2HLEB

Structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
138
structure length
133
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVQYEYYKVYMVDKDQADRCTIKPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase receptor
molecule keywords Ephrin type-B receptor 4
total genus 23
structure length 133
sequence length 138
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2hleB00
1AS8A 2FT7A 1OE2A 1OCOB 1JZHA 2DWTA 1ID2A 2VM4A 1SDDA 1MG3C 3NJIA 1A4CA 2HX9A 4HCFA 2B3IA 5D4JA 3WG7B 4WTQA 1AZCA 1J5CA 1AZBA 2IWEA 1PZBA 3EHBB 4DP4X 5F7AA 1CYWA 2QPEB 1MDAA 3NP3A 4BDVA 2BZCA 2IDTA 4P5SA 4KO6A 2XLLA 3OMAB 2X88A 2YAQA 3TBCA 4BXVA 1PZAA 4E9SA 3AW5A 1JERA 4BWWA 5I6OA 3NSFA 1GS7A 5B1JA 1X9UA 4YL4A 3SQRA 2FNWA 2XVBA 5D4IA 2HRHA 1E5YA 2EIJB 2XUWA 1JVOA 5I6PA 1J9SA 3V9EA 4DP6X 1SHXA 1A65A 1A3ZA 1J9QA 1NZRA 1ZDQA 3CVBA 3JT2A 2HXAA 1SHWA 1SDDB 3AY2A 2VW6A 2GSMB 1ET5A 3OQRA 2YQBA 4DP0X 1NINA 5B7MA 4ZK8A 3N55A 2BW5A 3AG1B 3ZBMA 3S3DB 4F7KA 1W6LA 2IDUA 4W9ZA 2R7EA 1JOIA 2YAPA 4A67A 4BDVB 2WO2B 3BVDB 4ENZA 3NJMA 3NT0A 3MX0B 1TEFA 3IN0A 4GP5B 1JXFA 1AAJA 2DYRB 3OD3A 5B1AB 1M57B 1AR1B 2H47C 3GDCA 5AZUA 1BXVA 4A2GA 7PCYA 1KCBA 1AG0A 1FWXA 2A3TA 3QJUB 3ZX1A 3TU6A 2NRDA 3CZUB 2JKWA 1J9RA 5AFAA 4YSSA 3RYMA 3S3BB 1GW0A 1KBWA 4KOCA 2XV2A 3NJLA 2FWLB 2XV3A 4L0PB 2PPDA 1NICA 3FT0A 1WA1X 2Y1AA 4MFHA 2YXVA 3DTUB 1CYXA 3DIVA 3IEAA 1JVLA 5I5JA 4A2HA 1V54B 3UABA 2QDVA 4TXVB 1QNIA 2FT8A 4AKPA 2QT6A 3WIAA 5I28A 2HRGA 4DP2X 5IY5B 1NIAA 1SF3A 4KNUA 1PLBA 1NTDA 1A4AA 1J5DA 2AVFA 5ANHA 3NJFA 1M9WA 1NWPA 2WSDA 3X1NA 4BXSV 4DPAX 4YSEA 3CG8A 2FJSA 2ZONA 5TK4A 2PP8A 3U25A 3G5WA 2DV6A 4CSZA 3FQYA 1V10A 1KDJA 4GXFA 1T5KA 2ZXWB 1CUOA 5I5IA 2QDWA 2PPEA 1BQKA 3FYEB 1HFUA 3AZUA 1L9PA 2W8CA 5EHFA 1OOWA 3IBOA 3OMIB 2AANA 2IDSA 1BQRA 4G7QB 2MRYA 1ZV2A 2GC4C 4KOBA 1ADWA 3IE9A 3NP4A 1WAEA 4E9YA 1EHKB 1IKOP 4G7SB 3ABGA 1TU2A 1AACA 1J9TA 4DP5X 1AOZA 3X1FA 4JHVA 2MTAA 2PCFA 1BQ5A 1EZLA 4HHWA 1BXAA 3V9CA 2GI0A 2J5WA 1M56B 4KNTA 4M4RB 2GC7C 2EILB 2CALA 3QJTB 1ASPA 3QJQB 4YSOA 3X1EA 3PCYA 5B1JC 3MBWB 2XU9A 1OV8A 1NPJA 3ASNB 2P80D 1PNDA 4E9VA 1JZFA 1ZDSA 4NERA 4EF3A 4P5RA 4DPCX 3OM3B 2RACA 3SBRA 4E9TA 3CDZB 3EH3B 4A66A 4WKXA 1DZ0A 1YLBB 1PMYA 1R1CA 3FYIB 3FU9A 1SNRA 4HCIA 1PY0A 4X4KA 5PCYA 4AKOA 1HAUA 1QLEB 3BQVA 1ILSA 1ET8A 2VSMB 1AS7A 4KO7A 2UXGA 2WO3B 2BP8A 4KO5A 2BWDA 4N8UA 2HX7A 3WI9A 5B7FA 4AKQA 1BAWA 3FSVA 2HX8A 4YSQA 4YVNA 2H5UA 1AZNA 3T9WA 3N2JA 2ZOOA 3PPSA 4K9JA 3UADA 3X1GA 2HZHA 3FQ1A 4F2EA 1BYPA 4Q89A 2VMJA 1WS7A 2BHFA 1SFHA 4HIPA 1SFDA 1V55B 5LDUA 3PAZA 3TASA 1OCCB 1NDTA 4FA7B 1OCRB 1NIDA 3UAEA 3ZIYA 2GBAA 1F56A 4Q8BA 5I6MA 1L9TA 1ILUA 4KO9A 5B1KA 1GS8A 1KV7A 1IBZA 2GB2A 3IN2A 3X2QB 3NSDA 1BYOA 2EINB 4YVUA 1N70A 1L9RA 2CAKA 4YSPA 1AZUA 1N68A 1KBVA 1L9SA 2DYSB 1AS6A 1E65A 2P80A 2XX1A 5I26A 2BO0A 3EH4B 3TA4D 4GP4B 1BEXA 1SJMA 5I6LA 3QJRB 2TSAA 2OCCB 4AI7A 3ERXA 4A68A 2AZUA 2FQEA 5TK2A 3S8GB 7PAZA 1RCYA 1TEGA 3C75A 2FQFA 1AQ8A 1ETJA 4M3HA 2VW4A 4PCYA 5B1BB 2PP9A 3T6WA 3T6VA 1DYZA 4BWUA 3S8FB 1ASOA 1L9OA 2PP7A 2Q9OA 4NAJA 1AIZA 2FTAA 4G72B 1CC3A 4HALA 3OMNB 1IBYA 5F7BA 3FSAA 1PF3A 1NIBA 2UXTA 3H56A 3NJNA 4HZ1A 3QJVB 2UX6A 4BK5C 1I53A 2YAHA 3FPYA 4CSPA 3FPXA 1JZJA 2VN3A 2YAMA 5A7EA 2GHZA 4GY4A 1AZRA 1KYAA 1PLAA 2VM3A 4E9QA 1GS6X 1AG6A 3WKPA 1FA4A 2ZWNA 6PAZA 3WKQA 4QLWA 1JZEA 1XB3A 2LLNA 1JZGA 5E9NA 2XYBA 4HAKA 1JXGA 3TBBA 2QPDB 1E30A 3CVCA 1PNCA 1HAWA 2IH8A 4UAHA 3UACA 3JTBA 1VLXA 4AX3A 2AFNA 1E67A 4DP1X 1A4BA 2FT6A 1XB6A 3NSCA 3QQXA 2N0MA 2IDFA 2OV0A 3D12B 2J56A 4AZUA 2H3XC 3SBPA 4A2EA 4GP8B 2IH9A 1XMEB 3GXUB 1KGYE 3QPKA 1BXUA 3KW7A 4E9RA 1PZCA 4E9XA 1RZQA 3EH5B 2EIMB 1NWOA 3HB3B 3FQ2A 1XB8A 2YAEA 3AG4B 1B3IA 4DP9X 1RZPA 2JXMA 1RKRA 2PPFA 4G71B 2J57A 1GY2A 2DWSA 3S3CB 1A8ZA 1FFTB 4YSCA 3X1BA 1SF5A 1ET7A 2J55A 3FU7B 5I6KA 2UXVA 1PLCA 1WS8A 1ASQA 2BP0B 3AG3B 4A2FA 3ZDWA 3NJHA 4G7RB 4UF7C 2YAFA 1WA0X 1JZIA 2BP8B 4UANA 3NJJA 1NIEA 1E5ZA 2CJ3A 2FQDA 3ABKB 2PLTA 5FC9A 3CVDA 5AKRA 2BP0A 1W6WA 1ZIBA 2XX0A 2W88A 1ZIAA 4DP7X 1GR7A 3KW8A 5D4HA 4YSTA 1X9RA 3CDZA 3DKHA 1MZYA 1L9QA 1PCSA 1IC0A 2IAAC 3HEIB 4QKTA 3PLYA 3NJKA 1KCWA 4N4YB 2Q5BA 4JKNA 4F2FA 5B7EA 4YSUA 1QHQA 1MG2C 4GYBA 1KDIA 1TKWA 2CBPA 2FQGA 3FSWA 2GIMA 2OJ1A 2I7SA 1W8EA 3NJGA 2DY2A 3FU7A 3UGEA 4DPBX 5B3SB 4YSRA 3H4HA 1PAZA 2BWIA 3FU8A 2JFCA 2YAOA 2UX7A 2XV0A 2E86A 2YXWA 8PAZA 1NPNA 1WA2X 1GSKA 3PXLA 3PAVA 1GY1A 4W1TA 4BWTA 4PAZA 3PAUA 2VW7A 2PPCA 1NIFA 3UAAA 3SBQA 3NYKA 4HHGA 1OCZB 1UATA 1IUZA 6PCYA 1AANA 2UXFA 2AZAA 2VSKB 4NB7A 4YSAA 1CURA 3EF4A 3FS9A 5I6NA 3NSYA 1OE1A 2PPAA 2Y69B 4RH4A 4DP8X 3WNJA 1GYCA 1OF0A 2PCYA 3T71A 2B08A 2X87A 2I85A 3T6ZA 2BZ7A 3L45A 2BW4A 2EIKB 4YSDA 4KNSA 4HCGA 4A2DA 1MZZA 4E9WA 3AG2B 2CUAA 3QJSB 3H4FA 1JXDA 1URIA 1OE3A 2IWFA 2IWKA 9PCYA 4FAAB 3ASOB 2I7OA 2XXFA 3WNIA 3GYRA 2IDQA 2HLEB 3FSZA 3T6XA 3ABLB 4G70B 5PAZA 3ABMB 2TSBA 5I5MA 2R7EB 1ZPUA 2YARA 2XXGA 2XWZA 4JHUA 2CCWA
chains in the Genus database with same CATH superfamily
2CBMA 2H8PB 4X9FA 4HWNA 5F6HI 4UTCA 1A3RL 1F3RB 1JZDC 4ZSOE 5HDRA 1A4KA 3COOA 1A7RL 4OKVA 4MMXA 1SDDA 4MCNA 4AVHA 5IOPA 3K6SB 1G1YA 5FDWA 3ETSA 3TWCL 5D71L 1N7MH 1LNUA 3EJUA 3LN9A 3P11H 2FL5B 2W92A 4DGYL 1KB3A 1S7XB 3G9AB 1SXCA 3K5RA 2Z31C 5SWZD 4YZFE 3ULVH 1DEDA 2XG4B 1FH5L 3FRUB 5F9OL 1E6JL 3DYMA 4XNZC 3IFOA 2OMTA 4NP9A 4B3EA 1CFVL 3DVGA 5D1XC 1MCFA 1I1AA 4LBEB 2CO2A 4P59L 1FSKB 3WHE1 3TPUA 1WZLA 1Y6NR 1J0HA 1NMBL 3DOSA 3FKUS 4I3GA 3FQWA 4KDVA 3VWKC 4LHUD 2BVOA 4FMKA 2BCMA 3P0GB 2QKIB 2OW7A 5ELIA 3RVUD 5EOQL 2EVHA 3MRGA 1CGVA 5GS0L 4DTGL 3TESA 1BECA 4Y4HC 5J11C 3OKOB 4PWJA 3Q01A 5ETUB 3EIFA 1SHXA 2OMZA 2VABA 3DNKA 3Q6GH 4RA0C 5T3XL 5BUAA 3V7AE 1EANA 2QV4A 5FDWB 2XFXA 2X4UB 2UVFA 4GW5B 2ZP8A 5E95B 2NX5A 2MCG1 3TNMB 3BLBA 2ZZUT 4QNPE 3D06A 3VFSA 5F88A 1QP1A 1NBZB 4X9IA 3N55A 4M5SA 4I89A 4XN5A 3UZEA 1Z5YD 1M05A 1W6LA 5E8DH 4ENZA 1MRDL 5DZLA 3RURA 1G94A 4DEPC 5D7JB 4RIRA 5DJXA 1LO3L 5C0BD 3IN0A 3MJ7B 3TV3H 5HGHA 3K72A 1T6VN 4K73A 1J05B 1DR9A 3UTSE 2R2BA 1FUNA 3UTOA 1WITA 4WSKA 5KW9L 3LPOA 1NAML 1OANA 4KVNH 3L5WB 4BE5A 3QYMA 3X3FL 1QYGH 4YHKH 5GS3A 2A9MH 2DLHA 1QSEB 1N10A 4X4ME 3RP1A 2AVGA 5EPMB 2EEFA 1KBWA 3ILQC 5HJGA 4Q0XH 4X5XB 3ZHFA 1VF5C 4RISH 4WI6A 3ZTJG 1J8KA 1WBYB 3E6HA 5CEXB 4X98B 4MFHA 3VU1A 3HPJA 1CYXA 3GZPA 4KKCC 1P5UB 2XWXA 4PI2A 4PLJC 1W91A 4HUVA 1YEIL 5K59F 4XNYL 4HBQA 1X4YA 2OMUA 3FUHA 4YIQB 1E5BA 1T5WA 4NC1C 4BRJA 5C0AE 1F18A 3BMWA 2VZ3A 1W80A 5CUSH 2QT6A 1JWUB 1GVIA 3HG3A 3M46A 1XAKA 2JJTC 3MACL 1F4XH 4MWFA 1JK9B 5J12B 3MV7D 4WFGE 3B56A 1PEWA 1F90L 3ARUA 3UXFA 3WKYA 1HILB 1QBLH 3V4UH 1UOVA 3VRLF 1V10A 2G60L 2DD8L 1IE5A 3WSQH 1XZWA 4AITA 4S1DD 4DKFL 3CZFA 2A4ZA 2QDWA 3IDMB 4X7TA 3L3GA 4GRWB 3NK3A 5TDPB 1Z5LB 3RBGA 4I77H 4Y16B 3TH4T 5CIPB 5BOPA 1OB1B 4G9FE 3BAEH 4M48H 5JHDD 5H8DA 2FATL 1XXFC 2YPKA 2IDSA 2VDOH 3PNWA 3M7OA 1OP3K 3TT1H 3IE9A 3ZK0A 5EU3B 2ESVA 2NUTB 2P43B 1TU2A 2IH3B 1Y1UA 1T5WB 1HYSC 1OZUA 4ELMB 4UUJB 4WCYH 5T1LD 2A74C 5HI4D 1T7VA 3FH8A 3U7AA 1U0QA 3EYQD 4LP8A 4I87A 4OGYH 3S7GA 1YCSA 2CALA 4AT6A 2KDYA 5SWQB 2Y22A 3X1EA 2R0WL 5B1JC 3SE9L 1NGXA 2Y7NA 4L9LA 2BNQD 5MEOA 3WTYA 1XF1A 1Z2KA 2ODIA 2FH8A 4OZ4A 1M1XB 3IETA 2RH0A 3QZPA 2BINA 4JFSA 5F9WC 3KR3L 4MZRA 1E4JA 3CDZB 5CD3A 1HC1A 4MMYB 1JPSH 1PY0A 3JWDC 3NZUA 1CTMA 4WW2C 5KANG 4XH2A 1O7DE 3IGAB 1DDTA 3V0HA 1JJUA 4QTIH 1LO2L 3E8UL 1AS7A 2VLKA 3FBKA 4BA8A 4ENED 4PJIB 5DEFA 3MROA 4D0CA 2HG5A 3FSVA 1PZ5A 5D1QC 4XXDB 5C0CA 1QSFD 4Q56A 2VAAB 4LCCA 4GPVA 4W6XB 3ULUC 1QATA 3TO4B 1XBDA 1C08B 1U8LB 5KJ7E 5F9JB 2YPLE 1WS7A 1BQHG 5GPRA 3U4KA 4MXQC 5LDUA 3EOBB 2EYSB 3PAZA 3Q5TA 4UQ3A 4ODSL 4TUJB 4FA7B 3UAEA 1RMFL 4PJ5E 2B8OT 4N5UA 2E56A 3DPDA 2QSTA 4FL4C 5JYLA 5LGHL 1DSWA 1L9TA 1SBSH 4X4XA 1NSNL 5B1KA 3ILQD 2WBJB 1WF5A 4XN8A 5FM8A 5HJBA 3QFJE 1UWGH 1KV7A 2XA8L 1IBZA 1T20A 1MCWW 5TDOA 1XTLA 3SZKC 4EKXA 4FFTA 5ENWA 3TV8A 2J2ZB 2XN0A 3EJQA 5D7LE 4HUUA 4WU7B 3F01A 1DSFL 4KK8C 4U7MA 4PV8B 5KSAC 3QXDB 1KB5L 1ZWIB 3QJRB 4E68A 1IL1B 1F97A 1F4HA 1F2XK 4E5XB 2E74C 1TJIL 1BAGA 4CGUB 2D7QA 2EQDA 1MAKA 4KRLB 1CDYA 1TSHA 1NFKA 1XV8A 3QXAA 3ZTEA 2W0FB 1N64H 3MNWA 5A6LA 5GHWL 3SPHA 3U4BH 3QXUA 4D3CL 3STZB 3KPTA 5LBSL 2VW4A 1VFOA 2APSA 1MNNA 1U8NB 2Q9OA 3U30C 1JVKA 2VRAA 4N25A 1OSPH 2WP3O 4KZCA 4NKOA 4QXTB 4TUKH 3GMMB 3RFZC 1MWAH 5JQIB 3D25B 1RZKH 2JKLA 1OALA 3RL1B 4FQ2H 3BLKA 4H20H 4JO4H 3T0ED 4YHNA 5E2UH 3WE1A 2X0WA 3DOHA 4Q9QH 3VXTA 3HAEA 4TSCL 3CIAA 1BIIB 1MH5B 1N5AB 2ED8A 3D08A 3AMLA 3OB8A 4PRHB 4AYID 4GO9A 3I2CL 4HOMA 1S7RA 1OHQA 2BERA 5H94A 3SB3A 1FFOB 2LLNA 1T0MB 1YPZE 3GFUA 4LFHG 1A14L 3VX0A 4JPIA 4PV8A 4WO4C 3BUIA 4F8TA 5I0ZA 2V3EA 3AT8A 3GB7A 4PJEA 3QQNA 2X4SB 5INCB 4C59B 3ILEA 4JQVA 1C16A 4AZUA 3TPUB 3ULVE 4M6MH 5GSVA 3GXUB 3F6IA 3QPKA 1R3KB 2EDTA 3T0WA 3TIEB 4AQ1B 2ZUWA 4P46D 4PJCB 5K9JL 4FJZA 3FUDA 3JTTB 3EH5B 5FKPA 5I17B 2PXYC 4JQIH 3ZKMD 1PKOA 1C1EL 1OGAE 5CCKH 3ZDZB 3Q8AA 4TSBL 2Y2TA 3PGCA 1B2WH 2WQUA 4D94A 5BVPL 2PCXA 3LRKA 1EFQA 3S2CA 1Q0XL 3ZGHA 3HZKB 2J55A 4WLCA 4NZTL 5GS1C 1XF2A 2C3HA 1PLCA 1A2YA 4XCYB 3AMKA 4HSQA 3MCKB 4ZXBD 3D2TA 3V0VA 1JV5A 3SDAA 2IQ9H 1NBZA 4N1CA 3NQKA 4NRYA 5DFVC 4P04A 2BSRB 1MCPH 4M5ZL 1O7SA 1OM3H 3ZDXE 5AKRA 3FMGH 2CR0A 1YEEL 2W38A 4MX7B 1PYWA 4FQLL 4A04A 5D7KE 1RI8A 5F3HA 3TXAA 3RIFF 4L5FE 3Q8EA 5K39A 4FQQB 1CI3M 5C9JB 1A9EA 2JTDA 4YJZL 1CLZL 5E2TL 3D48R 3WN5A 3MMEA 4G7VH 4XWOD 3QIUA 2WBXA 3RVXD 1WVZA 1EMTL 2A6KA 5IFHH 3Q6FA 2FWOA 3CLWA 5FWQA 4PUBH 4WJ5A 4H1LB 1LWHA 3PDOB 1OD9A 1MCNA 3KWWB 3STLB 2F53D 5C0JA 3ULUL 4WZ9A 4UUJA 2J5LC 4Y8AA 4Q97A 3H9SA 4JFVA 1MCCA 4O58L 1ED3A 3QULA 3MLUL 3LRSB 3QJHA 1WO2A 3FZUD 4KKLC 1YY9C 1QI4A 4LCWE 3EHBC 5AAWA 5IBTL 1JHLL 4TNEA 4DVBA 2CM5A 4UWQB 5E2WL 2HKFH 5HI5D 4NNPL 3F58L 3PQYE 2Q7AA 1SM3L 4NENB 1PBYA 4FQIH 4KKBC 2A73B 4KKZA 5EZOL 5FYKE 2VRKA 4GG6F 5LBGA 3G5ZA 3VI4F 1FDLH 5F7NC 3CLFH 1O0VA 5DJ0A 4MAYA 5AZEL 1I9EA 4J7RA 4JHZA 2AZAA 1HIMH 3GSQA 3MRHB 1KEML 2KERA 5DC0A 1U42A 3O0RL 4DKDC 4XNXH 3H53A 3FOLB 4IIZA 3L1EA 4Y9FA 3O8XD 1E4KC 3QUYB 4FFVD 4ELKB 5I18H 2QR0A 1JK9A 5BOJA 1ECZA 3CLEH 1J1OH 1OAJA 3SDDD 3VQ1C 3H0TB 1OPGH 5E8NA 4FFVC 1MELA 4OAWB 3FT3A 3QDHA 4NO0B 3WJLC 3EXLA 4E9WA 2P1YA 3ECBB 4G6FD 4R8WH 3OAYH 2J6EH 5F93C 3WXVH 5DJ8A 3T77B 4TSBH 1JL8A 1MFBH 3NFPB 4J3SA 1QSFA 4G43A 1XMWA 1R0AL 4DGYH 2ADIB 3SO3C 3DARA 1PFCA 5C0NC 3KEDA 1BVOA 2OCJA 2WXFA 1YNLH 3OMZA 4OTXL 1PIFA 4AEIH 1ORSA 2I27N 5ACMA 1CVSC 4QAWA 5TDOB 1LEGB 2BVTA 5CIPH 4RFEB 4ABWA 3B2XA 4YBLC 5LG1A 2CPCA 4NM8L 3B5TA 2ZKXA 1AHMA 5AEAA 2J25A 4X5WB 3KYOB 4G3YL 5FUZL 4XMTA 3NJIA 5HYSG 1CFSB 5C2BH 1QO3B 2X4RB 4DW2H 1AYRA 4U2ZA 4LSVL 1YSOA 2DWYA 4GBXA 3AQZA 1PZBA 1SJHA 3M88A 3IPBA 2UV3A 2BY2A 3WD5H 5F1NA 4K8RD 3T65B 1T21A 3CZEA 3I6LE 2BH0A 2MCPL 4FHJA 4UINH 3CZKA 3TGXA 2ARJQ 1UZ8A 3MJWA 2EVIA 1XR9B 4Y1AA 3FFDB 5ALCH 2WSPA 1X5IA 2VDQH 3LV3B 2YGVA 3D2UB 3VRIB 3PWLA 5FGSA 1JE6A 2X09A 1B88A 4IOIB 2V5TA 3E9TA 3NSFA 4K9EL 1QPXA 4NN6C 2X1WL 4MMYA 5F2FA 1B3JA 4IU3B 3UP6A 2AEPH 3SQRA 2JJUA 3H9YA 1ZTXL 3CFUA 3O45A 1MW0A 4ZMQA 3KAAA 3MXVL 1Q9WB 3PUCA 1IEBB 4LEXH 3W5NA 1ZA6B 1KJ2B 2BLFA 3NIFE 1JPTL 1M2OA 2YSSB 3MNVB 1T1ZA 1GGYA 1IC5L 1NZRA 1U8KA 1QO3A 4MAUH 3QDGE 4HMEA 4OCLC 5CZVL 3WS3B 5I75B 4Z6AT 2P52A 1XGPA 3P30L 3EYSH 3T0BA 3RZCD 3UIYA 4HD5A 4LDLB 4QRSB 4OM1L 4P23D 2K70A 2NY4B 3BVDB 4JN2A 5I8KH 1M3JA 2B39A 3MX0B 4Y4FC 4OJDH 4N1HB 2FSEA 4X6DE 3B9KD 2NUTA 2E4TA 1GHFH 3B2UD 4FQ1L 4PP1C 5CU9A 5FLUA 5L8KB 3JTSA 4PMEA 2WPGA 5AZUA 5C08E 4YHMH 3ARSA 2P42B 1NCWH 3VH8A 2JSFA 1KCBA 1M7UA 4GH7B 4XVJL 3AVEA 4MYPA 4BFIB 2PXYB 5E1GA 3MUZ1 3ZW3A 5IQ7H 3KLQA 5DMKA 1ONQA 4UV4L 2X2UA 3I3EA 3L5HA 5DC2A 3PAYA 1JYWA 3NJLA 3KLLA 2XV3A 2HT3D 4TVPE 4Z5RB 1IVTA 1NICA 3VXME 3RUGE 3KM1A 1FZKA 2QSCL 3HOGA 4JRXA 2ITDA 1H3XA 4NPJA 2VISB 4OLUL 1DQDL 2HRGA 2MH4A 3BIAX 2G9HA 3ILPA 1X5KA 4XOEA 3VXQA 4CVZB 3H8NA 3NCJH 3KBHE 1M9WA 4FTVD 1AJ7H 1U30A 1ZHKB 1DSYA 2B9AA 3HPJB 4DEUA 4S0TD 4M62H 1QBML 4HC1L 2QQNH 3UROR 1DEEB 5HVWA 2WLMA 5D6DC 1RZKC 3TZVD 4GFTB 4U6TA 3CN1A 1JFQH 3D0LB 1BQKA 5E2VH 5AW1B 4OGYL 5FV2A 2VMFA 2BC4B 4AIXA 1K9TA 1P4UA 2R0WH 5TF0A 4U3XA 4U3HA 5JDSB 1EPFA 3G08A 4YDKH 4TQHA 3VXRE 4X0NA 3CFQA 3L54A 2FWOB 3TVMA 3DGCR 2WNGA 1J05A 2EDYA 1LWRA 1LHZA 3MXVH 1K85A 1J9TA 4LEXL 1JWMA 2JKTM 1CIUA 2P45B 1NGZB 2PCFA 2X6CA 4NKMB 3U36B 2R69H 4I3SL 1I85A 2QHRL 4YLQT 5F7FA 5IUSA 3B5GA 4NZ8A 4XPGH 5D7IE 2QKSA 3TNMA 2VXSL 3TBTA 4BSWB 5A3ID 1IBGH 1AQDA 4B60A 4CMHB 2P80D 2KZWA 4K5NA 4XWGH 3CX5K 1XR9A 1G9EA 3S35X 1U4FA 3A6CH 1A2YB 3L5XH 2ZUYA 5CJBA 5GRZA 1ZLDA 4MXWL 4AIEA 2X40A 1OO2A 1O5PA 2K9UA 2N56A 2AJZB 1SBBA 4BCYA 3ZUCA 2EABA 1FIGH 2DM4A 2NPLX 1MREL 5DJAA 1FI8C 3Q2VA 1PPIA 3WTWA 1QW9A 4F7PA 3G08B 2BNRA 5GS2H 1DE4A 4WWKB 2EE0A 2WWMC 5IZ7A 1ZSDB 5IW6A 3BQUB 4J28A 2D2CC 4GUCA 5GZOD 1YN7A 5FO2A 3VI4A 1Q9LA 4GRMA 4GG6A 2C9RA 3MNMA 3FQ1A 2H9GB 5GZOC 4N2BA 2VOTA 1U8MA 2O6EA 4PIBA 4V1DD 1J48A 1HHHA 1RJYA 1T0MA 5KW9H 5LGJA 1LEIA 2XA3A 1YEIH 3BP4B 4YNYB 2K0RA 1IAOB 2YA0A 3C5ZA 2Z93B 1AQDB 2X28A 3RKDD 4V2BA 5C6PB 2CGYA 3Q48A 1PKQE 4FJYA 35C8H 3PWLB 2OMYA 3REWA 2OL3B 1XEDA 2ZOKA 3QBTB 1QBMH 1N6QL 3TO4C 4OZIE 2EVGA 1OSPL 4LVOB 3QQDA 4EN2A 3V6ZB 2AF2A 5CLYA 4J3UA 4OZGB 5C0IB 3SDDC 1KCVH 4FC3E 5INDB 4ALAH 4PGZA 4UDTA 1BMWA 1G7PA 3EGXA 3GKZA 4DGWC 4CKVX 3MRCA 1U3HA 1FZJB 3LTVA 5JOFA 4A68A 4QTHA 2LE9A 1A6VH 2AAAA 3BSZL 4KQ4L 5AB1A 3S8GB 3HMXH 4D0DA 1N59B 3I9GH 4JFTA 4J8RB 5E6RB 4UQCA 3UG5A 2SODB 2O5ZL 3VFMA 1VACB 4Y4KD 3KL5A 2D7OA 1WTGT 5IK3A 5JOEA 1BPVA 1EJOL 1QOKA 2E7LA 1AIZA 1T3FA 1PSKH 1TJGH 3O6FD 5EORL 3KLHC 3IFLL 2L7JA 5BNXD 4N3TA 3NCWA 1NCIA 4YUEL 1XGPB 2KH2B 1FZMB 1SUJA 4NSKB 4BK5C 1R33A 2BOBB 4ZFOA 3OGOE 2VN3A 2Q3ZA 4UILL 3RDTB 3WDIA 1KXTA 3ARWA 1LO2H 3ECBA 2A99A 3LQZB 2VM3A 4EDXA 4J27A 5JOFB 1C12B 5E8NB 3RWHB 3QRGH 1K5NB 4CU7A 6PAZA 3C12A 2E7HA 4TUJA 3ROOB 4OCSH 4BSJA 4M8UA 3MA7B 4HAKA 4TTDC 4WGWB 1RSFA 1JPFA 5HHNA 5DXWA 1E8YA 2DQIL 3CVCA 4I2XB 4UAHA 1ZANL 4AX3A 2AFNA 2HN7A 4ABUA 1ITBB 3C08L 4JRYD 3D12B 3O41A 4AQEB 5KSUB 1P1ZA 4KX7A 5DSCA 4ZSOB 3TNNA 1BXUA 4E41D 3LQAC 2G5UA 2CR3A 2FECL 5DD5L 4CNIA 4QOKE 5HYSA 3QG7L 3F83A 5LNDA 2PW2B 3CDGB 4NQXB 5FA3A 1V3MA 5T3XE 3DA0A 5I74C 5C0EB 2YRBA 1YEGL 4X8GA 2VE6A 1FFTB 4XMXA 1R46A 3RHWK 3UIZA 1GC1C 1ET7A 2P8PB 4XOAA 3X1BA 4DOHB 2BZDA 5E1IA 2P3YA 5ACLA 1IGMH 1BQHB 2DM3A 1CWVA 1Q1JH 4JW3A 4LPTA 1WAAA 4PJDB 4KXDA 1RIHL 3HW7A 3LMJL 3RNKB 2JQAA 1WA0X 1JZIA 4H8WC 4XVOA 2VLME 4LEBA 5H4YA 5CD5D 2MNWA 4GSDL 5TE7L 2W88A 4PG9B 5HI3D 1OGTA 1VHPA 3KW8A 3NIDE 3PG2A 2FLBT 4H2CA 4WSGA 3CQQA 5GXBB 5L2KE 3MLZH 2EIDA 4DO4A 4WU5B 1KJ2A 5HHOE 2XG4A 1J1XL 2G75B 3O3UN 2IH1B 2FL5A 3NH7H 3ISRA 4M56A 4R7LA 1IGCL 1HHIA 4YLCA 1UASA 5IESH 2DIAA 1BBJB 3NJVA 3NJKA 3TNNB 5K5YA 4NO2A 4OF7A 4N1EA 1K6QH 1H3VA 1A7OL 1I3GH 3BZ4A 3PJNA 3RIAF 1C5DA 4YSUA 5J6HB 2APXA 2D9QB 2Z91B 1RK1A 4C4UA 4GYBA 2BHZA 1KDIA 2YFOA 1EBPA 2XWTA 1XH3B 2K1MA 1HIML 4FCHA 4LHUA 1KEMH 3S3SA 3P4NB 2TAAA 1DLFL 3GJFB 4B6ZA 1YO4A 1UM5H 1OP4A 3C60B 3GRWA 3TZVA 4DPBX 4LGRB 5FUOH 3VQMA 4HOWA 3QUZB 2UX7A 2YK1L 5TQ2H 2E8YA 1S78C 4JRYE 4PJXE 1QRNE 1TQVA 4Z0XA 1ZY9A 3VI3F 2IJ0C 5IR1B 3RDTA 5EEWA 4XMUA 1QLFB 2WOYA 3EYQC 5KS9A 2COVD 3N1MC 4OM0L 2G2NA 3BPOC 2R1YB 3LN5A 3SGDI 2UY6B 4B3VA 3O6FB 1UEYA 2H0FA 1OVZA 3LKSB 3PDGA 3GZKA 4HHGA 4G8IB 4OLVH 3QDJE 1IUZA 1NM9A 1I9RH 2OL3L 5JPMA 1ED3B 3QULB 5HDWA 1YNLL 43C9B 5J0BA 3CVHH 4NQEE 4HUWB 5I6NA 5IEKB 5CSZA 5CR1A 3C08H 5DF0A 5GGTH 2CK2A 4Y9BA 2DJSA 2Y4SA 2GJPA 1DLHA 4ZW8A 4KJPD 4AVJA 4QRAA 4HX1A 2XPGB 1N6VA 2N3JA 4GSQA 1CF1A 3BQUC 3HTLX 3HN3A 2ICES 3B9DA 4PRPA 3HZYA 4KK9D 1KYFA 3MV9E 2PYEA 4NHUA 3Q1SL 3B8SA 5F1SA 3WJJA 4CSTA 1MCSA 2CUMA 5DQ9B 3BD5A 4HF5L 3WNIA 4FXKB 4KTEL 1NOAA 4TN9A 3ESMA 4HK3N 3MRQB 4L1LA 1XXDC 3RDJA 4LQ1A 3B1UA 4G6FB 4OT1H 3RWEB 1IIIA 2Q76B 2FT7A 1RERA 2P4AB 4I0PA 1IAOA 2BXZA 3MRMB 1RJZB 1Y7VA 4JX0A 1EA9C 2EVFA 2VJXA 1N19A 3E38A 4PW9A 4CN1A 4S0HA 2VXTL 5CXPA 1WTLA 2AEPL 1IX2A 2RIKA 4URKA 4YPGB 1UURA 1QFHA 5A2AA 4LARL 4WK0B 2DYPB 3BH9A 4HIJB 4MLSA 2Z35B 4H40A 3PV7A 3WN6A 4UT9L 4KKAC 3FTVA 3CDCA 1IQWH 3PV6B 2P5WA 3H9SB 3BSHA 4XPBH 4IOSD 1TJHL 2BVOB 4YBLB 2AQPA 1OP3H 2I07A 4JMNA 1BFVH 3U6RA 4XVSH 3KGUA 2M2DA 3DV4B 1HNFA 1PFOA 4HS3B 4JCMA 2JCWA 1R3JA 4F15C 2K6WA 4CMHC 5HJ3B 3FCTB 4FFZL 2X4SA 5INCA 1FLRL 2K8MA 2MPVA 5DO8A 3S48A 4OCRH 4NQCD 3Q8CA 4Z7VB 2BK8A 5GS0D 3NZ8A 4YL4A 4ZYKA 4OCXL 3P2BA 5TD4A 3D85B 2HJKB 3VFPB 1WEJH 3B9AA 2HRHA 4X9BA 4ELMA 3UYRH 3WAJA 5F7LB 3BZFB 3JVGC 5TQ2L 4ELMF 4LK4A 3RTQA 2ZCKL 1AGDB 2H26B 1P4BL 4FLOA 4BFOA 4Q74A 1AMXA 4QGYA 5GRYA 2NY7H 1T5XB 1ZHBA 2CQVA 1QBBA 4H0IA 4IRZA 4AQZA 2WBKA 3GS0A 2VDOB 3TCLA 3FAXA 1KY7A 1VRSA 3LV3A 4AIZB 4PRBA 1BHGA 4ZSOA 2W81C 5EN2A 5EU6D 5EN3A 3S3DB 1SOXA 2CG9X 1MFBL 3DOIA 2P8LB 4XXWA 3KPOA 3LKOA 5AAMC 3CN4A 1MJ8L 4FFYH 2DYRB 5CHNB 4NPYA 4F7MA 5K9QI 3NCMA 5GGVL 3D3VA 2I26N 3HR6A 1CFSA 1NH6A 1T4KA 2LHAA 2XYCA 1NLDH 3QXAB 4KK5D 4LSTH 4MNQB 3MRJA 4YK4C 4O5LL 4KMTL 3ZX1A 4LMQE 2GIYA 4X6EA 1JHKH 4YR6A 3VXMA 4DGIH 1SPDA 3BRDA 2VLJE 3CIQA 1ES0A 1QEXA 4KOCA 1G7LA 2XV2A 5JIMA 1HKLH 2ITCB 3B8YA 2W0LA 1FBIH 4R96A 2O6PA 5IVXF 5ADOL 4X5LA 2B3RA 2NY5L 3W9DA 4X98A 3PF2A 4QY8A 3UL4A 4ADGA 2O5XH 2M1KA 4OTXH 1I7UA 5F9AC 4Z3EA 2XBZA 3QG6A 3T3PB 5IQLA 2XQYK 2O5YH 1TLKA 3DURA 3QXVA 4XB7A 2FT8A 5IG7A 3X3GH 4PY8J 3HE6C 5FIEA 4NGHH 2J6EL 4HXBH 2Z0UA 1DUYB 4L23A 3T2OA 3LIZH 3BEWB 4F7EA 3U7WL 2PR4H 1BSIA 1OB1A 2BOLA 2VJ0A 4B41A 3MOQA 1USZA 1VGKB 2F1BA 3IE4A 4QJ3B 4ZMTA 3QO0A 5SWSE 1A6TA 3IDMA 3ZSSA 2ZXDA 4NBYB 5DT1L 5H4ZA 2FK9A 2PXYD 4ZTEA 4Z1PA 3MPCA 3VXRA 4XPGL 1JK8B 2NTFB 3QNXB 4JFHE 5FFGA 1HEZB 2PKDA 3DJ9A 1C5DB 3REWB 5E94B 3TBVB 2OZ4A 3BKMH 1TFHA 3QZWG 4UNVA 1RAMA 2W0FA 1S8DB 1ZV2A 3T0EC 1YEKH 1KIUB 2XFXB 3PFQA 3UCQA 4M1GH 5HPMB 4OCXH 4MS8C 3ABGA 4XPAL 5I66A 3T04D 3SPJA 2LVEA 3G3LA 1YVLA 4J3OH 4QLRA 4M1CD 5D7IA 3UG3A 4WI9A 4NX0A 3HA0A 3OZKA 1THAA 1WWCA 3O9WA 2X2JA 1CE6A 3ABZA 4ISVA 2V5MA 3QUML 3SQBA 2PYFB 4WQOA 1H5BC 1R3HA 1EEQA 4XVJH 1Q1PA 4I9WE 2BJML 1IC4L 2VIRA 1DJZA 1MQ8A 3U2SB 4XB3A 4QHPA 4JKPH 4IRSA 5DRXA 4NC1E 5DVLA 4EUPB 5JXAH 2ZJSL 2ZG1A 2I32A 4PREA 3L1GA 1U6AH 5I66B 1YLBB 5PCYA 5HD8D 1MJUH 3BH4A 1GHFL 3X17A 3QJOA 3WDHA 1H3TA 1NAMB 4YDMA 3NPSC 4PJ5B 5DDHA 2N1TE 4AM0B 2HG5B 2JKSA 5EIIB 4KO5A 5DI8B 4OIFA 3BFOA 2IWGA 5T1DH 5CEZL 1NCAH 2AHIA 3EYSL 5F88B 2HX8A 3TBTB 2EADA 3CFCL 2FX9L 3PHSA 1HKLL 3SY6A 4BSWA 4OM1H 5IIEB 4CC4C 2JH2A 1MPAL 1MJJA 4RQQB 2R2CA 2FEDC 4O2EB 4WFHE 1SXBA 2X6AA 2OMZB 2NY3C 3ULVL 4PLKC 4QGTA 4EOWH 2ZG3A 3DX8A 2J1KA 1XL4A 2AQ3A 4BBWA 1Z3GL 4YDNA 3MFFA 4KHXL 1XF5B 1OCCB 1SJEB 2C3WA 2WBJC 3EYUH 4FZ8H 3ROOA 2F8XC 4KQ4H 3X3GL 4PWFA 3FJTA 3SDYH 1URLA 3I9GL 5E6YA 3PHQB 1LO5B 3ZTNL 2EYTB 3DV6A 3T4AB 3V0IA 4RFNC 4Z7UB 3KCWA 3K74B 4NUMA 1O9ZA 4FMVA 1TJGL 5EORH 5AUMA 3WL9A 1KJMA 3ME0A 5CEXA 2XX1A 2XQBH 3QK0A 5DD3H 3SOBL 4APQC 4L0YA 5EDXA 5GRUL 4QXGH 3CK0H 4YXLH 2FEJA 5ECGA 3ARED 1YEFH 5ESVB 3UTZA 2D3LA 1DO6A 1AHWA 4LDCA 4NN7B 4OCWH 4XB8A 4IBSA 3ERXA 4P23C 3AY4A 4KZDH 1NGYB 4MB5A 2NX5D 5IQOA 1UH2A 3VXTB 4HQQL 4DQAA 5JHMA 1EDHA 1RCYA 3IMSA 5FM5M 4ZMAT 3ZR6A 4X5QA 5E1AB 3FN0H 4KX9A 1HXKA 4Q6IB 4EDWH 4LVNB 3L9RB 4NKOB 4QXTA 4ZTPL 5D7JD 4I1NB 4JKKA 1A5FH 4NOFA 3ZHNA 3I9AA 4MYWB 4XO3A 3FSAA 4HUMB 1PF3A 4D2NA 1UZ6F 2UY7A 5FB8A 5INDA 1NGPH 2Y7LA 4Z7VF 3RWIB 2R4SH 1HL8A 3CU1A 3BUYB 5DC4B 5H2BA 3O8XA 2R69L 5D1QE 3PWUA 4MQSB 2A9ML 3T6QC 1ZHBB 2F08A 1QRNB 4F8PA 3ZT5A 1FA4A 2XN2A 3IDXL 3WKQA 4XBPB 4LGSB 5F6HJ 4YO0B 4NJ9H 1ZLVH 4LF3B 1JF1A 3JV4A 4OZFB 3B3IB 3L4CA 3OAZH 4HUXB 5JO5B 3UACA 1P6AB 3HE7A 1XD0A 3RL2A 4ODHH 5JW3L 1EAPA 4PI0A 2E4FA 1NFDA 2IDFA 3JV5A 4W4NA 3T08A 2E47A 5T1DL 3BP5B 3UDWC 3QEGL 4JPWH 5DS2A 5GRXG 3DECA 3NTCH 4XNBA 1FO0B 5EU5B 4I3RH 1CU4H 1RVFL 2DTML 4DZBA 3CFCH 3R4RA 2QL1A 2XNAA 1JXKA 1UQSB 4EI5B 2WAQA 2WUCL 3QIWA 3FRUA 5IR1A 3FZUC 1KXVC 1VESA 3IF1A 1K3ZA 1RZPA 1H6EA 1T7XA 2JE8A 1N7ML 3K72B 3WLBB 5AVSB 1WE5A 5AYUH 3DETD 4YPGA 4KUZL 1R24A 3BC9A 3DHJA 1GRWA 2XWDA 4KKBD 3IRZA 5D70L 3ZDWA 2G4GA 5TTRA 4BZ1H 3NJHA 3QFJB 1G9NC 2X10A 1OK8A 5BS0D 3EDEA 4H0HB 2L7UA 2IAMC 3P9MA 4XMWA 4PHZA 4JCWA 2PLTA 3DETC 5BV7C 1MXGA 3IGAA 1I1RA 2YO3A 1NMBH 4WGVB 1MKFA 2VKXA 3OHXA 4OIIL 1R3IL 3BUPA 3CH1B 4AV0A 3CDZA 1XGTA 4PS8A 1FORH 3L3KB 3KJ6H 1MIMH 1FL3A 1WT5A 4N2KA 5GGSA 3RB7A 3I9IA 2ZUXA 2FUTA 4KKAD 4P3DB 2LFGA 1OGTB 3TIEA 1IFHH 3JWNC 5EU5A 4Z77B 3TP4A 4PJAA 4UOW0 4Z78A 4C58B 1PDKB 3APNA 1OL0A 3KLSA 4F2FA 1CD1A 3G6JF 4NM4L 2BSTA 4EDWL 1CE6B 1TETH 5GGSY 5T33H 3TBWB 2WYIA 4UAOC 3H9HB 1THCA 3FSWA 1KF9B 2Z6FA 5C8JB 1OZTG 1LXMA 1NGPL 4QJ5B 5LDSA 5CFHA 1WQVT 4NWTH 3AS2A 3BW9B 5D1XA 2BWIA 2WW8A 3MUGA 1IAII 3W0WB 5C70A 2IAMD 1A8JH 3QPQD 2APVA 4Z0BL 4DGVL 2WXMA 3UZQB 3DXAE 2N01B 4CSSA 4WRLA 1U8HB 1UB5A 3HB3D 4J2XA 4ANUA 4TQEH 3LEXB 1ACYL 1ZTXE 2Y24A 1JPEA 4NCC1 5F0PB 1NKRA 3FT3B 4RX4D 1P1ZB 2QSQA 3W0WD 1UA6H 5AOZA 3WTUA 4AOFA 3DPBA 3V0FA 2BS9A 4Y4HA 2DZEA 2KQNA 2ROXA 4OZGA 3FO1B 2B5IC 1L9NA 4ODHL 1AKJA 3U46A 4WI7A 5DA0B 1MIEH 3BKYH 2M26A 3GDBA 3V4PH 2VDLB 3X13A 1SY6L 4UBDC 5EBLB 1NMAH 1T0PB 1R5WB 4R4NC 3B9VA 4HJJL 3MNZA 1AQHA 1G6RB 3MOBL 3BFWA 1J86A 3S96A 5CZRA 2BWQA 2J12B 3U6XS 2LU3A 4DIXA 4K7PH 5FA4B 2HRLA 3QZNA 2G75A 2YGNA 1F00I 5D2LB 4PWHA 3CFMA 1UD2A 3QG7H 2IF7A 4W9JC 2UWEB 4NZRL 1I31A 4IKKA 4IOFC 4R2GC 3BW9A 4YFEA 1EXHA 3FNKA 3OHMB 4P4KC 3VA6A 5IB2B 4Y16C 2ZYRA 3I6GB 3IJEB 4HBCH 4ZS6C 5PAZA 5C0DB 4KK6D 5K59E 4QRSA 3G6DH 2O6DA 1MRCL 4R4BB 4S1QH 3MUY1 4DKFH 2EYTA 3SYQA 3WNNA 3CUPA 2B59A 4ODTL 2DEYX 1N12A 1N64L 1X7QB 1OCOB 2OTWA 3L3OC 4ZOAA 5ITFB 5D7LA 4I18A 2ADGA 5LKNA 3PWJB 5D6CA 3PQYA 4D3CH 2ZICA 3MR9A 2DQJL 4Q0XL 3FUEA 4GMSH 3BWZA 2EYSA 3ZRFC 3SGEI 1TQWA 2P5WE 4FA8A 2XACC 2AK4B 1TCMA 1U8LA 4RFOL 3F12B 4MCZA 5MERA 4KTGA 2YJQA 1NEZA 3QDAA 2X3CA 4HFWA 4ZO8A 4DP4X 1MLBA 4OW6A 5J6GB 4JFFA 1G1KA 4PJ5D 1F5WA 2NQ3A 3H7BB 4NO5B 4JFEB 4LVNC 2N4IA 4JZJA 2UZYB 2NZIA 4WWPA 5IROD 1RUPL 3AW5A 2DB8A 3JYBA 4U3SA 1WFOA 3R4DA 4ZODA 2WXRA 4XAWH 1DBMH 3L9EA 2CHDA 5BMFH 1QSFE 4EUPA 1LMIA 4NXSA 3QWOB 4Z23A 2EIEA 4AXWA 1A1OA 4LSQL 4N3UA 2F68X 4B5ZA 1M1XA 4ZFZA 1JVOA 1JGEB 4N90E 5EG6C 1JNHA 4JDEA 2IV9A 5E6ZA 4UIKH 1KSRA 3FN3A 1YYLH 2GITA 1A3ZA 5B38A 1ZDQA 5I71B 1XCQB 3GI8L 1U36A 4HLZH 3MLPA 1SHWA 2YUZA 2W65A 2A9NH 3FULA 1KN2H 1IAMA 1L9MA 4P57A 4N2OA 1NQBA 1X5FA 2P5PA 3UJIL 1EO8H 5DD1L 2WXGA 3NN8A 5LWYL 2WO2B 1EEYB 4BD4A 1AIFB 2OMWA 4NFCA 4WCYL 4XMPL 3DHMA 3EOTL 5LGKA 1T7WA 3O81A 2P8MA 4OGZA 1AFVL 12E8L 2QHLA 3QIBA 3D69A 4HCRL 4ODSH 4WI0B 5KVFL 4NGHL 4YZFF 3HR5A 4ZMPA 5J1SC 3IFNL 4TTDD 4OT1L 1S7RB 1ZKAA 2YGPA 4E2OA 1GC1L 5GISH 5E6IB 5I16A 3O4LB 5TGBA 1JZ8A 2O26U 1D7DA 2VXTH 3RVWC 4YGAB 4PJGB 4C83A 1CDGA 5HI5C 1LWJA 3EZ8A 1U95B 3QA3B 2YEZB 4HBCL 5HVFB 5GGTL 3DIVA 5AW0B 4G7VL 4HF5H 1U58A 1GYVA 2X9YA 4P23B 3OKMA 4U31A 5EF2A 2GQHA 3IKCB 4Z7AA 3C5ZB 4FXGB 2V9UA 2V4LA 5G5DA 5SWSA 3W9EB 3LOWA 1B4LA 1VFAA 2GY7B 3CG8A 3GRBA 4IQHA 4O51B 3L6FA 5FHAL 3W9DB 2PP8A 4HOXA 1G4MA 3KPSD 3E6HB 1RFDL 2PO6A 4TLTA 2MQGA 1T5KA 1J9CT 2D03H 2FBRA 5IF0A 5E51A 5J3HC 4MD0A 4ZMYA 3EH2A 4RX4A 3AZUA 1GZQB 2VDPB 2W8CA 1XGYH 2QGDA 2JKRM 4Y9CA 3VG0H 3ZPDA 4XBMA 5FO9A 4AG4L 2NY7L 4I1RA 4J8RA 4ZW6A 1VSCA 2F54D 5GZNC 5MEND 4TF4A 1L7IL 2OR9H 3E1ZA 2Z3FA 2R29A 1MEXH 4FXGA 2HLFC 4NPYB 4ODVL 2XVKA 3U0TA 3VFNA 1AACA 2LLLA 2XT1B 3NIFB 4K0OA 3A6OA 4LLYB 4AENA 3DUSB 4Z7QB 5C07A 1UD4A 3C5SA 4YS4A 3UYRL 4K7FA 1WCQA 2J5WA 3VFRB 3FDWA 4HJGA 1CLYH 1I9IH 4ERSL 1JTPA 2EC9T 1AOHA 1I9JL 2HTLD 3VGDA 5EEXA 2VAAA 2LGNA 2CLZA 4M6ML 5CEYA 5C0BE 4HGWA 2V2WB 1FIEA 4GMTH 5E5MB 3D39B 4J6RL 1KGCE 3OKOA 2YKLL 4Y2LA 3VWJD 4IRSD 1TJMA 1T21B 2J73A 5C7ZA 1ZT4B 2E9JA 3HFML 2RACA 1BVLB 2GFBB 2OSLB 3DX7A 4GKNB 5LCVL 1OTSD 1ZTMA 1F4AA 3EYUL 3N44B 2ZCKH 4FZ8L 4GSRA 4JO4L 1DZ0A 1WV7T 4HCIA 2XKUA 5FYLE 3C8KA 1MJ8H 3BFQG 5JA8B 3QP3A 3QZMA 4IBLT 1PY4A 3P9WB 1XH0A 2YN3A 2IPUG 4LCYA 5I19H 1X5AA 2BSDA 3UJTH 2Y1ZA 2GKIA 1YEJL 4U0RB 5FO9B 2HLFD 4KO7A 1BAFH 3NEXA 5KVEL 1DE4B 4WWKA 1HJBC 4AWJC 2AV1A 1U92B 5F1KC 3VWJB 1JPST 1R75A 1IGFL 2WTPA 4R4BA 1GSMA 5G4OA 2XKNA 2B0SH 4PFEA 5KBMA 3PJLA 1UKTA 4K94L 3V4PA 5IB2A 1P6FA 3X1GA 1SXSA 2UWEA 5L9DH 1HTYA 3JV4B 4WKZA 5DUPH 4A55A 1ZHKA 5LHDA 1F1AA 1SFHA 4R0LA 4AH2B 3NAAH 2QPSA 1R3LA 3VI3A 3ARFB 3CH8A 3VXPB 5HYSB 2GJ6A 1FLTX 1QUNB 1YJDL 3C60C 4JFDB 4ZX4A 1TU2B 4GLRI 4L1DA 3VH8G 4Q8BA 1CVRA 3Q13A 4HETA 2J72A 3AXLA 3MBWA 2YRZA 2YSTA 1UENA 1GS8A 2EECA 3QZWB 5AL0A 4BFRA 2UZYA 1YEKL 5DHVA 3QEHA 4MA7L 4NO5A 1MFVA 4DOHE 4Z7OF 3IMUA 3NACH 1F11B 1T6BX 1L9SA 2PR4L 3LSOA 2Y2WA 3WAKA 4XVTL 4P3CH 4G5ZH 2QBWA 3SE3C 1C8PA 1HKFA 3U9PL 3I3BA 1AI1H 3WEOA 4TULL 1OY3B 1HNGA 1DJXA 3INOA 2AJSL 4J3OC 2AJXL 4HD9A 3GBMH 4AYFB 1KGIA 3T0VA 4ORZC 2FH6A 3GSWB 4M5YH 4LEEA 4PGCB 3ZQWA 3B7RL 2NMSA 2A6IB 2HMID 2AABH 2YQGA 2TRYA 5B38G 4NSKA 1AQ8A 1G7MB 1PLGL 1IC4H 3IYLW 4NEHB 3BT0A 2OX5A 4YC2B 1V7NH 1ZK5A 2WAHA 1L9OA 1N3NA 1ZD6A 3UTZB 3H7LA 3VVVA 1DVYA 4YPJA 3T4YA 5J1AB 5JW3H 3ME0B 2NY2D 3I74A 4XMLH 4WHTA 4FNTA 2HG0A 4Z7OB 5IB4B 1OHZA 3ROLA 5KG9B 3IGFA 4BSVB 1E42A 3IXAA 4W93A 1ACZA 5CP7B 1A4JB 5A7EA 4PY8I 4JDVB 4GS7B 2GHZA 4G1MB 4GY4A 3QWRD 4OF5A 2QTEA 4WTZA 5KSBF 2JI3A 3DXAB 3VYPA 1MFCH 2HJLA 1FYTA 4XPAH 2AK1L 3ZE2B 3H9ZA 1TZGL 1FRGH 3V10A 4BYHA 4ZZFA 2NY6C 1YNTF 3LIZA 4DCQB 2O1AA 4OD2B 3X12B 1Y18A 4Q9RL 4HXAL 1ZHLA 3EBHA 1AY1L 4FJ6A 4F80A 3H2PA 4QRRE 5I1KL 2YC1A 3TFKC 1VLXA 3VQLA 3LXUX 1PYWB 5C0GA 4GFXA 3WSQL 1OGAB 3KWUA 4LASH 4XNUL 3QZOA 1E43A 5ESAB 5KZCB 4P9MH 4GP8B 4CA4A 3GXDA 1XMEB 3WTTA 1T0OA 3DVIA 2J8UF 1UHVA 2VUOA 3N43B 2Z92B 5C09B 3ZTNH 2ORBL 4LT7A 1GZPB 4YDVA 1INDL 4YHLH 3T2PA 5EZJA 1JRHH 1YNTB 4MA8H 3A23A 2JXMA 3OWEA 5CJXC 3KDPB 5J89A 4LPCA 1UJTA 5CGYD 4K3EL 3NCCB 4LRNL 2XQBL 3L4XA 4G8EB 3P77B 4EOWL 1WS8A 5E8EA 5GRUH 1ASQA 1FF5A 3CK0L 4IOFD 3TYGH 1MFMA 1OTUC 3UTPE 4YXLL 3ZHKA 4M7KL 3KLKA 4G7RB 1XGQB 2WYZA 3NZ8B 3QHTC 3CXHK 4QCIB 4R3SA 4ZYKB 4PG2C 5BRZD 2VN4A 2E27H 5DRWA 3CZLA 1EDQA 3BP5A 1TETL 4PWIA 3MV7B 4LCYB 2VDKH 5I73C 2WKLA 5IT2H 3MNVA 1GR7A 2Z8WC 4L05A 1WDAA 5HJDA 2DM7A 4AEIL 3IXTA 4ZFZB 5L4FA 1O6SA 2CIKA 1CO1A 3VFTB 5D2LA 4MB3A 3HC3L 1OSZA 4JLRA 2F5AH 4PJAE 5KBLA 4NOBA 2AJXH 3KPMA 5HGBB 2VR6A 1YUHA 4TQEL 1M7IA 3OHXB 2C9QA 3HNVL 2O72A 5CILL 3FO0H 5KVMC 3QORB 5DUMH 4Z3JA 1A4KB 1IV8A 3LEYH 3OKNA 4JFEE 4AYEC 3BUQA 4PJBA 4OI8A 4H26B 4N0UB 2GK0A 3OAYK 3RWEA 1FNLA 3D52A 4OFDA 4R4ND 5D1XE 5EF0A 5DD3L 1I1FB 2FQGA 4UBDD 3SOBH 5J6GA 4X8CA 1UWEH 3AAZB 5LNGA 1YZZA 4M61B 4PW3A 4AV5A 3UGEA 4HFWB 4W68A 4JFHD 1HSAB 2JB6B 3GKWL 1F4WL 4WIQA 5AYTA 3NABL 4YHML 5C0ND 4DVRL 3GHBH 4JGJA 5SWSD 1OTTC 1GY1A 3QR2A 4QHMA 3GIZL 1G0YR 4MSWA 1HCFX 4Y4KC 3ARXA 5B8CA 5K69A 1TZGH 1UM4H 2CMRL 5E9DE 3NVQA 3IB4A 1UATA 3T3MF 1BBDH 1JGDB 6PCYA 3B7TA 3L2MA 1LEGA 3QISA 2HUEA 4AYDC 1IEHA 2Y5TA 1HCYA 3EF4A 3QWRA 1KJMB 1FHGA 1JN6A 3ARDD 3WUWG 1UCBL 2HRPL 1WBYA 1HE7A 5I1EH 2WC7A 5EC1A 3T4AA 1FFOA 2YLHA 4RAVA 2VRQA 4GG8B 1UD8A 2XIIA 2AQSA 1KB5B 4AY0A 3APMA 4A2DA 2BNUA 35C8L 3A4FA 3H42H 2KPWA 2RFXB 5A2FA 1CU4L 1RVFH 2DTMH 1CXEA 3QZLA 3KPPA 4IGBC 3BPCA 5HY9B 4TVPD 1Z32X 5DMJB 3W11D 1KCVL 1HI6A 5EO9B 2X53A 9PCYA 1AKJB 5AB0A 3ASOB 3MRFB 1GMIA 4B96A 4PS7A 4L3EB 2VDRL 5JPNA 1GPOH 4XPTL 2CCVA 4HLJA 5I5MA 3N41F 4TUKL 2YARA 1TVBA 3L9RA 4Y0GA 1V5JA 2E27L 2EJ1A 4Z95L 2NZ9D 2VLJB 4AYSA 3CVHB 2FIRT 4XC1H 1OE2A 1S9KC 3SQOL 2A73A 4P0DA 5H37G 3VFSB 1TSRA 5TJWK 2FBOJ 5A2CA 4OB5H 2X44D 3QW9A 3MRRB 5I1DB 1K4DB 2R15A 2JLPA 4NUPA 5DMYA 4I9XA 2NXYD 4XXCC 2VLMD 3BRGC 3KPLB 3AS1A 4HIEA 5EC2A 3MN8A 4YUEH 1T4WA 3QNFA 2F5AL 4XWOC 5F7AA 1F8TL 3AS3A 3QRFM 1MCJA 3ZDYF 5EFIA 2B2XL 2XLLA 5KSAB 3V0EA 3WLWD 3DX4A 1G0DA 1UA7A 5CCGE 5A16B 4H1LA 2CCLA 3PUUA 5AZ2L 1ITCA 2L7EA 4G8AC 1ZT1B 4OLZH 2WBJD 1EAPB 4X6BA 3AREC 3V7MA 4E9SA 4MQ7A 2XN1A 4NQCE 1P53A 1GS7A 5J8OA 4JRLA 4ES8A 4E41E 2XVBA 5GRVK 2J1YA 4IIQC 1UGNA 3A6CL 3EOBA 1FL6A 4BZ2A 1FP5A 2P8PA 1IEAB 3AROA 4NQDB 1P7QB 3FU5A 3CWGA 4KV5E 4PYHA 3V5DB 5KBNC 4GS7C 1J9QA 3MRRA 3V79C 1CTOA 1SDDB 1SY6H 3M17B 4H44C 1EDYA 2AJVL 3APDA 5D1ZB 1S78D 1OGSA 4NM4H 3ZY7A 4AC4A 3IT8D 4LSPL 4M5ZH 4L8CA 4LHUG 3QFJA 2YJLA 5C07B 1B0GB 3K6FA 4ANVA 3NT0A 5B4MC 3IMBA 4HIHB 1JI1A 4H13C 2D3JA 4L29A 1IGML 3OD3A 4Z0BH 1QTYT 1LEKB 5DJCA 2X6MA 1AR1B 1RPKA 1Z9SB 4R6UA 2WIIB 2XRAL 5JIDA 3B1TA 2ENJA 4IRSB 5D2LF 2XFGB 3DUHA 3NUKA 1IBGL 3HI5H 1BOGA 5JTWA 1QTSA 4N0FB 4XPHH 4AC2A 4GI6A 1W9XA 4AW7A 2A77H 3V6OE 5K9QG 5FCUH 2EYRB 3L5XL 1C16B 5SWQA 4M4PA 3PREA 2Z4TA 5AW4B 4IRJA 1E9PA 2PPDA 4Z7IA 1MVYA 4KJQC 3LD8B 3N85H 5DEZA 1UTDA 2CH8A 4XPTH 5CP3H 4P5TB 4N2NA 3AQXA 1H15A 4XTRC 3N9GH 4TL4A 3U9WA 2GJZB 2H4EA 3SKUD 3P73A 5FOJA 3PHQA 2YD8A 4KJQD 4PRHA 1JHLH 3ETTA 4Y19B 4JG5A 1PLBA 1OCWL 1SBSL 1ZCRA 1R19A 4K8RH 3QUKB 5I73B 2ID5A 1ZAGA 5JW5B 3ZDYB 2KLRA 4ZFQA 3C2SA 4BXSV 2OTPA 2QQKL 5H2BB 4XP6H 3WIIH 3JUZA 2YEZA 5HGHB 4CSZA 2DPKA 1CJYA 2J8UA 2QPUA 2RCSH 5AZEH 3VXRB 5IJVA 1CXLA 3SPVA 1CLYL 2X4QB 4MJ5A 3IFLH 3A21A 4PJ8A 1HFUA 2DQDH 4JQXC 4PJIA 5DEFB 4JHWL 4UIKL 2AMGA 4R7XA 2DMBA 3UTSB 3OKNB 2HSIA 5DHVB 2KC0A 3UEZA 4MJIA 2QQLH 4PJCF 1JG9A 1NC4D 4P2QA 4MASA 2WWKO 3QDMB 5AW9B 3PWPB 5ABAA 2K4AA 2DRUA 4B27A 3BMVA 3LNGA 1IU1A 2J3SA 3WXWL 4HOZA 4XC3H 4RFOH 1F2QA 1UUSA 1XGRB 2JTYA 5D5MA 3VD2A 4I2XE 4FFZA 3CSYA 2P46B 1OAZL 3AJ7A 3VM5A 4KQ0A 4CMMB 2BCKA 2W5PA 3H54A 4LSQH 4QT5A 3SKJH 5DLLA 3VFGL 1M56B 1JMXA 2K3TA 1Q9LB 4C56D 2JNZA 4LOVA 3EO0B 5KVEH 3GSUB 4YSOA 5ID1A 4TS6A 2FEEL 2ZCLH 3NJXA 4HS3A 3VDCA 1NPJA 2A9BA 1A9BB 2VC2B 4GRWF 5GGUA 4AJYV 2OYLA 3RB5A 1JNJA 3MRJB 3MI6A 4B53A 2DQCH 4D9LL 1F13A 4S2SA 1DJHA 2KI6A 2XZAH 3SBRA 3SKMB 4LIQH 4LQFL 1D5IH 3W2DH 4A2HA 1R1CA 3ALPA 4FKKA 1JZ7A 2X9WA 1Q0EA 3PWPA 1MJJB 5E5UB 2ICWI 3ARQA 3U1SL 3K80A 4MMXB 1S8DA 4KHTH 4NUGL 1ET8A 4OFKA 5IHZB 4JFQA 3N41B 2ZOLA 1NKOA 3F00A 1SXAA 3S34H 4BZYA 4D7BA 4DUXA 4N90D 5FCUL 2BWDA 2Y36H 4JG0H 1ZVNA 4PJDF 3CVHA 4E42B 1A9VA 1ZLWK 4L1HA 5B4MD 1D6EB 5J9PA 2NCEA 3N2JA 2X9ZA 3F5WB 4L3EA 2Z64C 2P26A 4GO6B 3VXRD 1J18A 5FHAH 4OR1A 1GGBH 5E6UB 4FQCL 5AB2A 3UC2A 3PPEA 3MC0A 5F89B 2HKHH 1YAIA 2XBTA 1CL7I 1Y0LB 2JB5L 1NCUA 1YEDA 2XTJC 4PW4A 5JZ7C 2CJUH 2HFEB 4PJFE 2I60L 2UWEF 3JWOH 5CN1A 4OLYH 4PTUA 4HX1B 3FTGB 4AQOA 1DL7H 4OCRL 1QWHA 4I0KA 2GB2A 4M8QA 4OD1L 3E80A 2CHXA 2E8ZA 4UQIM 4KK5C 1FNSH 4GAFB 5D4QA 1CD9B 5E4OA 4JFPA 3CFDB 3HJEA 4H1LG 4J4PC 1D5RA 4R96B 5EV7A 2IANA 3V6FA 1AZZC 2RMNA 2PO6B 4R9HA 1RZIA 2QSVA 1RFDH 3KBFA 4AI7A 1RIHH 3CHXA 3LKSA 2ESVB 4U1NB 1KC5L 4RWHA 5FYLH 3L4ZA 1ZXQA 2AZUA 1INEH 3DJSA 3IGKA 1L6PA 4AEFA 3VD0A 5HDLA 1I3UA 3CSFA 4DFHA 1MFCL 5DD6B 1WBXB 4I8DA 4NT6B 4L5FH 4YX2L 2ED6A 3WNMA 3FK3A 1FL5B 3F3HA 5CINH 4BWUA 2VKWA 4KY1H 2VMEA 2YLKA 3ZZ1A 1EJ6A 2FTAA 3OMNB 1D5XB 2Q7NA 3H56A 1D5BB 4O58H 3QI9C 2ZSVB 1VGKA 1LLAA 5E00B 5MEPA 5A3IC 4R2GB 1A7BA 1SRDA 1I53A 2HVJA 2YAHA 3CPUA 3V5KB 3A4AA 1I9IL 3GMLA 3KPPB 4JL1A 1KGUA 4ERSH 3TEXA 5I19L 5JLZA 4YDLB 3WIHH 1DQDH 4CKQA 2NNRA 2RFXA 3F7YA 2QLVB 1PLAA 4KTYA 1AD0B 2IALA 4NNPH 4B0MM 4E9QA 5MEQA 1GS6X 3MUGB 3W0WA 5HDBB 1DUZA 4QRRA 3RZCA 3VXPA 4QLWA 4XNQA 1UM5L 2NQDA 3WFCH 4G6AC 1KENH 3O11A 1JXGA 3RWFB 3V6FB 5ECJE 3FQRB 3JTSB 4NP4H 1NUNB 3KXFE 1Q8MA 3MO1A 5I74B 3QEUB 4UDUB 3SCMB 4NKIH 4AGMA 3HI6H 3TEZA 3CZNA 4AMKH 4JG9A 1T04B 4G82A 5E2VL 2ZKWA 2BNQA 3IM1A 3PXHA 4MKTA 2ZOWA 4PJEF 2WP3T 3FQUA 4PJHB 2XWEA 3CGTA 2AXFB 4KXAA 3QRBA 5JORA 1EHLH 3KW7A 1DCLA 1Q9KA 1LE5B 1A02N 4A2MA 1CTNA 4F7PB 3H3PL 2DQTL 3ARDC 5KVDH 3HFMH 5LCVH 4OF0A 5ADPH 2DM2A 2YAEA 1B3IA 3MRKA 2DWSA 1K4DA 4G6MH 1TNNA 5TDNB 4EVNA 3AG3B 3JT0A 4YDVB 3GJFA 3V6OC 4C57C 5IFJA 1E4XH 3NDZE 2Y1VA 4UF7C 4XNMA 3M1CA 3GSOA 4M6NL 1B90A 5F0LB 2CA4A 1G43A 4AQEA 1MLCB 2X6UA 3KDMA 4JO3H 4WNSA 5BVJB 1W15A 4OD1H 1NAMA 2GBTA 4AGOA 2R2EB 3D2UA 2A4EA 2ENSA 3ESUF 3QS3A 5F7KC 3MV11 3E2HC 3QUXB 4R0LC 4APXA 3VFRA 4OSUH 5EUOB 1G9MH 2CDFB 4I9WD 1Q72H 1SJXA 1MZYA 3PGCB 1NFIA 4PY7B 5BS0A 5FGCB 2D7PA 3BPCB 5HY9A 3VFPA 1OWRM 1EO5A 1JHTA 1C12A 3FCGA 2WYTA 3TJPA 2DBLH 2VSCA 1DFBH 4RAHA 5IB5A 1IC7H 3NRPA 4QRTB 4P07A 2ZOUA 4RBPK 2RA1A 3RWDA 1QHQA 3UZVB 3DVGB 5B21A 3OJMB 4YHYC 1L7TH 5LN8A 4JFYA 2EH8H 2OJ1A 2WLZA 4J39A 3MLWL 4ONGL 2C4FT 1V7NL 2BXYA 1AO7E 4NQVA 5DR5H 3WIFB 2G4EA 3RX5A 2JFCA 3ZHLA 3MXWH 3OVUB 1H3PH 1T0NB 2GAZB 4NQXA 2D2OA 5FA3B 5EZJB 4ZUVB 4A1RA 2HWZL 3BD3A 3ILPB 4LHQB 3AT9A 4LSTL 4HIXH 5C1MB 1Z0NA 3NCBB 4Q9BA 4CDGC 1A3RH 4AK1A 2QZQA 1QHPA 4FTVE 3OZLA 3L2LA 1S46A 5BRZA 5C3TA 2VISA 4OLEA 1KCLA 1WEJL 3T2NL 4YHLL 3MU3A 4PSPA 3PQYD 1T6WA 1XSIA 2J43A 3FO1A 1HH6B 3IFPA 3WTSA 5EEYA 1GYCA 4H8VA 1EVTC 4M02A 4AEHH 3BEWA 3CN2A 1T22A 2X89A 1GTNA 1K5NA 2AKRA 3ARYA 4M7KH 4QRPD 4KZ0A 1QFOA 2AK1H 2H2PC 2DQTH 5KVDL 1FRGL 4ZO9A 1UJ3B 4QYOB 3HR5B 4HKXA 2VDNB 2DBJA 2IH1A 3V95A 5ADPL 2EXSA 1KLFB 3S36H 1EAOA 3IDNB 3EJSA 1P4LB 3FRPA 3MZTA 3APFA 3HC2A 2AW2A 3QDGB 4ZX6A 4GRMB 3WIFA 4GG6B 1J5HA 2VC2H 3LPGA 1CK0L 2B2XH 2X2IA 2Y5TB 4GQPH 3T0AA 2TSBA 3CFJB 2A0LC 2GJJA 4L18A 3FHQA 4PTTB 2IQAA 1YA5A 2N0KA 1X7TA 2JVUA 4ZO7A 1ZK9A 3DX6B 1JZHA 2R1YA 3LN5B 4JFOB 2DWTA 3F7QA 3NEOA 2OZNA 3RAJL 5CJXA 3BAWA 3Q6FB 4H25B 5GRJH 3FSOA 3HS0A 3UOAB 4QMEA 3GSNA 3UCRA 2B3IA 2C9XA 5EOQH 3IDYB 1JP5A 3ZVVA 1SYVB 4XP4L 3RTQD 1G7IB 3D8MA 4ODUA 4OCSL 2HLAA 4F7TA 4OQTH 3FTSA 4RGND 2ETWA 2A74B 1KIPA 4PP2B 3QWOA 4WUUA 4OZGE 1FCGA 3ZMEA 3S8WA 1GGIL 1ZGLA 1KPRB 1UGKA 1FGVL 4K71C 5G4MA 4AQ8A 5JMRA 1IKFL 5J5EA 3DRQB 5FO7B 4R5XA 3RI5K 2VWEC 4BXVA 1FG2A 3CSPA 4P4KB 4JZJB 1L0YA 5I1CL 1GIGL 1OQOA 1FNAA 2YZ8A 5JIIA 5DUML 4NAMA 4WFHD 4YBQD 2BVQB 4EO5A 4JZOA 4K94C 3VYNA 2VQTA 1AYOA 4DPRA 4U1SA 5AVTB 1LP9B 1Y1DA 3IDJA 3N1FC 3HUJA 4LZKA 3C8HA 5LQBL 3R8QA 4HCRA 2XUWA 5SX5K 1I7ZB 1SXZA 2AQTA 1S7SB 4DP6X 2GTZA 3SJVD 3WGVB 4P2OA 1IO4C 5AG9A 4N87A 4U1IA 1AQMA 3KYMA 3NABH 3PQYB 2GSMB 4JG1L 3HC4H 2BSED 3F04A 3MOAL 5JDSA 5F3BA 5DRWB 1M6UA 5DWPA 1CGXA 4B9ZA 3RE0A 5GSVB 1FH2A 2IFFH 2F7QA 1U3ZA 2XXMB 1WLHA 4J12A 3BJ91 3ESVF 2CKNA 4BDVB 15C8L 1C5CH 3WTXA 4O4YL 2HKAA 5I8OH 3L95B 1JXFA 4Q52A 2F1AA 2MNJB 4S1SH 2X4NB 4Y5VA 5HDBF 5DFTA 5GZND 1S9VA 2CBTA 2N59A 3NFPA 1VFBB 4X9HA 4YAQA 5DZJA 1TVDA 3RILA 4EQ3A 1QEWB 2MMXA 2QZ5A 4P2CG 5CBEA 1QSED 4OBSA 4HLZG 5DSCB 4BQBA 1LD9A 1M7DB 5D2NB 1CXIA 2NTFA 4F37K 3RKDC 1OLZA 4AUUA 3BIBX 1B6DA 1G7JA 3F7RA 1HN1A 5J6SA 1U2YA 3D0VA 3GLEA 2OYKA 4NIKB 3AB0B 4FEMA 3RX7A 1YQVH 5I5JA 2FHCA 4XHQA 5C71A 5DQ9A 4Y4HB 3MLSL 4X7SH 4CVXA 4NHUB 4XRCB 4NUJA 5TQ0H 4PWEA 4GKZA 4RAUB 4WFEE 4JPVL 3BIKB 3RVTD 2CRIA 4IGBA 3RGVA 3OLGA 3WFZA 5HI4C 2XZQL 1RLBA 3WXWH 4XC3L 4YAQB 5HYIA 4ZPVA 4OFVA 1XWVA 2X05A 2BOBA 1CDCA 3OLIA 5J56B 2XTJD 3CHSA 1T66D 4JN1H 1TXKA 3UFIA 1C8QA 2JMRA 2NY1C 2XXCB 4IRJB 3EFDL 4WI8A 3GHPA 1BVNP 3O6LH 2K78A 1ZVSB 1E2WA 3FUFA 4P2QE 4IHOA 2XG5B 3KPRB 3TO2A 4AZ8B 4DAGH 2J2ZA 2RGSA 2ZCLL 4WDIB 3FC8A 3GRWH 1LP9E 2AANA 3A67L 3GSWA 4PGCA 4JUSA 5IB1A 2JF1A 1VKXA 3IU4H 4M43H 4N26A 3V8CA 1F6FB 2BNRD 4X4XB 3S98A 2MQCA 3AM8C 4XAKD 3BZEB 5C07D 4Z18A 5CGBA 4XODA 4ZW3A 1FL3B 1NEZG 5LAPA 3D9AL 1U58B 1GGCH 3BZDA 1CQKA 3PABB 5BW7C 3LZOA 4FLHA 1T03H 3D39A 4OCWL 2XWTB 3SDDB 3E8UH 5IWLA 3NBNA 1A6AB 3O2DL 3AREA 1TQTA 1ASPA 2NY3D 2BIIA 4JG0L 1CICA 4QWWD 3MREB 1HEHC 2ED7A 1IKNC 3P40A 1PNDA 2KKQA 1DO5A 2A77L 1HXMB 2BMKB 4UB0L 4MCYB 4NERA 3VSVA 5K1JA 1D9KA 1Z9LA 1AMYA 1RV6X 2PETA 3QRGL 3LZRA 4ZQKB 4GKLA 1O6SB 7TAAA 1QFUH 4J3WA 3BZEA 1K72A 5AOIA 5IKCB 3W5MA 1RMFH 4X4KA 2FIKA 4YDZA 3TV3L 3NPZB 3DOSB 3IETB 1ILSA 4PJGF 1H8SA 2CLVA 4LBEA 1U92A 2QVMA 4HWEH 1JF6A 3G5YA 2J71A 1JDDA 1RUKL 5TE6H 3TPKA 5EFIB 5M94B 4PTTA 4U1HB 3HE7C 4BQ6A 2GITB 4JPQA 4K9JA 2NW3A 3PFUA 4IM8A 5F0JB 2P5EA 5JHDE 1JGEA 1Q9OA 3IJSB 1YNTA 2QLYA 3C09C 2J88L 4JPIB 3ILDA 4QWWC 4UM9B 3VMNA 1FG9C 4HW6A 1O75A 1INEL 3BWUF 2BIMA 3BUBA 4AE0A 3NTCL 3S96B 1SJVA 2ATPB 3UBFA 2WUCH 3MQIA 1XF3A 1QPPA 2WLLA 3OGCA 2W0PA 1NJ9A 4MJIB 4L2YA 4RMRA 3K8MA 3IN2A 4KY1L 2ICEB 2F5BH 1XDTT 1QNZH 3SJVA 3UAJC 1KBVA 4BFFA 4KRPD 3WO3B 5I26A 3IGUA 2O6FA 4GLRH 4JCLA 1ZLVK 4MBOA 2AJ3B 5F97E 2EZ0D 1JD9A 2TSAA 3F05A 3RY4A 2BIOA 2A9NL 3QCVL 4KXZH 4ZD3L 1H6UA 5L7XL 3LJ3A 5IB1B 4NCC2 3LHPL 1A4JA 1BZDA 4ZX3A 1U8HA 5CSBA 4PRPE 1PG7L 2Z31D 5K9JH 1NCOA 1R5IA 5D1QB 5LWYH 2VDRB 2HFGL 3FQNB 1LVEA 5IBLC 3GPEA 4PRPD 3X14B 1CC3A 3F7LA 4JQXA 4XN2A 5F71A 4Y2DC 5MI0C 3MV8D 4WHCA 4BH7A 4NAQA 3DRTB 4PJFF 3OR6A 5CP3A 1QLEH 1DQQB 2YGOA 2O5XL 1D5IL 3CFTA 3W2DL 1DJGA 2XWCA 4KU1A 3WJMA 4OGXL 5F3BB 3FPYA 4ZMNA 3TN0B 3U1SH 3OPUA 5GS0C 3L16A 4P5KA 4JQIL 3G5VA 1SGKA 4N2LA 1SVBA 4XX1G 1G6RA 2XVLA 1JNHB 3FH5A 4WEBH 1JZGA 5IQ9B 4FOMA 1BPLB 2WXNA 3IMTA 4NWTL 2C7FA 1E30A 1AQKH 1O5DT 1UACH 1N4XH 4KMLB 1KYDA 4LHUB 3P0VL 1OK0A 1L0QA 1HWHB 2GK0B 3FTWA 2DEXX 5HGGS 1V05A 3FAWA 5I1GL 1Y07A 2NYYC 4MRCA 2Q1EA 5FHBH 1KLGA 4KTDH 4M7ZB 4NLAA 1D7BA 5FX3A 4NI6A 2A9AA 4PBWD 4RMSA 4V1DE 3MTRA 4GAYA 1I3RB 1A7PH 3AABA 3NMEA 4FF9A 4AM0A 1AXTL 4N2AA 3C8DA 1INQB 5F96H 4WUUB 2BHUA 1XB8A 4JPSA 2P28B 5DRZB 3WLWC 1YNKL 1AH1A 4LIQL 5IJKC 2AV7A 2P5EB 1R47A 3QB7C 4MMZC 4LP5A 2VN6A 4POZC 5ETUA 2J88H 4ZUUB 4BV1A 3MX0A 2YD6A 4K3DL 1AIFA 2OMWB 3FU7B 1FVCA 2UXVA 2C9AA 1E2VA 4HJJH 1RURH 1ZEAL 2Y7MA 3GJFH 3ZT6A 1S3RA 2E3VA 4G42A 3CVDA 1NSNH 1YY9D 2QMJA 3GS7A 4G7YL 4POZD 2WHVA 3ULUH 1UWGL 4L5FL 4LDOB 4N0UE 4Z77A 1T1ZB 3DUUB 1QI3A 4YWGH 4YSTA 1SEQL 4K7PX 4RRPM 3FRPB 4YL9A 3MMEB 5C09D 5T5FA 2DH3A 5DRZA 2H45A 2AI0L 1OKEA 3LZLA 1RHHA 2V7HB 1VENA 2WANA 2YR3A 4J3XA 2XTLA 1IQWL 3JBG7 4UTBA 1CDIA 3ARBC 3HEIB 3BYYA 3EDKA 2A4CA 4WI2A 2HKFL 3D3VE 4ZI8A 5I1DA 4HH9B 1NUDA 3FT1A 1BFOA 4IGBD 5IJDC 4MKMA 4XVSL 3TVMD 4EN3B 3SBWC 3LRMA 1VAHA 4NXKA 4UQEA 2Y1YA 4QEGA 3H6AA 3SDDA 5C07E 1GXEA 2VLJA 1I7TB 2QELA 4D9QE 1EO8L 1P0SE 1JYXA 2I7SA 2DOCA 4A7GF 3RVVD 4NP4L 1PAZA 4MNGB 5DC9B 2W94A 3BN9C 1IM9D 4TNGA 2HCZX 5E1AA 5HYJD 3PP3H 4NENA 4P2QD 2OAAA 4ONFL 5D7JC 4FQHA 1BVKB 1X3DA 4YOKA 1NGWB 3P54A 3B3BA 5EOTB 3IFNH 3N1QC 1HE8A 4BWTA 1IGFH 2X0UA 3FO9B 1WFNA 1J8SA 3DTDA 2BNUB 5DHXB 3MA9H 3NYKA 4K94H 5BMFL 4DH2A 3QCTH 1ZMYA 1F86A 1SLWA 4YSAA 1H5BB 3EH1A 5JIPA 4CC1A 4V1DB 5KOMC 4HULB 1QI5A 3MJ9H 4YDJB 3ZE1F 4KK9C 3QEUA 4N2EA 5C0AD 1JN6B 1HINH 3SCMA 4OIAA 3UBXG 3FUJA 1IJ9A 5D2LE 4OZHE 3T6ZA 4X5XA 2H6PB 4GQ9L 4MJ2A 2R9HD 3SZ6A 2B1AH 4IGBB 4Y19E 4K5LA 4D9QD 4LSDA 3TEUA 5BZDA 2GYSA 4JHAH 4F9LA 5KS9B 1YNKH 5D7SH 4XP4H 3QJSB 5KVDE 2DWEB 3DHUA 1HEJC 32C2A 3C09B 3E0GA 1B2WL 2VDNL 1ZTXH 1F45A 1NCBL 3LRLA 2FB4H 2OL3A 3ES6A 2NSMA 3OKYA 3OB0K 4X6CB 1RURL 1ZEAH 2Y5QA 3CC1A 2AEOA 1S7WB 5D2NA 2PXYA 1BJ8A 1E4XL 4J3BA 2NNAA 1QEWA 5LBSA 4TV3A 2GCYA 4WNQB 1KXQA 1RUMH 5KAQG 1A4CA 1T80A 1R3LB 1N9PA 2IMNA 5D8JL 4GUPB 1MVFA 2QQQA 2X4PA 1ZGLM 3P3RA 1CFQA 1R17A 1HHIB 4HUNB 3WV0A 2IEPA 2IWEA 3IDXH 4XZ4A 4EE2A 1VIWA 1RH8A 4OSUL 3MRGB 1G9ML 3UERA 5I1AA 1JNNH 4N2GA 3UTPD 5E6SB 2QKIA 1K4CB 2BVUA 2Z8RA 2NYZA 5DCCA 4WO4D 4R5VA 3N5AA 3RIKA 3RWJB 3OMAB 3F6LA 4X6BB 1TIUA 2NUPB 1B2YA 1ADQH 1HHKB 3RU8L 5GGVY 1CGWA 5HI3C 4FN0A 4AT6B 1A21A 3A0OA 2IFFL 3A22A 3HUJE 4BWWA 2Q10A 3IVKA 4OUOA 3ZTDC 4APQD 1OD7A 3WCYA 3EFFB 3E8VA 3I6SA 1Q72L 2FNWA 2EICA 2XZZA 5ERWB 5D4IA 5EUOF 3ZOAA 5KS9F 1CG9B 4Q6IC 2XZCL 1KELH 4OY9A 3QIUC 3VSTA 2XN9B 2W9LA 3LS4H 3HMXA 3R7QA 5D5MB 5DWUH 1XIWC 3A5VA 4KUZH 2QGCA 5F7DA 1OLLA 4HWZA 1DVQA 4C4BA 3VG0L 1RIVH 2WNKA 4OGQC 2ORBH 1NINA 2ZSWB 3ZE1B 3EJJX 2R56L 3DBSA 5FO8B 2EH8L 2IOMA 4F5CE 1EFXB 3B2DC 4XH2B 4UU9B 2ZP9A 1UM6L 3CLFL 3MJ9L 1KNOB 3F84A 3NJMA 5AWNL 3CMOH 4TVUA 4JFDE 4P5TD 3EBIA 3GXMA 3VRJB 3ECUA 1FORL 1M57B 1ZA3B 3VFUB 1U6AL 2X4RA 2DTSA 3QFDB 4JDTH 1NBYB 2C3GA 4WV1A 2O5NA 4AEHL 1F1DA 2OJZH 1CE1L 2EH7L 1FWXA 2PTUA 1FO0A 1OB0A 1QA9B 2WVTA 2W60B 2YKLH 5AL8A 1X5JA 3Q2WA 1ZLUH 3SQBB 4X6CE 4M62L 4Y2NA 3FT0A 3MCYA 1MHEA 3HE6D 2CLRB 3G04B 4PYGA 1E4KA 4E41A 3N43F 2RTTA 1N6UA 2R2HB 1VFAB 3GTNA 1N0XL 4HLEA 3UJTL 3BT2H 2ICWJ 3FFCB 1VACA 4HS6B 1R5IB 5D1QA 5E70A 1YMMB 4E36A 3HMWL 1RUML 2HT2D 3F7YB 4XPFL 4JDZB 2AXJA 1B4TA 3QZBA 4NC2B 4JL2A 3TX4A 2WSDA 3VG9C 4Z7WE 3DJTA 1BJMA 3UBXB 5C9KA 5CHNA 3OLEA 5TDPA 4KZEL 1XTMA 5JXEC 1CK0H 2CBQA 3C60A 3TZVB 1AGEA 4LHJB 2RALA 1E27B 3P4NA 4AMWA 1I7TA 2GJ6D 5E4EC 4HYTB 4X7DC 3STZA 3TYFA 2R23A 3O4OC 3ULUD 2ZOKB 3GTVA 4MHHG 3OMIB 4PJAF 1IQDB 3HS0C 4I48A 1WBXA 1P5UC 1J0KA 2WLLB 1HHGB 1KJ2H 5BOZG 1CR9L 5F8QC 4HQQH 4Z7NE 1YMMA 2X4NA 4J4PD 2NY1D 4MZ2A 4Y5VB 4XGZA 5E6IC 5ESQA 4P46B 4K9EH 4PJ8D 2EVJA 1WG3A 2YMTA 2FZ3A 5E99H 1BXAA 4RZKA 5C0JB 1E5AA 4O02B 3LQAH 4HUKB 5GJTL 2XPYA 3VJ6B 1H6TA 4XCNB 3BRFA 5E9DA 3W11C 1IC5H 3GXNA 4XNUH 3QJQB 4U1IB 1FV1A 1UWFA 2QMKA 2AABL 2DLGA 3M7FB 2A6KB 5B38B 3ASNB 3HC4L 3MOAH 3QARA 2W9DL 4C55A 3B2VL 4Y2OA 3HHMA 3D5OF 2QGEA 2BS8A 4FFWD 3QPXH 2MPAL 3QGVA 1MRFH 4F20A 1E8ZA 5DJAB 5DMIH 3VQ2C 4F7MB 1C08A 3BI9X 5FGBC 4Y5XB 5I8OL 3T0EB 1PMYA 3QDGD 3AU1A 1K8IA