBB 3UZQA 4MMZC 3CG8A 1GOGA 1HOEA 1T5XB 2VDQB 1Z5HA 3MRJA 5I1JL 2VDLL 3L7FA 2KI6A 1UKQA 1YEEH 1FA4A 3FFDA 5DD3H 4JZJB 4JFDA 1BIHA 1JNHA 1KBKA 4UZGA 4ZNCD 3P30L 1JYWA 4Y2LA 4GSXA 4OZGF 1SGKA 1DBKL 3VXUA 4Q14A 3VFWB 4K5MA 1CXEA 1E5BA 3MCLL 4HJJH 3RGVA 2HAZA 4I3SL 3V8CA 3FCTB 1IAKA 2ZKWA 4Y5VA 1GMEA 5DFVC 1H3XA 4Y4FC 2WIMA 3FUNA 3L9EA 3T3PB 5C1MB 3GSOB 1KY7A 2VSDA 2ZCKH 5AEAA 1S7TA 5C0DA 5H2BB 3VGAB 5EDSA 1NGQL 4N2NA 2RFXB 3STZB 2X70B 3QCVL 3ULAB 4Y16B 4W4OA 1SHXA 1JK8B 4W9LC 1CT8B 2A6KB 3ZE1E 4XMZA 5LJYH 5G4MA 1CTNA 3MREB 4DUWA 4A7QA 3VD0A 2XV0A 3S9DB 4WV1A 4U1NA 3P69A 3JVFC 4K8RH 3K2UH 1PQZB 4Z3GA 3QFJE 5HHME 1E3ZA 4ZMXA 4JY6A 4LCWB 4FI8A 5GGTA 4X5WB 3VSUA 3KYKL 1UM6L 4NZJA 4HEPA 3VTAA 2VXQA 3Q8FA 4LVNC 43C9B 2CKBA 4MNGB 3ORJA 4G72B 1A6ZB 4HALA 4XWOD 3FFCA 4EZJA 4RMSA 3KBHE 1AP2A 1RUPL 2B8OT 3HPLB 2YD2A 3SEPA 4DWHA 1G9ML 3QIWB 1G7MA 5D7IB 4WDIA 5I66B 4L48A 3MLTB 2DJMA 4N8PA 3QORB 4XNZB 3SCMB 1U3HD 4DGUA 4X5PA 1SNRA 1MXDA 1R34A 1JZIA 4LIQL 3WLWD 1XIWD 2MJWA 5CM1A 1FYHB 4DCQA 1Q94B 4ZS7L 4XPAH 3W0WB 3PF2A 3VFGH 5CEZH 2W88A 3OKMB 2O72A 4XCFH 1A6PA 3TV3H 3D0LA 2ITDB 4FLQA 2DTSA 4L2LA 4FHJA 5HGDA 4AIEA 2DWDB 4PJ8D 5TGBB 1SY6L 1XX9C 1CFQB 3QXTA 4G8FB 4GI6A 5FYKH 3MLUH 1G9NC 4Z7WF 2J71A 3QZWG 4AMWA 4ADGA 1TJXA 3HI1B 4FQQA 3W3BA 1BFOB 3GSXA 4PJXF 1KENL 4Z7NB 2Z0UA 1UH3A 5C0BD 4OB5L 1I8KA 2VAAB 5GISL 4L4JA 2R1XB 3Q0HA 2CBTA 4ZFOB 3P9MA 3U4KA 3SKOA 4BQCA 5E8PA 2NUPB 1QFUL 1WAAF 3FSWA 4P3DB 1CG9B 4O5LL 4PHZA 4XCYA 4MXWH 3KE0A 2P44B 4AV5A 4HWZB 3CX5K 4AQZA 2HLFC 1MIML 3ZVVA 2AQ3A 4Q8BA 1FH2A 3C60B 3OR6A 3G5VB 4HZAA 2E47A 4POZC 3U7WH 3F7PC 1DVFB 1NBZB 2CDGB 2Z7WA 3O4OC 5D55A 3M8OL 3GMQB 3P2TA 2OM5A 2XN9B 2EVJA 5E4IA 2Q1EA 2Y06H 2HWZL 3KS0J 4FZ8H 2JTYA 4KUCD 2CR6A 1QR1B 3KPLB 4I9WD 1FBIL 4G7RB 1MLCB 2YGPA 4HJ0D 2J73A 3LN4B 4ES9A 4Y1AA 4F2MA 1IBFA 1TIUA 1E65A 3C5ZB 2C9SA 4EKXA 2F5BH 1T03L 3TA3D 1SUHA 4HPYH 1S7VB 5T1KB 2Q3ZA 1XCTA 1ZMYA 5I1HL 3UBXB 1U8QB 1EO8H 2VAJA 1A7BA 1YMHA 2Y1VA 1Z9MA 1T0NB 4P5MB 3T08A 5FWRA 1KYFA 2B0SL 2YXWA 4K3DL 4MJ6A 4MZIA 4IK7A 5I73B 5DZPA 3QUXC 1AR1D 2I9LB 3BWAB 1AQDA 2KPWA 4CSZA 4HX1A 5IFAH 3O6FC 2DQHL 5I5IA 4LSUL 1S7SA 1M53A 4AJYV 2Y6SD 2NMSA 4XMPL 4NQXA 4BD4A 3P3UA 4LOEA 1EEZB 3E8UH 3QDJE 1Z66A 4LDCA 4YH6A 3ML8A 2XZZA 1QP1A 1A7PL 4ZW6A 4AKOA 4JFYA 5CIPA 4Q9CA 1BF2A 1DZ0A 2B7DT 2FSDA 3UCRA 2GJPA 2MQ0A 3QHFH 3AU0A 4PJAF 4JPSA 1GAFH 2FUQA 1P5UA 1XL4A 3VQ1C 3KPQA 5HHXH 1CDGA 3U2JA 3FONA 5E03A 3C6LB 3O3AB 5KEZA 1TENA 3W11D 4JGMA 3D3VB 1CYGA 3F6LA 4GAJL 1QFWL 2R69H 3QQ4A 4KQ4H 2VQTA 1A0QH 3QUZB 3X1BA 1MRDH 4NUMA 1FQ9C 3O6LL 5DK0A 3BGFB 1RUQH 5G4OA 1D9KB 4ALAH 5ID0B 3EJYD 3BMWA 1DQDH 4WQOA 4ELKB 4FQIL 4XP4H 1LILA 5EOCH 4MMYA 4TNFA 4WF7A 3GDCA 3GO1H 3OQRA 3HNVH 1WIUA 4AI7A 5F7AA 5IEHA 5EIQA 3SE4C 5GS1B 3LEXA 1JUFB 2BNRD 4UMGA 1XTLA 4L8SC 5DD1L 1IQDA 2OMWB 5ABZA 1FZJA 2O5XH 4D8PA 1CFNB 3WLBA 4DVRL 3PABB 3QC6X 5D9SA 4S10A 3NESA 4FEIA 3N1GC 3CMOH 4KXZH 3ZE1F 4A6YB 5TK2A 4HGMA 4DKFH 4YGVA 2VDQH 3QEHB 3V6ZA 1O9ZA 4Q0XH 1PKQE 4JPWL 4BRJA 1KPRA 1HCVA 4LMQE 1MLBA 1UCBH 3RWFA 1T5XA 3TTSA 3LX9A 4J4PA 4A2MA 4I3RH 3OKOB 3ABGA 3B9AA 4FJYA 4DO6A 3SGEH 1N2RB 3QRLA 4HGKC 4JZJA 3IGLA 4BK8A 1JD9A 1RIHL 3ZIMA 5KTEL 2ED8A 2ZICA 3KBPA 3MZTA 2BOLA 3QWNA 4PV8B 3REVB 3LHPH 4R5XA 3VFWA 1RJLB 2CO1A 4RA3A 2I5YL 3KGRA 4YJZL 4Z7QB 3FCTA 1WPCA 1I85C 5I1LB 3HNTH 3S2AA 4PJIE 3MLZL 4RA0C 1AJ7H 2NY2D 1J5IA 1CBJA 1CICC 3GSOA 1KBWA 4PJEA 4FYSA 3R1GH 4XN8A 5H2BA 5JHLH 3AY4C 2Y25A 3K72B 2RFXA 4RGNE 3L1GA 1FGNH 3T6VA 4Y16A 3WNOA 3KM2A 4JX0A 1CT8A 2A6KA 4A7VA 1J9TA 2DI8A 1RLBA 3ATEA 1P7KB 3IS0X 3S6CA 4ODTH 3MREA 1BD2B 4HFUL 3HAEG 5J13C 2BOCB 5FO9B 4ODVL 4UQ2B 5ICUA 1CDIA 1MCBA 3QVAA 3U1SH 4RFNB 4D9QE 5F97E 5DT1H 1PQZA 4AE0A 1HHJB 4DAGL 1H3VA 3DV4B 4LCWA 4X5WA 2XJLA 4MZRA 5DZOA 2WLLB 5C09E 4AQ8A 3HG4A 1F4YL 5EWIL 1MNUH 1R5WA 4N68A 2KQMA 3EO9H 5KBLA 4PJHE 4FG6D 4MNGA 3IGKA 1A6ZA 2X2UA 4LASH 4XN7A 3OKNB 5KVGE 1FE8H 3CH1B 3HPLA 5JYLA 5DJZB 4L18A 4RAUB 1C8PA 3T1WA 3ULVD 1TTUA 1XZWA 2QADB 3O3EB 2GJZB 5D7IA 4PJGB 4XNUL 5C6TL 5I66A 1LO4H 4AEIL 5CSGA 3SCMA 3CCHB 3QORA 1DANT 4E2OA 3T5WA 4X42A 1N6QL 3H2WA 2ARJQ 3K46A 5FM5M 3QYNA 4ODXB 4BELD 5F7FA 3GS7A 35C8L 4P48A 4DKEH 4Q9QL 2GSIB 1Q94A 1TO4A 3F7RA 4B96A 1I1RA 3W0WA 3GUFA 3PJLA 5ALCH 4F7CB 3OKMA 2VDRL 2IGFH 2ITDA 3V0FA 1EJ6A 4OF3A 4D9RE 4KAQH 4CBPA 5BQ7B 3EYSL 2K8MA 3ARFD 4ODSL 5TGBA 4EI6A 4G8FA 1CFQA 4W6YB 2WO2B 3HR5B 3BWSA 3JWDL 1XH3B 3V5KB 2O6EA 1ZDSA 5D7LE 5E99L 3NSDA 3HI1A 4ZTOL 1NJ9A 3KVPA 4MA1C 5EIVA 3AQZA 5C0FB 3D50A 1BFOA 2IBZX 3S5LB 3TVMB 2P5EE 3UZVB 4JFFE 3QWRD 3PWNB 1T7ZA 1UJ3C 2VAAA 4PBXA 2R1XA 2XZQH 3MLRL 4TULL 2CDFB 4JFZL 3LH2L 1T66D 4ZFOA 1UD8A 4GG6E 4PVBA 5JIMA 4C55A 2NUPA 5D7KD 4P3DA 1CG9A 2WZPA 5IW1B 1ERNA 3KS0H 4I87A 1BWMA 2Q7YB 3NSCA 4HWZA 4NP9A 5SX4H 4GSDH 4B9GA 4JG9A 3RUGB 4PS4H 1AIFB 2VCOA 3C60A 5TDNB 3VFTB 3G5VA 4AGOA 1FH5H 4IW4C 1NBZA 2CDGA 3NP3A 1U3YA 2LHAA 3FCSB 3PJSB 3GMQA 4PRIB 4XC1H 3JVGC 3IJSB 4R8WL 4H20L 2XN9A 3SGJC 2NQ3A 3V4UH 5HPMA 2ZXCA 2YO3A 1PLBA 4OT1H 4GP5B 3TO4C 1CVRA 5CEYA 2F9BT 1QR1A 4QIRA 1N67A 4YVUA 3UO1H 4P2QE 4MJ5B 3OXSB 4QHNB 3QJUB 3LN4A 1QLFB 3KLQA 3C5ZA 3UGXA 3K81A 8CGTA 1E4WL 5T1KA 1S7VA 5IV2B 2N7BA 3O8XB 4HJTA 2ICWI 3VH8B 1JTPA 4L1HA 4KGJA 3ILDA 3BVXA 5I15L 3FL7A 2J8HA 2DYSB 2L0DA 3NTCL 5T3ZE 3IYLW 1T0NA 4P5MA 1HH9B 1QPXA 2R2HB 1OP9A 3DSNB 1FYTB 2ZX6A 3UABA 1FO0L 3FU5A 3KPRD 3BKMH 1L5GB 4M6OL 5I1AB 4GIPD 3BWAA 2I9LA 4UT9H 2BXZA 2WV3A 4ENED 5KSBE 4KQ0A 1KBGL 1K6QL 4NT6B 1E7UA 2VC2L 4MQTB 1D5RA 1IBGL 3MTXA 4I1PA 1EEZA 4JPIB 1MQKH 4P06A 3ZE2F 3O41B 5HDOA 5L4FA 4H1LB 5EOQH 2CJSA 1OK8A 4TOYH 2F53B 5FC9A 3WMPA 2Z31C 1R0AH 3KEHA 2H7WA 1JZ4A 1WZKA 5CCKL 1R47A 3FSAA 4IS6B 4PGCB 5IROA 1IGFL 4L5FE 2HUHA 5FUOH 4ZMAT 4KKCD 5C0CD 3HN8A 5D6DC 3C6LA 5BVJB 3T0XA 2F15A 3HRZB 2YWZA 3U79A 3D3VA 1YEJH 5FIEA 2EH8L 5F8RC 1IBHA 1MJUH 2Z1KA 2IOMA 1FNSH 3ZKXC 4K7PH 3QUZA 2R29L 2EXYC 1F1DA 3Q2NA 4NNXB 1TTCA 4HOZA 2EYTA 3DYOA 1BP3B 3BAYA 4WO4A 4P5RA 3HR6A 3VXSB 1D9KA 1Z0MA 3NPZB 4QTHB 4LCCA 3UL4A 4Z3IA 5ID0A 1J0HA 2VMDA 5JQ6H 3VGDA 4WNQB 4ELKA 3MLSL 2DW5A 3VG9C 2HH0H 1EVTC 3CVIH 4XZUB 1O7SA 2GSMB 2BIMA 5E94B 4L4VE 4PJIF 2PETA 3CVBA 1JUFA 4WKZA 1U8KB 5D7HA 4LLWA 2OMWA 2HA1A 1DQKA 1CFNA 3PABA 1WD8A 1F97A 2WXGA 4XCNB 3NDZE 2CXKA 4HUXA 2FBOJ 4WW2B 4J3OC 5I23A 2ODIA 3ZSSA 1ZT7B 4A6YA 4WI6A 4F9PC 3FTGB 3QEGL 4JHAL 2K45A 3DYPA 5EEXA 3VSTA 1L6ZA 2LVEA 1DLFH 3VJ6B 3L3HB 5JPMC 2OJ1A 2FYVA 3FYIB 2IANB 2FJUB 2UXGA 1SXZA 4PR5A 1TQBC 3ESNA 4YSAA 1EHXA 3OKOA 4P3CL 4X7CC 3C6EA 1DLHB 1EUTA 3P4NB 1N2RA 2E0PA 1REIA 1E9OB 5DQDL 3WNKA 4MMXA 2DKSA 5JYMA 3REVA 3T1FB 4PV8A 4PJHF 1ZLVK 4OLUL 1G9NH 1X5ZA 1YNTF 3FQ4A 1KG0B 4GG8B 5D2LB 4LLVB 2FLRT 3L4VA 5GRUL 3RY6A 3UC2A 5I1LA 4XPTL 5F9WB 4TQ8A 3MRMB 4ZOEA 4EDWH 2E9JA 4FGMA 3ARRA 4FCHA 4WEMB 1U6AL 4KKNA 4XTRD 2DQJH 2F08A 4X7FC 4E42B 4ZNEA 2ZPKL 1KZYA 3QJHB 5DMJB 1D2OA 4Z7VE 2E59A 2Q20A 2VR7A 4FQ2L 2ZUQB 4PJFB 2XXFA 1WSST 1TOXA 3W38A 1WEJL 3DO7B 2CGRL 5DJXB 2YMXL 3QO0B 2VW4A 4HV8B 4KTGA 1P7KA 1AQMA 3PXJA 2ZJSH 4RQQA 4BE5A 1JPSH 5JQHC 2BOCA 1KF9B 1QI4A 4NZTH 2X5PA 2XKNB 1KXVA 5FO9A 3KWTA 4EF3A 2RIKA 3MRIB 2Z0BA 4UQ2A 1BG9A 3KPSB 3C8DA 1HHJA 1QATA 2HT4D 4ZPVB 1ML0A 2JKSA 1LE5A 3DV4A 4NP4H 4KJYB 5C08D 4QXUH 2RACA 2WLLA 3PL6C 3JWOL 2FHFA 4KKLD 1HU8A 1WUNT 2EDOA 3FUMA 2BSBA 4I88A 3GSNH 4JY4B 3WTTA 3OKNA 3BEVB 4KH2A 3CH1A 1G7IB 3BP4B 5DJZA 2HFTA 4RAUA 1YNKH 3TM6A 3UP1A 3RFZC 5AVXB 3HMXA 5DWUL 1A7QH 1JYXA 3LIZL 3O3EA 2GJZA 4GG6F 1UC6A 4JGJA 4UMSA 4PJGA 4G71B 1R1CA 1OZUA 3CCHA 4QMEA 2A0LC 1ET5A 3X17A 3FO1A 1CVSC 4PY7B 1RI8A 2OMNA 5HYQB 3LDBB 2IH1B 1V7NL 3ALPA 1EQWA 1CD1B 2VDML 3I2CL 4F7CA 5IUCA 3FAWA 3JYCA 4PWJA 2GK2A 5EF3A 4Z6AT 4WK2B 1YC7A 4J3OG 1KTDB 1BMZA 5AW1B 5IBUG 1PY4A 1BPVA 2HKFH 1BWWA 3HR5A 4G3YL 1SJVA 1OM3H 2XBDA 4NI3A 4XNYL 1FGVL 1SXAA 4RISH 3V5KA 4PJ9C 3G6DL 2DMCA 5KYXB 2KUTA 1BVOA 4Y8AA 2QPEB 4XNBA 4JN2B 5C0FA 2VWEC 2ZXQA 3LS5H 3S5LA 3TVMA 3N2JA 3NSYA 3WBDA 3UZVA 4PUBH 1KCVH 5EORH 3PWNA 5DFTA 1F58L 5SWSB 4ABWA 2CDFA 5EU7E 2J2ZB 1GTFA 2AJUL 3MOQA 5IW1A 1S8DB 4G42B 5KSBF 2Q7YA 4IDJL 2TSAA 2DEYX 3FJTA 2OA9A 3RUGA 4PBDA 1AIFA 1ASOA 5DEJA 5TDNA 3VFTA 2VR5A 2JJVA 2JJUA 4XB7A 2Q8BL 4JFED 4AW7A 2E3VA 1CU4L 3PJSA 3FCSA 5I9QB 4PRIA 4FERA 3IJSA 2EEXA 3DGCR 4V1DE 2MKWA 2ZNWA 1CB4A 1TYJA 3DO3A 3NFNB 4MGXA 4KRPD 4OZFB 5GPRA 2YQ2A 5BV7B 1ICTA 5GZOC 5I2IA 2FX8L 1OGAE 2OR9H 1JSYA 3QULB 4MJ5A 3HVDA 3OXSA 2APXA 1QLFA 4KTDL 4OD3H 3D25B 4QGTA 4AYEC 5IV2A 3O8XA 4QOKB 4A38A 1VADB 3VH8A 4F8PA 2X3BA 1Z32X 1MG2C 3AY2A 1GY2A 1KJ2L 2C3WA 4KKQA 4L9LB 1ECYA 4U3CA 2WCPA 1HH9A 2R2HA 5TDOB 2O5NA 3KBFA 3DSNA 1FYTA 4M1GH 1L5GA 3KHOA 1O7DC 5IWLC 3P3RA 5I1AA 5KVEL 1SJHB 3WYRA 1SPDA 1KCRH 2A1WH 1MEXH 3IFNL 4FA8A 3JBG7 4H1LH 2LLNA 1JK9B 4NKQB 4HUUB 1JJUA 1OCRB 4MBRA 1EJ8A 1CQYA 4JPIA 2W81C 2WP3O 3O41A 1J48A 1QSFB 2AEWA 3WKQA 1QYGL 4H1LA 5FDYA 1OAKH 1Q9OB 2XFGB 3QIBB 2F53A 4JPQA 3B2PA 1U42A 4K2UL 4ZMVA 5EEUA 2BPBA 3F01A 1QZ1A 4IS6A 4PGCA 2NY3B 4GRMA 1AAJA 4HAFA 4M62L 1JCKA 4Y5YA 3GKZA 3B6SB 2YSTA 1HL9A 5BVJA 3LPOA 3ARBC 3O2DH 2VXTH 2ZOOA 4YR6B 2N0MA 4M00A 1M7DB 4U1HA 1ZJAA 3V6FB 3U4AA 12E8H 1MY5A 4XO9A 1DBML 1YUHB 2DBLL 4L3EE 5DJDB 3VRIA 1OCOB 4QTHA 3WKPA 2EYSB 3NA9H 2O93L 4WNQA 2MOQA 3K80A 3QBTB 1UA6L 1EERB 4XZUA 3RA7H 4K7PX 5E94A 5T3XD 4DQOL 1AG6A 2VR8A 4N2MA 3ECWA 3PQYE 4N86A 2EC9U 5JIIA 5IIEB 1KYUA 1T6WA 3WUWG 4CMHC 5DZ9A 1U8KA 1I3GH 5B21A 1NCCL 4Z7VF 3RWCA 3UFIA 1ANUA 1SHWA 1ZHBB 3WDIA 1DO5A 3BDYL 1J1PH 4B97A 4DETA 1AXTL 1W6LA 4OJCA 5EZOH 1IJ9A 3OAYH 4M61B 4WW2A 4YO0B 3D0AA 4KZDL 1ZT7A 3FTGA 2ZX9A 4NM8L 4F57H 1MHEB 4R2GB 2L8AA 3G5YB 4TNVK 1JZ7A 4HUWB 2LOEA 3GMNB 3CFIC 1IGJB 2YAPA 2AEPH 3VJ6A 3L3HA 1H3PL 1LQSR 2CDEA 2JB6B 4FFYL 5DLLA 4LFHG 2IANA 3RWHB 1R24B 1AZVA 2IH8A 1WHPA 2G0LA 3AAZA 2XDHA 2MSPA 1DLHA 3P4NA 4PWEA 1XZ0B 3GC3A 1A9BB 4W4OC 4NZRH 1E9OA 3HG3A 1KCSL 2NY0B 4GLRH 3T1FA 4E9QA 3OB0H 1JFQH 1PG7H 3MA7B 5D6CB 3FNKA 2VLKB 4MCZB 5D2LA 2VDNH 3N06B 1KG0A 3PU7A 4FMFA 4GG8A 4LLVA 4M4RB 1G6VK 1GIGL 4HSCX 4OFKA 4PMEA 1NCOA 3MRMA 1D6VH 1AYOA 2NZIA 4NLHA 4JB9L 2E4FA 3ALWA 4YIQB 1DSYA 4MJHA 4E5XG 2MQCA 4ZUUB 4QLRA 3LZOA 3QJHA 3HG0A 4WHCA 1BQHB 2GSGB 4PJFA 3BKJL 2SEBB 2WBJD 3GINA 3LCYA 3VD4A 15C8H 2QSVA 5DJXA 3ZTDC 3LD8B 4RSVA 3DO7A 3QO0A 5CZXC 1A6WH 2OW7A 4AKPA 2XNAB 4MB3A 3VA6A 4OI8A 1WIOA 5T5FL 3WTSA 4YDLC 2XKNA 4K8RD 3MRIA 5IVNA 1RZGB 2FBJH 3KPSA 4ZPVA 5IJKA 4RX4A 1BXVA 1O6SB 2B08A 3H56A 3IMWA 3AT8A 1EMTH 1E9QB 3F7VA 2ZP9A 2VZ1A 3FB8B 1MCPH 2JQMA 1Z6JT 1QLEL 3P9WB 3W9EA 2P7TB 1IU1A 4F7TB 5LGHL 1ACXA 3JV6B 3UH8A 1QVOB 2ESVB 5ABDE 1KXHA 1P4BL 4TVSa 4JY4A 4YHOH 5F96L 3BEVA 4KK8D 4P2OB 4G6JL 1G7IA 2DD8L 1LEKA 3BP4A 5B39B 5FYJH 5FYLH 3GMPA 4KFZC 4X6CB 3RVTD 2CM5A 2Q8AL 3FT2B 1NUGA 3B1TA 5CMAB 3NGBB 3DVGA 5DJ8A 5GHWH 4N2HA 3WELA 1NFDE 5FLUA 1EDYA 3IT8D 5C07B 1SEBB 2YHGA 4PY7A 6FABH 3EHBB 1MCSA 1PEWA 3HUJE 3P3TA 4ZPTB 5F3FA 3WNPA 2IH1A 5CEZD 5HYQA 4H8WL 3FB6B 1CD1A 2EUVA 3P0VH 2AXGB 2EKSB 1GW0A 3KEDA 4GRLD 1YMMD