2HMBA

Three-dimensional structure of recombinant human muscle fatty acid-binding protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
131
structure length
131
Chain Sequence
b'VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUSCLE FATTY ACID BINDING PROTEIN
publication title Three-dimensional structure of recombinant human muscle fatty acid-binding protein.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 26
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 1992-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2hmbA00
5L8NA 2GC9A 1FE3A 2HZRA 3BRNA 4IB7A 1YWDA 3T1DA 4BOEA 2FS7A 3NQ9A 3TGAA 5KHPA 1PMPA 5EDCA 4LKPA 2ALLX 2OVDA 3ELZA 4ZHHA 3QKGA 1EQDA 4ZHDA 1BRPA 4OMXA 3B2LA 1N0SA 1RLBE 1OBUA 3KZAA 3APUA 3PEDA 5H9LA 4RUUA 4ZR2A 2JU3A 1U17A 5H9KA 1S2PA 1YIVA 1MUPA 1GKAA 1SXXA 5HBSA 2FTBA 3UEVA 1B56A 4NYQA 2A3FX 5LJGA 4HPDA 5JR8A 1R0UA 4GNWA 3CWKA 5EZ2A 2Q39A 3FW4A 4I3BA 3VG3A 2CBSA 4BVMA 4O9SA 2FLJA 5D47A 2K23A 5EPQA 4ZHCA 3VG2A 1JYDA 5D8JA 2YG2A 1ERBA 3HWGA 5LJHA 2WSJA 1KZXA 2L9CA 4Y0SA 1SY2A 1BSQA 4OS0A 5HTDA 4WFUA 1LIEA 1B4MA 4IMNA 1FELA 4QYNA 1DV9A 3FA9A 3WJGA 3GAQA 1GXAA 1YWBA 1PEEA 3KFGA 5HZ5A 3ELXA 4Y0QA 2KT4B 3BU9A 3D97A 3FENA 3P6HA 5FFHA 2CZUA 3I0AA 3Q6LA 1IIUA 2HLVA 1ADLA 3WJDA 2AT5X 1EUOA 1T68X 3S26A 3I17A 1ZNEA 1CBQA 1BRQA 1ML7A 4YBUA 4ORSA 3APWA 1X8PA 3C77X 4I3CA 1EXSA 4ZH6A 5HZQA 4AW8A 5KIDA 4QYPA 2A2GA 1I05A 1ZNLA 1FEMA 1OPAA 1QFVA 2NP1A 3EM0A 3NP1A 4GH7A 4QGXA 3U03A 3FIQA 3AKMA 2L68A 3DTQA 1IW2A 4UU2A 2RCQA 4GKCA 1FDQA 4YCEA 4QGVA 3D96A 1RBPA 1IKJA 1QY0A 5L8OA 3C78X 3P6CA 4NLJA 3FR4A 1O1UA 1BM5A 1Z24A 1B0OA 4I3DA 2AKQA 3O19A 4GRJA 4OS8A 2CZTA 2LKKA 4KIIA 2W2AA 3TGBA 1KZWA 1BBPA 2Q4NA 4ORUA 1LIFA 3FMZA 5CE4A 5HWZA 4CK4A 2AL0X 5BVSA 4ZHFA 1MDCA 3CBSA 3UEXA 4DQ3A 1QQSA 2NNDA 1AELA 2AT3X 2JOZA 2QO5A 3CMPA 1YUPA 4IMOA 4R0BA 3P6GA 4MVKA 3STMX 5HZ8A 4XMCA 4YFQA 1JYJA 2ACOA 3AKNA 2RD7C 2AT6X 3FELA 5DG4A 5F6ZA 2F73A 2RQ0A 4TKHA 2Q2MA 1TXLA 1X71A 4K19A 4AZPA 5HZ6A 1EIIA 3STKA 4XMFA 2JN3A 1TW4A 4A1HA 4IAWA 4XMHA 1QY1A 4YKMA 1UREA 4YH0A 3EYCA 3C76X 4XMDA 1H91A 1VPRA 2W2BA 2WUTA 5B27A 1T0VA 1ZNKA 1G85A 2AT0X 2XKLA 3IFBA 3NADA 4EDEA 3HWEA 4GE1A 3SAOA 5F1EA 4YFPA 5H8TA 4ZHGA 1A57A 4Y0PA 1X8OA 1O1VA 1IFBA 1SXWA 1OEKA 2HNXA 3BU1A 3PH6A 1DZPA 3WXQA 3ZUIA 2A13A 1IFCA 5HCCC 1KQXA 1MVGA 5IO6A 3UEWA 1LF7A 2WEXA 1EW3A 2FT9A 4ORWA 1X8QA 3WBGA 1I04A 2WWPA 1YWCA 1IKEA 1G74A 1P6PA 3BLGA 4EEJA 5LJEA 2E4JA 4MVLA 2MM3A 3D95A 1X8UA 1HN2A 3B2IA 1KT7A 1BJ7A 1GGLA 3U0DA 1NGLA 1UZ2X 5IO5A 3BS2A 4TKJA 1PM1X 4HFOA 4NNSA 5D48A 4A1YA 1TVQA 3VG5A 1LICA 2IFBA 2WR6A 2QOSC 1E02A 2W2FA 4HPCA 4EFGA 5LKFA 2L67A 4YGZA 1EPAA 1YP6A 4QAEA 4YMYA 4Y0RA 3WJFA 1KT4A 5HTEA 1CBRA 4NP1A 4YBPA 5D4AA 4TJZA 4WFVA 2AH7X 3PH5A 4ODDA 2CM9A 5LJKA 5FAZA 1HBQA 5HCDC 5H9NA 1JZUA 3FA6A 2LBAA 3CBCA 1XCAA 2L5PA 1AVGI 1D2UA 1GX8A 2OFMX 3O22A 4IBAA 3P6DA 2WQ9A 1JV4A 2QM9A 4N7CA 1JJXA 1KQWA 4IAXA 1DZJA 1ACDA 1KT3A 2QO6A 4ORXA 1E5PA 1JBHA 3B2KA 1DZMA 3FEKA 3ZQ3A 1OEEA 1X89A 1B8EA 1VYGA 2WQAE 4GNYA 2G7BA 5F58A 1SY3A 3JS1A 2A0AA 4YFRA 5H9AA 1LIDA 3BX7A 3FA7A 3STNA 4AZOA 3VG7A 4XMGA 1YP7A 3FR5A 4ORRA 2LB6A 4BQUA 1EPBA 1S44A 2RA6A 2QO4A 1U18A 4TNNA 3L4RA 1LPJA 2A2UA 1LIBA 1I4UA 4AZMA 1ZNHA 1EIOA 2AMMX 3DSZA 1GKAB 2OVAA 3UEUA 2NNQA 1FENA 2K62A 1G5WA 2GTFX 4N7DA 2AT8X 3WJEA 2R74A 1ICNA 2MO5A 1CBIA 4I9RA 4ZGUA 2FR3A 3WVMA 1LNMA 2OVEA 1SY0A 4A8ZA 5B29A 2Q2PA 4TQ2A 5FENA 1AQBA 1TOUA 4PSQA 5LJCA 2OFRX 3NR3A 4D6BA 1LFOA 4ARHA 2CBRA 1GT1A 1U0XA 5EEDA 5AQ6A 5HA0A 5HCEC 1HMRA 1LKEA 2JU8A 1BLRA 1AB0A 2ANSA 3B2JA 3FLLA 4EXZA 1QFTA 2POAA 1OBQA 4OS3A 1QWDA 1OEJA 4A60A 4ZFXA 3EBWA 4MVIA 5C0NA 3KQ0A 4M6SA 2R73A 3OJYC 3F8AA 1ICMA 4I9SA 5HZ9A 1SY1A 4QZUA 3O2YA 3U9PC 2G78A 2KTDA 4YKOA 5BVQA 3TF6A 4HPBA 5LJBA 3PECA 1DFVA 3VG6A 4IB6A 3EMMA 3HWFA 2XSTA 1A2DA 3IA8A 5DPQA 2CM4A 1KOIA 4AZQA 4YGHA 1L6MA 5F7GA 2FR2A 1A18A 1DF3A 1E06A 2PY1A 3HWDA 4OMWA 3B2HA 4ZJ0A 4XMEA 1TOWA 3MBTA 2Q9SA 4AZRA 2P8GA 3NQ3A 3KFFA 2HMBA 4LZVA 4YCHA 3NPOA 1SXUA 4ZCBA 1CJ5A 2FRSA 3WJCA 1A3YA 2NNEA 3APVA 1GM6A 3BY0A 4NNTA 2JU7A 1XKIA 4IB8A 3CR6A 2HZQA 1GT3A 1GX9A 4ALOA 3BDRA 1CBSA 3G7XA 3NX1A 3PPTA 2N93A 3K3LA 5EDBA 3PP6A 4YDAA 1JJJA 1KT5A 1QY2A 5D45A 2ASNX 3EBKA 5HA1A 3HK1A 3P6FA 3NX2A 2X45A 4DQ4A 1FTPA 4AYHA 1DC9A 4UU3A 2ACPX 1ZNDA 2G79A 1NP4A 2DM5A 3BX8A 1ZRYA 4YDBA 2BLGA 3MVFA 1MX8A 4QZTA 5LJDA 1QABE 1S7DA 5HAEA 1QG5A 4LZUA 4M7MA 2EU7X 3RZYA 2LBVA 3CQRA 1D3SA 1OBPA 4NLIA 3KFIA 3F9DA 5K06A 1MX7A 4RUNA 2R56A 4ORYA 3RSWA 1GT5A 4ES7A 2HYSA 2FWVA 1ZNGA 4YGGA 3TGCA 5F6BA 4ALBA 3TZSA 1CRBA 1X8NA 1BWYA 3FR2A 4TKBA 1VYFA 3KFHA 4GETA 4WBKA 1BSYA 5EEEA 3WJBA 1SA8A 1NP1A 4IB9A 2LFOA 1HMSA 4NYRA 4LKTA 1E00A 1EALA 1O8VA 1I06A 3CQNA 2WEWA 1G7NA 2FS6A 3ZUOA 1HMTA 2GJ5A 4ZH9A 3FW5A 2OZQA 2X46A 3BSZE 5BVTA 5IO7A 3JSQA 1GT4A 5KICA 2MJIA 4D6AA 3VG4A 1PBOA 3P6EA 1DZKA 1OPBA 1KXOA 1T8VA 2O62A 1ERXA 4HPAA 3FEPA 4TLJA 1YWAA 3APXA 3FA8A 1HBPA 5LKEA 2RCTA 1ALBA 5L8IA 4QGWA 1KT6A 1HQPA 4AZNA 1KGLA 1SXYA 1BSOA 1BEBA
chains in the Genus database with same CATH superfamily
4IABA 4O3XB 4FQBB 4MIRA 2GC9A 1FE3A 2HZRA 1JQPA 3AUMO 1YWDA 3BRNA 4IB7A 2FS7A 3T1DA 4BOEA 3NQ9A 1RXHA 3TGAA 4B55A 5KHPA 4BX6B 1PMPA 5EDCA 4LKPA 2ALLX 1I78A 2OVDA 5CYBA 3ELZA 1SWAA 4ZHHA 1VWGB 4I60A 3QKGA 2RTCB 1EQDA 1RXKA 4ZHDA 1BRPA 4OMXA 4CDEA 4NW4A 4U8UM 3B2LA 3WOVA 1N0SA 1RLBE 1OBUA 4CPEA 2IZIA 3KZAA 3APUA 3PEDA 1RXJA 3T6FA 5H9LA 4RUUA 4ZR2A 2JU3A 1U17A 5H9KA 1S2PA 1YIVA 1MUPA 1GKAA 1SRGA 1SWHA 1SXXA 2FTBA 2IZFB 1B56A 5HBSA 4NYQA 3UEVA 1KFFA 4KH8A 3ZZVA 2A3FX 5LJGA 4HPDA 3ZW1A 1R0UA 4GNWA 5JR8A 4GDZA 3CWKA 1SWPA 2Q39A 3FIDA 3FW4A 2A5CA 4I3BA 5EZ2A 3S5XA 3SZIA 3VG3A 1LDOA 2CBSA 4BVMA 2Y32A 1SWSA 3MX7A 2FLJA 4O9SA 2K23A 5D47A 5EPQA 5F2BA 4ZHCA 5BYPA 3VG2A 1JYDA 1SWEA 2YG2A 5D8JA 1ERBA 3HWGA 5B3MO 1I9HA 2HKDA 4NV8A 2WSJA 5LJHA 1KZXA 2RTRB 2X32A 2L9CA 4BX7B 4ML7B 4Y0SA 4U46A 1SY2A 1BSQA 2OFAA 4OS0A 4CDFA 4I6SA 1LIEA 4WFUA 3X00A 5HTDA 1B4MA 4IMNA 1FELA 4IRWA 4QYNA 1DV9A 4GJVA 2GH7A 2RTFB 1NDJA 2ZAIA 3FA9A 3GAQA 3WJGA 1GXAA 1YWBA 1LELA 1JJUA 4BX6A 1PEEA 2RTLA 3KFGA 4Z2PA 2RTQB 5HZ5A 3ELXA 4Y0QA 1UYOX 2KT4B 3BU9A 3D97A 3FENA 3P6HA 3V8UA 4YVBA 5FFHA 5K67A 2CZUA 3I0AA 3ZI8A 4OKAA 3Q6LA 1IIUA 2HLVA 1ADLA 2Y3FA 3WJDA 1EIOA 2AT5X 1EUOA 1T68X 3S26A 1LCVA 3I17A 1ZNEA 1CBQA 1JMZA 2FGSA 1BRQA 1ML7A 4YBUA 3FYFA 4ORSA 3APWA 1X8PA 3C77X 4I3CA 1EXSA 4ZH6A 5HZQA 2IZAA 2JMBA 1SLFB 4GGRA 4AW8A 5KIDA 4QYPA 2A2GA 2BS5A 1I05A 1ZNLA 1FEMA 1OPAA 1QFVA 2NP1A 1VWAB 3EM0A 2KTSA 3KVNA 3NP1A 4GH7A 1KL3A 1RSUB 2DJGA 3AKMA 3FIQA 2L68A 3DTQA 1IW2A 4UU2A 3RY1A 2RCQA 2OY5O 5FQ8E 4GKCA 1FDQA 1LCZA 4YCEA 4QGVA 3D96A 1RBPA 1IKJA 3RDQA 1QY0A 5L8OA 3LTWA 4BCSA 1STRB 2C4IA 2FKGA 3C78X 2RTJA 3P6CA 4NLJA 3FR4A 3RDSA 2X8SA 1O1UA 1VWOB 1BM5A 4CPHB 4KC7A 1Z24A 1B0OA 4I3DA 2AKQA 1EI5A 3O19A 4GRJA 4OS8A 2CZTA 2LKKA 5B5FA 4KIIA 2W2AA 3TGBA 1KZWA 1BBPA 2G8CO 3HOLA 2Q4NA 4ORUA 2GTLO 1LIFA 1SWQA 2A5BA 2X34A 4OELA 3FMZA 4BX5B 5CE4A 3H3IA 5HWZA 4CK4A 2AL0X 5BVSA 4ZHFA 1MDCA 3CBSA 3UEXA 2G5LA 4DQ3A 4GD9A 1QQSA 2NNDA 4BJ8A 2AT3X 2JOZA 2QO5A 3CMPA 1YUPA 4IMOA 2VFBA 4R0BA 3P6GA 4MVKA 3STMX 3VHIA 5HZ8A 4XMCA 4YFQA 1JYJA 1VYOA 4WHIA 4EQAC 2ACOA 2CAMA 2BHVA 3AKNA 1VWFB 4O3YA 2RD7C 2AT6X 3FELA 5DG4A 5F6ZA 2IZDB 2PI3O 2F73A 2RQ0A 3WZNA 4TKHA 3T6LA 2BS6A 2Q2MA 1TXLA 1X71A 2X4MA 3GE2A 4K19A 3VGWA 4AZPA 2IZLB 5HZ6A 1EIIA 1SWLA 3STKA 4XMFA 3EW1A 2JN3A 1STSB 1TW4A 4A1HA 4IAWA 1N4JA 4XMHA 1QY1A 4YKMA 1UREA 2OL8O 5B10O 5HCEC 4YH0A 3EYCA 1BLRA 3C76X 3ZW0B 4XMDA 1SWNA 2F09A 2GTLM 1H91A 1Y0GA 1VPRA 4NV7A 1Y9LA 4Z27A 2W2BA 2WUTA 5B27A 1T0VA 3WYPA 5IRWA 1ZNKA 1G85A 2AT0X 1FJ1E 2JGSA 2MWHA 2XKLA 3F6ZB 3IFBA 3HWEA 3NADA 4EDEA 4GE1A 4Z2VA 1HXLA 5AJCA 3SAOA 5F1EA 4YFPA 3MM0A 5H8TA 4ZHGA 1N9MA 1VWDB 1A57A 4GUZA 1VWMB 1X8OA 1O1VA 4O4OA 4Y0PA 4CSBA 1IFBA 1SXWA 4BX5A 4O4XA 2UYWA 3Q34A 1OEKA 3PQUA 2HNXA 3BU1A 3PH6A 1DZPA 3WXQA 3VE2A 3SOTA 3ZUIA 2A13A 1IFCA 5HCCC 1KQXA 1MVGA 5IO6A 3UEWA 1LF7A 2OL6O 2WEXA 5JD2A 1EW3A 2FT9A 4ORWA 1SWJA 1X8QA 1I04A 2OVSA 3WBGA 2WWPA 2AF5A 1SREA 1NQMA 1YWCA 1IKEA 1G74A 1P6PA 3BLGA 3RE5A 4EEJA 2OYBO 5LJEA 4BBOA 3U03A 2E4JA 1N9YA 3LV4A 2IZGB 4MVLA 1W5RA 2MM3A 3D95A 1SWDA 1X8UA 5IRAA 3LHNA 2FKJA 1HN2A 3B2IA 1KT7A 1BJ7A 2BC3A 3PDFA 1GGLA 1RSTB 3U0DA 1NGLA 1UZ2X 5IO5A 3BS2A 4TKJA 1KL5A 1PM1X 4O49A 1VWRB 2Z4IA 2RTBB 1SWTA 3E3CA 1IJ8A 1HY2A 4HFOA 4I95A 2Z4HA 4NNSA 4O3ZA 5D48A 4Z28A 4A1YA 3RY2A 1TVQA 3VG5A 1LICA 1VWHB 2RTEB 4GDAA 1SRIA 4CPFA 2IFBA 2WR6A 3EW2A 2QOSC 3PK2A 1E02A 3RBYA 2FHNX 4JHQA 2W2FA 4HPCA 4EFGA 1SMPI 5LKFA 2L67A 4MISA 4YGZA 1EPAA 1YP6A 1JMXA 2WPUA 3OBLA 4QAEA 1LCWA 4YMYA 2MHDA 4OEMA 1PTSA 4Y0RA 3WJFA 1KT4A 2X8FA 3FDCA 4O4SA 5HTEA 1CBRA 4QGXA 4NP1A 1VWJB 4QRLA 2C1SA 4YBPA 5D4AA 4TJZA 3N91A 5L8NA 4QQ1A 4WFVA 2AH7X 3PH5A 4ODDA 2CM9A 5LJKA 1SRHA 5FAZA 3VHMA 1HBQA 5HCDC 5H9NA 3RDOA 5CHKA 1JZUA 5B5GA 3FA6A 2LBAA 3CBCA 1XCAA 2L5PA 4GK9A 2IZKA 4L3RA 1AVGI 1D2UA 1GX8A 1VWEB 3VPJE 2OFMX 4Z2OA 3O22A 4BX7A 1AVEA 4IBAA 2RTMA 3P6DA 2WQ9A 2VFCA 4KCAA 2Y3EA 4BGFA 1JV4A 2QM9A 1SWCA 4N7CA 2X56A 1JJXA 1KQWA 2VDFA 4IAXA 1DZJA 1NQNA 1ACDA 2ZSCA 1KT3A 2QO6A 4ORXA 1E5PA 3HTYA 1JBHA 3B2KA 1DZMA 3FEKA 1JIWI 1OEEA 1X89A 1B8EA 1VYGA 2RTGB 3OD9A 3ZQ3A 4U3QA 2WQAE 4GNYA 2G7BA 4CDDA 5F58A 1SY3A 3JS1A 2A0AA 1HXZA 1MM9A 4YFRA 4INNA 1LIDA 5H9AA 3BX7A 3FA7A 4QNIA 3STNA 4AZOA 3VG7A 4GU8A 1W4TA 4XMGA 4Y5DA 1YP7A 3FR5A 1VWBB 3P24A 2LB6A 4ORRA 1E2TA 4BQUA 1EPBA 1S44A 2RA6A 2QO4A 1U18A 4TNNA 3CKGA 1HQQA 2I5VO 3L4RA 5AJBA 4O4UA 1LPJA 2A2UA 4JO6A 1LIBA 1I4UA 1SWBA 2MF6A 1ZNHA 4AZMA 2AMMX 3DSZA 1GKAB 2QOMA 2OVAA 3UEUA 1Y55X 2NNQA 1FENA 2K62A 1AELA 4FBRA 3CKFA 1G5WA 2GTFX 4N7DA 2AT8X 2IZEB 3WJEA 3ZW1B 2R74A 1ICNA 3EC5A 2MO5A 1CBIA 4LQZA 4PJ2A 2RTIB 4I9RA 3RDUA 2IZBA 4ZGUA 2FR3A 1SRFA 3WVMA 1LNMA 1GX3A 2OVEA 3VU1A 1SY0A 3SLJA 3D9WA 4A8ZA 4COTA 2Q2PA 1SLDB 4TQ2A 1AQBA 1TOUA 5B29A 5FENA 4PSQA 5LJCA 2OFRX 3NR3A 4D6BA 1LFOA 4ARHA 2CBRA 4CPHA 1GT1A 1U0XA 5EEDA 5AQ6A 1K24A 4GGTA 1HMRA 1LKEA 1SRJA 2JU8A 3OE3A 5B11O 5HA0A 3WZPA 3AEHA 1AB0A 2ANSA 3B2JA 3FLLA 4EXZA 1QFTA 2KD2A 1OBQA 2POAA 2RTOB 1NC9A 4OS3A 3T2WA 3SLTA 1QWDA 1OEJA 4Y59A 4A60A 4ZFXA 3EBWA 5AEOA 4MVIA 4L1NA 5C0NA 3RWXA 5L3YA 3KQ0A 4M6SA 1VWIB 2R73A 1SLEB 5CSEA 2FHLA 1SWKA 1ICMA 3F8AA 3OJYC 4I9SA 4ZGFA 5HZ9A 1SY1A 4QZUA 3S60A 1Y53X 3O2YA 2C1QA 3MG5A 2JW1A 2G78A 3U9PC 1VWNB 2KTDA 4U9CA 4YKOA 5BVQA 3TF6A 4HPBA 4CDCA 5LJBA 3PECA 1DFVA 1STPA 3VG6A 4IB6A 3EMMA 3HWFA 3D4RA 2XSTA 1A2DA 3IA8A 5DPQA 3T2XA 2CM4A 1KOIA 4AZQA 4YGHA 1L6MA 1SWGA 5F7GA 2RTHB 2FR2A 1A18A 1MOYA 3WZQA 1DF3A 2I5ZO 1E06A 2PY1A 3HWDA 4OMWA 4GJSA 3UAQA 1OSPO 3B2HA 4JGLA 2OY8A 4ZJ0A 4XMEA 3S5VA 1TOWA 3MBTA 2Q9SA 4AZRA 2M4LA 4C5PA 1MK5A 2P8GA 3NQ3A 3KFFA 2HMBA 4LZVA 4YCHA 3NPOA 1SXUA 4ZCBA 3SZJA 3ZW0A 4MVEA 1CJ5A 4Z6JA 2FRSA 3WJCA 1A3YA 2NNEA 3APVA 1GM6A 3BY0A 4GGZA 4NNTA 2JU7A 1W6FA 1XKIA 4DNEA 2A8GA 4ID2A 4IB8A 3CR6A 5IRUA 2RTKA 1LUQA 2HZQA 1GT3A 1GX9A 4ALOA 3BDRA 1CBSA 1VWLB 3G7XA 3NX1A 3PPTA 3WYQA 2N93A 3K3LA 5EDBA 3PP6A 4YDAA 1JJJA 1KT5A 1QY2A 5D45A 2ASNX 3EBKA 5HA1A 4O3WA 2AVIA 3HK1A 3NX2A 3P6FA 2X45A 2DJFA 1FTPA 3WZOA 4DCBA 4DQ4A 2GTLN 4AYHA 2RTNB 1DC9A 4UU3A 1SWFA 2ACPX 1ZNDA 2G79A 4KT5A 1NP4A 2DM5A 4FGIB 3ZWEA 3BX8A 1ZRYA 4YDBA 2BLGA 3MVFA 1MX8A 4QZTA 4U8UN 1QABE 2BT9A 3HPEA 5LJDA 2QMIA 1S7DA 5HAEA 1QG5A 1WBIA 4KC8A 3SLOA 1MEPA 4LZUA 4M7MA 2EU7X 5K68A 3RDMA 2LBVA 3CQRA 3RZYA 1Y52X 4JNJA 2OF8A 2X8TA 1D3SA 1OBPA 4NLIA 2QCBA 3P02A 5IXGA 3KFIA 2IZHB 4GZVA 3F9DA 5K06A 1N7YA 2OFBA 1MX7A 2IZCB 3RKGA 3NBXX 4RUNA 2R56A 4ORYA 3RSWA 1GT5A 1PBYA 1RAVA 2OY1O 4ES7A 2HYSA 2FWVA 1ZNGA 2X55A 4YGGA 3ZW2A 3TGCA 1VWQB 2RTDB 2RTPB 5F6BA 1VWKB 4ALBA 1SWUA 3JQOA 3VE1A 3TZSA 1CRBA 1DF8A 1NBXA 2F01A 1VWCB 1X8NA 1BWYA 3FR2A 2RTAA 4TKBA 1VYFA 3KFHA 4HWMA 4GETA 4WBKA 1BSYA 5EEEA 3WJBA 2UZ2A 4CV7A 2OL7A 1SA8A 1NP1A 4IB9A 3RDXA 1K3BA 4CPIA 2LFOA 1HMSA 2YMSA 4NYRA 4LKTA 1E00A 4ON1A 1EALA 2KW1A 1O8VA 1I06A 3CQNA 2WEWA 4MEEA 1G7NA 5FQ6E 2FS6A 3PQSA 3ZUOA 1HMTA 1WUBA 2GJ5A 3SZHA 4ZH9A 3FW5A 2LA7A 2OZQA 2X46A 3BSZE 2IZJA 5BVTA 2RN4A 1SLGB 2ZAGA 4U8UO 1AVDA 2OY7A 5IO7A 3JSQA 1GT4A 4FBVA 2MJIA 3RE6A 4D6AA 4EKVA 5KICA 5B2AO 3VG4A 1PBOA 3P6EA 1DZKA 1OPBA 1KXOA 1T8VA 2O62A 1ERXA 4HPAA 1Y9TA 1KL4A 3FEPA 4TLJA 1YWAA 3APXA 3QQ2A 3FA8A 1HBPA 1SWOA 5LKEA 1UYNX 2RCTA 3NQKA 4FBOA 1VWPB 1ALBA 1SWRA 2BSZA 1KT6A 4QGWA 5L8IA 1HQPA 1LDQA 3HOEA 4AZNA 1N43A 3VHHA 2OF9A 1KGLA 5FQ7E 1SXYA 1BSOA 1BEBA
chains in the Genus database with same CATH topology
4IABA 4O3XB 4FQBB 4MIRA 2GC9A 1FE3A 2HZRA 3BRNA 4IB7A 1YWDA 3T1DA 4BOEA 2FS7A 3NQ9A 3TGAA 5KHPA 1PMPA 5EDCA 4LKPA 2ALLX 2OVDA 5CYBA 3ELZA 4ZHHA 3QKGA 1EQDA 4ZHDA 1BRPA 4OMXA 4NW4A 4U8UM 3B2LA 3WOVA 1N0SA 1RLBE 1OBUA 3KZAA 3APUA 3PEDA 5H9LA 4RUUA 4ZR2A 2JU3A 1U17A 5H9KA 1S2PA 1YIVA 1MUPA 1GKAA 1SXXA 5HBSA 2FTBA 3UEVA 4FBRA 1B56A 3ZZVA 4NYQA 4KH8A 2A3FX 5LJGA 4HPDA 3ZW1A 1R0UA 4GNWA 5JR8A 4GDZA 3CWKA 5EZ2A 2Q39A 3FW4A 4I3BA 3VG3A 3S5XA 2CBSA 4BVMA 3MX7A 2FLJA 4O9SA 2K23A 5D47A 5EPQA 4ZHCA 5BYPA 3VG2A 1JYDA 5D8JA 2YG2A 1ERBA 3HWGA 5LJHA 2WSJA 1KZXA 2L9CA 4ML7B 4Y0SA 1SY2A 1BSQA 4OS0A 5HTDA 4I6SA 1LIEA 4WFUA 1B4MA 4IMNA 1FELA 4QYNA 1DV9A 3FA9A 2ZAIA 3GAQA 3WJGA 1GXAA 1YWBA 1PEEA 3KFGA 5HZ5A 3ELXA 4Y0QA 2KT4B 3BU9A 3D97A 3FENA 3P6HA 3V8UA 5FFHA 2CZUA 3I0AA 3ZI8A 3Q6LA 1IIUA 2HLVA 1ADLA 3WJDA 2AT5X 1EUOA 1T68X 3S26A 3I17A 1ZNEA 1CBQA 1BRQA 1ML7A 4YBUA 3FYFA 4ORSA 3APWA 1X8PA 3C77X 4I3CA 1EXSA 4ZH6A 5HZQA 2JMBA 4AW8A 5KIDA 4QYPA 2A2GA 2BS5A 1I05A 1ZNLA 1FEMA 1OPAA 1QFVA 2NP1A 3EM0A 3NP1A 2KTSA 4GH7A 4QGXA 3U03A 3FIQA 3AKMA 2L68A 3DTQA 1IW2A 4UU2A 2RCQA 5FQ8E 4GKCA 1FDQA 4YCEA 4QGVA 3D96A 1RBPA 1IKJA 1QY0A 5L8OA 3C78X 3P6CA 4NLJA 3FR4A 2X8SA 1O1UA 1BM5A 4KC7A 1Z24A 1B0OA 4I3DA 2AKQA 1EI5A 3O19A 4GRJA 4OS8A 2CZTA 2LKKA 4KIIA 2W2AA 3TGBA 1KZWA 1BBPA 3HOLA 2Q4NA 4ORUA 2GTLO 1LIFA 3FMZA 5CE4A 3H3IA 5HWZA 4CK4A 2AL0X 5BVSA 4ZHFA 1MDCA 3CBSA 3UEXA 4DQ3A 1QQSA 2NNDA 1AELA 2AT3X 2JOZA 2QO5A 3CMPA 1YUPA 4IMOA 4R0BA 3P6GA 4MVKA 3STMX 5HZ8A 4XMCA 4YFQA 1JYJA 4WHIA 4EQAC 2ACOA 2BHVA 3AKNA 4O3YA 2RD7C 2AT6X 3FELA 5DG4A 5F6ZA 2F73A 2RQ0A 4TKHA 2BS6A 2Q2MA 1TXLA 1X71A 3GE2A 4K19A 4AZPA 5HZ6A 1EIIA 3STKA 4XMFA 2JN3A 1TW4A 4A1HA 4IAWA 4XMHA 1QY1A 4YKMA 1UREA 4YH0A 3EYCA 3C76X 3ZW0B 4XMDA 2F09A 2GTLM 1H91A 1VPRA 1Y9LA 2W2BA 2WUTA 5B27A 1T0VA 1ZNKA 1G85A 2AT0X 2XKLA 3IFBA 2MWHA 3F6ZB 3NADA 4EDEA 3HWEA 4GE1A 5AJCA 3SAOA 5F1EA 4YFPA 5H8TA 4ZHGA 1A57A 4Y0PA 4O4OA 1X8OA 1O1VA 4CSBA 1IFBA 1SXWA 4O4XA 1OEKA 3PQUA 2HNXA 3BU1A 3PH6A 1DZPA 3WXQA 3VE2A 3SOTA 3ZUIA 2A13A 1IFCA 5HCCC 1KQXA 1MVGA 5IO6A 3UEWA 1LF7A 2WEXA 1EW3A 2FT9A 4ORWA 1X8QA 2OVSA 1I04A 3WBGA 2WWPA 1YWCA 1IKEA 1G74A 1P6PA 3BLGA 4EEJA 5LJEA 2E4JA 3LV4A 4MVLA 2MM3A 3D95A 1X8UA 3LHNA 1HN2A 3B2IA 1KT7A 1BJ7A 1GGLA 3U0DA 1NGLA 1UZ2X 5IO5A 3BS2A 4TKJA 1PM1X 4O49A 2Z4IA 3E3CA 4I95A 4HFOA 2Z4HA 4NNSA 4O3ZA 5D48A 4A1YA 1TVQA 3VG5A 1LICA 2IFBA 2WR6A 2QOSC 1E02A 3RBYA 2W2FA 4HPCA 4EFGA 1SMPI 5LKFA 2L67A 4MISA 4YGZA 1EPAA 1YP6A 3OBLA 4QAEA 4YMYA 2MHDA 4Y0RA 3WJFA 1KT4A 2X8FA 4O4SA 5HTEA 1CBRA 4NP1A 4YBPA 4QRLA 5D4AA 4TJZA 3N91A 5L8NA 4QQ1A 4WFVA 2AH7X 3PH5A 4ODDA 2CM9A 5LJKA 5FAZA 1HBQA 5HCDC 5H9NA 1JZUA 3FA6A 2LBAA 3CBCA 1XCAA 2L5PA 4GK9A 4L3RA 1AVGI 1D2UA 1GX8A 3VPJE 2OFMX 3O22A 4IBAA 3P6DA 2WQ9A 4KCAA 1JV4A 2QM9A 4N7CA 1JJXA 1KQWA 4IAXA 1DZJA 1ACDA 1KT3A 2QO6A 4ORXA 1E5PA 3HTYA 1JBHA 3B2KA 1DZMA 3FEKA 1JIWI 1OEEA 1X89A 1B8EA 1VYGA 3OD9A 3ZQ3A 4U3QA 2WQAE 4GNYA 2G7BA 5F58A 1SY3A 3JS1A 2A0AA 4YFRA 4INNA 1LIDA 5H9AA 3BX7A 3FA7A 4QNIA 3STNA 4AZOA 3VG7A 4GU8A 4XMGA 1YP7A 3FR5A 3P24A 4ORRA 2LB6A 4BQUA 1EPBA 1S44A 2RA6A 2QO4A 1U18A 4TNNA 3L4RA 5AJBA 4O4UA 1LPJA 2A2UA 1LIBA 1I4UA 4AZMA 1ZNHA 1EIOA 2AMMX 3DSZA 1GKAB 2OVAA 3UEUA 2NNQA 1FENA 2K62A 1G5WA 2GTFX 4N7DA 2AT8X 3WJEA 3ZW1B 2R74A 1ICNA 2MO5A 1CBIA 4LQZA 4PJ2A 4I9RA 4ZGUA 2FR3A 3WVMA 1LNMA 2OVEA 3VU1A 1SY0A 4A8ZA 4COTA 2Q2PA 4TQ2A 5B29A 1AQBA 1TOUA 5FENA 4PSQA 5LJCA 2OFRX 3NR3A 4D6BA 1LFOA 4ARHA 2CBRA 1GT1A 1U0XA 5EEDA 5AQ6A 5HA0A 5HCEC 1HMRA 1LKEA 2JU8A 3OE3A 1BLRA 1AB0A 2ANSA 3B2JA 3FLLA 4EXZA 1QFTA 2KD2A 1OBQA 2POAA 4OS3A 1QWDA 1OEJA 4A60A 5AEOA 4ZFXA 3EBWA 4MVIA 4L1NA 5C0NA 3RWXA 3KQ0A 4M6SA 2R73A 3OJYC 3F8AA 1ICMA 4I9SA 5HZ9A 4ZGFA 1SY1A 4QZUA 3S60A 3O2YA 3U9PC 2JW1A 2G78A 2KTDA 4U9CA 4YKOA 5BVQA 3TF6A 4HPBA 5LJBA 3PECA 1DFVA 3VG6A 4IB6A 3EMMA 3HWFA 3D4RA 2XSTA 1A2DA 3IA8A 5DPQA 2CM4A 1KOIA 4AZQA 4YGHA 1L6MA 5F7GA 2FR2A 1A18A 1DF3A 1E06A 2PY1A 3HWDA 4OMWA 3UAQA 3B2HA 4JGLA 4ZJ0A 4XMEA 3S5VA 1TOWA 3MBTA 2Q9SA 4AZRA 2M4LA 2P8GA 3NQ3A 3KFFA 2HMBA 4LZVA 4YCHA 3NPOA 1SXUA 4ZCBA 3ZW0A 4MVEA 1CJ5A 2FRSA 3WJCA 1A3YA 2NNEA 3APVA 1GM6A 3BY0A 4NNTA 2JU7A 1XKIA 4ID2A 4IB8A 3CR6A 2HZQA 1GT3A 1GX9A 4ALOA 3BDRA 1CBSA 3G7XA 3NX1A 3PPTA 2N93A 3K3LA 5EDBA 3PP6A 4YDAA 1JJJA 1KT5A 1QY2A 5D45A 2ASNX 3EBKA 5HA1A 4O3WA 3HK1A 3P6FA 3NX2A 2X45A 4DQ4A 1FTPA 2GTLN 4AYHA 1DC9A 4UU3A 2ACPX 1ZNDA 2G79A 4KT5A 1NP4A 2DM5A 4FGIB 3ZWEA 3BX8A 1ZRYA 4YDBA 2BLGA 3MVFA 1MX8A 4QZTA 4U8UN 1QABE 2BT9A 5LJDA 2QMIA 1S7DA 5HAEA 1QG5A 4KC8A 4LZUA 4M7MA 2EU7X 3RZYA 2LBVA 3CQRA 2X8TA 1D3SA 1OBPA 4NLIA 3P02A 3KFIA 4GZVA 3F9DA 5K06A 1MX7A 3RKGA 3NBXX 4RUNA 2R56A 4ORYA 3RSWA 1GT5A 4ES7A 2HYSA 2FWVA 1ZNGA 4YGGA 3ZW2A 3TGCA 5F6BA 4ALBA 3JQOA 3VE1A 3TZSA 1CRBA 1X8NA 1BWYA 3FR2A 4TKBA 1VYFA 3KFHA 4HWMA 4GETA 4WBKA 1BSYA 5EEEA 3WJBA 4CV7A 1SA8A 1NP1A 4IB9A 2LFOA 1HMSA 2YMSA 4NYRA 4LKTA 1E00A 4ON1A 1EALA 2KW1A 1O8VA 1I06A 3CQNA 2WEWA 1G7NA 5FQ6E 2FS6A 3PQSA 3ZUOA 1HMTA 2GJ5A 4ZH9A 3FW5A 2LA7A 2OZQA 2X46A 3BSZE 5BVTA 2RN4A 2ZAGA 4U8UO 5IO7A 3JSQA 1GT4A 4FBVA 2MJIA 4D6AA 5KICA 3VG4A 1PBOA 3P6EA 1DZKA 1OPBA 1KXOA 1T8VA 2O62A 1ERXA 4HPAA 1Y9TA 3FEPA 4TLJA 1YWAA 3APXA 3FA8A 1HBPA 5LKEA 2RCTA 3NQKA 4FBOA 1ALBA 5L8IA 4QGWA 1KT6A 1HQPA 3HOEA 4AZNA 1KGLA 5FQ7E 1SXYA 1BSOA 1BEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8N A;  2GC9 A;  1FE3 A;  2HZR A;  3BRN A;  4IB7 A;  1YWD A;  3T1D A;  4BOE A;  2FS7 A;  3NQ9 A;  3TGA A;  5KHP A;  1PMP A;  5EDC A;  4LKP A;  2ALL X;  2OVD A;  3ELZ A;  4ZHH A;  3QKG A;  1EQD A;  4ZHD A;  1BRP A;  4OMX A;  3B2L A;  1N0S A;  1RLB E;  1OBU A;  3KZA A;  3APU A;  3PED A;  5H9L A;  4RUU A;  4ZR2 A;  2JU3 A;  1U17 A;  5H9K A;  1S2P A;  1YIV A;  1MUP A;  1GKA A;  1SXX A;  5HBS A;  2FTB A;  3UEV A;  1B56 A;  4NYQ A;  2A3F X;  5LJG A;  4HPD A;  5JR8 A;  1R0U A;  4GNW A;  3CWK A;  5EZ2 A;  2Q39 A;  3FW4 A;  4I3B A;  3VG3 A;  2CBS A;  4BVM A;  4O9S A;  2FLJ A;  5D47 A;  2K23 A;  5EPQ A;  4ZHC A;  3VG2 A;  1JYD A;  5D8J A;  2YG2 A;  1ERB A;  3HWG A;  5LJH A;  2WSJ A;  1KZX A;  2L9C A;  4Y0S A;  1SY2 A;  1BSQ A;  4OS0 A;  5HTD A;  4WFU A;  1LIE A;  1B4M A;  4IMN A;  1FEL A;  4QYN A;  1DV9 A;  3FA9 A;  3WJG A;  3GAQ A;  1GXA A;  1YWB A;  1PEE A;  3KFG A;  5HZ5 A;  3ELX A;  4Y0Q A;  2KT4 B;  3BU9 A;  3D97 A;  3FEN A;  3P6H A;  5FFH A;  2CZU A;  3I0A A;  3Q6L A;  1IIU A;  2HLV A;  1ADL A;  3WJD A;  2AT5 X;  1EUO A;  1T68 X;  3S26 A;  3I17 A;  1ZNE A;  1CBQ A;  1BRQ A;  1ML7 A;  4YBU A;  4ORS A;  3APW A;  1X8P A;  3C77 X;  4I3C A;  1EXS A;  4ZH6 A;  5HZQ A;  4AW8 A;  5KID A;  4QYP A;  2A2G A;  1I05 A;  1ZNL A;  1FEM A;  1OPA A;  1QFV A;  2NP1 A;  3EM0 A;  3NP1 A;  4GH7 A;  4QGX A;  3U03 A;  3FIQ A;  3AKM A;  2L68 A;  3DTQ A;  1IW2 A;  4UU2 A;  2RCQ A;  4GKC A;  1FDQ A;  4YCE A;  4QGV A;  3D96 A;  1RBP A;  1IKJ A;  1QY0 A;  5L8O A;  3C78 X;  3P6C A;  4NLJ A;  3FR4 A;  1O1U A;  1BM5 A;  1Z24 A;  1B0O A;  4I3D A;  2AKQ A;  3O19 A;  4GRJ A;  4OS8 A;  2CZT A;  2LKK A;  4KII A;  2W2A A;  3TGB A;  1KZW A;  1BBP A;  2Q4N A;  4ORU A;  1LIF A;  3FMZ A;  5CE4 A;  5HWZ A;  4CK4 A;  2AL0 X;  5BVS A;  4ZHF A;  1MDC A;  3CBS A;  3UEX A;  4DQ3 A;  1QQS A;  2NND A;  1AEL A;  2AT3 X;  2JOZ A;  2QO5 A;  3CMP A;  1YUP A;  4IMO A;  4R0B A;  3P6G A;  4MVK A;  3STM X;  5HZ8 A;  4XMC A;  4YFQ A;  1JYJ A;  2ACO A;  3AKN A;  2RD7 C;  2AT6 X;  3FEL A;  5DG4 A;  5F6Z A;  2F73 A;  2RQ0 A;  4TKH A;  2Q2M A;  1TXL A;  1X71 A;  4K19 A;  4AZP A;  5HZ6 A;  1EII A;  3STK A;  4XMF A;  2JN3 A;  1TW4 A;  4A1H A;  4IAW A;  4XMH A;  1QY1 A;  4YKM A;  1URE A;  4YH0 A;  3EYC A;  3C76 X;  4XMD A;  1H91 A;  1VPR A;  2W2B A;  2WUT A;  5B27 A;  1T0V A;  1ZNK A;  1G85 A;  2AT0 X;  2XKL A;  3IFB A;  3NAD A;  4EDE A;  3HWE A;  4GE1 A;  3SAO A;  5F1E A;  4YFP A;  5H8T A;  4ZHG A;  1A57 A;  4Y0P A;  1X8O A;  1O1V A;  1IFB A;  1SXW A;  1OEK A;  2HNX A;  3BU1 A;  3PH6 A;  1DZP A;  3WXQ A;  3ZUI A;  2A13 A;  1IFC A;  5HCC C;  1KQX A;  1MVG A;  5IO6 A;  3UEW A;  1LF7 A;  2WEX A;  1EW3 A;  2FT9 A;  4ORW A;  1X8Q A;  3WBG A;  1I04 A;  2WWP A;  1YWC A;  1IKE A;  1G74 A;  1P6P A;  3BLG A;  4EEJ A;  5LJE A;  2E4J A;  4MVL A;  2MM3 A;  3D95 A;  1X8U A;  1HN2 A;  3B2I A;  1KT7 A;  1BJ7 A;  1GGL A;  3U0D A;  1NGL A;  1UZ2 X;  5IO5 A;  3BS2 A;  4TKJ A;  1PM1 X;  4HFO A;  4NNS A;  5D48 A;  4A1Y A;  1TVQ A;  3VG5 A;  1LIC A;  2IFB A;  2WR6 A;  2QOS C;  1E02 A;  2W2F A;  4HPC A;  4EFG A;  5LKF A;  2L67 A;  4YGZ A;  1EPA A;  1YP6 A;  4QAE A;  4YMY A;  4Y0R A;  3WJF A;  1KT4 A;  5HTE A;  1CBR A;  4NP1 A;  4YBP A;  5D4A A;  4TJZ A;  4WFV A;  2AH7 X;  3PH5 A;  4ODD A;  2CM9 A;  5LJK A;  5FAZ A;  1HBQ A;  5HCD C;  5H9N A;  1JZU A;  3FA6 A;  2LBA A;  3CBC A;  1XCA A;  2L5P A;  1AVG I;  1D2U A;  1GX8 A;  2OFM X;  3O22 A;  4IBA A;  3P6D A;  2WQ9 A;  1JV4 A;  2QM9 A;  4N7C A;  1JJX A;  1KQW A;  4IAX A;  1DZJ A;  1ACD A;  1KT3 A;  2QO6 A;  4ORX A;  1E5P A;  1JBH A;  3B2K A;  1DZM A;  3FEK A;  3ZQ3 A;  1OEE A;  1X89 A;  1B8E A;  1VYG A;  2WQA E;  4GNY A;  2G7B A;  5F58 A;  1SY3 A;  3JS1 A;  2A0A A;  4YFR A;  5H9A A;  1LID A;  3BX7 A;  3FA7 A;  3STN A;  4AZO A;  3VG7 A;  4XMG A;  1YP7 A;  3FR5 A;  4ORR A;  2LB6 A;  4BQU A;  1EPB A;  1S44 A;  2RA6 A;  2QO4 A;  1U18 A;  4TNN A;  3L4R A;  1LPJ A;  2A2U A;  1LIB A;  1I4U A;  4AZM A;  1ZNH A;  1EIO A;  2AMM X;  3DSZ A;  1GKA B;  2OVA A;  3UEU A;  2NNQ A;  1FEN A;  2K62 A;  1G5W A;  2GTF X;  4N7D A;  2AT8 X;  3WJE A;  2R74 A;  1ICN A;  2MO5 A;  1CBI A;  4I9R A;  4ZGU A;  2FR3 A;  3WVM A;  1LNM A;  2OVE A;  1SY0 A;  4A8Z A;  5B29 A;  2Q2P A;  4TQ2 A;  5FEN A;  1AQB A;  1TOU A;  4PSQ A;  5LJC A;  2OFR X;  3NR3 A;  4D6B A;  1LFO A;  4ARH A;  2CBR A;  1GT1 A;  1U0X A;  5EED A;  5AQ6 A;  5HA0 A;  5HCE C;  1HMR A;  1LKE A;  2JU8 A;  1BLR A;  1AB0 A;  2ANS A;  3B2J A;  3FLL A;  4EXZ A;  1QFT A;  2POA A;  1OBQ A;  4OS3 A;  1QWD A;  1OEJ A;  4A60 A;  4ZFX A;  3EBW A;  4MVI A;  5C0N A;  3KQ0 A;  4M6S A;  2R73 A;  3OJY C;  3F8A A;  1ICM A;  4I9S A;  5HZ9 A;  1SY1 A;  4QZU A;  3O2Y A;  3U9P C;  2G78 A;  2KTD A;  4YKO A;  5BVQ A;  3TF6 A;  4HPB A;  5LJB A;  3PEC A;  1DFV A;  3VG6 A;  4IB6 A;  3EMM A;  3HWF A;  2XST A;  1A2D A;  3IA8 A;  5DPQ A;  2CM4 A;  1KOI A;  4AZQ A;  4YGH A;  1L6M A;  5F7G A;  2FR2 A;  1A18 A;  1DF3 A;  1E06 A;  2PY1 A;  3HWD A;  4OMW A;  3B2H A;  4ZJ0 A;  4XME A;  1TOW A;  3MBT A;  2Q9S A;  4AZR A;  2P8G A;  3NQ3 A;  3KFF A;  2HMB A;  4LZV A;  4YCH A;  3NPO A;  1SXU A;  4ZCB A;  1CJ5 A;  2FRS A;  3WJC A;  1A3Y A;  2NNE A;  3APV A;  1GM6 A;  3BY0 A;  4NNT A;  2JU7 A;  1XKI A;  4IB8 A;  3CR6 A;  2HZQ A;  1GT3 A;  1GX9 A;  4ALO A;  3BDR A;  1CBS A;  3G7X A;  3NX1 A;  3PPT A;  2N93 A;  3K3L A;  5EDB A;  3PP6 A;  4YDA A;  1JJJ A;  1KT5 A;  1QY2 A;  5D45 A;  2ASN X;  3EBK A;  5HA1 A;  3HK1 A;  3P6F A;  3NX2 A;  2X45 A;  4DQ4 A;  1FTP A;  4AYH A;  1DC9 A;  4UU3 A;  2ACP X;  1ZND A;  2G79 A;  1NP4 A;  2DM5 A;  3BX8 A;  1ZRY A;  4YDB A;  2BLG A;  3MVF A;  1MX8 A;  4QZT A;  5LJD A;  1QAB E;  1S7D A;  5HAE A;  1QG5 A;  4LZU A;  4M7M A;  2EU7 X;  3RZY A;  2LBV A;  3CQR A;  1D3S A;  1OBP A;  4NLI A;  3KFI A;  3F9D A;  5K06 A;  1MX7 A;  4RUN A;  2R56 A;  4ORY A;  3RSW A;  1GT5 A;  4ES7 A;  2HYS A;  2FWV A;  1ZNG A;  4YGG A;  3TGC A;  5F6B A;  4ALB A;  3TZS A;  1CRB A;  1X8N A;  1BWY A;  3FR2 A;  4TKB A;  1VYF A;  3KFH A;  4GET A;  4WBK A;  1BSY A;  5EEE A;  3WJB A;  1SA8 A;  1NP1 A;  4IB9 A;  2LFO A;  1HMS A;  4NYR A;  4LKT A;  1E00 A;  1EAL A;  1O8V A;  1I06 A;  3CQN A;  2WEW A;  1G7N A;  2FS6 A;  3ZUO A;  1HMT A;  2GJ5 A;  4ZH9 A;  3FW5 A;  2OZQ A;  2X46 A;  3BSZ E;  5BVT A;  5IO7 A;  3JSQ A;  1GT4 A;  5KIC A;  2MJI A;  4D6A A;  3VG4 A;  1PBO A;  3P6E A;  1DZK A;  1OPB A;  1KXO A;  1T8V A;  2O62 A;  1ERX A;  4HPA A;  3FEP A;  4TLJ A;  1YWA A;  3APX A;  3FA8 A;  1HBP A;  5LKE A;  2RCT A;  1ALB A;  5L8I A;  4QGW A;  1KT6 A;  1HQP A;  4AZN A;  1KGL A;  1SXY A;  1BSO A;  1BEB A; 
#chains in the Genus database with same CATH topology
 4IAB A;  4O3X B;  4FQB B;  4MIR A;  2GC9 A;  1FE3 A;  2HZR A;  1JQP A;  3AUM O;  1YWD A;  3BRN A;  4IB7 A;  2FS7 A;  3T1D A;  4BOE A;  3NQ9 A;  1RXH A;  3TGA A;  4B55 A;  5KHP A;  4BX6 B;  1PMP A;  5EDC A;  4LKP A;  2ALL X;  1I78 A;  2OVD A;  5CYB A;  3ELZ A;  1SWA A;  4ZHH A;  1VWG B;  4I60 A;  3QKG A;  2RTC B;  1EQD A;  1RXK A;  4ZHD A;  1BRP A;  4OMX A;  4CDE A;  4NW4 A;  4U8U M;  3B2L A;  3WOV A;  1N0S A;  1RLB E;  1OBU A;  4CPE A;  2IZI A;  3KZA A;  3APU A;  3PED A;  1RXJ A;  3T6F A;  5H9L A;  4RUU A;  4ZR2 A;  2JU3 A;  1U17 A;  5H9K A;  1S2P A;  1YIV A;  1MUP A;  1GKA A;  1SRG A;  1SWH A;  1SXX A;  2FTB A;  2IZF B;  1B56 A;  5HBS A;  4NYQ A;  3UEV A;  1KFF A;  4KH8 A;  3ZZV A;  2A3F X;  5LJG A;  4HPD A;  3ZW1 A;  1R0U A;  4GNW A;  5JR8 A;  4GDZ A;  3CWK A;  1SWP A;  2Q39 A;  3FID A;  3FW4 A;  2A5C A;  4I3B A;  5EZ2 A;  3S5X A;  3SZI A;  3VG3 A;  1LDO A;  2CBS A;  4BVM A;  2Y32 A;  1SWS A;  3MX7 A;  2FLJ A;  4O9S A;  2K23 A;  5D47 A;  5EPQ A;  5F2B A;  4ZHC A;  5BYP A;  3VG2 A;  1JYD A;  1SWE A;  2YG2 A;  5D8J A;  1ERB A;  3HWG A;  5B3M O;  1I9H A;  2HKD A;  4NV8 A;  2WSJ A;  5LJH A;  1KZX A;  2RTR B;  2X32 A;  2L9C A;  4BX7 B;  4ML7 B;  4Y0S A;  4U46 A;  1SY2 A;  1BSQ A;  2OFA A;  4OS0 A;  4CDF A;  4I6S A;  1LIE A;  4WFU A;  3X00 A;  5HTD A;  1B4M A;  4IMN A;  1FEL A;  4IRW A;  4QYN A;  1DV9 A;  4GJV A;  2GH7 A;  2RTF B;  1NDJ A;  2ZAI A;  3FA9 A;  3GAQ A;  3WJG A;  1GXA A;  1YWB A;  1LEL A;  1JJU A;  4BX6 A;  1PEE A;  2RTL A;  3KFG A;  4Z2P A;  2RTQ B;  5HZ5 A;  3ELX A;  4Y0Q A;  1UYO X;  2KT4 B;  3BU9 A;  3D97 A;  3FEN A;  3P6H A;  3V8U A;  4YVB A;  5FFH A;  5K67 A;  2CZU A;  3I0A A;  3ZI8 A;  4OKA A;  3Q6L A;  1IIU A;  2HLV A;  1ADL A;  2Y3F A;  3WJD A;  1EIO A;  2AT5 X;  1EUO A;  1T68 X;  3S26 A;  1LCV A;  3I17 A;  1ZNE A;  1CBQ A;  1JMZ A;  2FGS A;  1BRQ A;  1ML7 A;  4YBU A;  3FYF A;  4ORS A;  3APW A;  1X8P A;  3C77 X;  4I3C A;  1EXS A;  4ZH6 A;  5HZQ A;  2IZA A;  2JMB A;  1SLF B;  4GGR A;  4AW8 A;  5KID A;  4QYP A;  2A2G A;  2BS5 A;  1I05 A;  1ZNL A;  1FEM A;  1OPA A;  1QFV A;  2NP1 A;  1VWA B;  3EM0 A;  2KTS A;  3KVN A;  3NP1 A;  4GH7 A;  1KL3 A;  1RSU B;  2DJG A;  3AKM A;  3FIQ A;  2L68 A;  3DTQ A;  1IW2 A;  4UU2 A;  3RY1 A;  2RCQ A;  2OY5 O;  5FQ8 E;  4GKC A;  1FDQ A;  1LCZ A;  4YCE A;  4QGV A;  3D96 A;  1RBP A;  1IKJ A;  3RDQ A;  1QY0 A;  5L8O A;  3LTW A;  4BCS A;  1STR B;  2C4I A;  2FKG A;  3C78 X;  2RTJ A;  3P6C A;  4NLJ A;  3FR4 A;  3RDS A;  2X8S A;  1O1U A;  1VWO B;  1BM5 A;  4CPH B;  4KC7 A;  1Z24 A;  1B0O A;  4I3D A;  2AKQ A;  1EI5 A;  3O19 A;  4GRJ A;  4OS8 A;  2CZT A;  2LKK A;  5B5F A;  4KII A;  2W2A A;  3TGB A;  1KZW A;  1BBP A;  2G8C O;  3HOL A;  2Q4N A;  4ORU A;  2GTL O;  1LIF A;  1SWQ A;  2A5B A;  2X34 A;  4OEL A;  3FMZ A;  4BX5 B;  5CE4 A;  3H3I A;  5HWZ A;  4CK4 A;  2AL0 X;  5BVS A;  4ZHF A;  1MDC A;  3CBS A;  3UEX A;  2G5L A;  4DQ3 A;  4GD9 A;  1QQS A;  2NND A;  4BJ8 A;  2AT3 X;  2JOZ A;  2QO5 A;  3CMP A;  1YUP A;  4IMO A;  2VFB A;  4R0B A;  3P6G A;  4MVK A;  3STM X;  3VHI A;  5HZ8 A;  4XMC A;  4YFQ A;  1JYJ A;  1VYO A;  4WHI A;  4EQA C;  2ACO A;  2CAM A;  2BHV A;  3AKN A;  1VWF B;  4O3Y A;  2RD7 C;  2AT6 X;  3FEL A;  5DG4 A;  5F6Z A;  2IZD B;  2PI3 O;  2F73 A;  2RQ0 A;  3WZN A;  4TKH A;  3T6L A;  2BS6 A;  2Q2M A;  1TXL A;  1X71 A;  2X4M A;  3GE2 A;  4K19 A;  3VGW A;  4AZP A;  2IZL B;  5HZ6 A;  1EII A;  1SWL A;  3STK A;  4XMF A;  3EW1 A;  2JN3 A;  1STS B;  1TW4 A;  4A1H A;  4IAW A;  1N4J A;  4XMH A;  1QY1 A;  4YKM A;  1URE A;  2OL8 O;  5B10 O;  5HCE C;  4YH0 A;  3EYC A;  1BLR A;  3C76 X;  3ZW0 B;  4XMD A;  1SWN A;  2F09 A;  2GTL M;  1H91 A;  1Y0G A;  1VPR A;  4NV7 A;  1Y9L A;  4Z27 A;  2W2B A;  2WUT A;  5B27 A;  1T0V A;  3WYP A;  5IRW A;  1ZNK A;  1G85 A;  2AT0 X;  1FJ1 E;  2JGS A;  2MWH A;  2XKL A;  3F6Z B;  3IFB A;  3HWE A;  3NAD A;  4EDE A;  4GE1 A;  4Z2V A;  1HXL A;  5AJC A;  3SAO A;  5F1E A;  4YFP A;  3MM0 A;  5H8T A;  4ZHG A;  1N9M A;  1VWD B;  1A57 A;  4GUZ A;  1VWM B;  1X8O A;  1O1V A;  4O4O A;  4Y0P A;  4CSB A;  1IFB A;  1SXW A;  4BX5 A;  4O4X A;  2UYW A;  3Q34 A;  1OEK A;  3PQU A;  2HNX A;  3BU1 A;  3PH6 A;  1DZP A;  3WXQ A;  3VE2 A;  3SOT A;  3ZUI A;  2A13 A;  1IFC A;  5HCC C;  1KQX A;  1MVG A;  5IO6 A;  3UEW A;  1LF7 A;  2OL6 O;  2WEX A;  5JD2 A;  1EW3 A;  2FT9 A;  4ORW A;  1SWJ A;  1X8Q A;  1I04 A;  2OVS A;  3WBG A;  2WWP A;  2AF5 A;  1SRE A;  1NQM A;  1YWC A;  1IKE A;  1G74 A;  1P6P A;  3BLG A;  3RE5 A;  4EEJ A;  2OYB O;  5LJE A;  4BBO A;  3U03 A;  2E4J A;  1N9Y A;  3LV4 A;  2IZG B;  4MVL A;  1W5R A;  2MM3 A;  3D95 A;  1SWD A;  1X8U A;  5IRA A;  3LHN A;  2FKJ A;  1HN2 A;  3B2I A;  1KT7 A;  1BJ7 A;  2BC3 A;  3PDF A;  1GGL A;  1RST B;  3U0D A;  1NGL A;  1UZ2 X;  5IO5 A;  3BS2 A;  4TKJ A;  1KL5 A;  1PM1 X;  4O49 A;  1VWR B;  2Z4I A;  2RTB B;  1SWT A;  3E3C A;  1IJ8 A;  1HY2 A;  4HFO A;  4I95 A;  2Z4H A;  4NNS A;  4O3Z A;  5D48 A;  4Z28 A;  4A1Y A;  3RY2 A;  1TVQ A;  3VG5 A;  1LIC A;  1VWH B;  2RTE B;  4GDA A;  1SRI A;  4CPF A;  2IFB A;  2WR6 A;  3EW2 A;  2QOS C;  3PK2 A;  1E02 A;  3RBY A;  2FHN X;  4JHQ A;  2W2F A;  4HPC A;  4EFG A;  1SMP I;  5LKF A;  2L67 A;  4MIS A;  4YGZ A;  1EPA A;  1YP6 A;  1JMX A;  2WPU A;  3OBL A;  4QAE A;  1LCW A;  4YMY A;  2MHD A;  4OEM A;  1PTS A;  4Y0R A;  3WJF A;  1KT4 A;  2X8F A;  3FDC A;  4O4S A;  5HTE A;  1CBR A;  4QGX A;  4NP1 A;  1VWJ B;  4QRL A;  2C1S A;  4YBP A;  5D4A A;  4TJZ A;  3N91 A;  5L8N A;  4QQ1 A;  4WFV A;  2AH7 X;  3PH5 A;  4ODD A;  2CM9 A;  5LJK A;  1SRH A;  5FAZ A;  3VHM A;  1HBQ A;  5HCD C;  5H9N A;  3RDO A;  5CHK A;  1JZU A;  5B5G A;  3FA6 A;  2LBA A;  3CBC A;  1XCA A;  2L5P A;  4GK9 A;  2IZK A;  4L3R A;  1AVG I;  1D2U A;  1GX8 A;  1VWE B;  3VPJ E;  2OFM X;  4Z2O A;  3O22 A;  4BX7 A;  1AVE A;  4IBA A;  2RTM A;  3P6D A;  2WQ9 A;  2VFC A;  4KCA A;  2Y3E A;  4BGF A;  1JV4 A;  2QM9 A;  1SWC A;  4N7C A;  2X56 A;  1JJX A;  1KQW A;  2VDF A;  4IAX A;  1DZJ A;  1NQN A;  1ACD A;  2ZSC A;  1KT3 A;  2QO6 A;  4ORX A;  1E5P A;  3HTY A;  1JBH A;  3B2K A;  1DZM A;  3FEK A;  1JIW I;  1OEE A;  1X89 A;  1B8E A;  1VYG A;  2RTG B;  3OD9 A;  3ZQ3 A;  4U3Q A;  2WQA E;  4GNY A;  2G7B A;  4CDD A;  5F58 A;  1SY3 A;  3JS1 A;  2A0A A;  1HXZ A;  1MM9 A;  4YFR A;  4INN A;  1LID A;  5H9A A;  3BX7 A;  3FA7 A;  4QNI A;  3STN A;  4AZO A;  3VG7 A;  4GU8 A;  1W4T A;  4XMG A;  4Y5D A;  1YP7 A;  3FR5 A;  1VWB B;  3P24 A;  2LB6 A;  4ORR A;  1E2T A;  4BQU A;  1EPB A;  1S44 A;  2RA6 A;  2QO4 A;  1U18 A;  4TNN A;  3CKG A;  1HQQ A;  2I5V O;  3L4R A;  5AJB A;  4O4U A;  1LPJ A;  2A2U A;  4JO6 A;  1LIB A;  1I4U A;  1SWB A;  2MF6 A;  1ZNH A;  4AZM A;  2AMM X;  3DSZ A;  1GKA B;  2QOM A;  2OVA A;  3UEU A;  1Y55 X;  2NNQ A;  1FEN A;  2K62 A;  1AEL A;  4FBR A;  3CKF A;  1G5W A;  2GTF X;  4N7D A;  2AT8 X;  2IZE B;  3WJE A;  3ZW1 B;  2R74 A;  1ICN A;  3EC5 A;  2MO5 A;  1CBI A;  4LQZ A;  4PJ2 A;  2RTI B;  4I9R A;  3RDU A;  2IZB A;  4ZGU A;  2FR3 A;  1SRF A;  3WVM A;  1LNM A;  1GX3 A;  2OVE A;  3VU1 A;  1SY0 A;  3SLJ A;  3D9W A;  4A8Z A;  4COT A;  2Q2P A;  1SLD B;  4TQ2 A;  1AQB A;  1TOU A;  5B29 A;  5FEN A;  4PSQ A;  5LJC A;  2OFR X;  3NR3 A;  4D6B A;  1LFO A;  4ARH A;  2CBR A;  4CPH A;  1GT1 A;  1U0X A;  5EED A;  5AQ6 A;  1K24 A;  4GGT A;  1HMR A;  1LKE A;  1SRJ A;  2JU8 A;  3OE3 A;  5B11 O;  5HA0 A;  3WZP A;  3AEH A;  1AB0 A;  2ANS A;  3B2J A;  3FLL A;  4EXZ A;  1QFT A;  2KD2 A;  1OBQ A;  2POA A;  2RTO B;  1NC9 A;  4OS3 A;  3T2W A;  3SLT A;  1QWD A;  1OEJ A;  4Y59 A;  4A60 A;  4ZFX A;  3EBW A;  5AEO A;  4MVI A;  4L1N A;  5C0N A;  3RWX A;  5L3Y A;  3KQ0 A;  4M6S A;  1VWI B;  2R73 A;  1SLE B;  5CSE A;  2FHL A;  1SWK A;  1ICM A;  3F8A A;  3OJY C;  4I9S A;  4ZGF A;  5HZ9 A;  1SY1 A;  4QZU A;  3S60 A;  1Y53 X;  3O2Y A;  2C1Q A;  3MG5 A;  2JW1 A;  2G78 A;  3U9P C;  1VWN B;  2KTD A;  4U9C A;  4YKO A;  5BVQ A;  3TF6 A;  4HPB A;  4CDC A;  5LJB A;  3PEC A;  1DFV A;  1STP A;  3VG6 A;  4IB6 A;  3EMM A;  3HWF A;  3D4R A;  2XST A;  1A2D A;  3IA8 A;  5DPQ A;  3T2X A;  2CM4 A;  1KOI A;  4AZQ A;  4YGH A;  1L6M A;  1SWG A;  5F7G A;  2RTH B;  2FR2 A;  1A18 A;  1MOY A;  3WZQ A;  1DF3 A;  2I5Z O;  1E06 A;  2PY1 A;  3HWD A;  4OMW A;  4GJS A;  3UAQ A;  1OSP O;  3B2H A;  4JGL A;  2OY8 A;  4ZJ0 A;  4XME A;  3S5V A;  1TOW A;  3MBT A;  2Q9S A;  4AZR A;  2M4L A;  4C5P A;  1MK5 A;  2P8G A;  3NQ3 A;  3KFF A;  2HMB A;  4LZV A;  4YCH A;  3NPO A;  1SXU A;  4ZCB A;  3SZJ A;  3ZW0 A;  4MVE A;  1CJ5 A;  4Z6J A;  2FRS A;  3WJC A;  1A3Y A;  2NNE A;  3APV A;  1GM6 A;  3BY0 A;  4GGZ A;  4NNT A;  2JU7 A;  1W6F A;  1XKI A;  4DNE A;  2A8G A;  4ID2 A;  4IB8 A;  3CR6 A;  5IRU A;  2RTK A;  1LUQ A;  2HZQ A;  1GT3 A;  1GX9 A;  4ALO A;  3BDR A;  1CBS A;  1VWL B;  3G7X A;  3NX1 A;  3PPT A;  3WYQ A;  2N93 A;  3K3L A;  5EDB A;  3PP6 A;  4YDA A;  1JJJ A;  1KT5 A;  1QY2 A;  5D45 A;  2ASN X;  3EBK A;  5HA1 A;  4O3W A;  2AVI A;  3HK1 A;  3NX2 A;  3P6F A;  2X45 A;  2DJF A;  1FTP A;  3WZO A;  4DCB A;  4DQ4 A;  2GTL N;  4AYH A;  2RTN B;  1DC9 A;  4UU3 A;  1SWF A;  2ACP X;  1ZND A;  2G79 A;  4KT5 A;  1NP4 A;  2DM5 A;  4FGI B;  3ZWE A;  3BX8 A;  1ZRY A;  4YDB A;  2BLG A;  3MVF A;  1MX8 A;  4QZT A;  4U8U N;  1QAB E;  2BT9 A;  3HPE A;  5LJD A;  2QMI A;  1S7D A;  5HAE A;  1QG5 A;  1WBI A;  4KC8 A;  3SLO A;  1MEP A;  4LZU A;  4M7M A;  2EU7 X;  5K68 A;  3RDM A;  2LBV A;  3CQR A;  3RZY A;  1Y52 X;  4JNJ A;  2OF8 A;  2X8T A;  1D3S A;  1OBP A;  4NLI A;  2QCB A;  3P02 A;  5IXG A;  3KFI A;  2IZH B;  4GZV A;  3F9D A;  5K06 A;  1N7Y A;  2OFB A;  1MX7 A;  2IZC B;  3RKG A;  3NBX X;  4RUN A;  2R56 A;  4ORY A;  3RSW A;  1GT5 A;  1PBY A;  1RAV A;  2OY1 O;  4ES7 A;  2HYS A;  2FWV A;  1ZNG A;  2X55 A;  4YGG A;  3ZW2 A;  3TGC A;  1VWQ B;  2RTD B;  2RTP B;  5F6B A;  1VWK B;  4ALB A;  1SWU A;  3JQO A;  3VE1 A;  3TZS A;  1CRB A;  1DF8 A;  1NBX A;  2F01 A;  1VWC B;  1X8N A;  1BWY A;  3FR2 A;  2RTA A;  4TKB A;  1VYF A;  3KFH A;  4HWM A;  4GET A;  4WBK A;  1BSY A;  5EEE A;  3WJB A;  2UZ2 A;  4CV7 A;  2OL7 A;  1SA8 A;  1NP1 A;  4IB9 A;  3RDX A;  1K3B A;  4CPI A;  2LFO A;  1HMS A;  2YMS A;  4NYR A;  4LKT A;  1E00 A;  4ON1 A;  1EAL A;  2KW1 A;  1O8V A;  1I06 A;  3CQN A;  2WEW A;  4MEE A;  1G7N A;  5FQ6 E;  2FS6 A;  3PQS A;  3ZUO A;  1HMT A;  1WUB A;  2GJ5 A;  3SZH A;  4ZH9 A;  3FW5 A;  2LA7 A;  2OZQ A;  2X46 A;  3BSZ E;  2IZJ A;  5BVT A;  2RN4 A;  1SLG B;  2ZAG A;  4U8U O;  1AVD A;  2OY7 A;  5IO7 A;  3JSQ A;  1GT4 A;  4FBV A;  2MJI A;  3RE6 A;  4D6A A;  4EKV A;  5KIC A;  5B2A O;  3VG4 A;  1PBO A;  3P6E A;  1DZK A;  1OPB A;  1KXO A;  1T8V A;  2O62 A;  1ERX A;  4HPA A;  1Y9T A;  1KL4 A;  3FEP A;  4TLJ A;  1YWA A;  3APX A;  3QQ2 A;  3FA8 A;  1HBP A;  1SWO A;  5LKE A;  1UYN X;  2RCT A;  3NQK A;  4FBO A;  1VWP B;  1ALB A;  1SWR A;  2BSZ A;  1KT6 A;  4QGW A;  5L8I A;  1HQP A;  1LDQ A;  3HOE A;  4AZN A;  1N43 A;  3VHH A;  2OF9 A;  1KGL A;  5FQ7 E;  1SXY A;  1BSO A;  1BEB A; 
#chains in the Genus database with same CATH homology
 4IAB A;  4O3X B;  4FQB B;  4MIR A;  2GC9 A;  1FE3 A;  2HZR A;  3BRN A;  4IB7 A;  1YWD A;  3T1D A;  4BOE A;  2FS7 A;  3NQ9 A;  3TGA A;  5KHP A;  1PMP A;  5EDC A;  4LKP A;  2ALL X;  2OVD A;  5CYB A;  3ELZ A;  4ZHH A;  3QKG A;  1EQD A;  4ZHD A;  1BRP A;  4OMX A;  4NW4 A;  4U8U M;  3B2L A;  3WOV A;  1N0S A;  1RLB E;  1OBU A;  3KZA A;  3APU A;  3PED A;  5H9L A;  4RUU A;  4ZR2 A;  2JU3 A;  1U17 A;  5H9K A;  1S2P A;  1YIV A;  1MUP A;  1GKA A;  1SXX A;  5HBS A;  2FTB A;  3UEV A;  4FBR A;  1B56 A;  3ZZV A;  4NYQ A;  4KH8 A;  2A3F X;  5LJG A;  4HPD A;  3ZW1 A;  1R0U A;  4GNW A;  5JR8 A;  4GDZ A;  3CWK A;  5EZ2 A;  2Q39 A;  3FW4 A;  4I3B A;  3VG3 A;  3S5X A;  2CBS A;  4BVM A;  3MX7 A;  2FLJ A;  4O9S A;  2K23 A;  5D47 A;  5EPQ A;  4ZHC A;  5BYP A;  3VG2 A;  1JYD A;  5D8J A;  2YG2 A;  1ERB A;  3HWG A;  5LJH A;  2WSJ A;  1KZX A;  2L9C A;  4ML7 B;  4Y0S A;  1SY2 A;  1BSQ A;  4OS0 A;  5HTD A;  4I6S A;  1LIE A;  4WFU A;  1B4M A;  4IMN A;  1FEL A;  4QYN A;  1DV9 A;  3FA9 A;  2ZAI A;  3GAQ A;  3WJG A;  1GXA A;  1YWB A;  1PEE A;  3KFG A;  5HZ5 A;  3ELX A;  4Y0Q A;  2KT4 B;  3BU9 A;  3D97 A;  3FEN A;  3P6H A;  3V8U A;  5FFH A;  2CZU A;  3I0A A;  3ZI8 A;  3Q6L A;  1IIU A;  2HLV A;  1ADL A;  3WJD A;  2AT5 X;  1EUO A;  1T68 X;  3S26 A;  3I17 A;  1ZNE A;  1CBQ A;  1BRQ A;  1ML7 A;  4YBU A;  3FYF A;  4ORS A;  3APW A;  1X8P A;  3C77 X;  4I3C A;  1EXS A;  4ZH6 A;  5HZQ A;  2JMB A;  4AW8 A;  5KID A;  4QYP A;  2A2G A;  2BS5 A;  1I05 A;  1ZNL A;  1FEM A;  1OPA A;  1QFV A;  2NP1 A;  3EM0 A;  3NP1 A;  2KTS A;  4GH7 A;  4QGX A;  3U03 A;  3FIQ A;  3AKM A;  2L68 A;  3DTQ A;  1IW2 A;  4UU2 A;  2RCQ A;  5FQ8 E;  4GKC A;  1FDQ A;  4YCE A;  4QGV A;  3D96 A;  1RBP A;  1IKJ A;  1QY0 A;  5L8O A;  3C78 X;  3P6C A;  4NLJ A;  3FR4 A;  2X8S A;  1O1U A;  1BM5 A;  4KC7 A;  1Z24 A;  1B0O A;  4I3D A;  2AKQ A;  1EI5 A;  3O19 A;  4GRJ A;  4OS8 A;  2CZT A;  2LKK A;  4KII A;  2W2A A;  3TGB A;  1KZW A;  1BBP A;  3HOL A;  2Q4N A;  4ORU A;  2GTL O;  1LIF A;  3FMZ A;  5CE4 A;  3H3I A;  5HWZ A;  4CK4 A;  2AL0 X;  5BVS A;  4ZHF A;  1MDC A;  3CBS A;  3UEX A;  4DQ3 A;  1QQS A;  2NND A;  1AEL A;  2AT3 X;  2JOZ A;  2QO5 A;  3CMP A;  1YUP A;  4IMO A;  4R0B A;  3P6G A;  4MVK A;  3STM X;  5HZ8 A;  4XMC A;  4YFQ A;  1JYJ A;  4WHI A;  4EQA C;  2ACO A;  2BHV A;  3AKN A;  4O3Y A;  2RD7 C;  2AT6 X;  3FEL A;  5DG4 A;  5F6Z A;  2F73 A;  2RQ0 A;  4TKH A;  2BS6 A;  2Q2M A;  1TXL A;  1X71 A;  3GE2 A;  4K19 A;  4AZP A;  5HZ6 A;  1EII A;  3STK A;  4XMF A;  2JN3 A;  1TW4 A;  4A1H A;  4IAW A;  4XMH A;  1QY1 A;  4YKM A;  1URE A;  4YH0 A;  3EYC A;  3C76 X;  3ZW0 B;  4XMD A;  2F09 A;  2GTL M;  1H91 A;  1VPR A;  1Y9L A;  2W2B A;  2WUT A;  5B27 A;  1T0V A;  1ZNK A;  1G85 A;  2AT0 X;  2XKL A;  3IFB A;  2MWH A;  3F6Z B;  3NAD A;  4EDE A;  3HWE A;  4GE1 A;  5AJC A;  3SAO A;  5F1E A;  4YFP A;  5H8T A;  4ZHG A;  1A57 A;  4Y0P A;  4O4O A;  1X8O A;  1O1V A;  4CSB A;  1IFB A;  1SXW A;  4O4X A;  1OEK A;  3PQU A;  2HNX A;  3BU1 A;  3PH6 A;  1DZP A;  3WXQ A;  3VE2 A;  3SOT A;  3ZUI A;  2A13 A;  1IFC A;  5HCC C;  1KQX A;  1MVG A;  5IO6 A;  3UEW A;  1LF7 A;  2WEX A;  1EW3 A;  2FT9 A;  4ORW A;  1X8Q A;  2OVS A;  1I04 A;  3WBG A;  2WWP A;  1YWC A;  1IKE A;  1G74 A;  1P6P A;  3BLG A;  4EEJ A;  5LJE A;  2E4J A;  3LV4 A;  4MVL A;  2MM3 A;  3D95 A;  1X8U A;  3LHN A;  1HN2 A;  3B2I A;  1KT7 A;  1BJ7 A;  1GGL A;  3U0D A;  1NGL A;  1UZ2 X;  5IO5 A;  3BS2 A;  4TKJ A;  1PM1 X;  4O49 A;  2Z4I A;  3E3C A;  4I95 A;  4HFO A;  2Z4H A;  4NNS A;  4O3Z A;  5D48 A;  4A1Y A;  1TVQ A;  3VG5 A;  1LIC A;  2IFB A;  2WR6 A;  2QOS C;  1E02 A;  3RBY A;  2W2F A;  4HPC A;  4EFG A;  1SMP I;  5LKF A;  2L67 A;  4MIS A;  4YGZ A;  1EPA A;  1YP6 A;  3OBL A;  4QAE A;  4YMY A;  2MHD A;  4Y0R A;  3WJF A;  1KT4 A;  2X8F A;  4O4S A;  5HTE A;  1CBR A;  4NP1 A;  4YBP A;  4QRL A;  5D4A A;  4TJZ A;  3N91 A;  5L8N A;  4QQ1 A;  4WFV A;  2AH7 X;  3PH5 A;  4ODD A;  2CM9 A;  5LJK A;  5FAZ A;  1HBQ A;  5HCD C;  5H9N A;  1JZU A;  3FA6 A;  2LBA A;  3CBC A;  1XCA A;  2L5P A;  4GK9 A;  4L3R A;  1AVG I;  1D2U A;  1GX8 A;  3VPJ E;  2OFM X;  3O22 A;  4IBA A;  3P6D A;  2WQ9 A;  4KCA A;  1JV4 A;  2QM9 A;  4N7C A;  1JJX A;  1KQW A;  4IAX A;  1DZJ A;  1ACD A;  1KT3 A;  2QO6 A;  4ORX A;  1E5P A;  3HTY A;  1JBH A;  3B2K A;  1DZM A;  3FEK A;  1JIW I;  1OEE A;  1X89 A;  1B8E A;  1VYG A;  3OD9 A;  3ZQ3 A;  4U3Q A;  2WQA E;  4GNY A;  2G7B A;  5F58 A;  1SY3 A;  3JS1 A;  2A0A A;  4YFR A;  4INN A;  1LID A;  5H9A A;  3BX7 A;  3FA7 A;  4QNI A;  3STN A;  4AZO A;  3VG7 A;  4GU8 A;  4XMG A;  1YP7 A;  3FR5 A;  3P24 A;  4ORR A;  2LB6 A;  4BQU A;  1EPB A;  1S44 A;  2RA6 A;  2QO4 A;  1U18 A;  4TNN A;  3L4R A;  5AJB A;  4O4U A;  1LPJ A;  2A2U A;  1LIB A;  1I4U A;  4AZM A;  1ZNH A;  1EIO A;  2AMM X;  3DSZ A;  1GKA B;  2OVA A;  3UEU A;  2NNQ A;  1FEN A;  2K62 A;  1G5W A;  2GTF X;  4N7D A;  2AT8 X;  3WJE A;  3ZW1 B;  2R74 A;  1ICN A;  2MO5 A;  1CBI A;  4LQZ A;  4PJ2 A;  4I9R A;  4ZGU A;  2FR3 A;  3WVM A;  1LNM A;  2OVE A;  3VU1 A;  1SY0 A;  4A8Z A;  4COT A;  2Q2P A;  4TQ2 A;  5B29 A;  1AQB A;  1TOU A;  5FEN A;  4PSQ A;  5LJC A;  2OFR X;  3NR3 A;  4D6B A;  1LFO A;  4ARH A;  2CBR A;  1GT1 A;  1U0X A;  5EED A;  5AQ6 A;  5HA0 A;  5HCE C;  1HMR A;  1LKE A;  2JU8 A;  3OE3 A;  1BLR A;  1AB0 A;  2ANS A;  3B2J A;  3FLL A;  4EXZ A;  1QFT A;  2KD2 A;  1OBQ A;  2POA A;  4OS3 A;  1QWD A;  1OEJ A;  4A60 A;  5AEO A;  4ZFX A;  3EBW A;  4MVI A;  4L1N A;  5C0N A;  3RWX A;  3KQ0 A;  4M6S A;  2R73 A;  3OJY C;  3F8A A;  1ICM A;  4I9S A;  5HZ9 A;  4ZGF A;  1SY1 A;  4QZU A;  3S60 A;  3O2Y A;  3U9P C;  2JW1 A;  2G78 A;  2KTD A;  4U9C A;  4YKO A;  5BVQ A;  3TF6 A;  4HPB A;  5LJB A;  3PEC A;  1DFV A;  3VG6 A;  4IB6 A;  3EMM A;  3HWF A;  3D4R A;  2XST A;  1A2D A;  3IA8 A;  5DPQ A;  2CM4 A;  1KOI A;  4AZQ A;  4YGH A;  1L6M A;  5F7G A;  2FR2 A;  1A18 A;  1DF3 A;  1E06 A;  2PY1 A;  3HWD A;  4OMW A;  3UAQ A;  3B2H A;  4JGL A;  4ZJ0 A;  4XME A;  3S5V A;  1TOW A;  3MBT A;  2Q9S A;  4AZR A;  2M4L A;  2P8G A;  3NQ3 A;  3KFF A;  2HMB A;  4LZV A;  4YCH A;  3NPO A;  1SXU A;  4ZCB A;  3ZW0 A;  4MVE A;  1CJ5 A;  2FRS A;  3WJC A;  1A3Y A;  2NNE A;  3APV A;  1GM6 A;  3BY0 A;  4NNT A;  2JU7 A;  1XKI A;  4ID2 A;  4IB8 A;  3CR6 A;  2HZQ A;  1GT3 A;  1GX9 A;  4ALO A;  3BDR A;  1CBS A;  3G7X A;  3NX1 A;  3PPT A;  2N93 A;  3K3L A;  5EDB A;  3PP6 A;  4YDA A;  1JJJ A;  1KT5 A;  1QY2 A;  5D45 A;  2ASN X;  3EBK A;  5HA1 A;  4O3W A;  3HK1 A;  3P6F A;  3NX2 A;  2X45 A;  4DQ4 A;  1FTP A;  2GTL N;  4AYH A;  1DC9 A;  4UU3 A;  2ACP X;  1ZND A;  2G79 A;  4KT5 A;  1NP4 A;  2DM5 A;  4FGI B;  3ZWE A;  3BX8 A;  1ZRY A;  4YDB A;  2BLG A;  3MVF A;  1MX8 A;  4QZT A;  4U8U N;  1QAB E;  2BT9 A;  5LJD A;  2QMI A;  1S7D A;  5HAE A;  1QG5 A;  4KC8 A;  4LZU A;  4M7M A;  2EU7 X;  3RZY A;  2LBV A;  3CQR A;  2X8T A;  1D3S A;  1OBP A;  4NLI A;  3P02 A;  3KFI A;  4GZV A;  3F9D A;  5K06 A;  1MX7 A;  3RKG A;  3NBX X;  4RUN A;  2R56 A;  4ORY A;  3RSW A;  1GT5 A;  4ES7 A;  2HYS A;  2FWV A;  1ZNG A;  4YGG A;  3ZW2 A;  3TGC A;  5F6B A;  4ALB A;  3JQO A;  3VE1 A;  3TZS A;  1CRB A;  1X8N A;  1BWY A;  3FR2 A;  4TKB A;  1VYF A;  3KFH A;  4HWM A;  4GET A;  4WBK A;  1BSY A;  5EEE A;  3WJB A;  4CV7 A;  1SA8 A;  1NP1 A;  4IB9 A;  2LFO A;  1HMS A;  2YMS A;  4NYR A;  4LKT A;  1E00 A;  4ON1 A;  1EAL A;  2KW1 A;  1O8V A;  1I06 A;  3CQN A;  2WEW A;  1G7N A;  5FQ6 E;  2FS6 A;  3PQS A;  3ZUO A;  1HMT A;  2GJ5 A;  4ZH9 A;  3FW5 A;  2LA7 A;  2OZQ A;  2X46 A;  3BSZ E;  5BVT A;  2RN4 A;  2ZAG A;  4U8U O;  5IO7 A;  3JSQ A;  1GT4 A;  4FBV A;  2MJI A;  4D6A A;  5KIC A;  3VG4 A;  1PBO A;  3P6E A;  1DZK A;  1OPB A;  1KXO A;  1T8V A;  2O62 A;  1ERX A;  4HPA A;  1Y9T A;  3FEP A;  4TLJ A;  1YWA A;  3APX A;  3FA8 A;  1HBP A;  5LKE A;  2RCT A;  3NQK A;  4FBO A;  1ALB A;  5L8I A;  4QGW A;  1KT6 A;  1HQP A;  3HOE A;  4AZN A;  1KGL A;  5FQ7 E;  1SXY A;  1BSO A;  1BEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...