2HM2Q

Solution structure of asc2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of ASC2, a pyrin domain-only protein that regulates inflammatory signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Pyrin-only protein 1
total genus 27
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2hm2Q00
3J6JA 4M9XA 4N1JA 4M9SA 2DBGA 1DDFA 2N83A 2IB1A 2N1FA 1UCPA 1A1WA 2GF5A 4FH0A 2KM6A 3YGSP 2MS8A 2YU0A 1ICHA 1N3KA 4EWIA 4UZ0A 4JQWA 2LWEA 2OF5A 2YGSA 2LWDA 4LWDA 4A2WA 3QF2A 3MOPA 4F44A 1D2ZA 1PN5A 1A1ZA 2BBRA 4O9FA 4M9ZA 1YGOA 2YVIA 4D8OA 3J63A 1CY5A 3MOPK 3LQRA 2N00A 2DBDA 4QOBA 2HM2Q 2N97A 4O7QA 4IZ5E 1D2ZB 2NSNA 3KATA 1WMGA 1NGRA 2N7ZA 3T6PA 2G7RA 4RHWE 3MOPG 2VGQA 4E9MA 2L9MA 2O71A 4N1LA 1E3YA 2A9IA 4JUPA 2P1HA 2NAQA 2OF5H 4IZAB 3YGSC 2A5YB 1DGNA 2YQFA 4O9LA 4RHWA 2DBHA 2NZ7A 3CRDA 1CWWA 2MPCA 1WH4A 2LS7A 2B1WA 2D96A 1C15A 3EZQA 4F42A 1WXPA 4N1KA 2BBZA 2MB9A 1E41A 2DO9A 1FADA 3LQQA 2KN6A 4IZ7B 3EZQB 4A2QA 4P4HA 4I16A 4ZBWA 2L6AA 2MS7A 2DBFA 2MN4A 4O6XA 4P4HI 4DWNA 2N80A 1Z6TA 2M5VA 3CL3A 4NQKA 2F1SA
chains in the Genus database with same CATH superfamily
3J6JA 4M9XA 2MJMA 4N1JA 4M9SA 2DBGA 1DDFA 2N83A 2IB1A 2N1FA 2XV9A 1UCPA 1A1WA 2GF5A 4FH0A 2KM6A 3YGSP 2MS8A 2YU0A 1ICHA 1N3KA 4EWIA 4UZ0A 4JQWA 2LWEA 2OF5A 2YGSA 2LWDA 4LWDA 4A2WA 3QF2A 3MOPA 4F44A 1D2ZA 1PN5A 1A1ZA 2BBRA 4O9FA 4M9ZA 1YGOA 2YVIA 4D8OA 3J63A 1CY5A 3MOPK 3LQRA 2N00A 2DBDA 4QOBA 2HM2Q 2N97A 4O7QA 4IZ5E 1D2ZB 2NSNA 3KATA 1WMGA 1NGRA 2N7ZA 3T6PA 2G7RA 4RHWE 3MOPG 2VGQA 4E9MA 2L9MA 2O71A 4N1LA 1E3YA 2A9IA 4JUPA 2P1HA 2NAQA 2OF5H 4IZAB 3YGSC 2A5YB 1DGNA 2YQFA 4O9LA 4RHWA 2DBHA 2NZ7A 3CRDA 1CWWA 2MPCA 1WH4A 2LS7A 2B1WA 2D96A 1C15A 3EZQA 4F42A 1WXPA 4N1KA 2BBZA 2MB9A 1E41A 2DO9A 1FADA 3LQQA 2KN6A 4IZ7B 3EZQB 4A2QA 4P4HA 4I16A 4ZBWA 2L6AA 2MS7A 2DBFA 2MN4A 4O6XA 4P4HI 4DWNA 2N80A 1Z6TA 2M5VA 3CL3A 4NQKA 2F1SA
chains in the Genus database with same CATH topology
3J6JA 4M9XA 2MJMA 4N1JA 4M9SA 2DBGA 1DDFA 2N83A 2IB1A 2N1FA 2XV9A 1UCPA 1A1WA 2GF5A 4FH0A 2KM6A 3YGSP 2MS8A 2YU0A 1ICHA 1N3KA 4EWIA 4UZ0A 4JQWA 2LWEA 2OF5A 2YGSA 2LWDA 4LWDA 4A2WA 3QF2A 3MOPA 4F44A 1D2ZA 1PN5A 1A1ZA 2BBRA 4O9FA 4M9ZA 1YGOA 2YVIA 4D8OA 3J63A 1CY5A 3MOPK 3LQRA 2N00A 2DBDA 4QOBA 2HM2Q 2N97A 4O7QA 4IZ5E 1D2ZB 2NSNA 3KATA 1WMGA 1NGRA 2N7ZA 3T6PA 2G7RA 4RHWE 3MOPG 2VGQA 4E9MA 2L9MA 2O71A 4N1LA 1E3YA 2A9IA 4JUPA 2P1HA 2NAQA 2OF5H 4IZAB 3YGSC 2A5YB 1DGNA 2YQFA 4O9LA 4RHWA 2DBHA 2NZ7A 3CRDA 1CWWA 2MPCA 1WH4A 2LS7A 2B1WA 2D96A 1C15A 3EZQA 4F42A 1WXPA 4N1KA 2BBZA 2MB9A 1E41A 2DO9A 1FADA 3LQQA 2KN6A 4IZ7B 3EZQB 4A2QA 4P4HA 4I16A 4ZBWA 2L6AA 2MS7A 2DBFA 2MN4A 4O6XA 4P4HI 4DWNA 2N80A 1Z6TA 2M5VA 3CL3A 4NQKA 2F1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J6J A;  4M9X A;  4N1J A;  4M9S A;  2DBG A;  1DDF A;  2N83 A;  2IB1 A;  2N1F A;  1UCP A;  1A1W A;  2GF5 A;  4FH0 A;  2KM6 A;  3YGS P;  2MS8 A;  2YU0 A;  1ICH A;  1N3K A;  4EWI A;  4UZ0 A;  4JQW A;  2LWE A;  2OF5 A;  2YGS A;  2LWD A;  4LWD A;  4A2W A;  3QF2 A;  3MOP A;  4F44 A;  1D2Z A;  1PN5 A;  1A1Z A;  2BBR A;  4O9F A;  4M9Z A;  1YGO A;  2YVI A;  4D8O A;  3J63 A;  1CY5 A;  3MOP K;  3LQR A;  2N00 A;  2DBD A;  4QOB A;  2HM2 Q;  2N97 A;  4O7Q A;  4IZ5 E;  1D2Z B;  2NSN A;  3KAT A;  1WMG A;  1NGR A;  2N7Z A;  3T6P A;  2G7R A;  4RHW E;  3MOP G;  2VGQ A;  4E9M A;  2L9M A;  2O71 A;  4N1L A;  1E3Y A;  2A9I A;  4JUP A;  2P1H A;  2NAQ A;  2OF5 H;  4IZA B;  3YGS C;  2A5Y B;  1DGN A;  2YQF A;  4O9L A;  4RHW A;  2DBH A;  2NZ7 A;  3CRD A;  1CWW A;  2MPC A;  1WH4 A;  2LS7 A;  2B1W A;  2D96 A;  1C15 A;  3EZQ A;  4F42 A;  1WXP A;  4N1K A;  2BBZ A;  2MB9 A;  1E41 A;  2DO9 A;  1FAD A;  3LQQ A;  2KN6 A;  4IZ7 B;  3EZQ B;  4A2Q A;  4P4H A;  4I16 A;  4ZBW A;  2L6A A;  2MS7 A;  2DBF A;  2MN4 A;  4O6X A;  4P4H I;  4DWN A;  2N80 A;  1Z6T A;  2M5V A;  3CL3 A;  4NQK A;  2F1S A; 
#chains in the Genus database with same CATH topology
 3J6J A;  4M9X A;  2MJM A;  4N1J A;  4M9S A;  2DBG A;  1DDF A;  2N83 A;  2IB1 A;  2N1F A;  2XV9 A;  1UCP A;  1A1W A;  2GF5 A;  4FH0 A;  2KM6 A;  3YGS P;  2MS8 A;  2YU0 A;  1ICH A;  1N3K A;  4EWI A;  4UZ0 A;  4JQW A;  2LWE A;  2OF5 A;  2YGS A;  2LWD A;  4LWD A;  4A2W A;  3QF2 A;  3MOP A;  4F44 A;  1D2Z A;  1PN5 A;  1A1Z A;  2BBR A;  4O9F A;  4M9Z A;  1YGO A;  2YVI A;  4D8O A;  3J63 A;  1CY5 A;  3MOP K;  3LQR A;  2N00 A;  2DBD A;  4QOB A;  2HM2 Q;  2N97 A;  4O7Q A;  4IZ5 E;  1D2Z B;  2NSN A;  3KAT A;  1WMG A;  1NGR A;  2N7Z A;  3T6P A;  2G7R A;  4RHW E;  3MOP G;  2VGQ A;  4E9M A;  2L9M A;  2O71 A;  4N1L A;  1E3Y A;  2A9I A;  4JUP A;  2P1H A;  2NAQ A;  2OF5 H;  4IZA B;  3YGS C;  2A5Y B;  1DGN A;  2YQF A;  4O9L A;  4RHW A;  2DBH A;  2NZ7 A;  3CRD A;  1CWW A;  2MPC A;  1WH4 A;  2LS7 A;  2B1W A;  2D96 A;  1C15 A;  3EZQ A;  4F42 A;  1WXP A;  4N1K A;  2BBZ A;  2MB9 A;  1E41 A;  2DO9 A;  1FAD A;  3LQQ A;  2KN6 A;  4IZ7 B;  3EZQ B;  4A2Q A;  4P4H A;  4I16 A;  4ZBW A;  2L6A A;  2MS7 A;  2DBF A;  2MN4 A;  4O6X A;  4P4H I;  4DWN A;  2N80 A;  1Z6T A;  2M5V A;  3CL3 A;  4NQK A;  2F1S A; 
#chains in the Genus database with same CATH homology
 3J6J A;  4M9X A;  2MJM A;  4N1J A;  4M9S A;  2DBG A;  1DDF A;  2N83 A;  2IB1 A;  2N1F A;  2XV9 A;  1UCP A;  1A1W A;  2GF5 A;  4FH0 A;  2KM6 A;  3YGS P;  2MS8 A;  2YU0 A;  1ICH A;  1N3K A;  4EWI A;  4UZ0 A;  4JQW A;  2LWE A;  2OF5 A;  2YGS A;  2LWD A;  4LWD A;  4A2W A;  3QF2 A;  3MOP A;  4F44 A;  1D2Z A;  1PN5 A;  1A1Z A;  2BBR A;  4O9F A;  4M9Z A;  1YGO A;  2YVI A;  4D8O A;  3J63 A;  1CY5 A;  3MOP K;  3LQR A;  2N00 A;  2DBD A;  4QOB A;  2HM2 Q;  2N97 A;  4O7Q A;  4IZ5 E;  1D2Z B;  2NSN A;  3KAT A;  1WMG A;  1NGR A;  2N7Z A;  3T6P A;  2G7R A;  4RHW E;  3MOP G;  2VGQ A;  4E9M A;  2L9M A;  2O71 A;  4N1L A;  1E3Y A;  2A9I A;  4JUP A;  2P1H A;  2NAQ A;  2OF5 H;  4IZA B;  3YGS C;  2A5Y B;  1DGN A;  2YQF A;  4O9L A;  4RHW A;  2DBH A;  2NZ7 A;  3CRD A;  1CWW A;  2MPC A;  1WH4 A;  2LS7 A;  2B1W A;  2D96 A;  1C15 A;  3EZQ A;  4F42 A;  1WXP A;  4N1K A;  2BBZ A;  2MB9 A;  1E41 A;  2DO9 A;  1FAD A;  3LQQ A;  2KN6 A;  4IZ7 B;  3EZQ B;  4A2Q A;  4P4H A;  4I16 A;  4ZBW A;  2L6A A;  2MS7 A;  2DBF A;  2MN4 A;  4O6X A;  4P4H I;  4DWN A;  2N80 A;  1Z6T A;  2M5V A;  3CL3 A;  4NQK A;  2F1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...