2HMIA

Hiv-1 reverse transcriptase/fragment of fab 28/dna complex
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional implications of the polymerase active site region in a complex of HIV-1 RT with a double-stranded DNA template-primer and an antibody Fab fragment at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system/dna
molecule keywords DNA (5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*G
total genus 135
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hmiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hmiA05
4PWDA 4KHMA 3H5YA 3TWHA 3OYGA 4ID5B 1RBRA 4I7FB 4F2SA 1KHWA 1ASUA 1TP7A 1S4FA 1A5VA 2V4RA 3RRGA 1YT3A 3HJFA 1JLAB 3BR9A 1J5OA 4CHOA 1S9GA 4DL2A 3BQ0A 3OYAA 1NJZA 2JLEA 1S9GB 3QZ7A 1TK8A 2P51A 1SKWA 2G8KA 4K4VA 3M8PB 1HQEB 1L3TA 4DU3A 4J9RA 4O3SA 4ECZA 3L2QA 4Z4GA 1VRTB 3AV9A 3TAEA 5KG1A 4DTRA 1D9FA 2X74A 2BE2B 3HKWA 2R8HA 4KV8B 4ELTA 3SUPA 3CYMA 4K4SA 1VRUA 1WNSA 1SUQB 3OL7A 3OYLA 2E4LA 3SQ1A 1S6QA 2RPIA 4FVMA 4O5BA 1S6PB 4DQRA 2HMIA 1Z4UA 1ASVA 2W9CB 3KLGA 3I0SB 5L1LA 3P5JA 3WNGA 4DSLA 1EETB 1RT3A 3C94A 4IH5A 2OH2A 3PV8A 4GC7A 3VQDA 2YNHB 3B6OA 4NLVA 3OSPA 2VG7A 3OYJA 4Q8FA 2ZE2A 4ZP8A 2VA3A 4IG0A 3ZSYA 2WK4A 1VSKA 3D0PA 4MKBA 1MMLA 3HPGA 3K5LA 3KLIB 1JLCA 5KRSA 1TAQA 3LALA 5KG2A 4CECA 4FLZA 1U49A 3EZUA 3HVAA 4CFBA 3H4DA 4BWMA 1JLFA 3T5KA 3AVLA 2W8KA 3GV8B 5CYMB 1NK0A 4CF9A 4W5TA 1NK6A 2ATLA 2F8SA 1RT5A 2W8LA 5J2QA 3QEVA 3FQKA 4M3YA 1NJWA 5KG4A 4NLSA 4DSIA 3WNFA 3DLHA 3OVNA 3H98A 4DFPA 4K8XA 2FLPA 4AHRA 1REVA 2XGQA 2B5JA 1GOAA 3LWMA 1FKOB 3QNNA 3BJYA 1U48A 4M3UA 3S3NA 3OYBA 1TL3A 1S1VA 2VG6A 4MQ3A 4Y34A 4WXWA 1SL2A 2VG6B 1QSSA 4J9PA 1IKXB 3QIOA 1NK9A 4TY9A 4EO8A 1VSJA 4B08A 1S6QB 2D3ZA 3PW5A 3M9OB 3LP1B 2E9ZA 5F8JA 2ZKUA 4M41A 3RBEA 1LAVA 2HNYB 4I2QA 5F8GA 3CG7A 4DS4A 5I42A 4L8RB 4DL6A 3L2RA 2UUTA 3OL9A 3I0RB 4KAIA 4IFVB 3TARA 1KRPA 4Y3CA 2YNHA 2HWHA 1RTHB 5CYQA 4OVLA 1C0UA 4KHQA 4IDKA 1DTQA 3OYIA 4TYAA 3T1AA 4XPEA 4ECXA 4KO0A 3ZT1A 4FYDA 1RNHA 3M9MB 4J2EA 3KMSA 2BE2A 4LSLA 4MKAA 4WYWA 2YNIB 3LANA 4PQUB 2PZSA 1KLNA 4CEQA 1S48A 3V9ZA 1XHZA 5HRPA 1WSHA 2XY8A 2UVWA 1N5YB 4UQGA 3V9XA 3OLBA 3K57A 4HHTA 5KFYA 3K59A 3QIPB 4EYIB 2E6LA 1S1UA 3T5HA 2P5OA 4ECQA 5KTQA 4B9MA 3MEDA 3NBPA 5KFUA 1HJRA 4B8AB 2Z1GA 2R8KA 1C0TA 4CHNA 3SUQA 1TKZA 4FLVA 2JC0A 3L3UA 3OS1A 1NK8A 5F8IA 1WLJA 1TV6A 4BACA 4FLYA 5KG5A 4OPJA 4FJXA 3BSOA 1HNVB 2CKWA 4CJWA 2BRLA 2HAIA 3Q8QB 4DG1B 1X9WA 1K1SA 1T94A 1FXXA 4F4ZA 2E9RX 1MU2B 2I5JB 1Q8IA 2HMIB 2VWKA 4ZVGA 1LW2B 3D28A 4CIFA 2KFZA 5EUHA 2V4QA 3FSIA 1S1UB 3VQPA 2YHBA 1BIUA 1S9EB 3T5LA 1HARA 3UQSA 4EP5A 2AU0A 4DF8A 3DRSB 3FDSA 1RTIB 2HWIA 1ZTWA 3OYMA 4KO0B 1BQMB 4TYBA 2KQ2A 4DSFA 3AVGA 3PY8A 3NF7A 1L5UA 1QSLA 4AH9A 2HB5A 4EO6A 1JX4A 4O0IA 3ASMA 1C6VA 3K5NA 3SI6A 4N56A 3G86A 4JV2A 4ED3A 2IBKA 4DU4A 4OPKA 4I7FA 3OHAA 4PUOA 4HUFA 2EHGA 3K2PA 1B9DA 3AA4A 5K14A 1HMVA 3BSNA 4FS1A 2W9BA 2HNYA 2QKKA 2FVCA 4CEBA 4LQ3A 4BDYA 3DOLB 3DLRA 1ZETA 2Z1IA 3UR0A 5C25A 4ED2A 4C8OA 3DRRA 3ZSWA 2OPPB 3FQLA 5J2MA 1N4LA 3HHKA 1C0UB 4NYNA 4KHYA 3V6JA 4RUAA 1JLBA 4TLRA 3MEGB 4DL3A 4CEOA 4Q43A 1D0EA 4F4YA 4W5OA 4CGFA 4F2RA 5DK5A 5KFGA 3TANA 3AVNA 2PY5A 2X6NA 1JLGA 2J6UA 1JXEA 3ZSRA 1JKHB 3THVA 1IKXA 5HBMB 4E0DA 1FK9A 1WSGA 4PWDB 2XI3A 5KFXA 1XR7A 3ITHA 3LDSA 1RT6A 3MR2A 4KFBA 4DF4A 4WFZA 3CJ2A 3FFIA 3FFIB 4G1QA 2XCPA 3EYZA 2WOMB 2G8HA 2E9TA 3S3OA 1WSFA 3HYFA 4HVJA 3NL0A 3PX4A 3JSMA 4R0EA 3MFHA 3QETA 3KK1B 1BL3A 1U04A 3VQBA 3LWLA 4DSEA 4NCBA 4O44A 3IAYA 1TKTB 4AHCA 3U6FA 4RZRA 4Q0BB 3U3GA 2RDJA 3N6MA 1EP4B 3HP9A 2YHAA 5CZ2A 4NLWA 3KD5E 5KFMA 3NKYA 3DM2B 3NHGA 1WAFA 3OYKA 5KFQA 3DM2A 1LWEA 2GIRA 3PO4A 1SL1A 3IG1B 4G1QB 2PYJA 3HM9A 3IGNA 3NDKA 2V0NA 2E6MA 2GV9A 3I8DA 5HROB 3DRSA 3SJJA 4AHUA 1QQCA 2O4IA 2P1JA 3H5SA 2BR0A 4DTXA 3T19A 2CJQA 4I9LA 1BQNB 1QTMA 3QZ8A 3WNEA 4QOZB 4RNFA 3KLIA 2ITGA 4E19A 1SKRA 4IQXA 3CJ4A 2FBTA 2OA8A 1I39A 3MF5A 3MXMA 3GIKA 1FKPB 4DSJA 4CEFA 3JYTB 3QO9A 4MIAA 3QYYA 3LZIA 3MAQA 3KK3A 4E7JA 3H2LA 4H8KA 2XO7A 3QINA 4FJHA 1TKXA 4TQSA 4Z4HA 3QESA 5J2PB 1VSHA 4IFYA 5KFBA 3M8QB 5FDLA 3KLVA 2R2TA 2OPSA 3PJWA 1RTIA 1HQUB 4NLYA 4K4TA 1JXBA 3ZT4A 1QAJA 4O55A 4CF8A 4KHSA 4NCAA 1L3UA 2A1SA 4KBIA 4CJKA 1ZTTA 4DEZA 2FC0A 3U3YA 1T05B 4KV8A 3KNAA 5DQIA 3AVIA 4FLTA 2G8UA 4ZPDA 4RNOA 4FJ7A 5KFOA 2UUWA 4F4XA 3O4QA 2YV0X 3QEXA 4WE1A 3SYZA 4B9LA 3GV7B 2YKMB 3KJVA 2FBVA 3I5CA 5C5JA 3PR5B 2HW3A 4GMJB 2GUIA 1UWBB 1D5AA 3Q8SB 1RT7B 2X78A 4I2QB 1S9FA 2AJQA 2OYQA 2NUBA 3DLEA 4ECYA 1L3VA 5FRNA 3NGYA 3OYNA 4WYLA 3QLHA 4LY7A 3SQ4A 4B9NA 3ISND 4E7KA 3KLHA 1C2PA 2XRIA 1S0NA 3L2UA 1RBTA 4E3SA 2IJNA 2XWYA 4CJ4A 2OPRB 5KT6A 2IAJB 5CZ1A 1WSIA 1T03A 3ZSVA 1KFDA 1HNVA 4CE9A 5EWGA 3G6XA 2GIQA 3RB6A 5J1EA 5KFPA 1WSEA 4CF2A 4ZPCA 4BDPA 2YKMA 2W9BB 4IR1A 3TAFA 3QEIA 4LSNB 3HVWA 5DGBA 4ZHRB 4M3XA 2AQ4A 1W25A 2ALZA 1NKEA 2WOMA 4CERA 2KZZA 5J2MB 1KVBA 1REVB 5C42B 3PZPA 4IBNA 3SV4A 3V6KA 1JLBB 4O0JA 1TK5A 4M3TA 1X9SA 4ICLA 5HLFA 3F9KA 3K5OA 3NCIA 4K4YA 1TL3B 1IKWB 3CFOA 2YNGA 3HP6A 1TQLA 3MXIA 4F3TA 3V1OA 4B9VA 2G8FA 1KFSA 3HL8A 4M3RA 3ZSZA 1IG9A 3DLGB 4YMEA 3N6LA 3UIQA 4NYFA 1QS4A 4MK7A 1HYZA 1W0HA 1NKCA 2ZD1A 3CIZA 3E51A 3SNNA 4W5NA 2I5JA 5JS1A 2I1RA 4QWAA 4ZHRA 3PX6A 4HYKA 4NLXA 4RW8A 1N6QA 1HYSA 4Y1CA 4TXSA 2HVHA 1HYSB 2HHXA 3EPIA 4DMNA 2YNFA 2FLNA 1JL2A 1HQEA 1ASWA 3H5UA 4DTPA 1KTQA 3QNOA 4URGA 3RMAA 1D8YA 5F8NA 1CXQA 1TKTA 2BQRA 3L2WA 4ECRA 4ZMMA 4ECUA 2Z1HA 4B9UA 1SUQA 1J53A 2IMWP 3SV3A 2KFNA 4F4WA 4R5PB 1S6PA 4OLAA 4CGIA 4M95A 1RDDA 4CHQA 1IKVB 1JLFB 4YNQA 5CYMA 5C24B 1K6YA 5F9NA 3KLGB 4J9OA 4QCLA 2ILYA 3OYDA 2RN2A 3RAXA 1RYSA 2VG5B 3CJ0A 1QAIA 1QUVA 5T7BA 1VSEA 3RTVA 4MFBB 3SZ2A 5KFIA 4DQSA 2HHQA 5DMRA 3OYHA 5F9LA 1ZBUA 4CJLA 3RMDA 4B9TA 1GX5A 1NJXA 4IKFA 3DLBA 4CK2A 4GC6A 4Z4CA 4RW4A 3OHBA 4AHTA 4FZZA 1TV6B 1U47A 1RT1B 4QW8A 2IC3B 3Q8PB 3KHGA 1TK0A 4TSXA 2D3UA 3ULDA 1U45A 3OYEA 2BGGA 1KLMA 1J9AA 1RBUA 5KFJA 5DLFA 4KFBB 5EWEA 1NK7A 1S1WA 5CY4A 3VQSA 3M8RA 3DYAA 1JLQA 4E7IA 3I0SA 2IM0A 4FBTA 3LPUA 1UA0A 3V9WA 4Z4IA 2G8IA 4FZXC 4Q5VA 3QLHB 3PW7A 4WZQA 4I9QA 2DY4A 4U6PA 3CO9A 2QK9A 3VQCA 4O44B 2ILZA 1VSLA 4FK0A 1T03B 4CK1A 4DQPA 4PA1A 3IGVA 5EWFA 5J1EB 4EZ9A 3VQQA 4NLGA 3LP1A 5KFDA 1KVCA 3EPGA 2J6SA 2KZMA 2OZSA 4NRTA 3TAMB 4DFMA 4WZMA 3RR8A 1C1CA 3OYCA 3AO1A 3QEPA 4GVMA 3D5MA 2B43A 5SZTA 3DRRB 4CESA 1NHUA 4DLEA 3ISNC 4KB0A 2BRKA 5JXSA 3DLKA 3NGIA 4C8NA 3PO5A 4J2DA 3GIJA 3O3GA 4CF0A 3SQ0A 3DMJB 2YKNB 4ECWA 1BGXT 1NHVA 1QE1A 4CGJA 4OGCA 1LV5A 2AX1A 4IRCA 2F8TA 4B8CA 4F8RA 1BQNA 3LP0B 5HP1A 4ECTA 3VQ9A 1IKYA 3GQCA 3LAMA 1TVRB 4U7CA 4ECSA 4ID5A 4AILC 3V9UA 1A5XA 2FVPA 1I3AA 3VA0A 3NFAA 2W9AA 1GOCA 4AHSA 3DYAB 3RBDA 4DFJA 2D41A 4FXDA 3JSMB 3V6HA 5C42A 4C8KA 3TI0A 4CGDA 3NAHA 3PW2A 4KHWA 1RA7A 3BSCA 1KHVA 5KT3A 2WONB 3UPFA 2OPSB 3L2VA 1IKWA 2FVQA 1GOBA 2FVRA 3BGRA 5F8MA 4CFDA 3NH0A 1JXLA 1X9MA 4NLPA 5KG6A 1DTTB 4FJGA 5KI6A 5D3GA 1LW0A 2JEGA 3AVMA 4K50A 1A5WA 4KHUA 2JEIA 2DFEA 3BSAA 3Q8RB 4H4OA 4QWDA 4W5RA 3O4NA 2ZD1B 1HNIB 1TVRA 4B3OA 3KKRA 1HPZB 4B3OB 1RT6B 4CHZA 3V4IB 3EY1A 5K14B 5DLGA 1KVAA 3AVBA 4CEZA 3CFRA 4KKOB 2AX0A 3HO1A 5I42B 3QIPA 1ZYQA 1RT3B 3GYNA 1JIHA 3VQ6A 3NH1A 1XC9A 2OZMA 1S5JA 4KHRA 2HHSA 3GIIA 2FBXA 1RT4B 4DTMA 1VSFA 2VG7B 3NMAA 4IH6A 2C2RA 4MFBA 2QV6A 3ZCMA 5FRMA 3CWJA 2JEFA 3MEGA 1YTAA 4JS5A 1UA1A 2KW4A 1NNDA 1QHTA 3KHHA 4RW4B 1ITGA 3IRXB 5JS2A 1T3NA 3DLGA 4E1NA 4LSLB 4OL8A 3HPHA 4IH7A 2B4JA 3CJ5A 1I6JA 4NLTA 1EP4A 1WNEA 4QPXA 5JUMA 4J2BA 3SPYA 4OJRA 2HHVA 4CFCA 4QWBA 3SQ2A 4FK4A 5J2QB 3I5AA 4JRQA 4MH8A 3I0RA 1JLAA 1JLQB 1RDBA 3QEWA 2XY5A 2WHOA 3O3HA 3KLFB 3HVTB 3VQ8A 3OS0A 4DL4A 5DQGA 4CCHA 1S1TB 5HRRA 4KRFA 4JRPA 3HVRA 1NKBA 4MK9A 3CFPA 3RB0A 2IM2A 3ZSQA 2BDPA 1BI4A 3S9HA 1CZ9A 2YNGB 1LWFA 4KAZA 4O3OA 2HHUA 4ED6A 1YVFA 1NOYA 1D1UA 1QSYA 2LSNA 2HNZB 2HHTA 1N5YA 5C24A 3MR6A 1SV5B 3QGGA 4K4WA 4IR9A 3M9NB 1ZBLA 5I3UA 4FBUA 3AO4A 4O3NA 4WFXA 2FBYA 4IKAA 3G6YA 1Q9YA 4BWJA 5HRSA 4NYZA 1UAXA 3T5JA 4IG3A 2V9WA 4GW6A 1RT4A 4O3QA 4J9NA 5HROA 1BCMA 4FJ9A 1C1BA 2RF2B 4EYHB 3M8QA 4DQQA 2FJVA 1DLOB 4IDKB 4X2BA 3H59A 2X6SA 1RTDB 1RT1A 3OL8A 3G10A 5KFTA 1T05A 2QXFA 1SL0A 2R7YA 1WAJA 2DFFA 1FK9B 3NH2A 3SFUA 1RILA 1XWLA 3VQ7A 3DOKA 4PUOB 3BQ1A 4ZTJA 5DG9A 2Y1IA 4KTQA 3KK3B 4LSNA 1C1AA 4YQWA 2Z1JA 4CGGA 2ATQA 1RAJA 4Q45A 1Y97A 1RBSA 3IS9B 4CIEA 4RW7A 2ASDA 3PHEA 5SWMA 1N48A 2DTUA 1XHXA 1BQMA 1B92A 1DTQB 1KSPA 1DLOA 3VN5A 1LWFB 4J9QA 1EXQA 3VQ4A 1VK0A 4DS5A 3LP0A 5HP1B 1YVUA 5J2NA 3FRZA 2JEJA 3KIOA 3DDKA 2JGUA 2EX3A 4KE5A 3NF6A 1RT2B 4N76A 1JLEB 3KK2A 1JLEA 3KK2B 1TAUA 3ITHB 5I3UB 4FJNA 4DG1A 4M3WA 3DOKB 3PR4A 2R2SA 1F21A 5KFVA 2ZQBA 1Q9XA 3AA2A 5DG8A 4FZYA 2FLLA 3V1QA 5C25B 3K58A 5KFLA 1TL1A 4JV0A 4FJIA 4NZ0A 4YR2A 4YR0A 4KPYA 3HK2A 3V6DA 1N56A 3MXJA 4I2PB 2JC1A 4TY8B 3CDWA 4TY8A 1U4BA 1EX4A 2FJWA 3TAPA 3NE6A 1L3SA 4E1MA 2F8EX 4Q0BA 2UVUA 2BQUA 3RAQA 3RMCA 3HT3A 4J9KA 4ZVHA 4FLUA 1IKVA 4QWCA 4TN2A 4J2AA 2DPIA 5KG0A 3MECB 3G0ZA 3WNHA 4FW1A 4IG3B 2WB4A 3IS9A 3TAGA 4FM0A 4ZP6A 3TQ1A 4KTZA 1TL1B 3MR5A 4E7HA 4ED0A 2RF2A 3K5MA 2IDOA 4W5QA 3DLKB 3V6DB 3D45A 3M8PA 3PVXA 5KRTA 4DTUA 1HYVA 5L9XA 3AVHA 3QGIA 5L1JA 3KOAA 4RG8A 3B6PA 4Y2AA 3LP2B 4CHPA 1JLCB 5L1IA 1LWCB 3LP2A 1RDAA 1SH0A 2R8IA 2IS3A 4OKEA 4IRDA 1TKDA 1KLMB 5KG7A 2W42A 4CJUA 5KFFA 1U09A 1S1WB 3JYTA 4DWIA 4KI6A 4CJEA 4FJLA 3AO2A 4NLRA 3MR3A 4CF1A 4ZPAA 2C2DA 4IFVA 3MEDB 3VA3A 1T8EA 4EZ6A 4F4KA 2VWJA 1RYRA 3OJUA 1RTHA 5CYQB 3KTQA 5KT2A 1RDRA 4LH4A 4IG0B 4FCYA 1RTDA 4CK3A 4ECVA 4O3RA 4ELUA 4Q8EA 2IM3A 1DTTA 2OPQB 4HTUA 3SUOA 4Z0UA 2RDIA 3MEEB 3O3FA 3ALYA 4OKKA 3F73A 1HMVB 1LW2A 1HRHA 3V81B 1HPZA 1K1QA 1IO2A 4HKQA 4JV1A 2IM1A 4NLDA 4K4UA 4URQU 5EU7A 4RW8B 2VG5A 4DL5A 1S1TA 2HHWA 1C0MA 2OPPA 1S1XB 4URSA 1BIZA 4CJ3A 2XY7A 2O4GA 3AVJA 4RW7B 3OS2A 4I2PA 4FJJA 1R0AB 3ZSXA 4AHVA 4N47A 2PYLA 4JUZA 4CFAA 4H54A 1RTJA 2IAJA 1LWCA 1CSJA 2XI2A 3RR7A 1GX6A 1NK4A 4YP3A 2HNZA 2D0AA 2IJFA 4NRUA 4BE1A 2W7OA 4CJRA 2G8WA 3KJVB 3EZ5A 4ZTFA 1VSMA 3KD1E 1EKEA 3MECA 3DOLA 4HCCA 4LD0A 2HNDB 1SH3A 3IG1A 5KFZA 2HNDA 4RNHA 3H5XA 1Z25A 1C1BB 4CJSA 1S1XA 3KK1A 3NGDA 4TQRA 2XHBA 4FM2A 1BCOA 4ZP9A 3VQAA 3QIDA 4NLQA 2ETJA 4CJ5A 4C8LA 2FJXA 1FKOA 3H4BA 3V1RA 4BE0A 3P1GA 3IN5A 3LP3A 4DFKA 1JLGB 1S10A 2YNIA 3C95A 4PQUA 3AVAA 1TGOA 5FROA 2D7SA 4BDZA 4FLXA 3LPTA 3E01A 4KREA 4F50A 4LQ9A 2R8JA 2BANB 1FKPA 3AO5A 1SV5A 3HSTB 3CM5A 4K4ZA 1YTUA 2QKBA 3UDLA 2A1RA 2R8GA 4KB7A 3VQ5A 3S3MA 2UVRA 4G3IA 2KTQA 5KFNA 4CEEA 3N6NA 1TKXB 1RCHA 1J5OB 3RWUA 5KFHA 3KLHB 1WSJA 1G15A 4LH5A 4IFYB 4MK8A 2AGOA 2YNFB 4FLWA 2EC0A 4HUEA 2WONA 4FS2A 4M3ZA 4J9LA 1HQUA 3KHLA 1S49A 2WRMA 2ASLA 4Y2CA 5J2NB 4CHYA 4NCGB 1OS5A 4MIBA 4RNNA 4F3OA 4DQIA 2AGQA 5KFAA 4O4GA 1IKYB 1VRUB 3SI8A 3KLEA 4H4OB 1VSIA 4ID1A 2WCXA 2WTFA 2UVVA 3A2FA 4NLUA 3H08A 2W9CA 2GC8A 4YFUA 1RT7A 3V9SA 4RW6A 2D5RA 3OYFA 3NF9A 4FJMA 2Y1JA 1BHLA 1ZBFA 5KFRA 4C8MA 4KB1A 3CDEA 4ICLB 3TVKA 1CLQA 3DI6A 3C6TA 1D9DA 1QE1B 5KG3A 2G8VA 3DI6B 3OY9A 5EDWA 3GILA 1BI4B 3AVKA 3QERA 2FVSA 3KHRA 3RMBA 4ELVA 4DL7A 1VRTA 3KMQA 2R2UA 4WFYA 4B9SA 4JS4A 3H40A 4KHNA 5HBMA 3SCXA 3CVKA 4M42A 2OPQA 4N41A 5KFCA 3KLEB 4EBCA 1J54A 4ZVFA 1Z26A 3ZT2A 4EP4A 1NOZA 3PJXA 3NF8A 3SUNA 3HPOA 1B9FA 2W7PA 4KTWA 4YR3A 1IH7A 1RT5B 4H4MA 4HUGA 1NK5A 4KSEB 3OL6A 5DG7A 3KLFA 1CXUA 2XC9A 1N6QB 2XCAA 4K4XA 2ASJA 4CGHA 4PY5A 4FW2A 4ZP7A 3SPZA 3OLAA 4M94A 3OJSA 3C6TB 4ED7A 4CJPA 2ZE2B 3CQ8A 5KFWA 5DQHA 3AA3A 4NLOA 2DPJA 5KFKA 4O4GB 4QW9A 3QGHA 4OKJA 3LZJA 4RU9A 1WN7A 1HNIA 2AWZA 3M8SA 3MEEA 3BREA 2F96A 3ICLA 4R5PA 5DGAA 3KKSA 5KT4A 1NJYA 3QO9B 1LWEB 2IGIA 3PX0A 4RW6B 1XR6A 4RNMA 1ZBIA 2DFHA 4QWEA 4CIGA 4HCBA 5HRNA 5F8LA 2C22A 2C28A 2IOCA 4FM1A 3L8BA 2RKIA 5J2PA 3PW0A 4IRKA 2RKIB 5KT7A 4DLGA 3TR8A 5KT5A 4Z4EA 4RUCA 1LAWA 5FDLB 2OPRA 3G6VA 1S97A 4CJVA 2B5JB 1SH2A 2VA2A 3PUFA 4CJTA 4DTJA 2P5GA 1RTJB 3BDPA 4DTOA 5KGXA 5F8HA 1O1WA 1XI1A 2R2RA 2B6AB 3DRPA 3RB4A 4BE2A 1JKHA 1RBVA 4CEDA 2GBZA 1RT2A 3CDUA 4IOBA 3ZT0A 4O3PA 3RRHA 1T7PA 4RW9B 1X1PA 1KCFA 4EBEA 4FK2A 4WE1B 2C2EA 4QAGA 3TAMA 4OGEA 4ED1A 4XPCA 4DSKA 2BANA 4EEYA 3HXMA 4FJKA 1C1CB 3PW4A 3AO3A 1SKSA 3VQEA 4O4RA 3L3VA 3RB3A 3BQ2A 4Q44A 3MTKA 4Z4FA 1IM4A 1S0OA 4XIUA 2QE5A 3HVTA 1EETA 2AGPA 4N5SA 3C6UB 3NAEA 2IA6A 3C6UA 1JL1A 3CJ3A 3DLEB 3GV5B 4CJFA 1RDCA 5L1KA 3P83D 3T3FA 3NGZA 5KFEA 4JLHA 1CZBA 4ED8A 4R8UA 4R8UB 1S1VB 4J9SA 1VSDA 3AVCA 2J6TA 3AA5X 4ZPBA 2IC3A 4NCGA 2D0CA 3IRXA 2XY6A 5KGWA 2D0BA 3DRPB 4WXOA 2BQ3A 1LW0B 4E7LA 4XO0A 2XGPA 3E01B 3CM6A 4ZVEA 4RW9A 3TABA 5KFSA 1UWBA 2Q3SA 1UOCA 1W9HA 1MU2A 3ZSOA 3V81A 4OLBA 3V4IA 4H4MB 4FJ5A 1S0MA 4K8ZA 4DTSA 4KKOA 5T14A 1RA6A 4EBDA 2HVIA 1S9EA 3I5BA 3LAKA 4CEAA 4CJQA 4J9MA 3TAQA 3NBPB 1ZBHA 2YKNA 5E41A 3ZT3A 4E89A 1C0TB 3DMJA 1R0AA 3OSNA 4DTNA 3GIMA 5HLFB 3BGRB 3AVFA 1TKZB 3NAIA 1XR5A 3SFGA 1BISA 4FJ8A 4KI4A 2O5DA 4M45A 4Y1DA 4DU1A 2B6AA 5D3GB 3MFIA
chains in the Genus database with same CATH superfamily
4PWDA 1UFKA 2YH0A 5LMNF 2ZJQQ 4LF6F 5ETSA 2GVDB 4FYYB 1KHWA 3D66A 1ASUA 3SK3A 2Y8YA 4GO5X 4BHQA 1NMNA 4Y2IA 2LKZA 4QYZJ 1Q0NA 4KPCA 1S7IA 2MZ1A 1IBKF 3RRGA 1P8GA 2ACMA 3MCSA 2VGNA 1PYOB 1R7IA 4JI5F 4OZJA 2JLEA 1TK8A 3OXGA 2P51A 1R0CB 1GEHA 2JFKA 4MLEA 2HEKA 2HSTA 2AP1A 3M8PB 4OYAA 1QY7A 1RAIB 4Z4GA 3AV9A 1ILYA 5KG1A 4LF6J 2X74A 2F8MA 4USVA 2R8HA 4KV8B 3KZBA 4DR2K 1FEEA 4HI1A 2L9WA 1VRUA 1WNSA 1SUQB 3MMCB 5IOLA 2E4LA 1OH7A 3FUYA 4H0PA 1Q4RA 1TU0B 3E9OA 2RPIA 1YWXA 2HMIA 1DQ8A 3D2WA 4CZHA 3R5BA 2W9CB 3KLGA 1UJ5A 3OTOJ 2QWMA 3FBCA 4DSLA 5E33A 1EETB 1KEKA 1PGZA 3VGKA 4FYXB 3PV8A 4GC7A 3BP8A 4ANCA 1H7XA 3WX4A 2VG7A 2E5JA 1Y3KA 3OYJA 4BC7A 1N0UA 2ZE2A 4ZP8A 2VA3A 1EZZB 5IFMA 2DR9A 2V2KA 4W4MA 1K8AT 1VSKA 3D0PA 3RBZA 4C1NI 3K5LA 1BUXA 1TAQA 2RS2A 4OQJA 5KG2A 1ITPA 2ITMA 1BWEA 4CH1A 2DKOB 2ZZMA 2HQFA 4ETZA 2M4MA 1UVMA 4JI1J 5CYMB 1NK0A 1NK6A 2GGPB 2VU5A 3P4UB 2W8LA 3PRBA 2F9JA 4DV7K 2DNKA 4DSIA 3CCRN 3O44A 3DLHA 1IBLJ 4LF5K 5HATA 1LWXA 1S6OA 2RHQB 1GMWD 5HQLA 2MZJA 1GOAA 3QNNA 3D6HB 4J7CA 4M3UA 1ZPVA 1MROB 2VG6A 1BG3A 4MQ3A 4WXWA 2VG6B 1QSSA 1IKXB 2UYTA 2RU3A 2LEAA 1X4GA 2ZVSA 2C2ZB 4B08A 1S6QB 4L73A 2D3ZA 3PW5A 2HG4A 3OVSA 3LP1B 5CHCB 3L9ZA 4M41A 2ABYA 3M5RA 3ZTRA 1TYQB 5I42A 3OUYA 2CADA 3OL9A 4YS2A 4M5HA 3ATVA 4KQZA 2VQEJ 3PSFA 1DT9A 4XK8C 2ZH3A 4GVBA 3QGPA 3VAFA 2HF4A 5BYSA 2QA4S 2APOA 4B02A 4QIEA 5ETRA 2N4CA 5ITHA 1KLNA 2R7UA 1ATRA 3CEDA 1J6ZA 1RAGB 2BE9B 3JXUA 5C12A 2M8DB 1T9VA 1N5YB 3V9XA 2DK2A 2ZH6A 4BLGA 2NLXA 3HSJA 4EYIB 3T5HA 4FOIA 4KH4A 4ECQA 2CVIA 1RSCA 5KTQA 5E3CA 3NBPA 2Q0RA 3CCSN 3C7NB 2Z1GA 3GB0A 4DZDA 4CHNA 4DR1J 1HNZF 4DHVA 2UXBF 3FGUA 4FLVA 2JC0A 2QMWA 5F8IA 5F0XA 1TV6A 1W97L 3KWMA 4BACA 3OFFA 3TZWA 1MN9A 5K8MA 2ZKTA 2Q36A 3BSOA 3D67A 1HNVB 4CJWA 5D4PA 3Q8QB 1WC6A 1EWQA 3GG1A 3W1YC 5AT1B 3AY9A 2VOOA 4DHYA 2HMIB 1Q8IA 4BC3A 3VVTA 2ZGYA 5EUHA 2V4QA 3AH6A 2D1CA 4AL7A 4U67Q 2V8HA 1SVDA 3T1YF 3VQPA 2YHBA 1BIUA 3T5LA 4EP5A 4WU2A 5DM7Q 3DRSB 4ZVTB 3FDSA 2HWIA 3TJ8A 2H3GX 1PJ7A 1YIJS 2KQ2A 3BV8A 2EI5A 5AE2A 3PY8A 1VQOS 2HB5A 1M1HA 1PYSB 4O0IA 4DV1F 4PXCA 5A6WA 1XMOJ 2O67A 3TO8A 2IBKA 3DDIA 2KT5A 2ZITA 1QHAA 4I7FA 2KRBA 3OHAA 2YX7A 2EHGA 1B9DA 1R59O 4HH0A 1HX1A 2FVCA 4LQ3A 3IR7B 3UD4P 4FPAA 3ZZRA 2A5XA 4CZIA 1HKCA 2DHGA 1WHYA 3GFHA 2V8GA 3JS9A 2FC8A 3VGTA 4KHYA 4I6MA 1FW6A 1JLBA 4TLRA 1VQLN 1D0EA 4F4YA 5MLCQ 2YJEA 4JI4F 5KFGA 3W66A 2K8GA 4IO1A 3EX7B 4X4RA 2X6NA 2DGTA 2J6UA 2QXLA 1XMQK 4FDFA 1JKHB 3EGVA 4ENOA 2PBDA 5HBMB 3L4IA 1WSGA 3EGNA 4PWDB 2ZNYA 1XUPO 1F9FA 3N0VA 2W2NP 4ZCIA 3MR2A 2XLIA 1HW8A 1RUSA 3FFIB 2O8BA 3NVMA 1LQ9A 2KDOA 3GJQB 5HOOA 3PX4A 1NHKL 1FWLA 3C7NA 3JB9k 4DOZA 2XMMA 4JI5J 2DCUB 4DSEA 5IWAK 2LXFA 5HAOA 1BDGA 3UCGA 1TKTB 4BRFA 3U6FA 4RZRA 1YXQA 4B3RJ 3CC4N 2P9LA 3U3GA 3SAHA 1BA0A 4Z7CA 3N6MA 4J9VA 1EP4B 4F0KA 4B3TJ 3HP9A 3M1FA 4AM6A 2XZWA 4OI0A 2CDQA 1RU2A 5CZ2A 4NLWA 1R3NA 1RWWB 3DM2B 3NHGA 3D4JA 1WAFA 3OYKA 5KFQA 3DM2A 3IG1B 2PYJA 1WJ9A 3IGNA 5L39A 4QJVA 3HFZB 4A8KA 3BGUA 2GV9A 4EIAA 2ADBA 5HROB 2WBRA 3H2VE 4OX9K 2XMWA 3CT9A 2COLA 3MTJA 2HK2A 2O4IA 3H5SA 2BR0A 3D7EO 1G2EA 4XTTA 4C3LA 3FK4A 2CJQA 3QZ8A 4QOZB 4RNFA 5EGYA 1S72S 4DV6F 3CJ4A 3HSZA 3BO3A 2FBTA 3BZQA 3MF5A 4DSJA 3H3OB 1N34J 1U8WA 3MWPA 3QO9A 3GSIA 1YSJA 3HHEA 4Z37A 3FC9A 2AJ0A 4H8KA 5KQ8A 4G65A 4DBQA 2NQPA 2D4WA 3QINA 2QWPA 5J2PB 3I9V9 5F0UA 3O9QA 4IFYA 3A8YA 4N8NA 5KFBA 3M8QB 3L7PA 5FDLA 4OZLA 2ZGZA 4Y65A 4NLYA 4XH4A 4DEZA 3R1XA 5DQIA 4FLTA 2G8UA 1R6VA 3CF5L 2XTJP 2R7SA 2UUWA 3O4QA 3G6ES 4WE1A 2X3GA 3BBCA 3TW0A 2YKMB 2HW3A 2ROEA 2FBVA 2ZH7A 1QVFM 2X78A 4RR5A 3DXMB 3R5CA 3SSRA 1RB0A 3DLEA 1IBLK 2BBEA 4LY7A 2LP4A 4E7KA 3GJRB 1RI7A 2XRIA 1S0NA 3FBBA 2WB1D 2IY5B 4OI4A 4CJ4A 1LXNA 3I56N 2OPRB 1HJOA 3KHYA 2CFXA 3A8JA 2D3OR 2GIQA 4TNOA 3GU0A 2WFBA 1S57A 2R7XA 5KFPA 2V2QA 4BDPA 2OKQA 2BW7A 3D6TB 2MEWA 2FXUA 1X0FA 6FDRA 4LFBK 4QS9A 4ZHRB 4BRAA 2EXUA 1YG0A 2RT3A 2WOMA 4B1XB 3IC1A 4CERA 1KVBA 3PZPA 4RKUC 1TK5A 4O0JA 4PZVA 2VICA 2C42A 4ICLA 1T44A 1TL3B 3CFOA 2A40A 1TQLA 4U95A 2G8FA 1KFSA 2CQ4A 3ZSZA 2CQDA 3DLGB 1B64A 3OVAA 3UIQA 1QS4A 4MK7A 1HYZA 1W0HA 1G1XA 2ZD1A 3CIZA 3UE5A 5E2QA 2N4DA 3MM9A 3RBXA 3P5TL 2KT3A 2I5JA 3C46A 4PKGA 2ZWPA 4QQBA 1NGCA 2RE2A 4QWAA 4EMDA 3PX6A 3WEEB 4NLXA 1N6QA 1E6YB 4IOCQ 2NZ4A 4Y1CA 3RRKA 1T3OA 3QBWA 2B56A 3EPIA 1JL2A 3J81U 2DNNA 1KTQA 1WDTA 4P2XA 4URGA 2UXCK 5LSLA 1TKTA 2BQRA 2NZTA 1SC6A 4RO0A 3H6EA 2Z1HA 1RGIA 1WSRA 2Q1LA 3CCEN 1JCFA 4ES2A 2IMWP 2GWJA 3MN7A 2NXEA 5JVHL 2ZH8A 1NGHA 1OVQA 3ID8A 4CGIA 2BXJA 1RDDA 4CHQA 4YNQA 5C24B 1K6YA 3Q83A 1RWPB 2GS8A 3ISZA 3MMAA 5F9NA 3ILJA 5AQGA 1EKRA 3BDEA 2RN2A 1VDHA 2GO9A 2VG5B 3CJ0A 1WORA 1G99A 1VSEA 3RTVA 3SZ2A 5IT0A 5KFIA 4MKVA 4LF7K 4CYUB 5HANA 3BGLA 3RMDA 4CJLA 4JKHA 2E66A 2I2YA 1NJXA 3DLBA 4AL6A 2NNWA 2NSBA 3MOZA 3OHBA 3Q24A 1U47A 1R31A 4AHTA 1ACMB 3Q8PB 5A8KA 2XQCA 5JMNA 3MN5A 3CD0A 2GZOA 3MUVP 1CS4A 1VK3A 5GMDA 4WP8A 5KFJA 4DR3K 3G6EN 5DLFA 4PG7A 5EWEA 3W2WA 1NK7A 3J7ZT 4UF4A 5H9FJ 2ZM6K 1RZMA 3TVYA 1VQSA 2WSCC 3LPUA 3CPEA 1K44A 3BZCA 3EN9A 2CZ4A 1AYEA 4GVEA 1VQNN 1DGKN 3MEKA 3IWXA 4QZVB 1RHQB 4CLPA 2XMUA 4O44B 2ILZA 1HL6A 2KU7A 3UNGC 4X64J 4DQPA 3BR8A 5T7LA 1SQFA 3OBIA 4C11A 5EWFA 4NEYA 3VQQA 2H65B 4NA1A 2OZSA 2DNLA 2FHMA 3AT1B 2VQFJ 1H2VZ 3PYEA 4A8OA 3O1BA 4ERDA 4WZMA 4J5OA 4YN3B 3JXOA 2DGWA 2FJDB 2H4YB 4GVMA 2V4JB 2QMXA 4RLEA 2QL5B 2VBWA 2DNOA 5SZTA 3DRRB 1NHUA 2BRKA 4ER8A 3P39A 3DLKA 4C8NA 3IM8A 3PO5A 4J2DA 5CCLA 3M2UB 4ZIWA 3N5FA 4CM0A 2YKNB 2BUNA 4LF4K 3MUTP 3ZETA 1LV5A 1SJQA 4GKKF 2F8TA 4B8CA 3NNCA 2RIJA 3SCLE 3O80A 4ECTA 4ID5A 3NY0A 4A8QA 1XMOK 4AQYK 1I3OB 3BUZB 3DYAB 4DFJA 1UVLA 2IDEA 3U1LA 3H8YA 3NMRA 3TI0A 3PW2A 1CC7A 3Q89A 1KHVA 2PT0A 2WONB 3TYTA 1PJ6A 1H0HB 2P5VA 3B78A 1JXLA 4NLPA 5CCMA 4PG5A 1Q8LA 3PDNA 1LW0A 2JEGA 1T6DA 2CDRB 1P8ZA 1CLFA 1Y00A 2J4RA 1S3XA 5A0YA 3BM7A 4QWDA 2IA0A 2JDJA 2YHXA 4B3OA 3R2DJ 4U8VA 1HNZK 1Q1KA 3L4QA 3OTDA 3BBFA 3V4IB 3EY1A 4J91A 4EHUA 2VBYA 4LF8K 4CEZA 1H7WA 4KKOB 4X84A 5I42B 3QIPA 1S76D 3GYNA 3G8SA 3VQ6A 2F4VJ 4TU8A 2HBLA 2HHSA 4YOXA 1V4TA 3GIIA 2Z2LA 4IH6A 2DIUA 1IVZA 3ZCMA 3CWJA 3MEGA 3HZ6A 2KW4A 3HD1A 1QHTA 4KC5A 5DZ6A 4OL8A 2CZ9A 2QLBB 3LQVA 4IH7A 3CD7A 4HHUA 3J80Y 5MAOA 5HL7Q 2HVEA 1I6JA 3OVBA 4FKXA 2YQ3A 3L0QA 2DEIA 4ES1A 2X1AA 3LDOA 5GIPA 3SPYA 1NLKL 4CFCA 3CCWA 2IVOA 4BRMA 3HHLC 4YHHJ 2VASA 2XNQA 1U1PA 3AA8A 5IV4A 1RDBA 2XSFA 3QEWA 3O3HA 3VQ8A 4CCHA 2HQ3A 1S1TB 1U2CA 3HKZD 4ANEA 1X7VA 3GBTA 4MK9A 3CFPA 3DNCA 3RB0A 2HQGA 2C2NA 2GHPA 5ETPA 2BDPA 3G2XA 5AQOA 1HKBA 2GQQA 4P74A 1R8PA 3X1LB 4X4SA 2DT9A 2HFZA 3HHLD 1N0VC 1NU4A 3GE9A 3FMBA 2YKQA 3MR6A 3H42A 2XLJA 2AZ1A 4P75A 4FBUA 1Q9YA 4BWJA 5HRSA 2MQNA 4Y2KA 2KYXA 3ZTOA 1RAAB 2HOEA 2BJ1A 4GW6A 1Q7YO 1VQ5N 1FRIA 4FJ9A 5EXWA 4IDKB 1PBAA 3PSIA 3H59A 5AQVA 4GV6A 5AQUA 2K1RA 4QR2A 5B8HA 1UVJA 1QD1A 3OFGA 2AYMA 3BYPA 4MO5A 2DFFA 3HD2A 3FSYA 3CW2C 3NH2A 3VAJA 4PG6A 2UV8A 4FPIA 3DOKA 5DG9A 3R8EA 3J7AN 3KK3B 4UOFA 1N33J 1C1AA 4B1WB 2Z1JA 3DDNA 2X7IA 1RAJA 1FJGK 4LBHA 5HVFA 3AQOA 3CJKA 2ASDA 3PLAA 3PHEA 2ZOGA 2C1EB 3B6BA 1Q53A 5LY3A 1N48A 2DTUA 2DH9A 1XHXA 4I6MB 2VV5A 5ETNA 3DXBA 4JKDA 2CG8A 3VAGA 3VN5A 3VOVA 3SBGA 5J2NA 2JEJA 4OPAA 3J81O 5KPRA 4KE5A 4PKHA 4F4AA 4NX9A 2HHPA 3WXMB 2XSJA 3R5AA 1JLEB 3KK2A 1NXIA 2C3YA 1U2VA 2H9ZA 1RCXB 2HVZA 3PR4A 2ZQBA 1F21A 5DO2A 4OJGA 2FLLA 3V1QA 4OPHA 2JVOA 1O5JA 4DR1F 4YR2A 1DY3A 4TKTA 4YR0A 4H5WA 4KPYA 5L38A 3HK2A 4JEPA 2HHHK 5IT9U 3MXJA 4I2PB 2GAGC 3CDWA 4TY8A 2HS0A 4HI2A 4D3GA 2FJWA 3TAPA 2F8EX 2AIRB 2B4VA 4AXIA 2VF3A 1SIWB 2Z2YB 1I1GA 3B4MA 3JQKA 4TN2A 2CVEA 5JLFA 4J2AA 4ED4A 2PO4A 4WKYA 1R8AA 1WUAA 4QR0A 1XQSC 1XK8A 3WNHA 4FW1A 2HGNA 3OA9A 3AXKA 3IS9A 4H03B 4E7HA 4LFCK 4OX9F 4ED0A 5K5MA 2AKWB 1F3FA 4DTUA 1Q81T 4IUFA 5IM0A 5L1JA 3KOAA 2LCWA 4Y2AA 3Q8YA 1JLCB 3MD1A 1RDAA 1SH0A 2CPEA 2P9PA 5BR9A 4OKEA 2H1YA 3NXZA 1B7YB 2VPZB 3ONQA 3HSDA 1KLMB 1GXUA 2Y0SD 4CJUA 3AARA 3UDVA 3QRQA 4MDAA 4FNIA 2MY8A 1NEEA 2O8DB 1F5CA 3JYTA 2DYAA 4K2JA 5ETVA 1HR0F 3MR3A 1LKZA 1FDDA 3UDCA 2XNRA 4LMZA 3ZO7A 1VC5A 4EZ6A 4F4KA 1RYRA 2NXUA 1KQFB 3OJUA 3CXCM 1RTHA 1T9XA 2ZF5O 1TL7B 1RDRA 2Z2ZA 2VB6A 4LH4A 2W6LA 5F3TA 4ZLJA 5JVGQ 4FCYA 4UOGA 3CJ9A 1RTDA 2Q97A 4HL9A 3T1YK 3FZFA 4Q8EA 3CC2N 2P9GA 3LA0A 4JN4A 1MWKA 2YCHA 4X66J 5AZIB 4EI2A 3S8SA 1JCGA 3SUOA 1Q86O 2PC6A 3MEEB 3O3FA 4JKEA 1XMBA 4P72A 3WIVA 1LW2A 3V81B 3W63A 4HKQA 4HDHA 4K4UA 2AP6A 4DL5A 3QRRA 4C98A 1BIZA 4BRDA 3CCLN 3EM1A 3ENWA 3W62A 3O1WA 2GTDA 3CJKB 4C1NK 4I2PA 4FJJA 1R0AB 2UXBK 1BC6A 2KM8B 3A0IX 1OSCA 2YKAA 1LWCA 4GV3A 4F7VA 3RR7A 4YORA 1NBWA 4FYWB 4LF9F 1RKJA 2IJFA 1YJTA 2A2DA 2OFHX 1HKAA 3OR1A 1T3VA 4GV9A 1G3OA 2ZOMA 3KD1E 2HS3A 3MOJB 5CA5A 3DOLA 3FR0A 1B7FA 5KFZA 4ILMA 3H5XA 4LRFA 2FZKB 1Z25A 1C1BB 1JNRB 4LUBA 2O1PA 3NGDA 4FM2A 4R25A 1FFGB 2R7TA 1Z6RA 3P1GA 1VQKN 3MX2A 5A8KB 1U8SA 4DFKA 4WP3A 5SUHA 4IO8A 1GLFO 3C95A 4YOUA 2G1DA 5EN1A 5D6GA 4JI8K 2D7SA 5A8WA 4FF4A 4NA3A 3BGFA 3LPTA 1RHKB 3E01A 2CWXA 3CNQP 3QFPA 3WBZA 4KREA 4LQ9A 4PKIA 2BANB 3CM5A 4K4ZA 2E88A 4ZVOB 4CZCA 1F6TA 2NR0A 2A1RA 2GQCA 4KB7A 4BY9C 2UVRA 4G3IA 2KTQA 1XQIA 1VJWA 3GPAA 2HPUA 2VODA 4GRSA 2P9IB 3S6EA 3EDQB 4LFCF 1G15A 5ADXH 4IFYB 4BGAA 2YNFB 4FLWA 4HUEA 4FS2A 4J9LA 3KHLA 2MJNA 2GUPA 2GAHC 3FEZA 4BROA 4V1Ak 4A46A 4F3OA 2AGQA 4O4GA 4OHYA 3KLEA 1GMVA 2YWGA 4PPZA 3E9PA 5LMUJ 4H4OB 3SCKE 4IEEA 2VFTA 2UVVA 2RU9A 1MMDA 4NYPA 1A9NB 3CCQN 2OSRA 2YPZA 3LGMA 3V9SA 4C3KA 1M5VC 2FDNA 2KG0A 4FJMA 3KK7A 3BH7B 1ZBFA 1VRQC 2XMAA 5FPNA 1RHJB 2ZFHA 3UR3C 3DI6A 2QWNA 4ZPWR 3DI6B 2IRYA 4UOCA 1BI4B 2Y9HA 2XBPA 1PBUA 4DL7A 1Y4ZB 2IIHA 4JI0F 3D7SB 1VK8A 2YKPA 4OHZA 4NLCA 2CH6A 3ENAA 3GIRA 2OPQA 4BRCA 2MPUA 5AQMA 1IUJA 2QSWA 5AZJA 4EP4A 3SUNA 3GR0A 2E1MC 2IVFB 1IH7A 2KHDA 3S1TA 1KDNA 2P9SB 4Z2XA 2XC9A 1N6QB 1PC4A 4MJKA 4K4XA 2D69A 4PY5A 3WT0A 3OLAA 4M94A 3OJSA 3CJTA 5AE3A 1PAUB 1YBTA 2R7VA 1E4GT 3MPUB 4OI1A 3D2EA 1AXQA 1KN6A 2GMJA 2MHNA 4QU6A 2H51B 3QNWB 4QW9A 3LZJA 1WN7A 3W2VB 1NB7A 5HVGA 2NUUG 4EK2A 3DOMB 5KT4A 2E1PA 4PXEA 2IGIA 2F9WA 4M5IA 2PFUA 3PX0A 1XR6A 2XMTA 4DV3F 4HCBA 4AD6A 4DV0K 1TFWA 3DGVA 3B82A 2RKIA 4DV5K 1Q82O 1HWUA 3O4WA 1QUPA 2WZ1A 2KHCA 1BOTO 1LK5A 3TZYA 2CPHA 4JI0J 5KGXA 1XI1A 3WXJA 3P6YC 2R2RA 4BE2A 1FDNA 2MKKA 4CEDA 2GBZA 4IOBA 3RRHA 5ETTA 1KCFA 4CLYA 4QOTA 4FK2A 4QAGA 2BANA 4EEYA 2VYPA 1D4XA 1K8AO 4OYZA 1U0HA 3AO3A 2CYYA 1SKSA 5GVQA 3FEXB 2F63A 5GINA 5U47A 3BQ2A 3MTKA 1IBKK 1IM4A 2EFQA 5AQHA 2QE5A 1EETA 4N5SA 1FHTA 3NAEA 3QFUA 4JHDA 4UZCA 2PN6A 2CQHA 3ILIA 4CJFA 1RDCA 1Q16B 5L1KA 2HBQB 3T3FA 5JVGL 2NRXA 5KFEA 2G2OA 5DM6L 4DB3A 1GMUA 3P96A 3AVCA 2FSJA 5AQXA 1OYDA 3P38A 4TU7A 5GADI 2MMYA 4NCGA 4LF8F 2VWBA 3MM5B 2XY6A 2D0BA 3DRPB 2NRRA 1ZZFA 4E7LA 4ZLNA 3E01B 1S22A 4NEZA 4C11B 3TABA 1ZAXA 3T9NA 1YJRA 1UWBA 1QM9A 3OR2A 2CJBA 1VQ4S 3ZSOA 1HI1A 3V81A 4OLBA 3I31A 5HQMA 4H4MB 3OBWA 4M5GA 4K0KJ 4LFBF 1S0MA 2P9SA 4ZITA 1UEKA 5T14A 5AQKA 4JI2F 3O5BA 3AJ1A 2HVIA 3LAKA 2DGXA 3GMGA 3SSSA 1C0TB 4CH0S 1R0AA 4WFNQ 5HLFB 3BGRB 3AVFA 3TUZC 3DWLA 3NAIA 4KI4A 2O5DA 4G1PA 4DX5A 2B6AA 3UDEA 1OQ6A 2O01C 5C2GA 1A0OB 1WKLA 4KHMA 3TWHA 3Q23A 5IWAF 3OYGA 3HOTA 1RCOB 4JI7K 4DUZK 3BR9A 1QQOA 4DL2A 3CCUN 4DI6A 1NJZA 3JSBA 3OYAA 1UETA 3NP5A 3QZ7A 2DH8A 3N4WA 5DRKA 4K4VA 1J2VA 4FPRA 4DU3A 4J9RA 4O3SA 4ECZA 5THWA 3TAEA 2ZVIA 1HPMA 4OX7A 1D9FA 1YF5L 3N5BA 3ADAC 3OYLA 2ZBIA 3A5LC 4G6VB 2QL9B 2F7VA 2DVIA 1FE0A 2K06A 2UXDJ 4FVMA 4DQRA 1BQXA 2HZAA 4WPAA 3AGRA 5BR8K 3I0SB 2IIRA 1VQ9S 1EIYB 2IMOA 2J9EA 2DNQA 4IH5A 3MK6A 2KT2A 1VQMN 3PRDA 3VQDA 4P7VA 2CQ2A 3B6OA 4NLVA 4ZOSA 4JYAF 5AQLA 4CLTA 4M8LA 3Q7CA 1QAYA 4WJBA 4B1UB 3AHPA 5KRSA 2HGLA 1M5OC 3HM8A 2AJ2A 4ILJA 3HSGA 3H4DA 4NA2A 2Y0BB 3N79A 3DC2A 1T9TA 2W8KA 4JI4J 2FD2A 4CF9A 3UKUA 2F8SA 4U67L 4KH6A 5J2QA 2GCFA 5CE3A 2VDHA 3NEKA 3T9ZA 2VBZA 1NJWA 5KG4A 4NLSA 5CQGA 3WNFA 3H98A 4DFPA 2JH3A 4CLZA 4DPUA 4AHRA 3EE8A 1DAXA 4DV6J 1N5TA 3QRPA 1IG8A 3BJYA 2ZM6F 4Y34A 1NK9A 2BOPA 4EO8A 3MCPA 1E4FT 1YBAA 4AT1B 4AF1A 1VSJA 2OTLS 3TWZA 3M9OB 1U1MA 3RVCA 2UUAK 3GG0A 1MDUB 5HMWA 1LAVA 5F8GA 3CCRS 1SJRA 3VGLA 3CCVN 3TARA 4H0TB 1GLLO 3T1AA 4XPEA 1UCNA 4ECXA 4BVOA 4JI6F 2BE2A 3DGPA 1MWYA 2K1RB 2YNIB 2OMOA 1NDLA 1I94J 1XNRJ 3IKMA 1S48A 4OYXA 2XSJB 1VGYA 4LSZB 4OZNA 1WSHA 3Q22A 2XY8A 2XMVA 4Q7AA 2UVWA 2ROGA 4NE9C 4B3MK 2LECA 3VGVA 1M0SA 3RW7A 4PABA 2NLWA 1NO8A 2P9CA 2C3PA 4IDHA 1Q78A 1Q18A 3MEDA 2R8KA 1TKZA 1NJIT 4RJVA 3QT7A 3OS1A 2HK3A 3FCWA 1Y10A 5B7WA 1WLJA 3TSQA 3H0PA 1NPRA 4QS8A 1KWMA 3PFEA 2CKWA 3FGVA 4ALZA 2WW4A 4DG1B 1WG5A 1K1SA 4HLBA 1FXXA 4KGMA 2I5JB 4YB7A 2CQ0A 5ETMA 1RHUB 2CNNB 2M2BA 3FSIA 5KQDA 1S9EB 1IR1A 1C0GA 2V2VA 2H5JB 4LIRA 4DF8A 4ILRA 1XIQA 3ENOA 1PO6A 1RTIB 5D8HB 5AQNA 3CI5A 2MDAA 4TYBA 5IT9O 4YY3K 4DSFA 3NNAA 1L5UA 3NF7A 5EVZA 3SXLA 2MTLA 4EO6A 4CP5A 3ASMA 2CQIA 4OZ0A 4RCHA 4JV2A 4DU4A 4KBOA 3MM8A 1VMBA 3MM8B 4PUOA 4YY3F 4HUFA 4DR4J 3AA4A 2KXNB 3G87A 2W9BA 4LR7A 2QKKA 4JV5F 4JKBA 2P8IA 5CZXA 5ETKA 4DR5J 4DV4J 4BDYA 1ZETA 1NAQA 1UWAA 2FSNA 3MPDA 3FQLA 1N4LA 2Q0UA 1WHXA 3POTB 3VMFB 4DDFA 4RUAA 4A5BA 1VI7A 3CTRA 4W5OA 1JJCB 4CGFA 3TANA 3AVNA 2CRLA 2PY5A 1OY8A 1JLGA 3NCPA 4I4BA 1JXEA 3O8MA 3A5NC 4B3TF 1GLBG 3THVA 1IKXA 1CQMA 4E0DA 5KFXA 1O6XA 2F4FA 2B9WA 4KFBA 4DXLA 2BH1A 4HHJA 2Z4PA 3OTEA 3FFIA 3BPSP 7FDRA 1OIAA 4G1QA 4CO4A 2XCPA 3EKSA 5KPTA 1HUXA 4MT1A 2YPYA 4AM7A 3S3OA 2B8PA 1FVSA 3MAHA 4P2SA 4HVJA 3NL0A 4R0EA 4ZN3A 3BPDA 1HD0A 2QGFB 2YXLA 4DR6J 5ETLA 1U04A 3VQBA 4DUYJ 3HI9A 4RL1A 4JK9A 2DR7A 2QW9A 4O44A 3IAYA 4P2MA 1Y9OA 3I96A 4Q0BB 5HJYA 3G4SS 2WUSA 2YHAA 2Q6BA 2PA3A 5CD4H 1V3RA 4MIWA 3KD5E 5KFMA 4DZ6A 2O8FB 3VQTA 2V51B 2SXLA 2KO1A 3LH2S 3VCDA 1SL1A 2PI5A 1B0TA 3NDKA 3HHNB 2E6MA 3I8DA 4LBPA 4CDIA 1FRHA 2GJIA 4AHUA 4X65J 2B4PA 3CO0P 3ENQA 4RU2A 2PE8A 3ZZYA 4I9LA 1BQNB 1LEOA 3TNVA 2A18A 3SCJE 1ZBSA 3WNEA 3O9UA 1HNWK 5K20B 1SKRA 4DV1J 2K7KA 3ET6B 2OA8A 1I39A 2Q31A 5AFUH 3MXMA 4YEAA 1H98A 3GWCA 5K8NA 3LOUA 2Y8WA 2HQIA 4F25A 5BRHA 1R8CA 4B1ZA 1YHQN 1WBBA 1TKXA 2NSCA 1TZ0A 3KKFA 2E5LK 3CE8A 4NASA 3IAM9 2R2TA 2OPSA 6AT1B 3W9IA 4ZS6A 2WC9A 1RTIA 4M5MA 4O55A 4CF8A 4KBIA 1J5EK 4U7UD 3H7HB 2FC0A 3U3YA 2E7VA 3AVIA 2P9EA 3C15B 4ZPDA 5E26A 3BB5A 4HWIA 3MDFA 5KFOA 5AQWA 1JCEA 1WSVA 4I68A 4F4XA 3C3LA 3R1LA 1XMOF 3I5CA 5C5JA 3PR5B 4GMJB 2GUIA 5LJWA 3Q8SB 5B0AA 4UUXA 4QR1A 3F2KA 1U6FA 2OYQA 2NUBA 2QO3A 3NGYA 2C2OB 1UFWA 3OYNA 3QLHA 4B9NA 2HFOA 2QYGA 5LMNK 1C2PA 4GKKJ 3I33A 2M88A 1RBTA 2ZZTA 2XWYA 4LF9J 2VOPA 3J81Y 4DPYA 3ZZTA 2QA4N 4UW2A 4F04B 3P31A 1VQYA 1FWPA 4FP9A 1WSIA 3ZSVA 3M1VB 1JK9B 2LEPA 3G6XA 2HIQA 2I8EA 2YWEA 4Q2LA 1WF0A 2DITA 1WSEA 1UEVA 5A8WB 1HQ2A 4K8RA 3I9ZA 3PIOL 4AUKA 2I7NA 4LSNB 5DGBA 4M3XA 4NXNF 3UI3A 5LT5A 1KQSR 3R6MA 5LSOA 1TL4A 5HSPA 3SV4A 1JLBB 4ZCMA 1YUWA 4P71A 4HACB 5HLFA 3K5OA 5D0HA 2XMJA 3HP6A 4F3TA 7FD1A 4B9VA 2LDYA 3V1OA 4ZVPB 3HL8A 4M3RA 4X62F 4I64A 4YMEA 4JI2K 2QZ8A 1YVNA 2O8EB 5AQQA 4DKWA 2VFRA 4W5NA 1O0PA 4MO4A 3CJ8A 2BJ7A 2AJFE 2JJ4D 1HI0P 5JS1A 2XZTB 4F36A 4ZHRA 3RG6A 4BR2A 1OPZA 4HYKA 4WYBA 2X51A 3WXLA 3CCVS 3O6WA 4A2BA 1HYSB 4DMNA 3OXFA 2FLNA 1NSAA 3H5UA 4DTPA 1D8YA 3QNOA 1EO1A 3MHYA 4CTAA 1KQKA 4CZMA 2QX0A 3NWGA 1SUQA 2XYHB 1VBXA 3BF4A 4FZVA 1FNMA 4OX6A 3FCHA 3SV3A 2KFNA 4F4WA 2ASPA 1NDPA 4M95A 1IKVB 2FZGB 3GOIA 4BG9A 3KLGB 4J9OA 4UTGA 1BO5O 4QCLA 2ILYA 5LSRA 1C4AA 2E20A 3RAXA 4JV5K 2VH7A 4BCAA 1QAIA 3D68A 4LIWA 1H72C 3AB2B 1HFEL 3PHTA 5M1NA 1WC4A 2HHQA 2OIHA 4B9TA 1Q8KA 3E1YA 2V6AA 4CK2A 4Z4CA 1TV6B 4WTYA 1N32F 3CULA 2LQBA 1TK0A 1RDWX 2D3UA 3D3CJ 2KFYA 3ULDA 3OYEA 4L74A 2BGGA 1J9AA 4KFBB 1S1WA 1SI9A 2EKYA 2FIUA 5CY4A 1RWXB 3VQSA 1JLQA 1IBMF 4EAHD 1RWUA 1WUUA 3W8GA 3ZTSA 4DU7A 2ADCA 1UA0A 3D9BA 3DU6A 4K2XA 2G8IA 4Q5VA 1HNWF 3ENHA 2J5AA 3EVMA 1KAXA 3EXYA 4IO9L 3N28A 2MB0B 1ZAWA 2DY4A 1VQ9N 2DB1A 1TUGB 3IFRA 2F9DA 2HURA 3VQCA 1VSLA 5JMVA 3H1VX 2B0GA 1SC4B 3LP1A 5KFDA 1QVFR 1G6BA 1KVCA 3PKMA 4LR8A 2XLKA 2KZMA 4I67A 4U7BA 2UU9J 3TAMB 3UNYA 4DFMA 2B7CB 1C1CA 2UV8G 1U1NA 4OLOA 3FBEA 1UFLA 4BRNA 3M6UA 5F41A 5JXSA 3GIJA 5AXMA 1RK8A 5K8PA 2HBJA 4YB6A 4WFAL 5AQYA 4ECWA 1BGXT 2BACA 1VIOA 3M6XA 1QE1A 4CGJA 4IRCA 4X65F 1KAYA 1RP5A 1BQNA 4FPBA 1FJ7A 1CULA 3GQCA 3LAMA 1TVRB 1NGBA 4ECSA 4G1IA 2E7WA 3TX0A 1I3AA 3VA0A 5AJ3J 4I0WA 3VF4A 2E2QA 2L3MA 1GOCA 4NXNJ 1YITN 1RHRB 3RBDA 4FXDA 4M5LA 2AHOB 1CPZA 1XNRK 2Z2MA 1RHMB 1QJHA 4QU7A 2F9TA 2XULA 2CQCA 4CGDA 3NAHA 3ILOA 1U1KA 3BSCA 2RUSA 1Y0HA 5KT3A 2OPSB 3L2VA 1OO0B 2FVQA 1C0FA 4U96A 3BGRA 2VHGA 2DHAA 3CJ1A 5CHIA 4KJIA 2OTJS 5KI6A 3D0IE 5BRFA 4K50A 1A5WA 3J7AP 3CPWM 1WC3A 3Q8RB 4H4OA 1VC6A 2LXIA 4W5RA 2ZD1B 1HNIB 3O6QA 3LPEA 3H25A 3UN5A 3KKRA 3VTIA 4NXMJ 2C3UA 1VQ5S 4HEA9 1NGAA 3A5OC 4PL7A 3C14B 5J1PA 1UZHA 1YJWN 3HO1A 1JIHA 3CQXA 1HNXK 1M5HA 1XC9A 3P4IA 1S99A 1HBMB 3WIUA 3M2UA 2FBXA 4DTMA 4LRDA 5FRMA 2UUBF 1GLJO 1V5IB 2WBMA 1UA1A 4JS5A 5L8RC 5B0DA 1RGVA 3B8HA 5IC6B 3GDQA 1ITGA 3IRXB 1T3NA 4E1NA 1XNQF 2Q1NA 1SQGA 1AA1B 3CJ5A 4K7QA 4J2BA 4GO7X 4USMA 3E3XA 1F9HA 1OMSA 4C97A 3LPYA 4QWBA 3O1LA 1SJ1A 4H5RA 2RHSB 4OI3A 4JRQA 4MH8A 1JLAA 1CVJA 2XY5A 3HVTB 1LXJA 3OS0A 5DQGA 4KRFA 5HRRA 2YQ0A 2G2YA 4JRPA 1NKBA 5BPMA 2V69A 2CGJA 3Q2SC 4YDDB 4JI6K 4DCPB 3RW6A 4BVPA 2RRAA 1CZ9A 2PEBA 4KAZA 4O3OA 4EU0A 3MAAA 4ED6A 4LF9K 1YI2S 2DEJA 4P7TA 4F3QA 1QSYA 2LSNA 2BKNA 4F02A 3DXKA 1WI8A 1VR6A 2V7ZA 2QL7B 2G2ZA 4IR9A 3M9NB 4DPTA 1ZBLA 2IHR1 4P9SA 3AO4A 5JJBA 1QVGM 4O3NA 1UW4A 2FBYA 2PFDA 4IKAA 3G6YA 1XMQF 3T5JA 4IG3A 4NMLA 1IQTA 4XDDA 3EGWB 2ZWOA 5HROA 2QC3A 2VONA 2CJ9A 4LF7F 1AT1B 2E8AA 2EBEA 1FXLA 3OL8A 2DR8A 3G10A 1EQMA 2Z56B 1T05A 3T1HF 1SL0A 4QIWD 5IC4B 1RAEB 4GKJF 3EDRB 1FK9B 2VPXB 1KD1O 3VQ7A 3KVGA 4PUOB 3WHIA 2Y1IA 4KTQA 4NI2B 4CGGA 5DDRC 3T6BA 3SBMA 1FCAA 2GVZB 4EHTA 1Q86T 1Y97A 4GVLA 1RBSA 2YWHA 3PG9A 4X4VA 1B92A 2DGUA 4A8WA 1DLOA 2GX8A 5AFUA 3C65A 1Q5YA 5HK4A 1MW7A 1YVUA 3VF6A 2FLOA 3KIOA 2QYCA 2DH7A 4GY2B 1EKSA 1XNQJ 3CDBA 3NF6A 3K8WA 2YHWA 2DRDA 2F3JA 5M2RA 3TUPA 3MPWA 2VFSA 5I3UB 4DG1A 2R2SA 5KFVA 2ATCB 5DM6Q 2VL1A 3K58A 1VC0A 1Q8BA 3A5MC 3LUYA 5KFLA 4JV0A 2R7QA 2DNGA 3I32A 4CLWA 2CQ1A 3ZNUA 2MKCA 3P8BB 3BO2A 4TY8B 4FF3A 1MROA 5E3QA 4K5RA 1EARA 3AODA 3QFWA 1L3SA 1OH5A 3EJMA 4WKRA 1VQ8N 3HFKA 2M9KA 5A0YB 2UVUA 4DUZF 4DR6K 3AAQA 4J9KA 3THWA 4ZVHA 3UW1A 4FLUA 1VQON 3N4PA 1U2VB 5JVHQ 3EUNA 1R8BA 1EWRA 5KG0A 1T9UA 3QDKA 1KS2A 3IBWA 2LA4A 3RJMB 3VV2B 5A8RB 4IG3B 2WB4A 4M63C 1Y3JA 5IV3A 4FM0A 3TAGA 2ZZNA 1TUYA 4Y0WA 2KI2A 3K5MA 3PFOA 4A8FA 3M8PA 4DCOB 3D1QA 1HYVA 1NZ8A 5L9XA 3AVHA 2MLXA 4ZVUB 4KH1B 4OJHA 2X3DA 1KNZA 3ID6A 1YX2A 4CHPA 5L1IA 4NXMK 2UUCJ 2IS3A 4IRDA 4LF5F 3ATUA 5KG7A 2W42A 4DX7A 4DU8A 3J80O 5KFFA 5M1QA 2E5LF 2A3ZA 2QJ3A 1DFDA 4DWIA 3U1NA 4KI6A 2UUBK 3ZZZA 2YBVA 3V5RA 1GFWB 4NLRA 1GMWA 1EJ7L 2MZRA 3D6MB 2QTDA 4IFVA 1C4CA 2VWJA 2ZH9A 1NDCA 5CYQB 5BJRA 2L48A 2C2KB 5HI7A 3UKRB 2GMHA 2OGUA 2P9KB 1WG4A 5KT2A 3CUNA 3I55N 4BRHA 1N5VA 5E3RA 3R6LB 1YJUA 1IWAA 1VQ6S 3BN7A 2IM3A 2P9PB 2A41A 1GLCG 4X66F 3ALYA 3CCTA 1PSDA 2E2NA 1HMVB 3HRGA 3ZEUB 4JV1A 3TJAA 4CVNE 1P1TA 2EFOA 4URQU 2N3LA 5EU7A 3UE2A 2VG5A 3MR7A 2OPPA 3NOCA 4DPOA 2XY7A 4RBVA 2Z0GA 3LF0A 4BR5A 2W2PP 3AVJA 3ELHA 3J7YU 3WXKA 3CJAA 3OS2A 1AZSA 2D0PA 5IM0B 1U26A 3UN3A 4CFAA 1WF1A 1RTJA 3R7BB 3IWNC 1QTNB 4H0XB 2W4CA 4ISGA 3H1QA 3M1VA 3L95X 1NK4A 5BXIA 2HNZA 1V3ZA 4OHWA 1YHQS 1SJFA 3NS5A 3SEOA 2G8WA 2A6MA 3UB5A 1WTBA 4ZTFA 3ZZOA 5B0BA 4NI2A 1OJ4A 3AB4B 4TLQA 3MECA 4B3SK 1S5ZA 4HCCA 3RU0A 4LD0A 2MKJA 2GFFA 1CBKA 5IZHA 1NH8A 1S1XA 3KK1A 4TQRA 1BCOA 4ZP9A 4NLQA 3LM9A 1W2IA 5C2FA 1SCJB 4CJ5A 4EWTA 2FJXA 3H4BA 3V1RA 4BE0A 1M5PC 4Z7YA 4WF9Q 2ZDPA 4LFAJ 3C15A 3CC4S 2UUBJ 3NGTA 4BDZA 1TUWA 3D0HE 1MWZA 4F67A 3AO5A 1YTUA 2QKBA 3UDLA 3S3MA 2OCEA 5KFNA 4CEEA 2H5EA 2MQOA 5ADXA 4AXJA 1TKXB 3OFHA 4A48A 2BVZA 1OVYA 4CO3A 3RWUA 2OANA 3KLHB 1E6YA 1FJCA 4LH5A 4RWWA 4MK8A 4JV5J 1IJJA 4ZJOA 4M3ZA 5L9NA 4AE5A 2Y1LB 2P9UA 1IQZA 4RNNA 4DX6A 5D78A 3TX8A 4QIGA 2ACYA 1X5SA 1Q5VA 1VRUB 1ELOA 1V6HA 2Q2RA 3CGIA 2BE7D 4IOXA 1MNEA 1M90T 1WOSA 3TRGA 2W9CA 2OD4A 5GAEI 1RT7A 3ZNJ1 2WSFC 2D5RA 2Y1JA 2XS2A 5IT9Y 4CM2A 1CLQA 1QZ6A 3C6TA 3E2EA 3LGNA 1Z1ZA 5KG3A 1IWGA 4DV2J 3NS7B 3GILA 1UPMB 3AVKA 3FZ2A 4ELVA 2KKZA 2HLUA 2F5GA 3R97A 4WFYA 3H40A 4KHNA 5D4OA 5HBMA 1FDAA 2H4WB 3SCXA 1FRXA 3PTWA 5LXYA 3W9HA 4MMOA 1CS4B 4WK1A 1A7GE 4RTFD 3PJXA 3NF8A 1B9FA 4DV3J 4KTWA 4YR3A 4C0BA 5F3ZA 6FD1A 2D9OA 4H4MA 3QWUA 2YWWA 4HUGA 5HMYA 3A4TA 3OL6A 1OYEA 3QAEA 4DV2F 1XNRF 2A6AA 3G25A 4CGHA 4WFNL 3SPZA 4ZP7A 1H1VA 5A6PA 1U2FA 3M2RB 4CJPA 1YIJN 3CQ8A 5K9FA 4H0OA 4ZPVR 1NPKA 2B4OA 3AA3A 3FMWA 3AXMA 4PYDA 3QGHA 4OKJA 4RU9A 1PAEX 1HNIA 2AWZA 3MEEA 4WTOB 2F96A 1S59A 3QPIA 1CJUA 4UQTA 2DPNA 2DNHA 3AD9C 5M1FA 3C14A 2FF6A 1J5EF 1HR0K 3VEOA 1TYQA 4CIGA 4WU3A 5F8LA 4GKKK 1T95A 4FM1A 3L8BA 3K9KA 5KT7A 4DLGA 3TR8A 4Z4EA 2A10A 1LAWA 1R8HA 4CJVA 2B5JB 5B09A 1Q95G 1O1WA 2NPIA 2AEFA 4LFCJ 1AFJA 1M90O 2JHEA 4Z94A 3JTOA 1RT2A 2HGMA 4RW9B 1X1PA 4B1YB 3CD5A 2B8QA 2JWLA 5BREA 2R4FA 3TAMA 1YITS 3HXMA 4FJKA 1C1CB 2JLFA 3BKUA 3VQEA 3KG0A 3L3VA 4K0KK 4Q44A 4ZA1A 2WBNA 1WHVA 4OI6A 5GMKa 3C6UB 2RHKA 2KYZA 3C6UA 1TTHB 3C16A 4USJC 4PG4A 3T69A 1CZBA 4R79A 4ED8A 4R8UA 5HMXA 4C8ZA 1X4HA 1VS3A 1S1VB 4R8UB 2YWKA 3D2EB 2VFUA 2IC3A 1VOMA 2GEMA 2JWKA 3AFGA 1LW0B 1DARA 2N7CA 1FD2A 2I0XA 3R9PA 2OI2A 5GIOA 1GXLA 1UOCA 3V4IA 2VJUA 4NYOA 2FYXA 1GTEA 4YB5A 5D4NA 2UP1A 4E1JA 4KKOA 1WELA 1VIXA 1RA6A 1URRA 1VISA 1S9EA 2C2MB 3HHLB 2O66A 1ZBHA 5GAHU 2RRNA 5E41A 3ZT3A 4E89A 1IV0A 3A3NB 3SFGA 1BISA 3VETA 4DU1A 1FRLA 2A3JA 3THTA 3RSEA 4NZ6A 2E5IA 2ZHBA 3KWIA 2JNJA 5HVHA 2E1AA 4ID5B 4I7FB 1UEUA 1U0HB 4DV0J 1A5VA 3NOGA 1ZBTA 2CJAA 2QEXN 4DUYK 2R3VA 2IYIA 3HJFA 1JLAB 2MZSA 3J7YP 3OW2R 4X4UA 4IYQA 5GAHI 2YH1A 5JICA 1JJ2R 2G8KA 2W40A 1HQEB 3UD3P 1L3TA 1GNKA 3L2QA 2BE2B 3DGPB 3HKWA 1RACB 3IR5B 4ZCLA 3SUPA 3OL7A 3TEHB 3JS6A 3CJCA 2NRZA 3SQ1A 2PMZD 1S6PB 1ASVA 3O2IA 1RAHB 2BMBA 4DUYF 3NLCA 3P5JA 4YHHF 3WNGA 1RT3A 4RUHA 3PEHA 3C94A 1PC5A 4D3HA 2A2CA 4O8UA 4L3NA 4USHA 2YNHB 3MUMP 3PYFA 3M8YA 1XJWB 2XHCA 2QRRA 4Q8FA 2VUGA 5KPZA 4HH1A 1NWKA 3W8PA 1RU1A 4IG0A 4DV4F 2EBGA 3M6WA 4OV1A 1MMLA 5C0YA 4DR4K 2AMCB 1JLCA 5T7LB 4PG8A 3T41A 3LALA 4CECA 3U1MA 3EWGA 3HVAA 4A8MP 3A12A 1B70B 4BWMA 1M1KT 1JLFA 3T5KA 3AVLA 1UKUA 4W5TA 3FJ2A 3TR5A 3VEVA 2IDLA 4K0KF 1URNA 1RAOA 3FQKA 4B1VA 1FX4A 2GVZA 4K8XA 1RLDA 1OH8A 3CIPA 1REVA 1Z05A 2HRYA 3IMXA 2XGQA 1BUPA 1DHMA 4FYVB 4GVBB 1FKOB 3IFEA 1BXNA 4H0YB 2A6OA 3S3NA 3ULEA 3OYBA 2NS1B 1S1VA 1TMJA 3KDNA 4TY9A 5DETA 2DO0A 3O9RA 5M2UA 3IXQA 2ZH4A 4ZDNA 1GQEA 5AXNA 2E9ZA 5GADP 1U0SA 2FF3B 1NMEB 3UKUB 2IJRA 2DBBA 4DS4A 4L8RB 4DL6A 3KG1A 3L2RA 2XS5A 4KAIA 3R8YA 3A8EA 4Y3CA 5DJBA 1HHQA 1RTHB 4F0HA 3NRBA 5DS7A 3LW5C 4KHQA 3LTOA 4TYAA 1ZAVA 4FWKA 1CEZA 5IT4A 4KO0A 3ZT1A 1XN9A 4FYDA 4B3MJ 4C9DA 4XAKA 4MKAA 4WYWA 4WK3A 3LANA 4PQUB 3HI0A 3K17A 4DX8H 1V5VA 4CEQA 4JNEA 5HRPA 3IUCA 1K47A 3M6VA 3TA1A 3CB4A 4IWVA 1Y64A 3PJ9A 3OLBA 3K59A 3QIPB 3GR1A 2E6LA 1S1UA 1SPBP 3DFEA 4OZ1A 5KFUA 3M2VA 4B8AB 1C0TA 3SUQA 4P73A 2MQPA 1HWIA 5KAKA 3WX8A 1NK8A 4DMZA 4FLYA 4USTA 5KG5A 3J8AA 2UXBJ 2P9NA 1CJVB 2EWHA 1RADB 3CCJN 2Q3PA 4XDCA 3MDQA 1T94A 4F4ZA 1MU2B 2VWKA 1HI8A 4ZVGA 3D28A 4DR5F 3ZZPA 1W7AA 4CIFA 1SQEA 3PXGa 2DJWA 2KFZA 2V50A 3NCQA 1RQ0A 4ZN1A 2YY3A 4QPTA 1AW0A 2HYIB 3IA0A 1HARA 3UQSA 2AU0A 2VDIA 4X66K 1ZTWA 2MY7A 3OYMA 3JTPA 3HFVA 4AH9A 1JX4A 3TEGA 2J8AA 4N56A 3WC2A 4DPWA 1UZDA 4BC5A 2ZUGA 2WAQD 3G86A 1FNOA 5AXKA 3GG4A 2BEFA 2ZM6J 1WB9A 4NLBA 3SBTA 5K14A 3US5A 3NNHA 2HNYA 2YX1A 4DV3K 2FY1A 1NNEA 4CEBA 3CETA 4NWBA 2FHJD 1BWFO 3DOLB 2Z1IA 3K0SA 3UR0A 4UY8T 4ED2A 1Y5NB 1WEXA 3DRRA 5JLHA 5J2MA 4NYNA 3V6JA 2CPYA 4DL3A 4CEOA 3TTDA 1RDUA 2ASMA 5BR8J 3I55S 3ZETB 4LF7J 3FBFA 5H9EJ 3GSDA 5AQFA 2KXHA 2V5HG 3PACA 2AF6A 3ZFVA 1H2TZ 4KGXB 3ITHA 3LDSA 3BO4A 3CJ2A 1R27B 2OMLA 4ISFA 4LF2A 1BLUA 2BJDA 4AQYF 4X4TA 2KKHA 2E9TA 1FRKA 5A8RA 3HYFA 3JSMA 5C2CA 1NGIA 3NMUA 1TMMA 3KK1B 3BF3A 1BL3A 3P45B 1W26A 3LWLA 1WEYA 1NGJA 2B4UA 4NCBA 3AJDA 5FPMA 3OXLA 2MQMA 4IO9Q 4S0MA 2FY8A 1FJEB 4XEIA 3S41A 2B9YA 1H2UX 1NM2A 4XH1A 4FVUA 2RVJA 2WVEA 4ETXA 4I6WA 3UD5A 1LWEA 1U24A 3HM9A 3VVUA 2Z8QA 3VALA 2V0NA 2B3TB 3HLUA 3WQPA 4PPDA 4FWLA 4JI7F 2P1JA 2RB7A 4DTXA 4J90A 3MMJA 3G82B 1JXVA 3WXIA 1QTMA 5DDOC 3G8TA 2EW9A 2MJUA 2ITGA 2HFNA 1X5OA 4DCHA 4LFBJ 1ICEB 3GIKA 2D9PA 1U1LA 4MIAA 3QYYA 3GJSB 3MAQA 2MSTA 4E7JA 1X0PA 2DD8S 2E1RA 3H2LA 2BJ8A 2QEXS 4BQZA 3E8OA 3ZTPA 4Z4HA 3QESA 2D1KA 4H4KA 2DXFA 3MM6A 1HW9A 1VSHA 2NRWA 1WTFA 3KLVA 4K59A 3PJWA 4KT0C 2E2OA 4K4TA 2HFVA 1JXBA 3ZT4A 1FO1A 1K9MT 4C2MA 4NCAA 4CJKA 4FXWA 1GAOA 4J8FA 1T05B 4KV8A 3KNAA 4FJ7A 2V8PA 2FC9A 2DISA 4KGZB 1UVNA 2PGCA 2QIFA 1IXKA 3ET6A 4TVAB 3QEXA 3A13A 3GV7B 5IQ6A 3TOQA 3KJVA 3AD7C 1UWBB 5D0RA 1R43A 1D5AA 2HBKA 5T41A 3LDNA 5CR4A 1RT7B 4I2QB 1VCTA 5KOXA 1NJIO 1S9FA 1FT8A 2AJQA 2YJFA 3O9SA 4ECYA 1L3VA 3O8WA 5E3AA 5FRNA 3KLHA 3EVWA 4PHTX 3P3DA 3L2UA 4E3SA 4H0VB 4NO7A 3GTYX 3VWSA 3PRVA 2IAJB 1B0VA 2BJ9A 4A4JA 3PIPL 4DV4K 4DR5K 5GMEA 3IMQJ 2NCKL 4OO1J 1HNVA 2KXFA 3RB6A 5J1EA 3OT9A 2IVNA 3DLJA 3H20A 4ZPCA 2ZBQA 1Y11A 2CJYB 3P49B 3B4DA 1NSQA 2BOAA 2YKMA 2W9BB 4A8YA 3DOMA 4IR1A 2KJWA 4K5SA 3TAFA 3QEIA 5AQRA 3W61A 4YHHK 4EUVA 3HVWA 2H48B 3CJSA 4JK7A 3DXMA 1CZAN 3FZKA 4YY3J 3M8WA 5C42B 1HBMA 1BE4A 4M3TA 1X9SA 4A59A 3DRYA 4M5DB 3M30A 3NCIA 2R7WA 3UFCX 4K4YA 1IKWB 4JAXA 1U6BA 1DQ9A 5B0CA 3MXIA 3MWBA 1IG9A 4OYIA 3N6LA 1X4BA 4DR6F 1CJVA 4TU9A 4CBXA 4L75A 3R3LA 3E51A 4CRJA 5ELZA 3Q7BA 1VFJA 2V8VA 5E5NA 4DUTA 1RAFB 1HYSA 1D3WA 2HVHA 2HHXA 3MWTA 2BM0A 2HVDA 1TL7A 1ASWA 3E9LA 1F0XA 3RMAA 2PEHA 2K3IA 3JSRA 4FWNA 2EFNA 9ATCB 1EQ0A 2DNRA 4PRFA 2ZJQL 1J53A 4W92B 5AZIA 4UY8O 1XERA 4R5PB 2DHSA 4CZEA 1MSWD 2A0FB 5CYMA 1VHIA 1I94K 2O8BB 1PJ5A 3OYDA 4CD1A 1RYSA 3LM2A 2MKSA 5T7BA 2DHXA 2HLTA 1AUSL 2QLFB 4MFBB 4DQSA 3OYHA 5F9LA 5LL6d 1GX5A 5L46A 2F7TA 4RW4A 3CMAS 1UVKA 4QW8A 2IC3B 1RKIA 3VGSA 1CQNA 1ZZNA 3BKFA 4HT7A 2QWQA 1U45A 1YJ9S 2UUAJ 3VESA 3CCJS 4BBYA 1PILA 1YZ6A 4YDUA 3DYAA 4BRQA 4CBUA 4E7IA 2IM0A 1X4EA 4CWBA 5C15A 2KG1A 2EFPA 3WC0A 3QJPA 4Z4IA 2B7BB 1O51A 3QLHB 3PW7A 2EFVA 4U6PA 3R9LA 1P9QC 2MHEA 2NXCA 2UZAA 3D6RA 3DU5A 3AOAA 3VTHA 3OV7A 4FK0A 2OEKA 2NXJA 4BGBA 2NXNA 3MPVA 4DL0C 4OYWA 1E6VA 1WWHA 3CCES 5J1EB 5AQZA 3VF2A 3EPGA 4P52A 2J6SA 4FO0A 2CH5A 3SMZA 3RR8A 5H9EK 4BC4A 2DR5A 5H9FK 1R0BG 3GFYA 2ZJPQ 4KB0A 1UJ6A 2RE1A 2G9OA 4I56A 3NGIA 2J0WA 4OZ5A 3O9TA 4CZGA 3O3GA 4CF0A 3SQ0A 3DMJB 3C66A 1NHVA 3J7YI 4IJAA 2OELA 5F1XA 4ZVRB 2K2PA 4F8RA 4JI6J 3LP0B 4F3MA 3IM9A 4WCEQ 5D15A 1IKYA 1NDKA 4M1KA 2CUYA 2RNEA 1VQ7S 4CO2A 4BQLA 1HHSA 4CW7B 2W9AA 4AHSA 1HIYA 1HNWJ 1SB6A 1K9MO 5HQ8A 2XS7A 4U8YA 3V6HA 2BTFA 3EZWA 4OV6A 2DY1A 4KHWA 1RA7A 2J7UA 4CJ7A 2R7OA 3UPFA 1WKKA 2FVRA 2P9UB 1IR0A 3F56A 3BN4A 4CFDA 3QSYB 1QLNA 4CD3A 1X4DA 1DTTB 4JKGA 2GJFA 4A8XA 5HMZA 4JI7J 2JEIA 1RLCL 3BSAA 1TVRA 2FB0A 4LREA 3OTOF 4L3QA 3ENBA 5AZJB 1X3NA 2M5YA 5IS2A 1RT6B 3BKTA 4CHZA 2O8DA 1RWVB 4BRIA 3K5PA 2J0QD 1KVAA 3AVBA 3CFRA 1KOOA 1K0TA 4WP9A 3NH1A 2OZMA 3MCMA 1RT4B 3K7RA 1VSFA 2ERRA 2C2RA 4MFBA 2QV6A 3HMJG 3RYLA 2JEFA 2H3EB 1YTAA 1NNDA 4BR9A 4JKCA 4RW4B 3RUBL 5MLCV 3PEJA 3DLGA 2VZ9A 4USWA 1FJGF 1QAXA 2HSEB 2CNKB 4NLTA 2V52B 1EP4A 4QPXA 3BBBA 4GMKA 5JUMA 3CC7N 4OJRA 3ENVA 2HHVA 2MQQA 1DURA 1LFPA 4DR4F 2ZH1A 3SQ2A 1K73T 4FK4A 4NXNK 4JI1K 2XG8A 2E1YA 2EK6A 4IEIA 1BWVA 3GL1A 5AJ3K 2D3O1 1JLQB 2HHHJ 2WHOA 3H90A 4OYBA 4DL4A 1N34F 2QWOA 4ITSA 3F9MA 2IM2A 2PD1A 1N8RO 4FWQA 3UVJA 3HCXA 3M30B 3UVJB 5H1SV 1BI4A 3S9HA 1LWFA 2HHUA 3M32A 4CNYA 1YVFA 1NOYA 5A76A 1D1UA 5LJVA 2HNZB 4QS7A 1KKHA 3OTOK 1QQMA 4FWMA 2HHTA 5C24A 4B3MF 1SV5B 1NH7A 3QGGA 4CI6A 5AQJA 1VQNS 2N7YA 3TP2A 4B3SF 2VPWB 4NYZA 4USIA 4UUWA 4BC9A 1UAXA 3JAMO 4DR2J 1U1RA 5C2DA 3OBYA