2HM2Q

Solution structure of asc2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of ASC2, a pyrin domain-only protein that regulates inflammatory signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Pyrin-only protein 1
total genus 27
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2hm2Q00
2NSNA 1A1WA 2NZ7A 4LWDA 4IZ7B 3J6JA 2N97A 3CL3A 2MN4A 2IB1A 2OF5A 2DBHA 2A9IA 1E41A 1D2ZB 4P4HA 4EWIA 4RHWE 2DO9A 3EZQB 3YGSP 1CWWA 2KN6A 4E9MA 4FH0A 3KATA 1UCPA 1WMGA 4RHWA 4IZ5E 2DBDA 4F42A 2BBZA 2P1HA 2A5YB 4DWNA 4P4HI 1D2ZA 3LQRA 1FADA 4N1JA 2LWDA 3EZQA 1DDFA 3MOPA 2YVIA 2MB9A 2HM2Q 2L9MA 3J63A 2N7ZA 2N00A 3LQQA 1WH4A 3T6PA 1PN5A 2N80A 3MOPK 2MS7A 4A2WA 2L6AA 2NAQA 4IZAB 2N83A 2YGSA 2N1FA 4M9ZA 2GF5A 4A2QA 4F44A 2KM6A 2VGQA 1A1ZA 1Z6TA 2D96A 2DBGA 4I16A 4O6XA 1YGOA 2O71A 4D8OA 2LWEA 3QF2A 4O9LA 4M9SA 2YU0A 1CY5A 3MOPG 1DGNA 4UZ0A 4JUPA 3YGSC 4ZBWA 2F1SA 4O7QA 1NGRA 4N1LA 4QOBA 1N3KA 2OF5H 2BBRA 1WXPA 2M5VA 2DBFA 1ICHA 2MS8A 2B1WA 4M9XA 4NQKA 1E3YA 2G7RA 2LS7A 4N1KA 2YQFA 4JQWA 1C15A 2MPCA 3CRDA 4O9FA
chains in the Genus database with same CATH superfamily
2NSNA 1A1WA 2NZ7A 4LWDA 4IZ7B 3J6JA 2N97A 3CL3A 2MN4A 2IB1A 2OF5A 2DBHA 2A9IA 1E41A 1D2ZB 4P4HA 4EWIA 4RHWE 2DO9A 3EZQB 3YGSP 1CWWA 2KN6A 4E9MA 4FH0A 3KATA 1UCPA 1WMGA 4RHWA 4IZ5E 2DBDA 4F42A 2MJMA 2BBZA 2P1HA 2A5YB 4DWNA 4P4HI 1D2ZA 3LQRA 1FADA 4N1JA 2LWDA 3EZQA 1DDFA 3MOPA 2YVIA 2MB9A 2HM2Q 2L9MA 3J63A 2N7ZA 2N00A 3LQQA 1WH4A 3T6PA 1PN5A 2N80A 3MOPK 2MS7A 4A2WA 2L6AA 2NAQA 4IZAB 2N83A 2YGSA 2N1FA 4M9ZA 2GF5A 4A2QA 4F44A 2KM6A 2VGQA 1A1ZA 1Z6TA 2D96A 2DBGA 4I16A 4O6XA 1YGOA 2O71A 4D8OA 2LWEA 3QF2A 4O9LA 4M9SA 2YU0A 1CY5A 3MOPG 1DGNA 4UZ0A 4JUPA 3YGSC 4ZBWA 2F1SA 4O7QA 1NGRA 4N1LA 4QOBA 1N3KA 2OF5H 2BBRA 1WXPA 2M5VA 2DBFA 2XV9A 1ICHA 2MS8A 2B1WA 4M9XA 4NQKA 1E3YA 2G7RA 2LS7A 4N1KA 2YQFA 4JQWA 1C15A 2MPCA 3CRDA 4O9FA
chains in the Genus database with same CATH topology
2NSNA 1A1WA 2NZ7A 4LWDA 4IZ7B 3J6JA 2N97A 3CL3A 2MN4A 2IB1A 2OF5A 2DBHA 2A9IA 1E41A 1D2ZB 4P4HA 4EWIA 4RHWE 2DO9A 3EZQB 3YGSP 1CWWA 2KN6A 4E9MA 4FH0A 3KATA 1UCPA 1WMGA 4RHWA 4IZ5E 2DBDA 4F42A 2MJMA 2BBZA 2P1HA 2A5YB 4DWNA 4P4HI 1D2ZA 3LQRA 1FADA 4N1JA 2LWDA 3EZQA 1DDFA 3MOPA 2YVIA 2MB9A 2HM2Q 2L9MA 3J63A 2N7ZA 2N00A 3LQQA 1WH4A 3T6PA 1PN5A 2N80A 3MOPK 2MS7A 4A2WA 2L6AA 2NAQA 4IZAB 2N83A 2YGSA 2N1FA 4M9ZA 2GF5A 4A2QA 4F44A 2KM6A 2VGQA 1A1ZA 1Z6TA 2D96A 2DBGA 4I16A 4O6XA 1YGOA 2O71A 4D8OA 2LWEA 3QF2A 4O9LA 4M9SA 2YU0A 1CY5A 3MOPG 1DGNA 4UZ0A 4JUPA 3YGSC 4ZBWA 2F1SA 4O7QA 1NGRA 4N1LA 4QOBA 1N3KA 2OF5H 2BBRA 1WXPA 2M5VA 2DBFA 2XV9A 1ICHA 2MS8A 2B1WA 4M9XA 4NQKA 1E3YA 2G7RA 2LS7A 4N1KA 2YQFA 4JQWA 1C15A 2MPCA 3CRDA 4O9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSN A;  1A1W A;  2NZ7 A;  4LWD A;  4IZ7 B;  3J6J A;  2N97 A;  3CL3 A;  2MN4 A;  2IB1 A;  2OF5 A;  2DBH A;  2A9I A;  1E41 A;  1D2Z B;  4P4H A;  4EWI A;  4RHW E;  2DO9 A;  3EZQ B;  3YGS P;  1CWW A;  2KN6 A;  4E9M A;  4FH0 A;  3KAT A;  1UCP A;  1WMG A;  4RHW A;  4IZ5 E;  2DBD A;  4F42 A;  2BBZ A;  2P1H A;  2A5Y B;  4DWN A;  4P4H I;  1D2Z A;  3LQR A;  1FAD A;  4N1J A;  2LWD A;  3EZQ A;  1DDF A;  3MOP A;  2YVI A;  2MB9 A;  2HM2 Q;  2L9M A;  3J63 A;  2N7Z A;  2N00 A;  3LQQ A;  1WH4 A;  3T6P A;  1PN5 A;  2N80 A;  3MOP K;  2MS7 A;  4A2W A;  2L6A A;  2NAQ A;  4IZA B;  2N83 A;  2YGS A;  2N1F A;  4M9Z A;  2GF5 A;  4A2Q A;  4F44 A;  2KM6 A;  2VGQ A;  1A1Z A;  1Z6T A;  2D96 A;  2DBG A;  4I16 A;  4O6X A;  1YGO A;  2O71 A;  4D8O A;  2LWE A;  3QF2 A;  4O9L A;  4M9S A;  2YU0 A;  1CY5 A;  3MOP G;  1DGN A;  4UZ0 A;  4JUP A;  3YGS C;  4ZBW A;  2F1S A;  4O7Q A;  1NGR A;  4N1L A;  4QOB A;  1N3K A;  2OF5 H;  2BBR A;  1WXP A;  2M5V A;  2DBF A;  1ICH A;  2MS8 A;  2B1W A;  4M9X A;  4NQK A;  1E3Y A;  2G7R A;  2LS7 A;  4N1K A;  2YQF A;  4JQW A;  1C15 A;  2MPC A;  3CRD A;  4O9F A; 
#chains in the Genus database with same CATH topology
 2NSN A;  1A1W A;  2NZ7 A;  4LWD A;  4IZ7 B;  3J6J A;  2N97 A;  3CL3 A;  2MN4 A;  2IB1 A;  2OF5 A;  2DBH A;  2A9I A;  1E41 A;  1D2Z B;  4P4H A;  4EWI A;  4RHW E;  2DO9 A;  3EZQ B;  3YGS P;  1CWW A;  2KN6 A;  4E9M A;  4FH0 A;  3KAT A;  1UCP A;  1WMG A;  4RHW A;  4IZ5 E;  2DBD A;  4F42 A;  2MJM A;  2BBZ A;  2P1H A;  2A5Y B;  4DWN A;  4P4H I;  1D2Z A;  3LQR A;  1FAD A;  4N1J A;  2LWD A;  3EZQ A;  1DDF A;  3MOP A;  2YVI A;  2MB9 A;  2HM2 Q;  2L9M A;  3J63 A;  2N7Z A;  2N00 A;  3LQQ A;  1WH4 A;  3T6P A;  1PN5 A;  2N80 A;  3MOP K;  2MS7 A;  4A2W A;  2L6A A;  2NAQ A;  4IZA B;  2N83 A;  2YGS A;  2N1F A;  4M9Z A;  2GF5 A;  4A2Q A;  4F44 A;  2KM6 A;  2VGQ A;  1A1Z A;  1Z6T A;  2D96 A;  2DBG A;  4I16 A;  4O6X A;  1YGO A;  2O71 A;  4D8O A;  2LWE A;  3QF2 A;  4O9L A;  4M9S A;  2YU0 A;  1CY5 A;  3MOP G;  1DGN A;  4UZ0 A;  4JUP A;  3YGS C;  4ZBW A;  2F1S A;  4O7Q A;  1NGR A;  4N1L A;  4QOB A;  1N3K A;  2OF5 H;  2BBR A;  1WXP A;  2M5V A;  2DBF A;  2XV9 A;  1ICH A;  2MS8 A;  2B1W A;  4M9X A;  4NQK A;  1E3Y A;  2G7R A;  2LS7 A;  4N1K A;  2YQF A;  4JQW A;  1C15 A;  2MPC A;  3CRD A;  4O9F A; 
#chains in the Genus database with same CATH homology
 2NSN A;  1A1W A;  2NZ7 A;  4LWD A;  4IZ7 B;  3J6J A;  2N97 A;  3CL3 A;  2MN4 A;  2IB1 A;  2OF5 A;  2DBH A;  2A9I A;  1E41 A;  1D2Z B;  4P4H A;  4EWI A;  4RHW E;  2DO9 A;  3EZQ B;  3YGS P;  1CWW A;  2KN6 A;  4E9M A;  4FH0 A;  3KAT A;  1UCP A;  1WMG A;  4RHW A;  4IZ5 E;  2DBD A;  4F42 A;  2MJM A;  2BBZ A;  2P1H A;  2A5Y B;  4DWN A;  4P4H I;  1D2Z A;  3LQR A;  1FAD A;  4N1J A;  2LWD A;  3EZQ A;  1DDF A;  3MOP A;  2YVI A;  2MB9 A;  2HM2 Q;  2L9M A;  3J63 A;  2N7Z A;  2N00 A;  3LQQ A;  1WH4 A;  3T6P A;  1PN5 A;  2N80 A;  3MOP K;  2MS7 A;  4A2W A;  2L6A A;  2NAQ A;  4IZA B;  2N83 A;  2YGS A;  2N1F A;  4M9Z A;  2GF5 A;  4A2Q A;  4F44 A;  2KM6 A;  2VGQ A;  1A1Z A;  1Z6T A;  2D96 A;  2DBG A;  4I16 A;  4O6X A;  1YGO A;  2O71 A;  4D8O A;  2LWE A;  3QF2 A;  4O9L A;  4M9S A;  2YU0 A;  1CY5 A;  3MOP G;  1DGN A;  4UZ0 A;  4JUP A;  3YGS C;  4ZBW A;  2F1S A;  4O7Q A;  1NGR A;  4N1L A;  4QOB A;  1N3K A;  2OF5 H;  2BBR A;  1WXP A;  2M5V A;  2DBF A;  2XV9 A;  1ICH A;  2MS8 A;  2B1W A;  4M9X A;  4NQK A;  1E3Y A;  2G7R A;  2LS7 A;  4N1K A;  2YQF A;  4JQW A;  1C15 A;  2MPC A;  3CRD A;  4O9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...