2HLOA

Crystal structure of fragment d-dimer from human fibrin complexed with gly-hydroxypro-arg-pro-amide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
b'VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrin alpha chain
molecule tags Blood clotting
total genus 22
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hloA00
1JY3P 1W2EA 1FZAA 3E1IA 1FZBA 3GHGA 1JY3N 2OYIA 2OYIC 1RE4C 1JY2O 2OYHC 1RF0A 2HPCB 1LT9A 1N86A 2OYIB 2OYHB 2FFDA 1RE3A 1JY2P 2A45H 1LTJA 2HODA 1N73A 3GHGC 1FZCA 1LWUA 1JY2N 3H32A 3HUSA 1RF1A 2Q9IA 1M1JA 1RF0C 2H43A 1LT9C 3GHGB 1FZCB 2FFDC 1FZGA 2HPCA 2HLOA 2FFDB 1LT9B 2A45I 2XNXA 1RE3C 1RF1C 1N73C 1LTJC 1N73B 1FZFA 1FZEA 1LWUC 1T3UA 2HODB 3BVHA 1FZCC 1LTJB 1LWUB 1RE4A 1M1JC 1JY3O 3H32B 3HUSB 3HUSC 2Z4EA 1M1JB 2A45G 2OYHA 1RF1B
chains in the Genus database with same CATH superfamily
1NKZB 1RH5B 3M0AA 4W80A 1MFZA 2E42A 1N86A 2OARA 1MUUA 1M1JA 2LXBA 1KN7A 5AVSB 2PGDA 2FYUJ 4L75A 4OGQD 1PP9G 2BEZF 2A06D 1QLED 1URQB 3QWOC 1YI2P 4PJ0E 1QVGO 1LNQA 1PP9E 1VPCA 1SQXJ 4W7YA 1M8OB 1PGPA 1PL5A 2RMZA 1FZCA 3L74J 1OXZA 2IZ0A 1DD4A 1ZRTE 2O1KA 3CXHD 1IO4A 1GL2B 2AXTE 2WMMA 1BGYD 2PRRA 3T97B 1JOCA 1QL2A 4ZKUA 1H0TA 2V7QH 4OWFA 2N1TA 1AV1A 2M5AA 5B66H 1DIPA 4YPCA 1SFCB 5APSA 1T3UA 1S3JA 3M9BA 2FYZA 2E76D 3K5BA 4C46A 2Y0CA 5CCHC 5E79E 3RK3C 1JY2N 1LTGC 5B5EH 2W27A 4WWIA 5KLVK 1LT9B 1T8ZA 2M0BA 2WSCH 3CC4P 2E75B 1USDA 1NTMG 1QVFO 1NTME 2WZ7A 5APUA 5AW1B 2ZVOB 3E7KA 3MTUE 3L72D 2KZIA 3CWBD 2QEXP 1NTKD 2A06G 5AVQB 2Q9IA 2R44A 3H1LG 1E5WA 1J1EB 3BASA 3NXSA 5KLVJ 1VF5D 2YXQB 2A06E 2LR2A 3H1LE 2Y0EA 3OW2O 1M1JB 5GTIE 2XV5A 3KQGA 3PH0A 3M9QA 3G3ZA 2E43A 2NPSD 2FXOA 5AW2B 1SFCC 2QJKB 3CXHE 2QM7A 1BGYG 1Z56A 4IOIH 2XKMA 1FZCB 1WRGA 2M3BA 1BGYE 2P67A 5APYA 1OWAA 3D71A 1PP9J 5AVVB 1LT9C 2ZYGA 3L73D 3WMM0 2YIUC 5BU5A 1YITP 2P58A 1A02J 2J59M 1H0TB 5CMZA 2YKPA 4KT0J 2N1TB 1KILA 1KQSO 1FZAA 2D2CB 1K8AQ 2WSEH 2IPPA 1E79H 3VP8A 1VQOP 2W8ZA 4RKUJ 2JWAA 1YQ4C 4PV1D 1KYOD 1T3JA 2Z4EA 3W67A 4BXLA 2FBWC 1AJYA 2N1TD 2ZT9C 4EI2A 2A45H 1N73A 2B89A 3TGUD 1J1EC 4AUWA 3VMAA 4NPDA 3L72G 1RQUA 3O6QA 2HPCA 3Q5PA 3L35A 5KAIH 3L72E 4QMAA 4WY4A 4UB6E 4BRYA 3BCCG 3JC22 2XZRA 2OTJP 1NU1G 1QEXA 4H0LB 3H1KD 1FOSE 3JSVC 1CI6B 3AE7C 3AEGC 1TU3F 1NU1E 2I1KA 5CHXA 5AVWB 1NAFA 1L4AD 2JR8A 1U7MA 4HB1A 1M7LA 1NTMJ 1OW6A 1W2EA 1W2BO 2G3AA 3P8CD 4NPFX 2QSIA 1JB0J 1SQXD 2PFXA 2N9BA 1LWUA 4H44C 4B86A 4IFFA 1K73Q 1GTWA 3V5BA 1ZN5A 5CCGA 2D2CC 3JCUE 1S5LH 3B4SA 3H1LJ 3L73G 1GW4A 2FFDA 1LTTC 1EDKA 1YTZI 3L73E 1HWTC 2OTKE 1K05A 1ZR4A 4IL6E 2WQYC 1NHLA 1G2CA 1LT1A 3RK2D 3N4XA 2R5BA 4WBAA 1ZW0A 1QX8A 1BGYJ 1IC2A 1H8AA 2KP8A 1ZR2A 1N7SC 3D70A 4U3FD 1DH3A 2K88A 1RF1A 1ZMEC 1PGJA 1KYOE 2CK3H 2HR3A 1S9KE 1VQ8P 1SQPG 3TSIA 3HUSC 3TGUG 1SQPE 1QL1A 1RF0A 2DW3A 1T2KC 3CCJP 3TGUE 2JKVA 1NTKK 1SQVD 1KILD 4L76A 1BE3G 1FBMA 3AE2C 2ITAA 2M8RA 3V4WA 1N73B 3H1KG 5AVUB 2C9LY 1BE3E 4EIJA 3Q2YA 1G1JA 3SWKA 4KJMA 2VRSA 3H1KE 5KTBA 3IFMA 2HPCB 1KZUB 2H88C 2JJLA 2E74D 3HD7B 4WY4B 1DX7A 5H2FE 4BRYB 5K5GB 2FYNC 3P32A 3L36A 1X22A 1SLQA 3A0HH 3P8CE 1ZOYC 1JO5A 3L72J 3B5NB 1AA0A 4GOEA 3O8ZA 2WPQA 1NU1J 5APWA 4DOJA 3AEEC 4JF7A 1LWUB 1M90Q 3NTNA 1LTSC 5AW6B 3LW5J 3M0DA 1KQLA 1GD2E 2HODA 2AEJA 5APTA 2K3RA 3HRNA 2BCCG 2FFDB 3FXEA 1IFIA 4EOTA 1USEA 3C9IA 2BCCE 3VTPC 1UIIA 5DJUB 2I8DA 3AE8C 4YXWH 5CBOA 1NAYA 4U3FE 1JY2O 4AQRD 1SP4A 1VQ4P 3Q5RA 2Y9ZA 4JQ0D 4AYCA 5CCGD 3AE4C 4ASVA 3L73J 2HLOA 1RE4A 1L0LG 1SQVG 2KS1B 1Q86Q 1L0LE 4Z1MH 1SQVE 3ZDMA 3CCQP 4XFJA 3H1HG 2XU6A 3MUDA 1HH0A 3H6PA 1KQFB 4U7JA 3H1HE 5AW3B 3WU2H 1FDOA 4DCKA 2O01H 1KFNA 3B5NC 3GHGA 1JTHA 3SWFA 1U7JA 1HJBA 2WPVB 3VYIA 1SQPJ 4ZMDA 1SQXK 1H88A 2KK7A 3TGUJ 1W5CE 1J1DB 3CCRP 1X0TA 2QJYB 2FY8A 4OGQB 2HYNA 2W6BA 2B87B 2NPSA 1NTMD 1XTGB 1BE3J 1IK9A 1HUCA 4EYYQ 2IZ1A 3IAOA 3KZIH 3H1KJ 3EWKA 2KLUA 1HBWA 1GDTA 4H13C 3CL3D 3Q5SA 1NTZG 2BEQD 5APVA 3G4SP 4DT0A 2KZJA 3H1LD 3AEAC 1LTIC 3UIAA 4K35A 2KXPB 3OA7A 5KKZC 4I6MC 4N78D 4TLFA 2V7QJ 2FXPA 1R5SA 4O9BA 2J58A 2R32A 1PGOA 2HODB 2E76B 2Q3IA 2FXMA 1VQMP 2A45G 1LTAC 3RL0C 1DD3A 1JY3N 4HYTB 2AXCA 4Y99C 2ZFCA 3M91A 1BSNA 5KAIE 3BVHA 4C7NB 2P1JA 1KMIZ 2WSCJ 2BCCJ 3AEFC 2OYIC 2Y0DA 3V4QA 3N7NA 4U3FJ 1BDCA 1J1DC 3V2RA 2XDJA 2KB7P 5AW5B 1IFNA 2R5DA 1BDDA 1HGVA 3GMAA 4GOFA 2Z5HA 2GUSA 1EXJA 3RL0g 1MV8A 1L4AA 4HKZH 3RBXA 1FDMA 1L0LJ 1SQVJ 1J2JB 1JTHB 3B71A 1NWQA 1VF5B 3C8VA 3V2QA 1K04A 3H1HJ 1S5LE 3AEBC 1URQC 3MGNA 2IFNA 3S4RA 4R4MA 2POHA 1M1KQ 1HGZA 2NPSB 4LC1A 2JO1A 3BCCD 3D6ZA 1NYHA 1NU1D 2ZXEB 3CC2P 3S9OA 1GL2C 1VQ9P 4N78E 3AEDC 3A7OA 1RE3A 1LTJA 1CZQA 3RK3E 3R2PA 3HE4A 1A02F 4N3YB 1Q82Q 1VQ5P 2GUVA 2WT7A 2O01N 1AVOA 1VQ6P 2K9YA 2ZT9D 2AEMA 4RESB 2WSFH 4PV1B 1N2DC 1NH4A 1FJKA 1IFMA 1GK6A 2OYHA 3CC7P 3R4YA 1L0NG 2M5AB 1YJ9P 1FAVA 2Q5UA 3U1AA 2E75C 3A3YB 3VMXA 3EFGA 3OJAB 1VF5C 3H32A 5KAFH 4D6TD 2KIKA 2KNCA 3IN6A 1NTMK 1S9KD 2P7JA 2B88A 1R8EA 2IYOA 1SQPD 3CI9A 3CX5H 2UWJE 2KUBA 2W6AA 1AQTA 1SQQD 1L4AB 2L91A 4H44D 2YKQA 3HE5A 1M1JC 2C0XA 1BE3D 3L71D 3D6YA 1JM0A 1S2EA 1IFPA 1EDLA 3PP5A 2NRGA 3BCCE 2QJKC 2OGUA 1EDJA 1FZCC 4JYBA 3MD0A 5BVZA 5TISH 2IYPA 5KJ7C 2WPRA 4PV1C 1N7SD 1Y47A 2OYOA 2KOGA 3RK2B 2N1TC 3HE4B 5GTHH 2QIWA 5AW8B 3F89A 2KI7B 2K9JA 2YO3A 2WT7B 1YJWP 1T2KD 4HH2A 2BASA 4WB4A 2XNDH 3EQ2A 3GF3A 5AW7B 4M3LA 1S72P 1GZLA 1JMBA 3NMDA 3E1RA 1HTLC 3A2AA 2BCCD 4D6TG 1U57A 2OYHB 3ITKA 1KILB 4D6TE 4L73A 1LP1A 2O1JA 3TDKA 3CCLP 1KB9I 1N7LA 3H32B 2ZAEB 5GTIH 3BRVB 1P84I 3KZIE 1SQQG 2E74B 4H0LC 1HF9A 1Q81Q 2QA4P 1Y8AA 1L0LD 1SQQE 3L71G 2WVRA 3SSUA 3CXHH 1NU1K 1OVVA 2L5GB 3H1HD 1NGMB 4YTPC 3L71E 1OMIA 3G6EP 1UIXA 3O6QB 4N6JA 2NZ2A 1OZHA 1VQKP 1FOSF 1Q2NA 2HFED 3B8EB 4XE5B 3RK2C 5CCHA 3PJSK 4GODA 1DEEG 3L75D 3RGUA 2FYUG 1XTCC 2B9BA 2YMYA 3SFEC 5B66E 2PP6A 3BCCJ 1YHQP 5CJ0A 3CCMP 1N8RQ 1JY3O 1BCCD 3L74G 3AE6C 1NTZD 1KILC 1EC5A 5B5EE 3KYQA 1EZVI 5TJHA 2YO2A 2K9JB 3H1JD 2HG5D 3U59A 2QVAA 2PAJA 2K1AA 2Q6QA 2E74C 1G2CB 1T6AA 3NFQA 1SQPK 1AQ5A 3WUUA 3SFDC 1N73C 2SPZA 2KSJA 3CPWO 3T97A 2IBZI 2C0WA 4GT1A 3H25A 2O01J 4LGDE 1RF1B 4PD4I 1KD1Q 3P7KA 1EQ7A 1SFCA 1JCDA 3HD7C 4WY4C 1FS0E 3V2PA 2YKOA 1OVRA 2JDIH 4H13D 4D6TJ 2WTYA 1EZVG 3H1IG 1FZFA 1D7MA 4UB8H 4ZKPA 2QJPB 3H1IE 1MKMA 1NJIQ 1LT9A 3CCUP 3A5TA 2FKWB 2IFMA 3L75G 1SQQJ 3M06A 3CX5I 1LWUC 1OX3A 3S1KA 4YXDC 2Y9YA 4JYCA 3L75E 2IBZG 5L8RJ 5AVYB 2AEFA 3TF5A 3L71J 2WWWA 3RL0D 5CCGC 1YIJP 1BCCG 3WUVA 3A0BH 3L70D 2FFDC 2ZJSE 3TNUA 1BCCE 1KC8Q 1KYOH 2QG4A 1IFJA 3VMZA 1IFDA 1NTZE 3H1JG 1KQGB 3CLQA 5CCHD 2E5YA 5KAFE 3H1JE 3Q1MA 4HJGH 3RK3D 1RF1C 3VMYA 2I1JA 3CX5E 1L0LK 1SQVK 2O3JA 1VQ7P 1KB9H 1WT6A 5H2FH 1RF0C 2N9YB 4Y28J 4OH8B 4I7ZB 1P84H 1KV4A 5KJ7A 2QJPC 1GK4A 2C9NY 1X8YA 3KXDA 2P10A 1URQD 3IF4A 3AE5C 3V2NA 4XA4A 3MIWA 3FX0A 4IFDK 1VQNP 1L2PA 1L0ND 4BWNA 1SQBD 3PRJA 2QJYC 4OGQC 1JUNA 1PV3A 3GLMA 4DZOA 5TISE 3E1IA 1R5LA 2H7HA 3Q3DA 1GL2D 3CMEP 4IL6X 1YJNP 3GHGB 4C7RA 2YNYA 3BATA 2YIUB 1SFCD 1PIXA 5GTHE 3GG2A 4I2LC 3W68A 3AE1C 1PFIA 1N7SA 3CXHI 5AW0B 1YTZT 3L70G 1NTZK 4A7PA 3MZWB 3H1IJ 4W7ZA 3L70E 3HUSA 2Q3EA 3II6A 4NPEA 3M0DC 3G71P 2E76C 4OVNF 3USSA 1LTBC 4RJTA 1HJ0A 1CI6A 3TNUB 3HTKA 1IZNB 3L75J 3AECC 2ZT9B 4EDFA 4WVZA 1VQPP 1NO4A 5AVRB 3C1LA 3PLNA 2YMKA 1OW7A 2E75D 2J5UA 4KHXA 2WSFJ 1FJPA 4I7ZC 2ZXXA 3OAKA 1BCCJ 1MFTA 3L4FA 1EXIA 1YQ3C 1RE4C 1NTZJ 1KFMA 2YXRB 2WSEJ 2CPSA 1K9MQ 2RN0A 1LJ2A 2GM4A 1PPJD 2H89C 3ABVC 1M57D 1PGQA 3MUDC 3H1JJ 1OVUA 2R3CA 2W90A 4PD4H 4L74A 1CSBA 4GIFA 1SQBG 1OFCX 1NOHA 3F5HA 3CCEP 1L0NE 1LGHB 5APXA 1SQBE 3GHGC 2CPBA 4H44B 3V6IA 2QRXA 3VN0A 3A0HE 1SS1A 2MJZA 1JY3P 3MP7B 2G8YA 1S1CX 2NPSC 2W6JH 1ZXGA 4PJ0H 2M3EA 4TT3H 5KJ7D 1QGKB 1MZ9A 2Z5IA 5KLIB 1Y9BA 1IJDB 2JEEA 3PHLA 1G1IA 1FE6A 2D2CD 3PTZA 2AXTH 1N7SB 1JY2P 2QM8A 3FXDA 4ASWA 1RHZB 3EFFK 3CWBG 1VQLP 2OTLP 2LKMA 3HUSB 1NTKG 1ZLLA 3HD7A 4DJGA 1Q90D 3CWBE 5APQA 1NTKE 3I55P 5AW9B 1GU5A 3WUTA 1AFOA 3HTKB 1KB9D 3L70J 5E79H 3B5NA 2WITA 2FYUD 1P84D 1LTJB 1Q7YQ 1GW3A 3AE3C 1PPJG 1KORA 1KYOI 1NKNA 3AE9C 1PPJE 4H0LD 1WMKA 1YYCA 3L74D 1L0NK 4JBZA 3WU2E 1SQBK 2FYNB 1YBKA 3VOPA 4UB8E 5AVTB 1FC2C 3VP9A 1SVFA 3QH9A 3U1CA 1ZV8A 1L4AC 1CW5A 5KLIC 3TYYA 1H89A 3FWNA 3IR9A 2KNCB 3MHVA 2JWDA 3A0BE 3LIEA 2KS1A 1L0NJ 2JP3A 1SQBJ 1M56D 2XNXA 3BRTB 3FGAD 3G9RA 2H8PD 2RH0A 3HE5B 4GKGA 1EZVD 4CPGA 3H1ID 3TK1A 1HVVA 1JEKA 4R4LA 3KPEA 3I5CA 2Q1KA 1AVYA 1RE3C 1LTJC 1FZEA 1JNMA 2WSSH 2OYIA 3CMAP 1GMJA 2QE7H 4JPZB 4GDOA 2R3SA 5EFWB 4I1LA 1X9VA 1KB9E 5CBNA 2ZYDA 2B87A 2IBZD 2FYUE 1P84E 5KLVD 1FDIA 1DEBA 3LIDA 4PD4D 1SQXG 2IX7C 3GW6A 4IFMA 2OYHC 1SQXE 3CWBJ 2Q7CA 3L74E 2KYVA 1S5LX 1KTMA 1NTKJ 3HD7D 4WY4D 1S4XA 1FZGA 4MN4C 1RQVA 1URQA 1X79B 2KSEA 3P8MC 2ZVNB 2P2UA 2W83C 4UB6H 3B5ND 5AW4B 5BU8B 3GF7A 3CCVP 1PP9D 1VDFA 4H13B 3CX5D 2H43A 1SQQK 2WPSA 2LXCB 1GL2A 1RY3A 4LLHA 4U3FG 2V4HA 5M1BA 1ZRTD 4ZNCA 3CD6P 5C39A 3KDPB 1LP1B 3KHUA 3LW5H 1IK7A 1GU4A 3M9HA 5KKZB 4C7NA 1ZP0C 3L37A 1VL2A 2KLVA 1OIPA 4RO0A 3RL0B 1EZVE 1FU1A 3JCUH 3SWYA 1KILE 4Y99B 4K3AA 2OQQA 2GA1A 5CJ4A 2FYUK 1EDIA 5AVXB 2MKVA 4IL6H 1JMMA 1FZBA 2E5TA 5KLVG 2OYIB 1BSHA 2ZYAA 3I56P 2IBZE 1NVOA 2K37A 2IDBA 1PZQA 1JCCA 5KLVE 5DJTB 3RK3B 2RKLA 2A45I 4PD4E 3FWLA 5AVZB 3CCSP 3RBZA 1OW8A
chains in the Genus database with same CATH topology
1NKZB 5BVZA 1CI6A 3M0AA 3TNUB 3HTKA 1JO5A 4W80A 3B5NB 1MFZA 2E42A 1N86A 5KJ7C 2WPRA 1NO4A 5AVRB 3O8ZA 2OARA 1MUUA 1N7SD 1M1JA 4KHXA 1FJPA 5AVSB 2WPQA 4DOJA 5APWA 2KOGA 3OAKA 4JF7A 1LWUB 3RK2B 2N1TC 3HE4B 3NTNA 1LTSC 3L4FA 5AW6B 5AW8B 1URQB 1RE4C 1KFMA 1VPCA 2CPSA 3M0DA 2YO3A 2WT7B 1KQLA 4W7YA 2HODA 1GD2E 1T2KD 1FZCA 2GM4A 5APTA 4HH2A 1OXZA 2BASA 3EQ2A 3HRNA 4WB4A 5AW7B 2FFDB 4M3LA 2O1KA 1GZLA 1IFIA 4EOTA 2R3CA 3NMDA 1IO4A 1HTLC 3C9IA 3VTPC 3A2AA 1CSBA 4GIFA 1GL2B 1JY2O 4AQRD 1SP4A 2OYHB 1JOCA 1QL2A 1NOHA 4ZKUA 1LGHB 1KILB 5APXA 4AYCA 3GHGC 5CCGD 2CPBA 2N1TA 2HLOA 2O1JA 1SFCB 3VN0A 5APSA 1T3UA 1N7LA 1RE4A 3H32B 3M9BA 2FYZA 2MJZA 1JY3P 3BRVB 4C46A 5CCHC 2NPSC 2XU6A 5KJ7D 3MUDA 1HH0A 3H6PA 3RK3C 1JY2N 1MZ9A 1LTGC 2W27A 5AW3B 5KLVK 1LT9B 1T8ZA 2Z5IA 1NU1K 2L5GB 1IJDB 2JEEA 2O01H 1KFNA 2WSCH 3B5NC 1G1IA 3GHGA 1JTHA 3SWFA 4N6JA 1HJBA 3VYIA 1SQXK 1N7SB 1H88A 1JY2P 1FOSF 2QM8A 1J1DB 2HFED 3B8EB 4XE5B 3RK2C 2HYNA 5CCHA 2LKMA 2W6BA 2WZ7A 3HUSB 2NPSA 1ZLLA 3HD7A 5APUA 1XTGB 5AW1B 1HUCA 1IK9A 5APQA 3MTUE 1XTCC 5AW9B 1GU5A 1HBWA 1GDTA 1AFOA 3HTKB 2YMYA 5AVQB 2Q9IA 2PP6A 3CL3D 1E5WA 1J1EB 3BASA 3NXSA 3B5NA 2WITA 5APVA 5CJ0A 1LTJB 1JY3O 1GW3A 1M1JB 2XV5A 3KQGA 1LTIC 3M9QA 3UIAA 1NKNA 3G3ZA 2E43A 3OA7A 1KILC 4I6MC 4N78D 2NPSD 1YYCA 3KYQA 1L0NK 1SQBK 5AW2B 1SFCC 4O9BA 2QM7A 2J58A 2YO2A 1Z56A 2R32A 2XKMA 3VOPA 5AVTB 2HODB 2HG5D 1FZCB 1WRGA 2Q3IA 2FXMA 2A45G 3U59A 2M3BA 2PAJA 3VP9A 1LTAC 1SVFA 3RL0C 1JY3N 2P67A 1G2CB 4HYTB 5APYA 3NFQA 1SQPK 1OWAA 4Y99C 1AQ5A 5AVVB 3U1CA 1LT9C 1ZV8A 3WMM0 1L4AC 2ZFCA 3M91A 5BU5A 1CW5A 3TYYA 1N73C 1A02J 2KSJA 2J59M 3T97A 1H89A 3BVHA 2C0WA 4GT1A 5CMZA 2YKPA 4LGDE 2N1TB 4C7NB 1RF1B 1KILA 2P1JA 3IR9A 1FZAA 3P7KA 2OYIC 2WSEH 2IPPA 1EQ7A 3V4QA 1SFCA 3VP8A 1JCDA 3N7NA 3HD7C 4WY4C 1J1DC 3LIEA 3V2PA 3V2RA 2XDJA 2YKOA 2KB7P 5AW5B 3BRTB 2XNXA 1IFNA 2WTYA 2R5DA 1FZFA 1T3JA 1HGVA 2Z4EA 4ZKPA 2H8PD 2Z5HA 2GUSA 2N1TD 1MV8A 1LT9A 3HE5B 4GKGA 1L4AA 1FDMA 2A45H 3TK1A 1N73A 1HVVA 1J2JB 3A5TA 3KPEA 3I5CA 2FKWB 2IFMA 1JTHB 1J1EC 1NWQA 4AUWA 3V2QA 1RE3C 1LTJC 3M06A 1FZEA 1LWUC 1JNMA 2HPCA 2OYIA 3L35A 4JYCA 5AVYB 4WY4A 1URQC 3MGNA 2IFNA 2POHA 2WWWA 2XZRA 3RL0D 4I1LA 1X9VA 5CCGC 1HGZA 2NPSB 1FOSE 1CI6B 4LC1A 2FFDC 2I1KA 5CHXA 5AVWB 3TNUA 1NAFA 1L4AD 1DEBA 3LIDA 1IFJA 2ZXEB 3VMZA 1M7LA 1IFDA 2IX7C 1GL2C 1W2EA 3P8CD 4N78E 4IFMA 2OYHC 2Q7CA 3A7OA 2KYVA 3CLQA 1RE3A 5CCHD 1LTJA 1CZQA 2N9BA 1LWUA 3R2PA 3HD7D 4WY4D 4B86A 3HE4A 1A02F 1FZGA 4IFFA 4N3YB 3RK3D 1URQA 1X79B 1GTWA 3V5BA 2GUVA 1RF1C 3VMYA 2I1JA 1ZN5A 5CCGA 3P8MC 2WT7A 2P2UA 1GW4A 2FFDA 3B5ND 5AW4B 5BU8B 1LTTC 1L0LK 1YTZI 1SQVK 1VDFA 1WT6A 1HWTC 4RESB 1RF0C 2WSFH 2H43A 1SQQK 1N2DC 2WPSA 4JYBA 1GL2A 1ZR4A 1NHLA 1RY3A 4OH8B 1G2CA 1NH4A 4LLHA 1FJKA 1IFMA 1GK6A 5KJ7A 2OYHA 1GK4A 2C9NY 3RK2D 3N4XA 3KDPB 2R5BA 1FAVA 2Q5UA 4WBAA 3LW5H 1X8YA 3U1AA 1URQD 1IC2A 1H8AA 2KP8A 1GU4A 3V2NA 4XA4A 3MIWA 3M9HA 3A3YB 1N7SC 3VMXA 1ZR2A 3EFGA 3OJAB 4IFDK 1DH3A 3H32A 4C7NA 1RF1A 1JUNA 1S9KE 3L37A 3TSIA 3HUSC 1NTMK 4DZOA 2KLVA 1S9KD 3E1IA 2H7HA 3RL0B 1FU1A 1QL1A 1GL2D 2P7JA 1RF0A 3SWYA 1T2KC 1NTKK 3CI9A 4Y99B 1KILD 1FBMA 2W6AA 3GHGB 4C7RA 5CJ4A 2YNYA 3BATA 1L4AB 2M8RA 2FYUK 3V4WA 1N73B 5AVUB 5AVXB 1SFCD 2C9LY 2YKQA 3HE5A 1M1JC 4EIJA 4I2LC 1PFIA 1G1JA 1N7SA 2VRSA 5AW0B 1YTZT 1JMMA 2C0XA 1FZBA 1NTZK 5KTBA 3IFMA 2HPCB 2OYIB 1KZUB 2JJLA 4W7ZA 3HD7B 4WY4B 1DX7A 3PP5A 3HUSA 1JCCA 3II6A 3RK3B 3M0DC 2A45I 3P32A 3L36A 1FZCC 5AVZB 1SLQA 3MD0A 1LTBC 3P8CE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 P;  1W2E A;  1FZA A;  3E1I A;  1FZB A;  3GHG A;  1JY3 N;  2OYI A;  2OYI C;  1RE4 C;  1JY2 O;  2OYH C;  1RF0 A;  2HPC B;  1LT9 A;  1N86 A;  2OYI B;  2OYH B;  2FFD A;  1RE3 A;  1JY2 P;  2A45 H;  1LTJ A;  2HOD A;  1N73 A;  3GHG C;  1FZC A;  1LWU A;  1JY2 N;  3H32 A;  3HUS A;  1RF1 A;  2Q9I A;  1M1J A;  1RF0 C;  2H43 A;  1LT9 C;  3GHG B;  1FZC B;  2FFD C;  1FZG A;  2HPC A;  2HLO A;  2FFD B;  1LT9 B;  2A45 I;  2XNX A;  1RE3 C;  1RF1 C;  1N73 C;  1LTJ C;  1N73 B;  1FZF A;  1FZE A;  1LWU C;  1T3U A;  2HOD B;  3BVH A;  1FZC C;  1LTJ B;  1LWU B;  1RE4 A;  1M1J C;  1JY3 O;  3H32 B;  3HUS B;  3HUS C;  2Z4E A;  1M1J B;  2A45 G;  2OYH A;  1RF1 B; 
#chains in the Genus database with same CATH topology
 1NKZ B;  1RH5 B;  3M0A A;  4W80 A;  1MFZ A;  2E42 A;  1N86 A;  2OAR A;  1MUU A;  1M1J A;  2LXB A;  1KN7 A;  5AVS B;  2PGD A;  2FYU J;  4L75 A;  4OGQ D;  1PP9 G;  2BEZ F;  2A06 D;  1QLE D;  1URQ B;  3QWO C;  1YI2 P;  4PJ0 E;  1QVG O;  1LNQ A;  1PP9 E;  1VPC A;  1SQX J;  4W7Y A;  1M8O B;  1PGP A;  1PL5 A;  2RMZ A;  1FZC A;  3L74 J;  1OXZ A;  2IZ0 A;  1DD4 A;  1ZRT E;  2O1K A;  3CXH D;  1IO4 A;  1GL2 B;  2AXT E;  2WMM A;  1BGY D;  2PRR A;  3T97 B;  1JOC A;  1QL2 A;  4ZKU A;  1H0T A;  2V7Q H;  4OWF A;  2N1T A;  1AV1 A;  2M5A A;  5B66 H;  1DIP A;  4YPC A;  1SFC B;  5APS A;  1T3U A;  1S3J A;  3M9B A;  2FYZ A;  2E76 D;  3K5B A;  4C46 A;  2Y0C A;  5CCH C;  5E79 E;  3RK3 C;  1JY2 N;  1LTG C;  5B5E H;  2W27 A;  4WWI A;  5KLV K;  1LT9 B;  1T8Z A;  2M0B A;  2WSC H;  3CC4 P;  2E75 B;  1USD A;  1NTM G;  1QVF O;  1NTM E;  2WZ7 A;  5APU A;  5AW1 B;  2ZVO B;  3E7K A;  3MTU E;  3L72 D;  2KZI A;  3CWB D;  2QEX P;  1NTK D;  2A06 G;  5AVQ B;  2Q9I A;  2R44 A;  3H1L G;  1E5W A;  1J1E B;  3BAS A;  3NXS A;  5KLV J;  1VF5 D;  2YXQ B;  2A06 E;  2LR2 A;  3H1L E;  2Y0E A;  3OW2 O;  1M1J B;  5GTI E;  2XV5 A;  3KQG A;  3PH0 A;  3M9Q A;  3G3Z A;  2E43 A;  2NPS D;  2FXO A;  5AW2 B;  1SFC C;  2QJK B;  3CXH E;  2QM7 A;  1BGY G;  1Z56 A;  4IOI H;  2XKM A;  1FZC B;  1WRG A;  2M3B A;  1BGY E;  2P67 A;  5APY A;  1OWA A;  3D71 A;  1PP9 J;  5AVV B;  1LT9 C;  2ZYG A;  3L73 D;  3WMM 0;  2YIU C;  5BU5 A;  1YIT P;  2P58 A;  1A02 J;  2J59 M;  1H0T B;  5CMZ A;  2YKP A;  4KT0 J;  2N1T B;  1KIL A;  1KQS O;  1FZA A;  2D2C B;  1K8A Q;  2WSE H;  2IPP A;  1E79 H;  3VP8 A;  1VQO P;  2W8Z A;  4RKU J;  2JWA A;  1YQ4 C;  4PV1 D;  1KYO D;  1T3J A;  2Z4E A;  3W67 A;  4BXL A;  2FBW C;  1AJY A;  2N1T D;  2ZT9 C;  4EI2 A;  2A45 H;  1N73 A;  2B89 A;  3TGU D;  1J1E C;  4AUW A;  3VMA A;  4NPD A;  3L72 G;  1RQU A;  3O6Q A;  2HPC A;  3Q5P A;  3L35 A;  5KAI H;  3L72 E;  4QMA A;  4WY4 A;  4UB6 E;  4BRY A;  3BCC G;  3JC2 2;  2XZR A;  2OTJ P;  1NU1 G;  1QEX A;  4H0L B;  3H1K D;  1FOS E;  3JSV C;  1CI6 B;  3AE7 C;  3AEG C;  1TU3 F;  1NU1 E;  2I1K A;  5CHX A;  5AVW B;  1NAF A;  1L4A D;  2JR8 A;  1U7M A;  4HB1 A;  1M7L A;  1NTM J;  1OW6 A;  1W2E A;  1W2B O;  2G3A A;  3P8C D;  4NPF X;  2QSI A;  1JB0 J;  1SQX D;  2PFX A;  2N9B A;  1LWU A;  4H44 C;  4B86 A;  4IFF A;  1K73 Q;  1GTW A;  3V5B A;  1ZN5 A;  5CCG A;  2D2C C;  3JCU E;  1S5L H;  3B4S A;  3H1L J;  3L73 G;  1GW4 A;  2FFD A;  1LTT C;  1EDK A;  1YTZ I;  3L73 E;  1HWT C;  2OTK E;  1K05 A;  1ZR4 A;  4IL6 E;  2WQY C;  1NHL A;  1G2C A;  1LT1 A;  3RK2 D;  3N4X A;  2R5B A;  4WBA A;  1ZW0 A;  1QX8 A;  1BGY J;  1IC2 A;  1H8A A;  2KP8 A;  1ZR2 A;  1N7S C;  3D70 A;  4U3F D;  1DH3 A;  2K88 A;  1RF1 A;  1ZME C;  1PGJ A;  1KYO E;  2CK3 H;  2HR3 A;  1S9K E;  1VQ8 P;  1SQP G;  3TSI A;  3HUS C;  3TGU G;  1SQP E;  1QL1 A;  1RF0 A;  2DW3 A;  1T2K C;  3CCJ P;  3TGU E;  2JKV A;  1NTK K;  1SQV D;  1KIL D;  4L76 A;  1BE3 G;  1FBM A;  3AE2 C;  2ITA A;  2M8R A;  3V4W A;  1N73 B;  3H1K G;  5AVU B;  2C9L Y;  1BE3 E;  4EIJ A;  3Q2Y A;  1G1J A;  3SWK A;  4KJM A;  2VRS A;  3H1K E;  5KTB A;  3IFM A;  2HPC B;  1KZU B;  2H88 C;  2JJL A;  2E74 D;  3HD7 B;  4WY4 B;  1DX7 A;  5H2F E;  4BRY B;  5K5G B;  2FYN C;  3P32 A;  3L36 A;  1X22 A;  1SLQ A;  3A0H H;  3P8C E;  1ZOY C;  1JO5 A;  3L72 J;  3B5N B;  1AA0 A;  4GOE A;  3O8Z A;  2WPQ A;  1NU1 J;  5APW A;  4DOJ A;  3AEE C;  4JF7 A;  1LWU B;  1M90 Q;  3NTN A;  1LTS C;  5AW6 B;  3LW5 J;  3M0D A;  1KQL A;  1GD2 E;  2HOD A;  2AEJ A;  5APT A;  2K3R A;  3HRN A;  2BCC G;  2FFD B;  3FXE A;  1IFI A;  4EOT A;  1USE A;  3C9I A;  2BCC E;  3VTP C;  1UII A;  5DJU B;  2I8D A;  3AE8 C;  4YXW H;  5CBO A;  1NAY A;  4U3F E;  1JY2 O;  4AQR D;  1SP4 A;  1VQ4 P;  3Q5R A;  2Y9Z A;  4JQ0 D;  4AYC A;  5CCG D;  3AE4 C;  4ASV A;  3L73 J;  2HLO A;  1RE4 A;  1L0L G;  1SQV G;  2KS1 B;  1Q86 Q;  1L0L E;  4Z1M H;  1SQV E;  3ZDM A;  3CCQ P;  4XFJ A;  3H1H G;  2XU6 A;  3MUD A;  1HH0 A;  3H6P A;  1KQF B;  4U7J A;  3H1H E;  5AW3 B;  3WU2 H;  1FDO A;  4DCK A;  2O01 H;  1KFN A;  3B5N C;  3GHG A;  1JTH A;  3SWF A;  1U7J A;  1HJB A;  2WPV B;  3VYI A;  1SQP J;  4ZMD A;  1SQX K;  1H88 A;  2KK7 A;  3TGU J;  1W5C E;  1J1D B;  3CCR P;  1X0T A;  2QJY B;  2FY8 A;  4OGQ B;  2HYN A;  2W6B A;  2B87 B;  2NPS A;  1NTM D;  1XTG B;  1BE3 J;  1IK9 A;  1HUC A;  4EYY Q;  2IZ1 A;  3IAO A;  3KZI H;  3H1K J;  3EWK A;  2KLU A;  1HBW A;  1GDT A;  4H13 C;  3CL3 D;  3Q5S A;  1NTZ G;  2BEQ D;  5APV A;  3G4S P;  4DT0 A;  2KZJ A;  3H1L D;  3AEA C;  1LTI C;  3UIA A;  4K35 A;  2KXP B;  3OA7 A;  5KKZ C;  4I6M C;  4N78 D;  4TLF A;  2V7Q J;  2FXP A;  1R5S A;  4O9B A;  2J58 A;  2R32 A;  1PGO A;  2HOD B;  2E76 B;  2Q3I A;  2FXM A;  1VQM P;  2A45 G;  1LTA C;  3RL0 C;  1DD3 A;  1JY3 N;  4HYT B;  2AXC A;  4Y99 C;  2ZFC A;  3M91 A;  1BSN A;  5KAI E;  3BVH A;  4C7N B;  2P1J A;  1KMI Z;  2WSC J;  2BCC J;  3AEF C;  2OYI C;  2Y0D A;  3V4Q A;  3N7N A;  4U3F J;  1BDC A;  1J1D C;  3V2R A;  2XDJ A;  2KB7 P;  5AW5 B;  1IFN A;  2R5D A;  1BDD A;  1HGV A;  3GMA A;  4GOF A;  2Z5H A;  2GUS A;  1EXJ A;  3RL0 g;  1MV8 A;  1L4A A;  4HKZ H;  3RBX A;  1FDM A;  1L0L J;  1SQV J;  1J2J B;  1JTH B;  3B71 A;  1NWQ A;  1VF5 B;  3C8V A;  3V2Q A;  1K04 A;  3H1H J;  1S5L E;  3AEB C;  1URQ C;  3MGN A;  2IFN A;  3S4R A;  4R4M A;  2POH A;  1M1K Q;  1HGZ A;  2NPS B;  4LC1 A;  2JO1 A;  3BCC D;  3D6Z A;  1NYH A;  1NU1 D;  2ZXE B;  3CC2 P;  3S9O A;  1GL2 C;  1VQ9 P;  4N78 E;  3AED C;  3A7O A;  1RE3 A;  1LTJ A;  1CZQ A;  3RK3 E;  3R2P A;  3HE4 A;  1A02 F;  4N3Y B;  1Q82 Q;  1VQ5 P;  2GUV A;  2WT7 A;  2O01 N;  1AVO A;  1VQ6 P;  2K9Y A;  2ZT9 D;  2AEM A;  4RES B;  2WSF H;  4PV1 B;  1N2D C;  1NH4 A;  1FJK A;  1IFM A;  1GK6 A;  2OYH A;  3CC7 P;  3R4Y A;  1L0N G;  2M5A B;  1YJ9 P;  1FAV A;  2Q5U A;  3U1A A;  2E75 C;  3A3Y B;  3VMX A;  3EFG A;  3OJA B;  1VF5 C;  3H32 A;  5KAF H;  4D6T D;  2KIK A;  2KNC A;  3IN6 A;  1NTM K;  1S9K D;  2P7J A;  2B88 A;  1R8E A;  2IYO A;  1SQP D;  3CI9 A;  3CX5 H;  2UWJ E;  2KUB A;  2W6A A;  1AQT A;  1SQQ D;  1L4A B;  2L91 A;  4H44 D;  2YKQ A;  3HE5 A;  1M1J C;  2C0X A;  1BE3 D;  3L71 D;  3D6Y A;  1JM0 A;  1S2E A;  1IFP A;  1EDL A;  3PP5 A;  2NRG A;  3BCC E;  2QJK C;  2OGU A;  1EDJ A;  1FZC C;  4JYB A;  3MD0 A;  5BVZ A;  5TIS H;  2IYP A;  5KJ7 C;  2WPR A;  4PV1 C;  1N7S D;  1Y47 A;  2OYO A;  2KOG A;  3RK2 B;  2N1T C;  3HE4 B;  5GTH H;  2QIW A;  5AW8 B;  3F89 A;  2KI7 B;  2K9J A;  2YO3 A;  2WT7 B;  1YJW P;  1T2K D;  4HH2 A;  2BAS A;  4WB4 A;  2XND H;  3EQ2 A;  3GF3 A;  5AW7 B;  4M3L A;  1S72 P;  1GZL A;  1JMB A;  3NMD A;  3E1R A;  1HTL C;  3A2A A;  2BCC D;  4D6T G;  1U57 A;  2OYH B;  3ITK A;  1KIL B;  4D6T E;  4L73 A;  1LP1 A;  2O1J A;  3TDK A;  3CCL P;  1KB9 I;  1N7L A;  3H32 B;  2ZAE B;  5GTI H;  3BRV B;  1P84 I;  3KZI E;  1SQQ G;  2E74 B;  4H0L C;  1HF9 A;  1Q81 Q;  2QA4 P;  1Y8A A;  1L0L D;  1SQQ E;  3L71 G;  2WVR A;  3SSU A;  3CXH H;  1NU1 K;  1OVV A;  2L5G B;  3H1H D;  1NGM B;  4YTP C;  3L71 E;  1OMI A;  3G6E P;  1UIX A;  3O6Q B;  4N6J A;  2NZ2 A;  1OZH A;  1VQK P;  1FOS F;  1Q2N A;  2HFE D;  3B8E B;  4XE5 B;  3RK2 C;  5CCH A;  3PJS K;  4GOD A;  1DEE G;  3L75 D;  3RGU A;  2FYU G;  1XTC C;  2B9B A;  2YMY A;  3SFE C;  5B66 E;  2PP6 A;  3BCC J;  1YHQ P;  5CJ0 A;  3CCM P;  1N8R Q;  1JY3 O;  1BCC D;  3L74 G;  3AE6 C;  1NTZ D;  1KIL C;  1EC5 A;  5B5E E;  3KYQ A;  1EZV I;  5TJH A;  2YO2 A;  2K9J B;  3H1J D;  2HG5 D;  3U59 A;  2QVA A;  2PAJ A;  2K1A A;  2Q6Q A;  2E74 C;  1G2C B;  1T6A A;  3NFQ A;  1SQP K;  1AQ5 A;  3WUU A;  3SFD C;  1N73 C;  2SPZ A;  2KSJ A;  3CPW O;  3T97 A;  2IBZ I;  2C0W A;  4GT1 A;  3H25 A;  2O01 J;  4LGD E;  1RF1 B;  4PD4 I;  1KD1 Q;  3P7K A;  1EQ7 A;  1SFC A;  1JCD A;  3HD7 C;  4WY4 C;  1FS0 E;  3V2P A;  2YKO A;  1OVR A;  2JDI H;  4H13 D;  4D6T J;  2WTY A;  1EZV G;  3H1I G;  1FZF A;  1D7M A;  4UB8 H;  4ZKP A;  2QJP B;  3H1I E;  1MKM A;  1NJI Q;  1LT9 A;  3CCU P;  3A5T A;  2FKW B;  2IFM A;  3L75 G;  1SQQ J;  3M06 A;  3CX5 I;  1LWU C;  1OX3 A;  3S1K A;  4YXD C;  2Y9Y A;  4JYC A;  3L75 E;  2IBZ G;  5L8R J;  5AVY B;  2AEF A;  3TF5 A;  3L71 J;  2WWW A;  3RL0 D;  5CCG C;  1YIJ P;  1BCC G;  3WUV A;  3A0B H;  3L70 D;  2FFD C;  2ZJS E;  3TNU A;  1BCC E;  1KC8 Q;  1KYO H;  2QG4 A;  1IFJ A;  3VMZ A;  1IFD A;  1NTZ E;  3H1J G;  1KQG B;  3CLQ A;  5CCH D;  2E5Y A;  5KAF E;  3H1J E;  3Q1M A;  4HJG H;  3RK3 D;  1RF1 C;  3VMY A;  2I1J A;  3CX5 E;  1L0L K;  1SQV K;  2O3J A;  1VQ7 P;  1KB9 H;  1WT6 A;  5H2F H;  1RF0 C;  2N9Y B;  4Y28 J;  4OH8 B;  4I7Z B;  1P84 H;  1KV4 A;  5KJ7 A;  2QJP C;  1GK4 A;  2C9N Y;  1X8Y A;  3KXD A;  2P10 A;  1URQ D;  3IF4 A;  3AE5 C;  3V2N A;  4XA4 A;  3MIW A;  3FX0 A;  4IFD K;  1VQN P;  1L2P A;  1L0N D;  4BWN A;  1SQB D;  3PRJ A;  2QJY C;  4OGQ C;  1JUN A;  1PV3 A;  3GLM A;  4DZO A;  5TIS E;  3E1I A;  1R5L A;  2H7H A;  3Q3D A;  1GL2 D;  3CME P;  4IL6 X;  1YJN P;  3GHG B;  4C7R A;  2YNY A;  3BAT A;  2YIU B;  1SFC D;  1PIX A;  5GTH E;  3GG2 A;  4I2L C;  3W68 A;  3AE1 C;  1PFI A;  1N7S A;  3CXH I;  5AW0 B;  1YTZ T;  3L70 G;  1NTZ K;  4A7P A;  3MZW B;  3H1I J;  4W7Z A;  3L70 E;  3HUS A;  2Q3E A;  3II6 A;  4NPE A;  3M0D C;  3G71 P;  2E76 C;  4OVN F;  3USS A;  1LTB C;  4RJT A;  1HJ0 A;  1CI6 A;  3TNU B;  3HTK A;  1IZN B;  3L75 J;  3AEC C;  2ZT9 B;  4EDF A;  4WVZ A;  1VQP P;  1NO4 A;  5AVR B;  3C1L A;  3PLN A;  2YMK A;  1OW7 A;  2E75 D;  2J5U A;  4KHX A;  2WSF J;  1FJP A;  4I7Z C;  2ZXX A;  3OAK A;  1BCC J;  1MFT A;  3L4F A;  1EXI A;  1YQ3 C;  1RE4 C;  1NTZ J;  1KFM A;  2YXR B;  2WSE J;  2CPS A;  1K9M Q;  2RN0 A;  1LJ2 A;  2GM4 A;  1PPJ D;  2H89 C;  3ABV C;  1M57 D;  1PGQ A;  3MUD C;  3H1J J;  1OVU A;  2R3C A;  2W90 A;  4PD4 H;  4L74 A;  1CSB A;  4GIF A;  1SQB G;  1OFC X;  1NOH A;  3F5H A;  3CCE P;  1L0N E;  1LGH B;  5APX A;  1SQB E;  3GHG C;  2CPB A;  4H44 B;  3V6I A;  2QRX A;  3VN0 A;  3A0H E;  1SS1 A;  2MJZ A;  1JY3 P;  3MP7 B;  2G8Y A;  1S1C X;  2NPS C;  2W6J H;  1ZXG A;  4PJ0 H;  2M3E A;  4TT3 H;  5KJ7 D;  1QGK B;  1MZ9 A;  2Z5I A;  5KLI B;  1Y9B A;  1IJD B;  2JEE A;  3PHL A;  1G1I A;  1FE6 A;  2D2C D;  3PTZ A;  2AXT H;  1N7S B;  1JY2 P;  2QM8 A;  3FXD A;  4ASW A;  1RHZ B;  3EFF K;  3CWB G;  1VQL P;  2OTL P;  2LKM A;  3HUS B;  1NTK G;  1ZLL A;  3HD7 A;  4DJG A;  1Q90 D;  3CWB E;  5APQ A;  1NTK E;  3I55 P;  5AW9 B;  1GU5 A;  3WUT A;  1AFO A;  3HTK B;  1KB9 D;  3L70 J;  5E79 H;  3B5N A;  2WIT A;  2FYU D;  1P84 D;  1LTJ B;  1Q7Y Q;  1GW3 A;  3AE3 C;  1PPJ G;  1KOR A;  1KYO I;  1NKN A;  3AE9 C;  1PPJ E;  4H0L D;  1WMK A;  1YYC A;  3L74 D;  1L0N K;  4JBZ A;  3WU2 E;  1SQB K;  2FYN B;  1YBK A;  3VOP A;  4UB8 E;  5AVT B;  1FC2 C;  3VP9 A;  1SVF A;  3QH9 A;  3U1C A;  1ZV8 A;  1L4A C;  1CW5 A;  5KLI C;  3TYY A;  1H89 A;  3FWN A;  3IR9 A;  2KNC B;  3MHV A;  2JWD A;  3A0B E;  3LIE A;  2KS1 A;  1L0N J;  2JP3 A;  1SQB J;  1M56 D;  2XNX A;  3BRT B;  3FGA D;  3G9R A;  2H8P D;  2RH0 A;  3HE5 B;  4GKG A;  1EZV D;  4CPG A;  3H1I D;  3TK1 A;  1HVV A;  1JEK A;  4R4L A;  3KPE A;  3I5C A;  2Q1K A;  1AVY A;  1RE3 C;  1LTJ C;  1FZE A;  1JNM A;  2WSS H;  2OYI A;  3CMA P;  1GMJ A;  2QE7 H;  4JPZ B;  4GDO A;  2R3S A;  5EFW B;  4I1L A;  1X9V A;  1KB9 E;  5CBN A;  2ZYD A;  2B87 A;  2IBZ D;  2FYU E;  1P84 E;  5KLV D;  1FDI A;  1DEB A;  3LID A;  4PD4 D;  1SQX G;  2IX7 C;  3GW6 A;  4IFM A;  2OYH C;  1SQX E;  3CWB J;  2Q7C A;  3L74 E;  2KYV A;  1S5L X;  1KTM A;  1NTK J;  3HD7 D;  4WY4 D;  1S4X A;  1FZG A;  4MN4 C;  1RQV A;  1URQ A;  1X79 B;  2KSE A;  3P8M C;  2ZVN B;  2P2U A;  2W83 C;  4UB6 H;  3B5N D;  5AW4 B;  5BU8 B;  3GF7 A;  3CCV P;  1PP9 D;  1VDF A;  4H13 B;  3CX5 D;  2H43 A;  1SQQ K;  2WPS A;  2LXC B;  1GL2 A;  1RY3 A;  4LLH A;  4U3F G;  2V4H A;  5M1B A;  1ZRT D;  4ZNC A;  3CD6 P;  5C39 A;  3KDP B;  1LP1 B;  3KHU A;  3LW5 H;  1IK7 A;  1GU4 A;  3M9H A;  5KKZ B;  4C7N A;  1ZP0 C;  3L37 A;  1VL2 A;  2KLV A;  1OIP A;  4RO0 A;  3RL0 B;  1EZV E;  1FU1 A;  3JCU H;  3SWY A;  1KIL E;  4Y99 B;  4K3A A;  2OQQ A;  2GA1 A;  5CJ4 A;  2FYU K;  1EDI A;  5AVX B;  2MKV A;  4IL6 H;  1JMM A;  1FZB A;  2E5T A;  5KLV G;  2OYI B;  1BSH A;  2ZYA A;  3I56 P;  2IBZ E;  1NVO A;  2K37 A;  2IDB A;  1PZQ A;  1JCC A;  5KLV E;  5DJT B;  3RK3 B;  2RKL A;  2A45 I;  4PD4 E;  3FWL A;  5AVZ B;  3CCS P;  3RBZ A;  1OW8 A; 
#chains in the Genus database with same CATH homology
 1NKZ B;  5BVZ A;  1CI6 A;  3M0A A;  3TNU B;  3HTK A;  1JO5 A;  4W80 A;  3B5N B;  1MFZ A;  2E42 A;  1N86 A;  5KJ7 C;  2WPR A;  1NO4 A;  5AVR B;  3O8Z A;  2OAR A;  1MUU A;  1N7S D;  1M1J A;  4KHX A;  1FJP A;  5AVS B;  2WPQ A;  4DOJ A;  5APW A;  2KOG A;  3OAK A;  4JF7 A;  1LWU B;  3RK2 B;  2N1T C;  3HE4 B;  3NTN A;  1LTS C;  3L4F A;  5AW6 B;  5AW8 B;  1URQ B;  1RE4 C;  1KFM A;  1VPC A;  2CPS A;  3M0D A;  2YO3 A;  2WT7 B;  1KQL A;  4W7Y A;  2HOD A;  1GD2 E;  1T2K D;  1FZC A;  2GM4 A;  5APT A;  4HH2 A;  1OXZ A;  2BAS A;  3EQ2 A;  3HRN A;  4WB4 A;  5AW7 B;  2FFD B;  4M3L A;  2O1K A;  1GZL A;  1IFI A;  4EOT A;  2R3C A;  3NMD A;  1IO4 A;  1HTL C;  3C9I A;  3VTP C;  3A2A A;  1CSB A;  4GIF A;  1GL2 B;  1JY2 O;  4AQR D;  1SP4 A;  2OYH B;  1JOC A;  1QL2 A;  1NOH A;  4ZKU A;  1LGH B;  1KIL B;  5APX A;  4AYC A;  3GHG C;  5CCG D;  2CPB A;  2N1T A;  2HLO A;  2O1J A;  1SFC B;  3VN0 A;  5APS A;  1T3U A;  1N7L A;  1RE4 A;  3H32 B;  3M9B A;  2FYZ A;  2MJZ A;  1JY3 P;  3BRV B;  4C46 A;  5CCH C;  2NPS C;  2XU6 A;  5KJ7 D;  3MUD A;  1HH0 A;  3H6P A;  3RK3 C;  1JY2 N;  1MZ9 A;  1LTG C;  2W27 A;  5AW3 B;  5KLV K;  1LT9 B;  1T8Z A;  2Z5I A;  1NU1 K;  2L5G B;  1IJD B;  2JEE A;  2O01 H;  1KFN A;  2WSC H;  3B5N C;  1G1I A;  3GHG A;  1JTH A;  3SWF A;  4N6J A;  1HJB A;  3VYI A;  1SQX K;  1N7S B;  1H88 A;  1JY2 P;  1FOS F;  2QM8 A;  1J1D B;  2HFE D;  3B8E B;  4XE5 B;  3RK2 C;  2HYN A;  5CCH A;  2LKM A;  2W6B A;  2WZ7 A;  3HUS B;  2NPS A;  1ZLL A;  3HD7 A;  5APU A;  1XTG B;  5AW1 B;  1HUC A;  1IK9 A;  5APQ A;  3MTU E;  1XTC C;  5AW9 B;  1GU5 A;  1HBW A;  1GDT A;  1AFO A;  3HTK B;  2YMY A;  5AVQ B;  2Q9I A;  2PP6 A;  3CL3 D;  1E5W A;  1J1E B;  3BAS A;  3NXS A;  3B5N A;  2WIT A;  5APV A;  5CJ0 A;  1LTJ B;  1JY3 O;  1GW3 A;  1M1J B;  2XV5 A;  3KQG A;  1LTI C;  3M9Q A;  3UIA A;  1NKN A;  3G3Z A;  2E43 A;  3OA7 A;  1KIL C;  4I6M C;  4N78 D;  2NPS D;  1YYC A;  3KYQ A;  1L0N K;  1SQB K;  5AW2 B;  1SFC C;  4O9B A;  2QM7 A;  2J58 A;  2YO2 A;  1Z56 A;  2R32 A;  2XKM A;  3VOP A;  5AVT B;  2HOD B;  2HG5 D;  1FZC B;  1WRG A;  2Q3I A;  2FXM A;  2A45 G;  3U59 A;  2M3B A;  2PAJ A;  3VP9 A;  1LTA C;  1SVF A;  3RL0 C;  1JY3 N;  2P67 A;  1G2C B;  4HYT B;  5APY A;  3NFQ A;  1SQP K;  1OWA A;  4Y99 C;  1AQ5 A;  5AVV B;  3U1C A;  1LT9 C;  1ZV8 A;  3WMM 0;  1L4A C;  2ZFC A;  3M91 A;  5BU5 A;  1CW5 A;  3TYY A;  1N73 C;  1A02 J;  2KSJ A;  2J59 M;  3T97 A;  1H89 A;  3BVH A;  2C0W A;  4GT1 A;  5CMZ A;  2YKP A;  4LGD E;  2N1T B;  4C7N B;  1RF1 B;  1KIL A;  2P1J A;  3IR9 A;  1FZA A;  3P7K A;  2OYI C;  2WSE H;  2IPP A;  1EQ7 A;  3V4Q A;  1SFC A;  3VP8 A;  1JCD A;  3N7N A;  3HD7 C;  4WY4 C;  1J1D C;  3LIE A;  3V2P A;  3V2R A;  2XDJ A;  2YKO A;  2KB7 P;  5AW5 B;  3BRT B;  2XNX A;  1IFN A;  2WTY A;  2R5D A;  1FZF A;  1T3J A;  1HGV A;  2Z4E A;  4ZKP A;  2H8P D;  2Z5H A;  2GUS A;  2N1T D;  1MV8 A;  1LT9 A;  3HE5 B;  4GKG A;  1L4A A;  1FDM A;  2A45 H;  3TK1 A;  1N73 A;  1HVV A;  1J2J B;  3A5T A;  3KPE A;  3I5C A;  2FKW B;  2IFM A;  1JTH B;  1J1E C;  1NWQ A;  4AUW A;  3V2Q A;  1RE3 C;  1LTJ C;  3M06 A;  1FZE A;  1LWU C;  1JNM A;  2HPC A;  2OYI A;  3L35 A;  4JYC A;  5AVY B;  4WY4 A;  1URQ C;  3MGN A;  2IFN A;  2POH A;  2WWW A;  2XZR A;  3RL0 D;  4I1L A;  1X9V A;  5CCG C;  1HGZ A;  2NPS B;  1FOS E;  1CI6 B;  4LC1 A;  2FFD C;  2I1K A;  5CHX A;  5AVW B;  3TNU A;  1NAF A;  1L4A D;  1DEB A;  3LID A;  1IFJ A;  2ZXE B;  3VMZ A;  1M7L A;  1IFD A;  2IX7 C;  1GL2 C;  1W2E A;  3P8C D;  4N78 E;  4IFM A;  2OYH C;  2Q7C A;  3A7O A;  2KYV A;  3CLQ A;  1RE3 A;  5CCH D;  1LTJ A;  1CZQ A;  2N9B A;  1LWU A;  3R2P A;  3HD7 D;  4WY4 D;  4B86 A;  3HE4 A;  1A02 F;  1FZG A;  4IFF A;  4N3Y B;  3RK3 D;  1URQ A;  1X79 B;  1GTW A;  3V5B A;  2GUV A;  1RF1 C;  3VMY A;  2I1J A;  1ZN5 A;  5CCG A;  3P8M C;  2WT7 A;  2P2U A;  1GW4 A;  2FFD A;  3B5N D;  5AW4 B;  5BU8 B;  1LTT C;  1L0L K;  1YTZ I;  1SQV K;  1VDF A;  1WT6 A;  1HWT C;  4RES B;  1RF0 C;  2WSF H;  2H43 A;  1SQQ K;  1N2D C;  2WPS A;  4JYB A;  1GL2 A;  1ZR4 A;  1NHL A;  1RY3 A;  4OH8 B;  1G2C A;  1NH4 A;  4LLH A;  1FJK A;  1IFM A;  1GK6 A;  5KJ7 A;  2OYH A;  1GK4 A;  2C9N Y;  3RK2 D;  3N4X A;  3KDP B;  2R5B A;  1FAV A;  2Q5U A;  4WBA A;  3LW5 H;  1X8Y A;  3U1A A;  1URQ D;  1IC2 A;  1H8A A;  2KP8 A;  1GU4 A;  3V2N A;  4XA4 A;  3MIW A;  3M9H A;  3A3Y B;  1N7S C;  3VMX A;  1ZR2 A;  3EFG A;  3OJA B;  4IFD K;  1DH3 A;  3H32 A;  4C7N A;  1RF1 A;  1JUN A;  1S9K E;  3L37 A;  3TSI A;  3HUS C;  1NTM K;  4DZO A;  2KLV A;  1S9K D;  3E1I A;  2H7H A;  3RL0 B;  1FU1 A;  1QL1 A;  1GL2 D;  2P7J A;  1RF0 A;  3SWY A;  1T2K C;  1NTK K;  3CI9 A;  4Y99 B;  1KIL D;  1FBM A;  2W6A A;  3GHG B;  4C7R A;  5CJ4 A;  2YNY A;  3BAT A;  1L4A B;  2M8R A;  2FYU K;  3V4W A;  1N73 B;  5AVU B;  5AVX B;  1SFC D;  2C9L Y;  2YKQ A;  3HE5 A;  1M1J C;  4EIJ A;  4I2L C;  1PFI A;  1G1J A;  1N7S A;  2VRS A;  5AW0 B;  1YTZ T;  1JMM A;  2C0X A;  1FZB A;  1NTZ K;  5KTB A;  3IFM A;  2HPC B;  2OYI B;  1KZU B;  2JJL A;  4W7Z A;  3HD7 B;  4WY4 B;  1DX7 A;  3PP5 A;  3HUS A;  1JCC A;  3II6 A;  3RK3 B;  3M0D C;  2A45 I;  3P32 A;  3L36 A;  1FZC C;  5AVZ B;  1SLQ A;  3MD0 A;  1LTB C;  3P8C E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...