2HLOA

Crystal structure of fragment d-dimer from human fibrin complexed with gly-hydroxypro-arg-pro-amide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrin alpha chain
total genus 22
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hloA00
3GHGB 3HUSC 1FZCA 2OYHB 1M1JC 1RE4C 2HODA 1FZGA 2HPCB 1LWUC 1LWUA 3GHGC 1RF1A 1RF1C 1N73A 1JY2N 1M1JA 3E1IA 2Z4EA 1RE3A 1FZEA 1N73C 2OYHA 1FZCB 1JY2P 2HLOA 3GHGA 3BVHA 2FFDC 2OYIB 1LTJB 1JY3P 2XNXA 1W2EA 3HUSA 1FZCC 1FZAA 1LT9A 1RF0C 2A45G 3H32A 2OYIC 1FZBA 2FFDA 1N86A 2A45I 1T3UA 3HUSB 2OYHC 2A45H 1LT9B 1RE3C 1RE4A 1LTJC 1LTJA 2OYIA 2Q9IA 1JY3N 1JY3O 1LT9C 1RF0A 1LWUB 2FFDB 1RF1B 1FZFA 1JY2O 3H32B 2HODB 1N73B 1M1JB 2H43A 2HPCA
chains in the Genus database with same CATH superfamily
1KYOH 1N7SB 2QSIA 5DJUB 1YJNP 5KKZB 4NPEA 1KYOI 1T6AA 2WZ7A 1VF5D 2O1KA 3T97A 1QVGO 2XV5A 2NRGA 3P32A 5CCHD 1FOSE 1JMMA 1Z56A 1VQ5P 4DJGA 1KILC 1YQ3C 1R8EA 3A0BH 3HE4B 1VQLP 1YQ4C 2PAJA 4C7RA 5CJ4A 2YXRB 5B5EE 1KYOE 1MUUA 2SPZA 1S1CX 1OW6A 1RF0C 2W27A 1OMIA 1PP9G 1IC2A 2QJPB 1LJ2A 3B8EB 3MHVA 5AW7B 5APSA 4AQRD 4C46A 2RN0A 5B66H 1JM0A 1XTCC 1ZRTD 1VQPP 4XFJA 1JB0J 2QJKC 3IFMA 3V2QA 3NXSA 3II6A 1RH5B 3CCQP 2FYNC 1PV3A 2OARA 1YJ9P 2M5AB 2ZT9B 1PPJD 1EDIA 1SFCC 1N7LA 1USDA 1N7SD 2ZT9D 4JYBA 3B5NB 3U59A 2OYHB 1FE6A 4K3AA 4PV1B 4ZNCA 3GHGC 2QJKB 5KAFH 1Q7YQ 2O3JA 3A0HH 2Z4EA 3CXHE 1FU1A 3TGUE 1FC2C 3H1IJ 3H1ID 4NPDA 4O9BA 1D7MA 3P8CE 4JBZA 2JWDA 4RKUJ 5AVXB 1QL2A 1MV8A 4EIJA 1URQC 1JOCA 3RL0B 3I55P 3PHLA 5KLVJ 1HGVA 4WY4A 5AVQB 3V4WA 1VQNP 1FZCA 3SFEC 1JY3N 1SQXG 2K9JA 1HJ0A 3PLNA 3TGUJ 4YXDC 4ZKUA 3TGUD 1VF5B 1JY2O 2YMKA 3AEAC 3RK3D 2Q3EA 2R32A 1PL5A 4D6TJ 2WSEH 4D6TD 3CCVP 1YITP 1N8RQ 1FDOA 3CCRP 1AVYA 1LTIC 2C0XA 3AE2C 1RY3A 5CCHA 1Y8AA 2M3EA 2AXTE 3B5NC 3KXDA 2E76C 3V4QA 1LWUA 1NTZG 1S3JA 1PP9D 1PP9J 5AVUB 5APVA 2WPRA 2JJLA 4WBAA 3O8ZA 1S9KE 3D6YA 1KN7A 1NHLA 1UIXA 2BASA 2XU6A 1FZCB 4JF7A 1G1JA 1WRGA 2AEMA 1NH4A 3B4SA 4L75A 1SQPG 1E79H 3CX5H 2JDIH 3L35A 1NTME 4UB8H 1BSNA 5APQA 3H1JG 4U3FE 1BCCJ 1BCCD 5KLVE 1NKNA 3GMAA 2KSEA 2IZ1A 1R5SA 2Y0DA 3AEGC 3H1LG 3JC22 4BXLA 5GTIH 1YJWP 2Q9IA 1JY3O 3TSIA 4EYYQ 3GLMA 2JR8A 2WITA 1SQBG 1GL2B 3MUDA 5GTHH 4BRYA 3L72E 2H8PD 4H0LD 1JCCA 1LTAC 1JCDA 2E74C 2Q1KA 3AE9C 4HKZH 1NTZD 1M1JC 1NTZJ 1RE4C 3JCUH 4IFMA 3CPWO 3CC4P 1JTHB 5AW6B 5BU5A 2N1TC 1ZN5A 1L4AD 5CCGA 2B87B 2IBZE 4PJ0H 1GL2A 4GOEA 5L8RJ 4BRYB 4W80A 1VQ7P 3CCEP 2D2CC 1MFZA 3VP8A 1A02J 2RKLA 3CX5I 3I5CA 2E75B 3E7KA 3CCLP 1NAYA 3Q1MA 1PIXA 5KLIC 2BCCD 2BCCJ 3P7KA 1T2KD 1GU4A 1JUNA 1EDKA 1LT9A 3HRNA 1J1DB 4ASWA 2LR2A 2OYIC 2KS1B 3TNUA 2A45I 3FX0A 4L74A 4OVNF 1S2EA 5AW8B 2E42A 1RE4A 1FDMA 1LTJA 2P58A 1UIIA 3AE8C 1N7SC 1SQBJ 1SQBD 2KP8A 2WWWA 3CWBG 1RF1B 1IK7A 1YIJP 1X22A 3BRVB 3L70G 4YXWH 1LP1B 1KILD 2YKQA 3H1KG 1J1DC 4PD4D 5CCGD 4IOIH 4GOFA 1OW7A 2B87A 1LGHB 1NU1G 2MJZA 5KJ7D 3S4RA 1T2KC 4CPGA 1SQPE 2E74B 1X79B 1OVRA 1EXIA 1GK4A 1SQVG 1SQPJ 1BGYG 1SQPD 4Y99B 3EWKA 3QWOC 1H89A 4DOJA 5KAFE 2Q3IA 2V4HA 2FYNB 1K05A 2OYHA 2N9YB 2R3CA 1GD2E 3GF3A 1AFOA 2ZT9C 3SWKA 2YO3A 1CW5A 1PGJA 3CX5E 4UB8E 1YI2P 1SQBE 2WSCH 2CK3H 2FYUK 3CCUP 2IBZI 2I1KA 2N9BA 4PV1C 1IFIA 1MZ9A 3R4YA 1MKMA 4HB1A 4YPCA 1LTBC 5AVWB 3WU2E 2QEXP 1RE3C 1OWAA 3CWBD 3CWBJ 2OYIA 1S9KD 1LT9C 1SFCB 1BGYE 3L70J 3L70D 1L2PA 1IZNB 2WSFH 1SQXE 2KYVA 3H32B 4UB6E 4YTPC 1HGZA 1M56D 2IYOA 2QVAA 2ZVOB 3CI9A 3CXHI 1PGPA 1QLED 3GHGB 3L75G 3HE4A 3HUSC 3RGUA 2BEQD 2KZIA 2IBZD 3WMM0 2DW3A 3LW5H 1JNMA 3S9OA 3A2AA 3FXEA 2N1TA 3L72D 3L72J 2ZYDA 3TDKA 1AQ5A 2K9YA 1URQA 1JY2N 1LP1A 1M1JA 1NTZE 3E1IA 3T97B 1VF5C 1CSBA 2Y9YA 1K04A 1AQTA 1KC8Q 4OH8B 4I7ZC 3CMAP 1LTJB 3MGNA 3MUDC 2WT7A 1BCCE 4EOTA 1VQ8P 4A7PA 3M0DA 1KMIZ 1NTMJ 1NTMD 3EFGA 1IO4A 1SFCD 2FFDA 1HVVA 2W6BA 1NU1J 1NU1D 5KLVD 2P7JA 3KDPB 1J1EB 1GDTA 4I7ZB 3MP7B 4B86A 3IAOA 2P1JA 2WT7B 3CC2P 1URQD 2AEJA 1FS0E 4H44B 1W5CE 1GTWA 1FDIA 1VPCA 3G71P 3L72G 3M0AA 1PP9E 3RL0D 1LWUC 2O01N 1IK9A 3EQ2A 3SFDC 2HR3A 2VRSA 3B5NA 2OTKE 1FBMA 2FYZA 1PPJG 3ABVC 2I8DA 4OGQB 1SQQK 3VTPC 1VQMP 3CC7P 5B66E 1BDCA 5H2FH 3V6IA 5K5GB 3RK2C 1IFPA 5KAIE 3G9RA 3L71E 2P2UA 3L71J 2IZ0A 3L71D 3BCCG 3L75E 4WY4C 2WPVB 3W68A 2YO2A 2ZJSE 3RBXA 3L75J 1RQUA 3L75D 3P8CD 1PGQA 3G4SP 2OTJP 2XDJA 1G1IA 2IFMA 1LT9B 2Z5IA 3R2PA 2OQQA 3U1CA 1SVFA 3CXHD 4OWFA 3VYIA 1SS1A 2RH0A 3H1LE 3VMXA 2KOGA 2WVRA 2AXCA 2KI7B 5E79H 1N73B 1M1JB 2B9BA 4IL6X 5AVZB 1Y9BA 2JWAA 4BWNA 4JPZB 1YTZI 1Q81Q 4RJTA 3AEDC 5CMZA 3RK2D 4AYCA 4TLFA 1QVFO 3FXDA 1CZQA 1PPJE 5AW2B 1NTMG 3NMDA 1QL1A 4U7JA 5APUA 3TF5A 4IFFA 1GK6A 1N73A 1VQ4P 2OYOA 4IFDK 1QX8A 1U57A 2FXMA 3BATA 2NPSD 4PD4H 5AW0B 4KJMA 1N73C 3BVHA 2FFDC 1PGOA 4N3YB 3LW5J 3PP5A 3CMEP 1PFIA 2E76B 2IPPA 3VN0A 3M0DC 1FZAA 1NO4A 3M9BA 5APYA 1DD3A 5AVVB 2PRRA 4C7NA 1KYOD 1VQKP 1WT6A 2A45H 1H0TB 3H1IG 2KXPB 1ZLLA 4JYCA 2KSJA 3WU2H 1RF0A 3GG2A 2Q5UA 3AE1C 1BE3E 3OW2O 1NYHA 2HODB 3WUTA 2IX7C 1IFDA 1KILB 1LT1A 2B89A 4W7YA 5DJTB 2MKVA 3AECC 4I1LA 4H13B 3RL0C 3V2NA 1KD1Q 1NWQA 1EZVI 2NPSB 3CXHH 1OVUA 2WPQA 3BCCE 1LTGC 4PD4I 1Y47A 4H0LC 2Y0CA 5AW1B 3RBZA 3F89A 1J2JB 1RE3A 4I2LC 2QM7A 3HD7A 2R44A 2P67A 4EDFA 4C7NB 4XA4A 1JY3P 1H88A 3CWBE 3NFQA 2LXCB 2POHA 1AJYA 4LC1A 3A5TA 3H32A 3AE5C 1VQ6P 2QE7H 1NU1E 1CI6B 1QGKB 2K3RA 1N86A 3LIEA 2D2CB 4GODA 2CPBA 2W8ZA 2OYHC 4Y28J 1M8OB 2WPSA 3H1HJ 3H1HD 3LIDA 1T3JA 4RESB 1DX7A 1KZUB 1WMKA 1ZW0A 1FZFA 1EDJA 1KQFB 1TU3F 1M57D 2QRXA 2Q7CA 5AVRB 3Q5PA 1S5LE 1Q82Q 1ZV8A 2WMMA 3H1JD 1DD4A 3H1JJ 4KT0J 2J59M 2ZXEB 2HG5D 3L37A 1FZGA 2FXPA 1KFMA 3V5BA 1NKZB 1N7SA 3L4FA 2CPSA 3SWYA 3Q2YA 2M5AA 1YHQP 3L36A 2J5UA 2K88A 5BU8B 1L0LG 1KB9I 4WY4D 3D6ZA 2H7HA 2LKMA 3MIWA 5KAIH 2WQYC 1N2DC 2WSSH 1NTKK 1SQVD 1SQVJ 1BGYJ 1BGYD 2OGUA 3HUSA 3A3YB 3K5BA 1OVVA 3L70E 4Y99C 3Q5SA 2J58A 5GTHE 3Q5RA 1L0NK 1LTSC 1BDDA 2QIWA 1KFNA 1OFCX 2KLUA 2YKPA 5AVYB 1YBKA 1SQVE 1AV1A 4H44C 1EQ7A 2KZJA 4MN4C 2E43A 3S1KA 3AE3C 3N4XA 2IFNA 2ZXXA 3CX5D 2B88A 1NOHA 2G8YA 4HYTB 5CCGC 1URQB 1ZOYC 4H13C 2Q6QA 2FKWB 3FGAD 3PTZA 2N1TB 3MD0A 4JQ0D 2WSFJ 5E79E 1S72P 1HWTC 4ZKPA 4PJ0E 4XE5B 2ZYAA 3HTKB 1FOSF 1L0LE 2A06D 2E75C 1GW4A 4H13D 4QMAA 1BE3D 1BE3J 1FZEA 3H1KD 1JTHA 3H1KJ 5KLIB 2Y9ZA 1ZMEC 4TT3H 2QJYB 2O01J 2K37A 2OYIB 4WB4A 1OW8A 1HH0A 1VL2A 2I1JA 1GZLA 1AVOA 1W2EA 2KB7P 2LXBA 2HYNA 2W90A 2Y0EA 4IL6H 5TJHA 4U3FJ 4U3FD 2JKVA 4K35A 2WSEJ 1NTKG 1FZBA 2FBWC 4N78D 1X0TA 2L91A 1VDFA 1T3UA 1FAVA 2GUSA 2KIKA 5APTA 5AW3B 3M9QA 3H25A 2M0BA 1LTJC 3C9IA 1SQPK 2FFDB 3I56P 2YIUB 2YMYA 2H88C 1S5LX 2NPSA 3F5HA 3M91A 3CCSP 5CCHC 2QG4A 4H44D 4IL6E 2YNYA 5H2FE 3VOPA 1M7LA 3B71A 1K8AQ 3L71G 3RK3C 3BCCJ 3BCCD 2HODA 4D6TE 3C1LA 3ITKA 5KJ7A 1L4AB 1SQBK 3FWLA 2FYUE 3IR9A 2PFXA 2W6JH 1GL2C 2AXTH 1L0NJ 1L0ND 3BASA 2P10A 1JEKA 1IFNA 1IFMA 3RK3E 1OZHA 3W67A 2C9NY 3PRJA 1KV4A 2QJYC 5EFWB 3CCMP 3C8VA 5CBNA 2GA1A 2ITAA 2RMZA 3H1HG 1FZCC 1G2CB 4AUWA 2PGDA 1IFJA 1BCCG 4R4MA 1EZVD 3KZIE 1VQ9P 1YYCA 3IN6A 3AE6C 3V2RA 5BVZA 2L5GB 3G3ZA 1SQXK 2K1AA 2E5TA 1ZP0C 3H1IE 3Q3DA 1NVOA 3L73E 2FYUJ 2FYUD 1K9MQ 1KQSO 1HJBA 1YTZT 2HFED 5CBOA 1BE3G 1IJDB 5APXA 5KLVK 5CJ0A 3B5ND 4OGQD 1KTMA 2FY8A 1BSHA 5AW5B 4N6JA 2KNCB 3VMZA 2IBZG 1VQOP 1RF1A 1RF1C 3OJAB 1A02F 3USSA 3CCJP 1CI6A 3L73J 3AEEC 2C0WA 3E1RA 3L73D 2HLOA 4KHXA 1EXJA 5AVTB 1RHZB 2KS1A 3A7OA 3H1LD 1KORA 3H1LJ 2M3BA 3KYQA 3P8MC 1ZRTE 2XNXA 2XNDH 3O6QB 3TYYA 3TK1A 1KB9H 3AE7C 2R5BA 2QM8A 1MFTA 1USEA 3AE4C 1EZVE 2XZRA 3HUSB 1E5WA 3SSUA 4NPFX 3ZDMA 2FYUG 2ZAEB 2YIUC 3L74G 4GIFA 1K73Q 3TNUB 1L0LD 1L0LJ 1OIPA 4L76A 2WSCJ 4GT1A 1L0NE 2JO1A 1NTMK 4DCKA 1ZR4A 1U7JA 4LGDE 3VP9A 1L0NG 1SLQA 2WTYA 2H43A 2GUVA 2HPCA 3SWFA 1EDLA 3MZWB 1X8YA 3GW6A 1DH3A 1PZQA 3CL3D 3A0HE 3A0BE 4PV1D 5KJ7C 3RK2B 2C9LY 3TGUG 1AA0A 1JY2P 1NAFA 3GHGA 2H89C 1OX3A 2KUBA 2JEEA 3H6PA 3JCUE 1NTZK 2O1JA 4WWIA 4WY4B 2NPSC 5KTBA 1H8AA 1JO5A 5CHXA 2ZVNB 1L0LK 2W83C 2XKMA 4N78E 1SFCA 2V7QH 3CLQA 2E75D 1SQQD 1SQQJ 4WVZA 2AEFA 1EC5A 1P84D 3PH0A 3VMAA 3OAKA 4ASVA 3O6QA 2R3SA 1Q90D 1LWUB 2Z5HA 3AEBC 3H1KE 2JP3A 2A06E 4OGQC 4DZOA 3L73G 2NZ2A 2N1TD 4L73A 1T8ZA 4EI2A 1RQVA 1HBWA 1GW3A 1P84I 5APWA 3H1JE 4U3FG 2IYPA 5KLVG 1J1EC 1ZXGA 4UB6H 3BRTB 1FJPA 5KKZC 3HE5A 2HPCB 1KILE 4PD4E 2BCCG 1Q2NA 5M1BA 2QA4P 1LTTC 2ZYGA 2PP6A 1KILA 4W7ZA 3GF7A 1S4XA 3G6EP 3EFFK 1DIPA 1HF9A 1W2BO 1SQXJ 1SQXD 3KQGA 3N7NA 4LLHA 1OXZA 4DT0A 1DEBA 1KB9E 3L74D 2E76D 3L74J 3M9HA 5TISE 1H0TA 5AW9B 1ZR2A 1SQQG 4Z1MH 5B5EH 2R5DA 1U7MA 1KQLA 1L4AC 3JSVC 2K9JB 4HH2A 5AW4B 3KPEA 3WUUA 1HUCA 2IDBA 2KK7A 1G2CA 3NTNA 4M3LA 3KZIH 3M06A 1Q86Q 1DEEG 3HD7D 1NGMB 3D70A 1SP4A 3U1AA 3WUVA 1P84H 2G3AA 2GM4A 2OTLP 4HJGH 5C39A 3RK3B 5TISH 2KNCA 2M8RA 1GL2D 2V7QJ 2ZFCA 1QEXA 3HTKA 4H0LB 1X9VA 4R4LA 1EZVG 1FJKA 2FXOA 1NTKD 1NTKJ 1SQVK 4ZMDA 1NJIQ 1NTKE 4D6TG 2E5YA 3VMYA 1XTGB 3QH9A 1NU1K 3HE5B 2W6AA 3AEFC 2E74D 3IF4A 1M1KQ 2KLVA 1SQQE 3PJSK 2QJPC 3UIAA 1GMJA 1KQGB 1GU5A 2A06G 1R5LA 1P84E 2A45G 3KHUA 3H1HE 3HD7B 3OA7A 1S5LH 5GTIE 2D2CD 4RO0A 3V2PA 3FWNA 2O01H 3D71A 2BCCE 3MTUE 4I6MC 4GKGA 2UWJE 1JMBA 1LNQA 3CD6P 2BEZF 1KB9D 2YXQB 3L74E 1HTLC 4GDOA 1M90Q 1L4AA 5AVSB 3RL0g 2YKOA 3HD7C
chains in the Genus database with same CATH topology
1N7SB 2WZ7A 3T97A 2O1KA 2XV5A 1FOSE 5CCHD 1JMMA 1Z56A 1KILC 3HE4B 2PAJA 4C7RA 5CJ4A 2W27A 1MUUA 5CHXA 1RF0C 4AQRD 1IC2A 3B8EB 5AW7B 4C46A 5APSA 1XTCC 3IFMA 3V2QA 3NXSA 3II6A 2OARA 1SFCC 3U59A 1N7LA 1N7SD 4JYBA 2OYHB 3B5NB 3GHGC 2Z4EA 1FU1A 4O9BA 3P8CE 5AVXB 1QL2A 1MV8A 4EIJA 1URQC 1JOCA 1HGVA 4WY4A 5AVQB 3V4WA 4ZKUA 1JY3N 1JY2O 3RK3D 2R32A 2WSEH 5CCHA 1LTIC 2C0XA 1RY3A 3B5NC 3V4QA 1LWUA 5AVUB 5APVA 2WPRA 2JJLA 4WBAA 3O8ZA 1S9KE 1NHLA 2BASA 2XU6A 1FZCB 4JF7A 1G1JA 1WRGA 1NH4A 3L35A 5APQA 1NKNA 2Q9IA 1JY3O 3TSIA 3MUDA 2WITA 1GL2B 2H8PD 1JCCA 1LTAC 1JCDA 1FZCA 4IFMA 1M1JC 1RE4C 1JTHB 5AW6B 5BU5A 2N1TC 1ZN5A 1L4AD 5CCGA 1GL2A 4W80A 1MFZA 3VP8A 1A02J 3I5CA 1T2KD 1JUNA 3P7KA 1GU4A 1LT9A 3HRNA 1J1DB 2OYIC 3TNUA 2A45I 5AW8B 2E42A 1RE4A 1LTJA 1N7SC 2WWWA 2KP8A 1RF1B 3BRVB 2YKQA 1KILD 5CCGD 1J1DC 1GU5A 5KJ7D 2MJZA 1LGHB 1T2KC 1X79B 1GK4A 4Y99B 1H89A 4DOJA 2Q3IA 1GD2E 2OYHA 2R3CA 1AFOA 1CW5A 2YO3A 2WSCH 2FYUK 2I1KA 2N9BA 1IFIA 1MZ9A 1LTBC 5AVWB 1RE3C 1OWAA 2OYIA 1S9KD 1LT9C 1SFCB 2WSFH 2KYVA 3H32B 1HGZA 3CI9A 3GHGB 3HE4A 3HUSC 3LW5H 1JNMA 3A2AA 2N1TA 1AQ5A 1URQA 1JY2N 1M1JA 3E1IA 1CSBA 4OH8B 1LTJB 3MGNA 2WT7A 4EOTA 3M0DA 3EFGA 1IO4A 1SFCD 2FFDA 1HVVA 2W6BA 2P7JA 3KDPB 1J1EB 1GDTA 4B86A 2P1JA 1URQD 1GTWA 1VPCA 3M0AA 3RL0D 1LWUC 1IK9A 3EQ2A 2VRSA 3B5NA 1FBMA 2FYZA 3VTPC 1SQQK 3RK2C 2P2UA 4WY4C 2YO2A 3P8CD 2XDJA 1G1IA 2IFMA 1LT9B 2Z5IA 3R2PA 3U1CA 2WT7B 1SVFA 3VMXA 3VYIA 2KOGA 1N73B 1M1JB 5AVZB 1YTZI 5CMZA 3RK2D 4AYCA 1CZQA 5AW2B 3NMDA 1QL1A 5APUA 1N73A 4IFFA 1GK6A 2FXMA 1N73C 5AW0B 3BATA 2NPSD 1FDMA 3BVHA 2FFDC 4N3YB 3PP5A 1PFIA 2IPPA 3VN0A 3M0DC 1FZAA 1NO4A 3M9BA 5APYA 5AVVB 4C7NA 1WT6A 2A45H 4JYCA 1ZLLA 2KSJA 1RF0A 2Q5UA 2HODB 2IX7C 1KILB 1IFDA 4W7YA 4I1LA 3RL0C 3V2NA 1NWQA 2NPSB 2WPQA 1LTGC 5AW1B 1J2JB 1RE3A 4I2LC 2QM7A 3HD7A 2P67A 4C7NB 4XA4A 1JY3P 1H88A 3NFQA 2POHA 4LC1A 3A5TA 3H32A 1CI6B 1N86A 3LIEA 2CPBA 2OYHC 2WPSA 3LIDA 1T3JA 4RESB 1DX7A 1KZUB 1FZFA 2Q7CA 5AVRB 1ZV8A 2J59M 2ZXEB 2HG5D 3L37A 1FZGA 1KFMA 3V5BA 1NKZB 1N7SA 3L4FA 2CPSA 3SWYA 3L36A 5BU8B 4WY4D 2H7HA 2LKMA 3MIWA 1N2DC 1NTKK 3HUSA 3A3YB 4Y99C 2J58A 1L0NK 1LTSC 1KFNA 2YKPA 5AVYB 1EQ7A 2E43A 3N4XA 5CCGC 2IFNA 1NOHA 4HYTB 1URQB 2FKWB 2N1TB 3MD0A 1HWTC 4ZKPA 4XE5B 3HTKB 1FOSF 1GW4A 1FZEA 1JTHA 2OYIB 4WB4A 2I1JA 1HH0A 3P32A 1GZLA 1W2EA 2KB7P 2HYNA 4IFDK 4N78D 1FZBA 5AVSB 1VDFA 1FAVA 1T3UA 2GUSA 5APTA 5AW3B 3M9QA 3C9IA 1LTJC 1SQPK 2FFDB 2YMYA 2NPSA 3M91A 5CCHC 2YNYA 3VOPA 1M7LA 3RK3C 2HODA 5KJ7A 1L4AB 1SQBK 3IR9A 1GL2C 3BASA 1IFNA 1IFMA 2C9NY 1FZCC 4AUWA 1G2CB 1IFJA 1YYCA 3V2RA 5BVZA 2L5GB 3G3ZA 1SQXK 1HJBA 1YTZT 2HFED 1IJDB 5APXA 5KLVK 5CJ0A 3B5ND 5AW5B 4N6JA 3VMZA 1RF1C 1RF1A 3OJAB 1A02F 1CI6A 4KHXA 2C0WA 2HLOA 5AVTB 3A7OA 3KYQA 3WMM0 2M3BA 3P8MC 2XNXA 3TYYA 3TK1A 2R5BA 2QM8A 2XZRA 3HUSB 1E5WA 4GIFA 3TNUB 1ZR4A 4GT1A 1NTMK 4LGDE 3VP9A 1SLQA 2WTYA 2H43A 2GUVA 2HPCA 3SWFA 1X8YA 1DH3A 3CL3D 5KJ7C 3RK2B 2C9LY 1JY2P 1NAFA 3GHGA 3H6PA 3RL0B 2JEEA 5KTBA 1NTZK 2O1JA 4WY4B 1H8AA 2NPSC 1JO5A 1L0LK 2XKMA 4N78E 1SFCA 3CLQA 3OAKA 2Z5HA 1LWUB 4DZOA 2N1TD 1T8ZA 1HBWA 1GW3A 5APWA 1J1EC 3BRTB 1FJPA 2HPCB 3HE5A 1LTTC 2PP6A 1KILA 4W7ZA 3KQGA 3N7NA 4LLHA 1OXZA 1DEBA 3M9HA 5AW9B 1ZR2A 2R5DA 1KQLA 1L4AC 4HH2A 5AW4B 3KPEA 1HUCA 4M3LA 1G2CA 3NTNA 3M06A 3HD7D 1SP4A 3U1AA 2GM4A 3RK3B 2M8RA 1GL2D 2ZFCA 3HTKA 1X9VA 1FJKA 1SQVK 3VMYA 1XTGB 1NU1K 3HE5B 2W6AA 2KLVA 3UIAA 3OA7A 2A45G 3HD7B 3V2PA 2O01H 3MTUE 4I6MC 4GKGA 1HTLC 1L4AA 2YKOA 3HD7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHG B;  3HUS C;  1FZC A;  2OYH B;  1M1J C;  1RE4 C;  2HOD A;  1FZG A;  2HPC B;  1LWU C;  1LWU A;  3GHG C;  1RF1 A;  1RF1 C;  1N73 A;  1JY2 N;  1M1J A;  3E1I A;  2Z4E A;  1RE3 A;  1FZE A;  1N73 C;  2OYH A;  1FZC B;  1JY2 P;  2HLO A;  3GHG A;  3BVH A;  2FFD C;  2OYI B;  1LTJ B;  1JY3 P;  2XNX A;  1W2E A;  3HUS A;  1FZC C;  1FZA A;  1LT9 A;  1RF0 C;  2A45 G;  3H32 A;  2OYI C;  1FZB A;  2FFD A;  1N86 A;  2A45 I;  1T3U A;  3HUS B;  2OYH C;  2A45 H;  1LT9 B;  1RE3 C;  1RE4 A;  1LTJ C;  1LTJ A;  2OYI A;  2Q9I A;  1JY3 N;  1JY3 O;  1LT9 C;  1RF0 A;  1LWU B;  2FFD B;  1RF1 B;  1FZF A;  1JY2 O;  3H32 B;  2HOD B;  1N73 B;  1M1J B;  2H43 A;  2HPC A; 
#chains in the Genus database with same CATH topology
 1KYO H;  1N7S B;  2QSI A;  5DJU B;  1YJN P;  5KKZ B;  4NPE A;  1KYO I;  1T6A A;  2WZ7 A;  1VF5 D;  2O1K A;  3T97 A;  1QVG O;  2XV5 A;  2NRG A;  3P32 A;  5CCH D;  1FOS E;  1JMM A;  1Z56 A;  1VQ5 P;  4DJG A;  1KIL C;  1YQ3 C;  1R8E A;  3A0B H;  3HE4 B;  1VQL P;  1YQ4 C;  2PAJ A;  4C7R A;  5CJ4 A;  2YXR B;  5B5E E;  1KYO E;  1MUU A;  2SPZ A;  1S1C X;  1OW6 A;  1RF0 C;  2W27 A;  1OMI A;  1PP9 G;  1IC2 A;  2QJP B;  1LJ2 A;  3B8E B;  3MHV A;  5AW7 B;  5APS A;  4AQR D;  4C46 A;  2RN0 A;  5B66 H;  1JM0 A;  1XTC C;  1ZRT D;  1VQP P;  4XFJ A;  1JB0 J;  2QJK C;  3IFM A;  3V2Q A;  3NXS A;  3II6 A;  1RH5 B;  3CCQ P;  2FYN C;  1PV3 A;  2OAR A;  1YJ9 P;  2M5A B;  2ZT9 B;  1PPJ D;  1EDI A;  1SFC C;  1N7L A;  1USD A;  1N7S D;  2ZT9 D;  4JYB A;  3B5N B;  3U59 A;  2OYH B;  1FE6 A;  4K3A A;  4PV1 B;  4ZNC A;  3GHG C;  2QJK B;  5KAF H;  1Q7Y Q;  2O3J A;  3A0H H;  2Z4E A;  3CXH E;  1FU1 A;  3TGU E;  1FC2 C;  3H1I J;  3H1I D;  4NPD A;  4O9B A;  1D7M A;  3P8C E;  4JBZ A;  2JWD A;  4RKU J;  5AVX B;  1QL2 A;  1MV8 A;  4EIJ A;  1URQ C;  1JOC A;  3RL0 B;  3I55 P;  3PHL A;  5KLV J;  1HGV A;  4WY4 A;  5AVQ B;  3V4W A;  1VQN P;  1FZC A;  3SFE C;  1JY3 N;  1SQX G;  2K9J A;  1HJ0 A;  3PLN A;  3TGU J;  4YXD C;  4ZKU A;  3TGU D;  1VF5 B;  1JY2 O;  2YMK A;  3AEA C;  3RK3 D;  2Q3E A;  2R32 A;  1PL5 A;  4D6T J;  2WSE H;  4D6T D;  3CCV P;  1YIT P;  1N8R Q;  1FDO A;  3CCR P;  1AVY A;  1LTI C;  2C0X A;  3AE2 C;  1RY3 A;  5CCH A;  1Y8A A;  2M3E A;  2AXT E;  3B5N C;  3KXD A;  2E76 C;  3V4Q A;  1LWU A;  1NTZ G;  1S3J A;  1PP9 D;  1PP9 J;  5AVU B;  5APV A;  2WPR A;  2JJL A;  4WBA A;  3O8Z A;  1S9K E;  3D6Y A;  1KN7 A;  1NHL A;  1UIX A;  2BAS A;  2XU6 A;  1FZC B;  4JF7 A;  1G1J A;  1WRG A;  2AEM A;  1NH4 A;  3B4S A;  4L75 A;  1SQP G;  1E79 H;  3CX5 H;  2JDI H;  3L35 A;  1NTM E;  4UB8 H;  1BSN A;  5APQ A;  3H1J G;  4U3F E;  1BCC J;  1BCC D;  5KLV E;  1NKN A;  3GMA A;  2KSE A;  2IZ1 A;  1R5S A;  2Y0D A;  3AEG C;  3H1L G;  3JC2 2;  4BXL A;  5GTI H;  1YJW P;  2Q9I A;  1JY3 O;  3TSI A;  4EYY Q;  3GLM A;  2JR8 A;  2WIT A;  1SQB G;  1GL2 B;  3MUD A;  5GTH H;  4BRY A;  3L72 E;  2H8P D;  4H0L D;  1JCC A;  1LTA C;  1JCD A;  2E74 C;  2Q1K A;  3AE9 C;  4HKZ H;  1NTZ D;  1M1J C;  1NTZ J;  1RE4 C;  3JCU H;  4IFM A;  3CPW O;  3CC4 P;  1JTH B;  5AW6 B;  5BU5 A;  2N1T C;  1ZN5 A;  1L4A D;  5CCG A;  2B87 B;  2IBZ E;  4PJ0 H;  1GL2 A;  4GOE A;  5L8R J;  4BRY B;  4W80 A;  1VQ7 P;  3CCE P;  2D2C C;  1MFZ A;  3VP8 A;  1A02 J;  2RKL A;  3CX5 I;  3I5C A;  2E75 B;  3E7K A;  3CCL P;  1NAY A;  3Q1M A;  1PIX A;  5KLI C;  2BCC D;  2BCC J;  3P7K A;  1T2K D;  1GU4 A;  1JUN A;  1EDK A;  1LT9 A;  3HRN A;  1J1D B;  4ASW A;  2LR2 A;  2OYI C;  2KS1 B;  3TNU A;  2A45 I;  3FX0 A;  4L74 A;  4OVN F;  1S2E A;  5AW8 B;  2E42 A;  1RE4 A;  1FDM A;  1LTJ A;  2P58 A;  1UII A;  3AE8 C;  1N7S C;  1SQB J;  1SQB D;  2KP8 A;  2WWW A;  3CWB G;  1RF1 B;  1IK7 A;  1YIJ P;  1X22 A;  3BRV B;  3L70 G;  4YXW H;  1LP1 B;  1KIL D;  2YKQ A;  3H1K G;  1J1D C;  4PD4 D;  5CCG D;  4IOI H;  4GOF A;  1OW7 A;  2B87 A;  1LGH B;  1NU1 G;  2MJZ A;  5KJ7 D;  3S4R A;  1T2K C;  4CPG A;  1SQP E;  2E74 B;  1X79 B;  1OVR A;  1EXI A;  1GK4 A;  1SQV G;  1SQP J;  1BGY G;  1SQP D;  4Y99 B;  3EWK A;  3QWO C;  1H89 A;  4DOJ A;  5KAF E;  2Q3I A;  2V4H A;  2FYN B;  1K05 A;  2OYH A;  2N9Y B;  2R3C A;  1GD2 E;  3GF3 A;  1AFO A;  2ZT9 C;  3SWK A;  2YO3 A;  1CW5 A;  1PGJ A;  3CX5 E;  4UB8 E;  1YI2 P;  1SQB E;  2WSC H;  2CK3 H;  2FYU K;  3CCU P;  2IBZ I;  2I1K A;  2N9B A;  4PV1 C;  1IFI A;  1MZ9 A;  3R4Y A;  1MKM A;  4HB1 A;  4YPC A;  1LTB C;  5AVW B;  3WU2 E;  2QEX P;  1RE3 C;  1OWA A;  3CWB D;  3CWB J;  2OYI A;  1S9K D;  1LT9 C;  1SFC B;  1BGY E;  3L70 J;  3L70 D;  1L2P A;  1IZN B;  2WSF H;  1SQX E;  2KYV A;  3H32 B;  4UB6 E;  4YTP C;  1HGZ A;  1M56 D;  2IYO A;  2QVA A;  2ZVO B;  3CI9 A;  3CXH I;  1PGP A;  1QLE D;  3GHG B;  3L75 G;  3HE4 A;  3HUS C;  3RGU A;  2BEQ D;  2KZI A;  2IBZ D;  3WMM 0;  2DW3 A;  3LW5 H;  1JNM A;  3S9O A;  3A2A A;  3FXE A;  2N1T A;  3L72 D;  3L72 J;  2ZYD A;  3TDK A;  1AQ5 A;  2K9Y A;  1URQ A;  1JY2 N;  1LP1 A;  1M1J A;  1NTZ E;  3E1I A;  3T97 B;  1VF5 C;  1CSB A;  2Y9Y A;  1K04 A;  1AQT A;  1KC8 Q;  4OH8 B;  4I7Z C;  3CMA P;  1LTJ B;  3MGN A;  3MUD C;  2WT7 A;  1BCC E;  4EOT A;  1VQ8 P;  4A7P A;  3M0D A;  1KMI Z;  1NTM J;  1NTM D;  3EFG A;  1IO4 A;  1SFC D;  2FFD A;  1HVV A;  2W6B A;  1NU1 J;  1NU1 D;  5KLV D;  2P7J A;  3KDP B;  1J1E B;  1GDT A;  4I7Z B;  3MP7 B;  4B86 A;  3IAO A;  2P1J A;  2WT7 B;  3CC2 P;  1URQ D;  2AEJ A;  1FS0 E;  4H44 B;  1W5C E;  1GTW A;  1FDI A;  1VPC A;  3G71 P;  3L72 G;  3M0A A;  1PP9 E;  3RL0 D;  1LWU C;  2O01 N;  1IK9 A;  3EQ2 A;  3SFD C;  2HR3 A;  2VRS A;  3B5N A;  2OTK E;  1FBM A;  2FYZ A;  1PPJ G;  3ABV C;  2I8D A;  4OGQ B;  1SQQ K;  3VTP C;  1VQM P;  3CC7 P;  5B66 E;  1BDC A;  5H2F H;  3V6I A;  5K5G B;  3RK2 C;  1IFP A;  5KAI E;  3G9R A;  3L71 E;  2P2U A;  3L71 J;  2IZ0 A;  3L71 D;  3BCC G;  3L75 E;  4WY4 C;  2WPV B;  3W68 A;  2YO2 A;  2ZJS E;  3RBX A;  3L75 J;  1RQU A;  3L75 D;  3P8C D;  1PGQ A;  3G4S P;  2OTJ P;  2XDJ A;  1G1I A;  2IFM A;  1LT9 B;  2Z5I A;  3R2P A;  2OQQ A;  3U1C A;  1SVF A;  3CXH D;  4OWF A;  3VYI A;  1SS1 A;  2RH0 A;  3H1L E;  3VMX A;  2KOG A;  2WVR A;  2AXC A;  2KI7 B;  5E79 H;  1N73 B;  1M1J B;  2B9B A;  4IL6 X;  5AVZ B;  1Y9B A;  2JWA A;  4BWN A;  4JPZ B;  1YTZ I;  1Q81 Q;  4RJT A;  3AED C;  5CMZ A;  3RK2 D;  4AYC A;  4TLF A;  1QVF O;  3FXD A;  1CZQ A;  1PPJ E;  5AW2 B;  1NTM G;  3NMD A;  1QL1 A;  4U7J A;  5APU A;  3TF5 A;  4IFF A;  1GK6 A;  1N73 A;  1VQ4 P;  2OYO A;  4IFD K;  1QX8 A;  1U57 A;  2FXM A;  3BAT A;  2NPS D;  4PD4 H;  5AW0 B;  4KJM A;  1N73 C;  3BVH A;  2FFD C;  1PGO A;  4N3Y B;  3LW5 J;  3PP5 A;  3CME P;  1PFI A;  2E76 B;  2IPP A;  3VN0 A;  3M0D C;  1FZA A;  1NO4 A;  3M9B A;  5APY A;  1DD3 A;  5AVV B;  2PRR A;  4C7N A;  1KYO D;  1VQK P;  1WT6 A;  2A45 H;  1H0T B;  3H1I G;  2KXP B;  1ZLL A;  4JYC A;  2KSJ A;  3WU2 H;  1RF0 A;  3GG2 A;  2Q5U A;  3AE1 C;  1BE3 E;  3OW2 O;  1NYH A;  2HOD B;  3WUT A;  2IX7 C;  1IFD A;  1KIL B;  1LT1 A;  2B89 A;  4W7Y A;  5DJT B;  2MKV A;  3AEC C;  4I1L A;  4H13 B;  3RL0 C;  3V2N A;  1KD1 Q;  1NWQ A;  1EZV I;  2NPS B;  3CXH H;  1OVU A;  2WPQ A;  3BCC E;  1LTG C;  4PD4 I;  1Y47 A;  4H0L C;  2Y0C A;  5AW1 B;  3RBZ A;  3F89 A;  1J2J B;  1RE3 A;  4I2L C;  2QM7 A;  3HD7 A;  2R44 A;  2P67 A;  4EDF A;  4C7N B;  4XA4 A;  1JY3 P;  1H88 A;  3CWB E;  3NFQ A;  2LXC B;  2POH A;  1AJY A;  4LC1 A;  3A5T A;  3H32 A;  3AE5 C;  1VQ6 P;  2QE7 H;  1NU1 E;  1CI6 B;  1QGK B;  2K3R A;  1N86 A;  3LIE A;  2D2C B;  4GOD A;  2CPB A;  2W8Z A;  2OYH C;  4Y28 J;  1M8O B;  2WPS A;  3H1H J;  3H1H D;  3LID A;  1T3J A;  4RES B;  1DX7 A;  1KZU B;  1WMK A;  1ZW0 A;  1FZF A;  1EDJ A;  1KQF B;  1TU3 F;  1M57 D;  2QRX A;  2Q7C A;  5AVR B;  3Q5P A;  1S5L E;  1Q82 Q;  1ZV8 A;  2WMM A;  3H1J D;  1DD4 A;  3H1J J;  4KT0 J;  2J59 M;  2ZXE B;  2HG5 D;  3L37 A;  1FZG A;  2FXP A;  1KFM A;  3V5B A;  1NKZ B;  1N7S A;  3L4F A;  2CPS A;  3SWY A;  3Q2Y A;  2M5A A;  1YHQ P;  3L36 A;  2J5U A;  2K88 A;  5BU8 B;  1L0L G;  1KB9 I;  4WY4 D;  3D6Z A;  2H7H A;  2LKM A;  3MIW A;  5KAI H;  2WQY C;  1N2D C;  2WSS H;  1NTK K;  1SQV D;  1SQV J;  1BGY J;  1BGY D;  2OGU A;  3HUS A;  3A3Y B;  3K5B A;  1OVV A;  3L70 E;  4Y99 C;  3Q5S A;  2J58 A;  5GTH E;  3Q5R A;  1L0N K;  1LTS C;  1BDD A;  2QIW A;  1KFN A;  1OFC X;  2KLU A;  2YKP A;  5AVY B;  1YBK A;  1SQV E;  1AV1 A;  4H44 C;  1EQ7 A;  2KZJ A;  4MN4 C;  2E43 A;  3S1K A;  3AE3 C;  3N4X A;  2IFN A;  2ZXX A;  3CX5 D;  2B88 A;  1NOH A;  2G8Y A;  4HYT B;  5CCG C;  1URQ B;  1ZOY C;  4H13 C;  2Q6Q A;  2FKW B;  3FGA D;  3PTZ A;  2N1T B;  3MD0 A;  4JQ0 D;  2WSF J;  5E79 E;  1S72 P;  1HWT C;  4ZKP A;  4PJ0 E;  4XE5 B;  2ZYA A;  3HTK B;  1FOS F;  1L0L E;  2A06 D;  2E75 C;  1GW4 A;  4H13 D;  4QMA A;  1BE3 D;  1BE3 J;  1FZE A;  3H1K D;  1JTH A;  3H1K J;  5KLI B;  2Y9Z A;  1ZME C;  4TT3 H;  2QJY B;  2O01 J;  2K37 A;  2OYI B;  4WB4 A;  1OW8 A;  1HH0 A;  1VL2 A;  2I1J A;  1GZL A;  1AVO A;  1W2E A;  2KB7 P;  2LXB A;  2HYN A;  2W90 A;  2Y0E A;  4IL6 H;  5TJH A;  4U3F J;  4U3F D;  2JKV A;  4K35 A;  2WSE J;  1NTK G;  1FZB A;  2FBW C;  4N78 D;  1X0T A;  2L91 A;  1VDF A;  1T3U A;  1FAV A;  2GUS A;  2KIK A;  5APT A;  5AW3 B;  3M9Q A;  3H25 A;  2M0B A;  1LTJ C;  3C9I A;  1SQP K;  2FFD B;  3I56 P;  2YIU B;  2YMY A;  2H88 C;  1S5L X;  2NPS A;  3F5H A;  3M91 A;  3CCS P;  5CCH C;  2QG4 A;  4H44 D;  4IL6 E;  2YNY A;  5H2F E;  3VOP A;  1M7L A;  3B71 A;  1K8A Q;  3L71 G;  3RK3 C;  3BCC J;  3BCC D;  2HOD A;  4D6T E;  3C1L A;  3ITK A;  5KJ7 A;  1L4A B;  1SQB K;  3FWL A;  2FYU E;  3IR9 A;  2PFX A;  2W6J H;  1GL2 C;  2AXT H;  1L0N J;  1L0N D;  3BAS A;  2P10 A;  1JEK A;  1IFN A;  1IFM A;  3RK3 E;  1OZH A;  3W67 A;  2C9N Y;  3PRJ A;  1KV4 A;  2QJY C;  5EFW B;  3CCM P;  3C8V A;  5CBN A;  2GA1 A;  2ITA A;  2RMZ A;  3H1H G;  1FZC C;  1G2C B;  4AUW A;  2PGD A;  1IFJ A;  1BCC G;  4R4M A;  1EZV D;  3KZI E;  1VQ9 P;  1YYC A;  3IN6 A;  3AE6 C;  3V2R A;  5BVZ A;  2L5G B;  3G3Z A;  1SQX K;  2K1A A;  2E5T A;  1ZP0 C;  3H1I E;  3Q3D A;  1NVO A;  3L73 E;  2FYU J;  2FYU D;  1K9M Q;  1KQS O;  1HJB A;  1YTZ T;  2HFE D;  5CBO A;  1BE3 G;  1IJD B;  5APX A;  5KLV K;  5CJ0 A;  3B5N D;  4OGQ D;  1KTM A;  2FY8 A;  1BSH A;  5AW5 B;  4N6J A;  2KNC B;  3VMZ A;  2IBZ G;  1VQO P;  1RF1 A;  1RF1 C;  3OJA B;  1A02 F;  3USS A;  3CCJ P;  1CI6 A;  3L73 J;  3AEE C;  2C0W A;  3E1R A;  3L73 D;  2HLO A;  4KHX A;  1EXJ A;  5AVT B;  1RHZ B;  2KS1 A;  3A7O A;  3H1L D;  1KOR A;  3H1L J;  2M3B A;  3KYQ A;  3P8M C;  1ZRT E;  2XNX A;  2XND H;  3O6Q B;  3TYY A;  3TK1 A;  1KB9 H;  3AE7 C;  2R5B A;  2QM8 A;  1MFT A;  1USE A;  3AE4 C;  1EZV E;  2XZR A;  3HUS B;  1E5W A;  3SSU A;  4NPF X;  3ZDM A;  2FYU G;  2ZAE B;  2YIU C;  3L74 G;  4GIF A;  1K73 Q;  3TNU B;  1L0L D;  1L0L J;  1OIP A;  4L76 A;  2WSC J;  4GT1 A;  1L0N E;  2JO1 A;  1NTM K;  4DCK A;  1ZR4 A;  1U7J A;  4LGD E;  3VP9 A;  1L0N G;  1SLQ A;  2WTY A;  2H43 A;  2GUV A;  2HPC A;  3SWF A;  1EDL A;  3MZW B;  1X8Y A;  3GW6 A;  1DH3 A;  1PZQ A;  3CL3 D;  3A0H E;  3A0B E;  4PV1 D;  5KJ7 C;  3RK2 B;  2C9L Y;  3TGU G;  1AA0 A;  1JY2 P;  1NAF A;  3GHG A;  2H89 C;  1OX3 A;  2KUB A;  2JEE A;  3H6P A;  3JCU E;  1NTZ K;  2O1J A;  4WWI A;  4WY4 B;  2NPS C;  5KTB A;  1H8A A;  1JO5 A;  5CHX A;  2ZVN B;  1L0L K;  2W83 C;  2XKM A;  4N78 E;  1SFC A;  2V7Q H;  3CLQ A;  2E75 D;  1SQQ D;  1SQQ J;  4WVZ A;  2AEF A;  1EC5 A;  1P84 D;  3PH0 A;  3VMA A;  3OAK A;  4ASV A;  3O6Q A;  2R3S A;  1Q90 D;  1LWU B;  2Z5H A;  3AEB C;  3H1K E;  2JP3 A;  2A06 E;  4OGQ C;  4DZO A;  3L73 G;  2NZ2 A;  2N1T D;  4L73 A;  1T8Z A;  4EI2 A;  1RQV A;  1HBW A;  1GW3 A;  1P84 I;  5APW A;  3H1J E;  4U3F G;  2IYP A;  5KLV G;  1J1E C;  1ZXG A;  4UB6 H;  3BRT B;  1FJP A;  5KKZ C;  3HE5 A;  2HPC B;  1KIL E;  4PD4 E;  2BCC G;  1Q2N A;  5M1B A;  2QA4 P;  1LTT C;  2ZYG A;  2PP6 A;  1KIL A;  4W7Z A;  3GF7 A;  1S4X A;  3G6E P;  3EFF K;  1DIP A;  1HF9 A;  1W2B O;  1SQX J;  1SQX D;  3KQG A;  3N7N A;  4LLH A;  1OXZ A;  4DT0 A;  1DEB A;  1KB9 E;  3L74 D;  2E76 D;  3L74 J;  3M9H A;  5TIS E;  1H0T A;  5AW9 B;  1ZR2 A;  1SQQ G;  4Z1M H;  5B5E H;  2R5D A;  1U7M A;  1KQL A;  1L4A C;  3JSV C;  2K9J B;  4HH2 A;  5AW4 B;  3KPE A;  3WUU A;  1HUC A;  2IDB A;  2KK7 A;  1G2C A;  3NTN A;  4M3L A;  3KZI H;  3M06 A;  1Q86 Q;  1DEE G;  3HD7 D;  1NGM B;  3D70 A;  1SP4 A;  3U1A A;  3WUV A;  1P84 H;  2G3A A;  2GM4 A;  2OTL P;  4HJG H;  5C39 A;  3RK3 B;  5TIS H;  2KNC A;  2M8R A;  1GL2 D;  2V7Q J;  2ZFC A;  1QEX A;  3HTK A;  4H0L B;  1X9V A;  4R4L A;  1EZV G;  1FJK A;  2FXO A;  1NTK D;  1NTK J;  1SQV K;  4ZMD A;  1NJI Q;  1NTK E;  4D6T G;  2E5Y A;  3VMY A;  1XTG B;  3QH9 A;  1NU1 K;  3HE5 B;  2W6A A;  3AEF C;  2E74 D;  3IF4 A;  1M1K Q;  2KLV A;  1SQQ E;  3PJS K;  2QJP C;  3UIA A;  1GMJ A;  1KQG B;  1GU5 A;  2A06 G;  1R5L A;  1P84 E;  2A45 G;  3KHU A;  3H1H E;  3HD7 B;  3OA7 A;  1S5L H;  5GTI E;  2D2C D;  4RO0 A;  3V2P A;  3FWN A;  2O01 H;  3D71 A;  2BCC E;  3MTU E;  4I6M C;  4GKG A;  2UWJ E;  1JMB A;  1LNQ A;  3CD6 P;  2BEZ F;  1KB9 D;  2YXQ B;  3L74 E;  1HTL C;  4GDO A;  1M90 Q;  1L4A A;  5AVS B;  3RL0 g;  2YKO A;  3HD7 C; 
#chains in the Genus database with same CATH homology
 1N7S B;  2WZ7 A;  3T97 A;  2O1K A;  2XV5 A;  1FOS E;  5CCH D;  1JMM A;  1Z56 A;  1KIL C;  3HE4 B;  2PAJ A;  4C7R A;  5CJ4 A;  2W27 A;  1MUU A;  5CHX A;  1RF0 C;  4AQR D;  1IC2 A;  3B8E B;  5AW7 B;  4C46 A;  5APS A;  1XTC C;  3IFM A;  3V2Q A;  3NXS A;  3II6 A;  2OAR A;  1SFC C;  3U59 A;  1N7L A;  1N7S D;  4JYB A;  2OYH B;  3B5N B;  3GHG C;  2Z4E A;  1FU1 A;  4O9B A;  3P8C E;  5AVX B;  1QL2 A;  1MV8 A;  4EIJ A;  1URQ C;  1JOC A;  1HGV A;  4WY4 A;  5AVQ B;  3V4W A;  4ZKU A;  1JY3 N;  1JY2 O;  3RK3 D;  2R32 A;  2WSE H;  5CCH A;  1LTI C;  2C0X A;  1RY3 A;  3B5N C;  3V4Q A;  1LWU A;  5AVU B;  5APV A;  2WPR A;  2JJL A;  4WBA A;  3O8Z A;  1S9K E;  1NHL A;  2BAS A;  2XU6 A;  1FZC B;  4JF7 A;  1G1J A;  1WRG A;  1NH4 A;  3L35 A;  5APQ A;  1NKN A;  2Q9I A;  1JY3 O;  3TSI A;  3MUD A;  2WIT A;  1GL2 B;  2H8P D;  1JCC A;  1LTA C;  1JCD A;  1FZC A;  4IFM A;  1M1J C;  1RE4 C;  1JTH B;  5AW6 B;  5BU5 A;  2N1T C;  1ZN5 A;  1L4A D;  5CCG A;  1GL2 A;  4W80 A;  1MFZ A;  3VP8 A;  1A02 J;  3I5C A;  1T2K D;  1JUN A;  3P7K A;  1GU4 A;  1LT9 A;  3HRN A;  1J1D B;  2OYI C;  3TNU A;  2A45 I;  5AW8 B;  2E42 A;  1RE4 A;  1LTJ A;  1N7S C;  2WWW A;  2KP8 A;  1RF1 B;  3BRV B;  2YKQ A;  1KIL D;  5CCG D;  1J1D C;  1GU5 A;  5KJ7 D;  2MJZ A;  1LGH B;  1T2K C;  1X79 B;  1GK4 A;  4Y99 B;  1H89 A;  4DOJ A;  2Q3I A;  1GD2 E;  2OYH A;  2R3C A;  1AFO A;  1CW5 A;  2YO3 A;  2WSC H;  2FYU K;  2I1K A;  2N9B A;  1IFI A;  1MZ9 A;  1LTB C;  5AVW B;  1RE3 C;  1OWA A;  2OYI A;  1S9K D;  1LT9 C;  1SFC B;  2WSF H;  2KYV A;  3H32 B;  1HGZ A;  3CI9 A;  3GHG B;  3HE4 A;  3HUS C;  3LW5 H;  1JNM A;  3A2A A;  2N1T A;  1AQ5 A;  1URQ A;  1JY2 N;  1M1J A;  3E1I A;  1CSB A;  4OH8 B;  1LTJ B;  3MGN A;  2WT7 A;  4EOT A;  3M0D A;  3EFG A;  1IO4 A;  1SFC D;  2FFD A;  1HVV A;  2W6B A;  2P7J A;  3KDP B;  1J1E B;  1GDT A;  4B86 A;  2P1J A;  1URQ D;  1GTW A;  1VPC A;  3M0A A;  3RL0 D;  1LWU C;  1IK9 A;  3EQ2 A;  2VRS A;  3B5N A;  1FBM A;  2FYZ A;  3VTP C;  1SQQ K;  3RK2 C;  2P2U A;  4WY4 C;  2YO2 A;  3P8C D;  2XDJ A;  1G1I A;  2IFM A;  1LT9 B;  2Z5I A;  3R2P A;  3U1C A;  2WT7 B;  1SVF A;  3VMX A;  3VYI A;  2KOG A;  1N73 B;  1M1J B;  5AVZ B;  1YTZ I;  5CMZ A;  3RK2 D;  4AYC A;  1CZQ A;  5AW2 B;  3NMD A;  1QL1 A;  5APU A;  1N73 A;  4IFF A;  1GK6 A;  2FXM A;  1N73 C;  5AW0 B;  3BAT A;  2NPS D;  1FDM A;  3BVH A;  2FFD C;  4N3Y B;  3PP5 A;  1PFI A;  2IPP A;  3VN0 A;  3M0D C;  1FZA A;  1NO4 A;  3M9B A;  5APY A;  5AVV B;  4C7N A;  1WT6 A;  2A45 H;  4JYC A;  1ZLL A;  2KSJ A;  1RF0 A;  2Q5U A;  2HOD B;  2IX7 C;  1KIL B;  1IFD A;  4W7Y A;  4I1L A;  3RL0 C;  3V2N A;  1NWQ A;  2NPS B;  2WPQ A;  1LTG C;  5AW1 B;  1J2J B;  1RE3 A;  4I2L C;  2QM7 A;  3HD7 A;  2P67 A;  4C7N B;  4XA4 A;  1JY3 P;  1H88 A;  3NFQ A;  2POH A;  4LC1 A;  3A5T A;  3H32 A;  1CI6 B;  1N86 A;  3LIE A;  2CPB A;  2OYH C;  2WPS A;  3LID A;  1T3J A;  4RES B;  1DX7 A;  1KZU B;  1FZF A;  2Q7C A;  5AVR B;  1ZV8 A;  2J59 M;  2ZXE B;  2HG5 D;  3L37 A;  1FZG A;  1KFM A;  3V5B A;  1NKZ B;  1N7S A;  3L4F A;  2CPS A;  3SWY A;  3L36 A;  5BU8 B;  4WY4 D;  2H7H A;  2LKM A;  3MIW A;  1N2D C;  1NTK K;  3HUS A;  3A3Y B;  4Y99 C;  2J58 A;  1L0N K;  1LTS C;  1KFN A;  2YKP A;  5AVY B;  1EQ7 A;  2E43 A;  3N4X A;  5CCG C;  2IFN A;  1NOH A;  4HYT B;  1URQ B;  2FKW B;  2N1T B;  3MD0 A;  1HWT C;  4ZKP A;  4XE5 B;  3HTK B;  1FOS F;  1GW4 A;  1FZE A;  1JTH A;  2OYI B;  4WB4 A;  2I1J A;  1HH0 A;  3P32 A;  1GZL A;  1W2E A;  2KB7 P;  2HYN A;  4IFD K;  4N78 D;  1FZB A;  5AVS B;  1VDF A;  1FAV A;  1T3U A;  2GUS A;  5APT A;  5AW3 B;  3M9Q A;  3C9I A;  1LTJ C;  1SQP K;  2FFD B;  2YMY A;  2NPS A;  3M91 A;  5CCH C;  2YNY A;  3VOP A;  1M7L A;  3RK3 C;  2HOD A;  5KJ7 A;  1L4A B;  1SQB K;  3IR9 A;  1GL2 C;  3BAS A;  1IFN A;  1IFM A;  2C9N Y;  1FZC C;  4AUW A;  1G2C B;  1IFJ A;  1YYC A;  3V2R A;  5BVZ A;  2L5G B;  3G3Z A;  1SQX K;  1HJB A;  1YTZ T;  2HFE D;  1IJD B;  5APX A;  5KLV K;  5CJ0 A;  3B5N D;  5AW5 B;  4N6J A;  3VMZ A;  1RF1 C;  1RF1 A;  3OJA B;  1A02 F;  1CI6 A;  4KHX A;  2C0W A;  2HLO A;  5AVT B;  3A7O A;  3KYQ A;  3WMM 0;  2M3B A;  3P8M C;  2XNX A;  3TYY A;  3TK1 A;  2R5B A;  2QM8 A;  2XZR A;  3HUS B;  1E5W A;  4GIF A;  3TNU B;  1ZR4 A;  4GT1 A;  1NTM K;  4LGD E;  3VP9 A;  1SLQ A;  2WTY A;  2H43 A;  2GUV A;  2HPC A;  3SWF A;  1X8Y A;  1DH3 A;  3CL3 D;  5KJ7 C;  3RK2 B;  2C9L Y;  1JY2 P;  1NAF A;  3GHG A;  3H6P A;  3RL0 B;  2JEE A;  5KTB A;  1NTZ K;  2O1J A;  4WY4 B;  1H8A A;  2NPS C;  1JO5 A;  1L0L K;  2XKM A;  4N78 E;  1SFC A;  3CLQ A;  3OAK A;  2Z5H A;  1LWU B;  4DZO A;  2N1T D;  1T8Z A;  1HBW A;  1GW3 A;  5APW A;  1J1E C;  3BRT B;  1FJP A;  2HPC B;  3HE5 A;  1LTT C;  2PP6 A;  1KIL A;  4W7Z A;  3KQG A;  3N7N A;  4LLH A;  1OXZ A;  1DEB A;  3M9H A;  5AW9 B;  1ZR2 A;  2R5D A;  1KQL A;  1L4A C;  4HH2 A;  5AW4 B;  3KPE A;  1HUC A;  4M3L A;  1G2C A;  3NTN A;  3M06 A;  3HD7 D;  1SP4 A;  3U1A A;  2GM4 A;  3RK3 B;  2M8R A;  1GL2 D;  2ZFC A;  3HTK A;  1X9V A;  1FJK A;  1SQV K;  3VMY A;  1XTG B;  1NU1 K;  3HE5 B;  2W6A A;  2KLV A;  3UIA A;  3OA7 A;  2A45 G;  3HD7 B;  3V2P A;  2O01 H;  3MTU E;  4I6M C;  4GKG A;  1HTL C;  1L4A A;  2YKO A;  3HD7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...