2HMIA

Hiv-1 reverse transcriptase/fragment of fab 28/dna complex
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*G
publication title Structure and functional implications of the polymerase active site region in a complex of HIV-1 RT with a double-stranded DNA template-primer and an antibody Fab fragment at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system/dna
total genus 135
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hmiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hmiA05
2WCXA 3U3YA 3M8RA 4DF4A 3IN5A 2ITGA 4F4WA 1RTHA 5L1LA 1SL2A 4F3OA 3SPYA 3FFIB 2XO7A 4E7LA 4E19A 2XRIA 4NLGA 3HYFA 4RW8B 1LW2A 1VSDA 2X74A 4NLDA 4KTWA 3FQKA 4FW2A 5JS1A 4KAIA 2XGPA 2I1RA 2ATLA 2Q3SA 1DLOA 3P83D 2Z1IA 4ECVA 3NKYA 3QGGA 3QEWA 1TKTB 3AVGA 2F8EX 4O3QA 4WE1B 4MK8A 1RYSA 2OZMA 1NK6A 4DL6A 2HB5A 1BHLA 1U49A 1X9MA 3MEDA 1RT7A 5HBMA 1ZETA 4K8XA 1U4BA 5KFVA 3H5XA 2IAJB 3SFUA 2YKNB 4NRUA 1S1VA 3RMCA 3T5JA 4DLEA 1NHUA 3AVIA 1RTJB 1NOZA 2ZD1A 2BE2A 3DI6A 3C6TA 2W9CB 3FRZA 1SKWA 1BI4A 3KD5E 1NJZA 1A5WA 4LY7A 3QO9B 1IH7A 4B08A 4O3PA 3NH1A 3MTKA 2F96A 4ZPAA 4DL2A 3B6PA 3T5KA 1S1UB 1SV5A 3QYYA 3KLIA 2J6TA 3CFPA 1NK5A 3BSCA 4PA1A 1SL0A 3EZUA 3ZCMA 1B9DA 2PYLA 1HQUB 2BDPA 4B3OA 1S49A 2UUTA 1HNVA 4K4UA 1UAXA 3O3FA 4FJIA 4E7JA 3SUQA 5KFZA 2HNZA 3RWUA 3SJJA 3OS2A 1JXEA 2VWKA 3DRRB 3K57A 3K5LA 4CHNA 4M95A 1O1WA 2IM1A 1C0UA 3M9MB 3QLHA 2Z1GA 3V4IA 4HVJA 4ECWA 5T14A 3OVNA 1D9FA 4J2BA 1S9FA 4AHTA 1S9GA 1VSHA 3L2QA 3IGVA 4PWDA 4HHTA 4FLXA 4IQXA 3PZPA 1LAVA 4U6PA 3VQ6A 4EZ6A 3OL8A 4Q8EA 3OHAA 3M8SA 1EP4B 2A1RA 2WTFA 4U7CA 2IJNA 5DG8A 3VQQA 4O3NA 1QAJA 4CESA 2FVPA 3DOLB 4N5SA 3CFOA 1S0OA 4CGIA 4KBIA 5I3UA 1WSHA 4ZMMA 2Y1IA 4DFKA 2HVHA 2QE5A 4NLXA 1JLBA 4RU9A 4J9OA 3DLHA 5KG3A 1LWFA 1D9DA 1RYRA 1FKPB 1IKVB 3UR0A 4M3UA 1RBSA 4RG8A 3TAMB 3ZT2A 4JRPA 1JIHA 4Q0BA 4J9LA 3DLRA 3DRSA 1QHTA 5KG7A 3K5OA 3NGDA 2FVQA 4CJPA 5HRNA 1FKOA 3ZT0A 1IKWA 3H4DA 5DQGA 2FLPA 3WNHA 3S3MA 3PO4A 4IG0B 4O3RA 3KJVB 1EKEA 1DTQB 4FVMA 5HP1B 4DTOA 3BDPA 1KLMB 4ED2A 4MIAA 1DTTA 3CM5A 5EU7A 5DGBA 4M41A 3V9ZA 3CDEA 3S3NA 3OYIA 3S9HA 4ZHRB 3NF9A 3ULDA 1T05B 4CF9A 3L3VA 1RT6B 3PR5B 3IAYA 4W5RA 3ZSQA 4JLHA 4ZPBA 3TAQA 3OLBA 3DRPA 1EXQA 2JEGA 3NH2A 3H40A 3T1AA 1RNHA 3ZT4A 4W5QA 4F2RA 5F8JA 1NHVA 3L2RA 3T19A 3GYNA 4FJGA 3SCXA 1TK5A 4CEOA 1LWEB 2P51A 4PUOA 2PYJA 3RRHA 1N6QA 3NCIA 4J9SA 3IRXB 4M45A 3DMJB 4NLVA 4DTJA 3G10A 1IKXB 4CJUA 4I7FB 3HL8A 3JSMB 3MEEB 1BQMB 5CYMB 3TWHA 4IFVA 3RB6A 4NCBA 5L1KA 2AGQA 4H4MA 3VN5A 2WOMB 3T3FA 4DTMA 3HVWA 4B9MA 4PQUA 4YFUA 4OPJA 1RT1B 3QEPA 5KFEA 4ECZA 2QKKA 1RT3B 3H98A 4CGDA 4J9KA 4DTNA 3TQ1A 3H59A 2YHBA 2OH2A 5KG1A 3QZ7A 2RN2A 4CF1A 4IH5A 3QNNA 1TKTA 4FZYA 3T5HA 4E0DA 3E01B 1JX4A 2AJQA 1S9EB 2NUBA 1NOYA 5J2NB 1RTIA 1C1CA 4XPCA 4FJKA 3GIMA 4CHOA 2FBTA 2RF2B 4KI4A 1WSJA 2IAJA 2IOCA 1RDBA 1JKHA 5CZ1A 5KFTA 2YKNA 4OPKA 1T03A 1VSFA 3TABA 3O4NA 4CF8A 1YT3A 1RTJA 3Q8PB 1SL1A 3KIOA 4FJ8A 3NL0A 2R2UA 1QAIA 2W9CA 3PW4A 2C22A 1WSEA 1L5UA 5F8NA 2I5JA 4URGA 2BQRA 1JLQA 1TKZB 3RAXA 3QO9A 2D3ZA 3ZSVA 3SFGA 5DLFA 4EYIB 4KKOB 4E3SA 3NDKA 4KFBB 4JUZA 1L3UA 1HPZB 1QSYA 5JS2A 4E7KA 4K4XA 4OKKA 4M3WA 3GV8B 5C42A 1D8YA 2P5GA 1TV6A 2J6SA 1X9SA 2ILZA 3OS0A 3HPGA 2VG7B 3HP6A 3ISND 1RA6A 4QW9A 4CK2A 1S6PB 3OYBA 1XR7A 2LSNA 1JLEA 4Q8FA 2C2EA 2JGUA 4DMNA 2G8IA 2RDJA 4NLUA 4TYAA 4DTSA 4CIGA 3V9XA 3L2UA 4YR2A 3VQDA 3UIQA 3DRRA 3AA3A 1WLJA 4EYHB 4KE5A 2D0CA 2DTUA 1C0TB 2KZMA 5KFOA 4Z4IA 3MFIA 4HKQA 4YR3A 3QIDA 4Y34A 1HJRA 1S0MA 4Z4CA 5DQHA 3C95A 3NHGA 3AO4A 4LSNB 2G8HA 5J2QB 1EP4A 1D5AA 1TK0A 4B8AB 3OS1A 3PW7A 3CYMA 4F4ZA 4DTXA 3V6DB 4RUAA 4ZTJA 3DOLA 4K4VA 2WB4A 4O4GB 2E9RX 2B4JA 5KRSA 5KFYA 4J2AA 1NK0A 1FKPA 1IKVA 1LW0B 1CZBA 2OYQA 4ED0A 1I39A 1IO2A 2IM0A 4JS5A 2FVSA 4DTPA 4TN2A 4ECTA 3QIPB 4OLBA 1RDRA 3OL9A 1SH0A 3H2LA 3ZSYA 4CJ3A 1S6QB 3KJVA 4QWBA 1DTQA 1BQNB 2R8KA 3VQEA 4Q44A 5HP1A 2ASJA 1HYVA 4NYFA 1KLMA 1JLGB 1JLCA 4TLRA 5I42B 3I8DA 3K59A 4NCAA 1XWLA 4NLOA 4KO0B 2AGPA 1JXLA 1GOCA 1EETB 1T05A 2R7YA 4LH5A 1RT6A 1IG9A 3DLGA 3L3UA 4RNOA 4UQGA 5KGXA 3LP2B 1QQCA 4QOZB 3M8QB 2IJFA 4OLAA 3RAQA 2HHUA 3NH0A 3D28A 2VG6A 3G86A 4DL7A 1TL3B 4RW9A 1LWEA 2X6SA 3DDKA 1BIUA 3OSNA 3O3HA 3QINA 2XY5A 4MIBA 3D45A 2R8IA 4CCHA 1WNEA 3HJFA 3G0ZA 4ZP6A 1S0NA 5L1JA 2JLEA 4I2PA 4I7FA 3JSMA 1ASWA 4DTRA 1QE1B 4YR0A 3MEEA 3AVFA 1BQMA 4YNQA 5CYMA 5KFPA 3OSPA 3AVKA 2WOMA 3OHBA 4OKEA 4WZMA 3DOKA 4NLYA 1W9HA 4CEDA 3KTQA 4R0EA 4CHPA 4J2EA 1HQEB 1RT3A 4ZP9A 4R5PB 3FDSA 1LV5A 3THVA 4ZP8A 3L2WA 2O4GA 4OVLA 5KG0A 2AWZA 4CJTA 3E01A 3BQ0A 1TAQA 1K1SA 4J9NA 3HSTB 4W5TA 1SKRA 2HHSA 4OGEA 4FJXA 3V6KA 1KVBA 1Q9YA 4CECA 4F4KA 4K50A 3ZSWA 1HYZA 2W8LA 4J9RA 1TKXB 4WYLA 4IKAA 5KT7A 3I0SB 3ZSOA 2YNHB 1FXXA 2E6LA 3M8PB 3E51A 1S5JA 1VSLA 1CZ9A 4DF8A 1TKZA 4Q43A 3KLHA 2IM3A 3DYAA 4KKOA 4N41A 4KFBA 3VA0A 2YNGB 3KLEB 3LPTA 2VG7A 4CJWA 4KRFA 2EHGA 3HM9A 4IDKB 4DG1B 4QCLA 4Z4HA 3PW5A 3LP0B 4Y2CA 3QESA 4TY9A 3BSNA 2D0AA 3MEGB 4CK3A 3HP9A 3H5SA 3WNEA 2R8HA 4TSXA 1BIZA 5D3GB 2XY8A 4BE0A 3NAEA 3KOAA 4EP5A 2BR0A 2FJXA 2WHOA 1KVCA 3TI0A 4RW7B 3CJ5A 3C94A 3IS9B 1TL1B 4DQSA 2IS3A 5J2MB 4O5BA 2JEJA 4K4WA 4I2QB 3O4QA 1RCHA 4M42A 3JYTB 4FCYA 5CYQB 1ZBFA 1WAFA 4C8KA 3KLFB 4GMJB 1X1PA 4O44B 3I5CA 3LDSA 4KHMA 4CEFA 1U48A 1HARA 1SUQB 3OL6A 1UWBB 3H4BA 2A1SA 1JLFA 2E6MA 4DL5A 2B5JA 1LWCB 4FXDA 3DLKB 1N56A 3V9SA 3OYCA 4DU3A 2ZE2B 2V4RA 2GC8A 1QSSA 4BDZA 3EPIA 4B9VA 1C1BB 1LW0A 5KT4A 4IFYB 3SI6A 4KTZA 4M3YA 4DSJA 5HLFA 4TQSA 4ID5A 1OS5A 4B9TA 4EBCA 3QIPA 5KFHA 1KHWA 5JUMA 3CQ8A 1NK7A 3BGRB 1BQNA 2KW4A 4DQRA 2F8TA 2HWIA 4FJ5A 3PJXA 1JLGA 1Z25A 5I42A 1ASUA 1X9WA 3NF7A 1W25A 3CWJA 2HNYB 4KO0A 1KHVA 4ZPCA 4JS4A 4TYBA 1EETA 4O55A 4M3ZA 4G1QB 3RMBA 4DSLA 3OYLA 1MU2B 3MR3A 2FLNA 4N76A 3LP2A 3M8QA 1LAWA 3OYKA 2O4IA 4NLWA 4IOBA 4CJ5A 2AGOA 5KG4A 4DQPA 4ELTA 2IMWP 4EEYA 4OJRA 5KTQA 1REVB 5T7BA 4J9MA 4NYNA 1NJXA 5C24A 4IH7A 3OJSA 4BWMA 2UVRA 4KHQA 4OL8A 5KT3A 4IH6A 4H8KA 2Z1HA 5FRNA 4B9SA 1IKYA 1WNSA 1R0AB 4B9LA 2OPSB 4ED1A 4DFPA 2B6AA 5KFQA 2FLLA 4FJHA 4KB7A 4FJNA 3NF6A 4JV1A 4ZP7A 1SH2A 4ICLB 4KTQA 1J53A 3PW2A 2UVWA 3MR5A 2PY5A 3OYEA 2OPRA 3DLEB 4FLTA 1S1WA 4R5PA 1JL1A 4FK0A 4CK1A 1N5YB 4KAZA 3VQPA 1QUVA 4MQ3A 2O5DA 3MAQA 1VRUB 3WNFA 3L2VA 3I0RB 4DFJA 5EWGA 4URQU 4LQ3A 1YVUA 4NLQA 3PV8A 2D7SA 3D5MA 2YNIB 4KHUA 3NAHA 1RA7A 4QWCA 3VQ8A 4FJ7A 4QPXA 4Y3CA 4MK7A 3NF8A 4FJ9A 5DMRA 3LALA 2ZKUA 3KK3B 3FFIA 1Z26A 2DFEA 4HTUA 4M3TA 3OLAA 4CJRA 3CM6A 4JV2A 3NBPB 4MKBA 1TKXA 3HT3A 3BSOA 3MECB 4RW8A 5SWMA 4I9LA 1TVRB 4AHSA 3AVAA 3I0SA 1WSGA 4Y1CA 3V9WA 2F8SA 4DWIA 4C8LA 4FBTA 2YNFB 1Q9XA 1RT5B 2PZSA 4ED8A 2WONB 4RNHA 5KFDA 4DEZA 4CHZA 3RR7A 3KLEA 4KHYA 3KK2B 4WE1A 4DL4A 3A2FA 3HKWA 3GIKA 3PVXA 3ITHB 3RB0A 4FLZA 2QV6A 1TAUA 3HHKA 4ED7A 4M3XA 1RTDB 1VRTB 3LP0A 4J2DA 3V6HA 4R8UB 2VG5B 4CGFA 3VQ9A 1TKDA 4LH4A 2RPIA 3MEGA 3KD1E 3CJ0A 2OPQB 4RNFA 5D3GA 4CF2A 4FLUA 3AV9A 1RAJA 1S48A 4RW7A 4HCCA 5L9XA 3CJ2A 2P5OA 3HPHA 4B9UA 4CJKA 4CJ4A 4QWAA 1KVAA 4I2QA 4CEZA 4RUCA 1L3VA 3KKRA 4FZZA 2WK4A 1YTAA 3CJ3A 3JYTA 2GIQA 4FM0A 2D3UA 4LSLB 3M9NB 3PY8A 1S1UA 5CYQA 1TQLA 1KTQA 4AHVA 3KLFA 4O44A 1VK0A 4BWJA 5KFSA 2HNDB 2FJVA 1SUQA 4M94A 3LAMA 5KFJA 4DL3A 5KFCA 3RR8A 1HQUA 2R2RA 3AO2A 4C8MA 2AU0A 2ASDA 1JL2A 1J5OB 1GX5A 1LWCA 2XI3A 3DLKA 4CEQA 3KMSA 4CJEA 3V81B 2XI2A 3RBEA 1NK9A 1CSJA 4FM2A 3MEDB 5HBMB 1UA1A 1C1BA 3QEIA 1S1VB 1S4FA 3LWMA 5HRRA 1BCOA 1VSMA 2ZQBA 3HVTB 2BE2B 2ZD1B 3M9OB 4NLPA 4ELUA 3C6TB 4ZVGA 1ZYQA 2JEFA 4FLVA 3BGRA 1C1AA 2V9WA 2B43A 2G8KA 3OL7A 3EPGA 2C2RA 1ZBHA 1QS4A 2IBKA 4DSEA 4CJQA 1KSPA 4FBUA 4J9QA 2HNYA 3TAEA 1B92A 1KCFA 2HHVA 1L3TA 3RTVA 4IG3B 3KMQA 1U47A 4Q5VA 1CLQA 4G1QA 4RW4B 2QXFA 3AA5X 4AH9A 4BE1A 4FLWA 5KT6A 5E41A 3SI8A 3PX4A 1MU2A 1MMLA 3TAMA 4Z4FA 3U3GA 4B9NA 4E1NA 4ZVHA 1HNVB 3CJ4A 4F4XA 3QIOA 4CJVA 4O3SA 5KGWA 4KHRA 1REVA 5JXSA 2HNZB 1BL3A 4KB0A 3ZSZA 4IG0A 3N6NA 1N48A 3NGZA 3TAPA 2E9ZA 4C8OA 1JLAB 3SQ4A 2HVIA 1R0AA 4J9PA 1C6VA 3V4IB 4FK2A 2UVVA 4N47A 3HVAA 3DLBA 3PO5A 2GIRA 2HWHA 4NLTA 4NZ0A 1S9GB 2OPSA 2AX1A 4DQQA 2G8UA 5KFWA 5HRSA 4ZHRA 3CFRA 4ECYA 5F8MA 3BREA 4EZ9A 3LANA 2XCAA 4BE2A 4ICLA 4K4SA 3OYDA 2KFNA 3GIIA 3N6LA 5FDLB 3ZT1A 3MR2A 4E89A 3QNOA 5KRTA 5KFXA 2FBVA 4FS1A 3RMDA 1JLBB 1N5YA 2KZZA 1U04A 4ZPDA 3F9KA 2HHWA 2E9TA 4CGGA 4EBDA 3IRXA 3KHLA 1VRUA 3I0RA 3MFHA 3DMJA 3SV3A 1XR5A 4ECUA 1IKXA 2YNIA 5DG9A 4C8NA 2EC0A 3LZIA 3SQ2A 4RNNA 2UUWA 2QK9A 3KK3A 3P5JA 2DY4A 2DFFA 4M3RA 3MECA 3H5YA 1DTTB 3RRGA 2KTQA 4DS5A 5C25B 1RT1A 5HRPA 4GC6A 2IA6A 4FW1A 3KK1B 2YNFA 5SZTA 3HPOA 5HROB 3T5LA 4F3TA 5DG7A 4GC7A 5DQIA 4JV0A 2YKMB 3O3GA 2YHAA 3PHEA 4Y1DA 3DRPB 3OYMA 4MKAA 1S9EA 2BRLA 5J2NA 5F8IA 3VQ4A 3SUPA 2XY6A 3MXMA 2ASLA 3K58A 3CDUA 4WXWA 1RTDA 2IC3B 3RB4A 4R8UA 2RF2A 1JXBA 3SNNA 3ZT3A 1Y97A 3QETA 3TAFA 2IGIA 2FVRA 4W5OA 2OPQA 3VQ7A 1SH3A 2FVCA 4B8CA 4CJFA 3H5UA 2FC0A 4EO6A 4RZRA 2DFHA 3V1OA 5KG6A 4AHRA 1TK8A 5F8LA 3P1GA 1D0EA 3PUFA 4H4OB 3V9UA 3NE6A 4IRDA 4FYDA 4WXOA 4IFVB 4H4MB 5K14B 1EX4A 4MFBB 3AVHA 4CGHA 1HPZA 4PQUB 4LSLA 1HYSB 1S1TB 1RT2B 4K4ZA 4K4TA 4ECQA 2UVUA 1WSFA 4FLYA 1XHZA 5KG2A 2V0NA 2ETJA 3ICLA 3SUNA 1ASVA 1S6PA 2HNDA 4I9QA 3QZ8A 3EY1A 4HUEA 1HNIB 4YP3A 2W7PA 2GBZA 2ATQA 1W0HA 1UA0A 5KFGA 5KG5A 3K5NA 1J5OA 3K2PA 3QERA 3ALYA 3PX6A 1RBTA 3I5BA 1RTIB 3V81A 1C1CB 1I6JA 4WYWA 5KFBA 3GIJA 1CXQA 4DSKA 1C0TA 4TQRA 4KREA 1JKHB 4RNMA 1T03B 3QEVA 3ZSXA 4LD0A 4Y2AA 1S1XB 3PX0A 3KHRA 3HVTA 4KSEB 4LSNA 3GQCA 2D41A 2I5JB 5J2QA 1JLQB 2JEIA 3SYZA 1D1UA 4O0JA 3V6DA 4KI6A 3NFAA 3AVMA 4QAGA 4K4YA 1C2PA 1U09A 3KKSA 4CJSA 1K1QA 2VA3A 3LPUA 4MH8A 4O4GA 5C42B 1TV6B 4IG3A 3EYZA 3C6UB 4RW4A 4ID1A 3SQ1A 1JLEB 2HAIA 5L1IA 4IBNA 4CFAA 2R2TA 4XIUA 1HMVB 2XY7A 4DS4A 2BANB 5KI6A 5DK5A 4O0IA 2KFZA 3HO1A 4ECXA 5J2PB 4CIEA 5EDWA 3GV5B 3HVRA 3BJYA 3GILA 2OA8A 1ZBLA 4EBEA 3UQSA 1S6QA 2D0BA 3AVBA 1JLAA 4F4YA 3SQ0A 3KHGA 3CO9A 3FQLA 3AVNA 1J9AA 2X6NA 1RBVA 4RW6B 2Z1JA 4ED3A 3KLGB 1RT4B 3AO5A 1Q8IA 4ED6A 2D5RA 1N4LA 1XC9A 4ECSA 1S97A 3RBDA 1KFDA 1F21A 4DSFA 3OYAA 5FDLA 1FK9B 2RDIA 4IRKA 3VQBA 4QW8A 1L3SA 1NJYA 1TL3A 4NCGB 4DU4A 3CDWA 2BGGA 3B6OA 5CY4A 3ASMA 4E1MA 3MF5A 3AVLA 4CHQA 2W8KA 2IDOA 4CEEA 3AA2A 4KB1A 3IGNA 4FM1A 3SUOA 1RDCA 2OPPB 1QE1A 1UOCA 5EUHA 4URSA 4KV8B 2OZSA 2XGQA 3QEXA 4CHYA 3MXIA 2ALZA 1JLCB 5C25A 3AO3A 5J1EB 1HQEA 4E7IA 4E7HA 2W9AA 3KK1A 3BSAA 5HROA 1ITGA 4CE9A 3IG1B 3RB3A 2YKMA 2BRKA 4Z4EA 3DLGB 1KRPA 4TY8B 1KFSA 1XI1A 3L8BA 4FK4A 5KFRA 4CFDA 5KFLA 2QKBA 2VG6B 2IC3A 4RW9B 3D0PA 2G8VA 2P1JA 4BACA 1T8EA 4CIFA 2W9BB 4XO0A 4K8ZA 4IRCA 4CFCA 3VQCA 3V6JA 4H4OA 4I2PB 2YNHA 3VQAA 2GUIA 3M8PA 2HHXA 3ZSRA 1ZBIA 4FJLA 2GV9A 4WFYA 1RBRA 3I5AA 5K14A 1RILA 4MFBA 1XR6A 1YTUA 3DOKB 1HRHA 2YNGA 4QWDA 4CF0A 5KFKA 1HYSA 4O3OA 2RKIB 1CXUA 1S1TA 1RT2A 1WAJA 1T3NA 4KHSA 1VSJA 4DFMA 4IKFA 4CERA 4LQ9A 3LP1B 3UDLA 1A5XA 4OKJA 2EX3A 4H54A 4WFXA 4BDPA 4GW6A 4IDKA 3EZ5A 4ZTFA 4DG1A 3OYJA 3NAIA 4NRTA 1HNIA 3LP3A 4YQWA 4DQIA 2J6UA 4DU1A 2HMIB 3AO1A 3DM2B 3Q8SB 3GV7B 1RDAA 4HUGA 4TXSA 4HUFA 1TP7A 4JRQA 4DLGA 1TGOA 1RBUA 4NLSA 1NKBA 1TL1A 3IS9A 5J2MA 1RTHB 1ZTWA 5KFAA 1S1XA 3TR8A 2G8WA 4DSIA 1LW2B 4X2BA 5KT2A 4WZQA 3H08A 2VA2A 5FROA 5KT5A 1NK8A 2R8JA 4GVMA 2KQ2A 1DLOB 3KLHB 3MR6A 3KNAA 5KFUA 1UWBA 3DYAB 5DLGA 2XHBA 1XHXA 2V4QA 5FRMA 2JC1A 3C6UA 5F8HA 4KPYA 2ZE2A 4KHNA 2BQ3A 3S3OA 2JC0A 3G6VA 1YVFA 1RT7B 3N6MA 3BQ2A 1IM4A 4FJJA 3BR9A 4DTUA 1VSIA 1HMVA 2G8FA 4IFYA 2BANA 4F8RA 3QGHA 5KFIA 2IM2A 1QSLA 5J2PA 4F50A 4ECRA 3DI6B 2Y1JA 1ZBUA 5F9LA 3KHHA 1BI4B 4Q45A 4N56A 3V1RA 1U45A 1BISA 3TANA 5F8GA 3PR4A 1Z4UA 3OY9A 3OYFA 4RW6A 1RDDA 2ILYA 5C5JA 1SV5B 3AVJA 3KLGA 1RT4A 3WNGA 1KLNA 3PJWA 3KLIB 2FBXA 2XC9A 5EWEA 1GX6A 2AX0A 3MXJA 2XWYA 1B9FA 3OJUA 3NGYA 4B3OB 4EO8A 1JLFB 4AHUA 4CFBA 4NYZA 4IR1A 2B5JB 1FK9A 3CIZA 2CKWA 2W7OA 3OYGA 4AHCA 4PY5A 4NCGA 5KFFA 4OGCA 4O4RA 1VSKA 2X78A 2W42A 3SZ2A 3AA4A 1SKSA 1C0UB 2XCPA 3QLHB 5HLFB 1NNDA 3VQSA 4AILC 4W5NA 1VSEA 1I3AA 3CG7A 2OPPA 3OYHA 4ID5B 2DPJA 3LWLA 1A5VA 4PWDB 4XPEA 4KV8A 3AVCA 2HHTA 3G6XA 3VQ5A 3F73A 1WSIA 1J54A 3NMAA 5F9NA 1NKCA 5J1EA 2FJWA 4ZVFA 3DLEA 4YMEA 4FZXC 3OYNA 5I3UB 2WRMA 1NKEA 2AQ4A 3TARA 5KFNA 3IG1A 4CJLA 4HYKA 1WN7A 4FS2A 1LWFB 1GOBA 3Q8RB 4TY8A 1T94A 3PW0A 3U6FA 2CJQA 4Q0BB 3RMAA 1T7PA 3DRSB 2HW3A 4EP4A 3FSIA 4CGJA 1FKOB 3UPFA 5KFMA 1IKWB 2R8GA 3LZJA 2BQUA 2HHQA 3K5MA 2VWJA 3TVKA 5C24B 3SPZA 4ZVEA 3CVKA 3VA3A 4BDYA 3QGIA 3NBPA 4MK9A 3KLVA 2W9BA 1IKYB 1NJWA 4WFZA 4HCBA 1TVRA 1BGXT 3HXMA 1NK4A 2R2SA 1G15A 3G6YA 4FJMA 3SV4A 4L8RB 3HK2A 1S10A 1ZTTA 4ELVA 4NLRA 2B6AB 3LAKA 2FBYA 1RT5A 4F2SA 4Z0UA 2WONA 5EWFA 2RKIA 2YV0X 4IR9A 3V1QA 2C2DA 3KK2A 3ISNC 3BQ1A 3Q8QB 4CEBA 3LP1A 4Z4GA 3ITHA 2OPRB 5DGAA 4G3IA 1S1WB 2DPIA 4QWEA 3NGIA 1VRTA 2C28A 1K6YA 2E4LA 2VG5A 2HMIA 4CEAA 3TAGA 4KHWA 4PUOB 1QTMA 1GOAA 3DM2A 1N6QB 1BCMA 1C0MA 5CZ2A
chains in the Genus database with same CATH superfamily
2O1PA 4JI2J 4DF4A 3N0VA 1N34F 3E9OA 1KQSR 5L1LA 3SPYA 3FFIB 2Z2LA 2XRIA 3HYFA 2VU5A 4RW8B 2W1BA 3D0GE 2XNQA 1HHSA 4NLDA 4FW2A 3MX2A 3M6VA 4KAIA 2I1RA 1Y5NB 4MKVA 4OV6A 3P83D 2Z1IA 4EFHA 3FBFA 2CPZA 2F8EX 3KWMA 4BRHA 2FGOA 1RYSA 1AXQA 3D68A 1NK6A 1U49A 2CUYA 1X9MA 5AQPA 5DM6Q 4CZIA 1PJ7A 4ISFA 3H5XA 3I96A 1VIXA 1S0VA 3SFUA 4H5WA 3D6MB 4NRUA 3RMCA 3T5JA 1GH8A 3T1YJ 2F4VK 2ZOGA 5AQKA 3NG8A 1MROB 5A8WB 2ZD1A 1IBMJ 1NM1A 3NWGA 4FOIA 1SKWA 2KKZA 1J5EK 3DRXA 1HNXK 4CLLA 4LY7A 3I33A 2KHCA 1ZAXA 4HHUA 3Q24A 3T5KA 1WKKA 4ENOA 2QLXA 3CCUS 2J6TA 1OH5A 1M5HA 4DR3F 4NE9C 4PA1A 1B9DA 2PYLA 2E5JA 3BBBA 1S49A 1H3DA 5E26A 4K4UA 1UAXA 1I1GA 1K73T 4FJIA 4USMA 2HNZA 2CPHA 2P9SA 4WFNL 2MKHA 4FPIA 2DCLA 2XTJP 2HQGA 3CSKA 2VWKA 3GZ7A 3I56N 3K5LA 4M95A 4X65F 2IM1A 1C0UA 2MQMA 3M9MB 1GTEA 2XS7A 3V4IA 2N82B 3D67A 1D9FA 4AHTA 3F0NA 3ILLA 3IGVA 4HHTA 4PWWA 1T9YA 3A3OB 4U6PA 1PAUB 3M8SA 1RZMA 4ID8A 3UWTA 1RFQA 2FIUA 5DG8A 2G1DA 4BR0A 1DKGD 5HATA 2YQ1A 5GAHU 2L41A 3KUEA 4OX6A 4CGIA 4KBIA 1WSHA 4ZMMA 2ZZNA 3BF4A 4LIRA 4OHVA 4BR2A 1JLBA 4J9OA 1VQMN 4IOCQ 2NRZA 5KG3A 3EGVA 1CQMA 2ZC3A 1U1QA 1S76D 2OAUA 4RG8A 4M5NA 4Q0BA 4LF7K 3D54A 3PYFA 1FDNA 1QHTA 1ROFA 4M5GA 4OYIA 1IKWA 2CG8A 1H74A 3TEHB 3QJLA 3TJ9A 2M3DA 5KOWA 1M90T 4M5LA 2F9WA 3AD7C 3KJVB 4LBHA 5D77A 1EKEA 1DTQB 3VENA 5TKYA 1VDHA 5HP1B 4OZ1A 1KLMB 3QGPA 4JD2B 2CQIA 2A6AA 3V9ZA 2B4UA 3Q2SC 5DM7Q 4I67A 1X60A 4ANDA 4C6AA 4ZPBA 5I3PA 1NDPA 1RWWB 5AQXA 3DRPA 2HF4A 1F9FA 4ZIVA 1EXQA 2JEGA 2ZBIA 4JKDA 5AJ3K 4F0HA 1L3KA 1RNHA 2QGFB 5F8JA 3GYNA 5LL6d 3MM6B 1N6QA 2GJ2A 3FGVA 1CJUB 4QIWD 2R7QA 2A10A 2CIMA 2PFDA 3DMJB 5CXTA 4NLVA 3Q23A 2MTLA 1Q7YO 4JI6J 3HL8A 3MEEB 4TLQA 3J7A1 4WP9A 4IFVA 2AGQA 3GONA 1SC6A 4OPJA 4U7BA 3RG6A 1OQ3A 1RT1B 2UUBK 3TOQA 3QEPA 2W4DA 5A6WA 5KFEA 4YOWA 1HBMB 4DTNA 1ZOTA 1VC0A 5KG1A 4CF1A 4BROA 1NSAA 5G0RA 2R7VA 3QNNA 5CD4H 4K2JA 4ISGA 1LK7A 2KRRA 4HH0A 3SCKE 2AJQA 1FEHA 1RU2A 3U7JA 4BRCA 1NOYA 1RTIA 3TVYA 4XPCA 3GIMA 4F04B 4PG7A 4RBUA 2HBLA 5AZIA 1VQNN 2DNZA 2BUPA 1JKHA 5CZ1A 1UMJA 3MAHA 2AYBA 2K8GA 2CJBA 1IWAA 2C3PA 3TABA 4ZA1A 1YT3A 1HR0K 5F8NA 3QFHA 3D2WA 1TKZB 1IXKA 3DHXA 3QO9A 1JB0C 3TP2A 1XNQF 2CQ0A 2BEFA 1L3UA 3LH2S 5ETLA 1D8YA 4B3TF 2VG7B 5E5NA 5IM0B 3M1FA 3OYBA 3AAWB 1SJ1A 4H5VA 4OIXA 3R97A 1IWGA 1MWZA 1U24A 3MAAA 1X4FA 4ETXA 4F3QA 4DMZA 4TYAA 2G9OA 2JLGA 1VQPN 3N01A 4CIGA 3L2UA 1F5CA 5GAEI 3VQDA 2E66A 1R8AA 3WXJA 5C2FA 3QIDA 5B0CA 1S6UA 4Y34A 3LUYA 1LXNA 5DQHA 1F5AA 2YWGA 2YY3A 4A2AA 4O8UA 5EHHA 3J7YP 1TK0A 3OS1A 2Q1NA 3I56S 1OKJA 4F4ZA 4DTXA 2CJKA 2G2YA 4RUAA 1ZH5A 4F3MA 3EZOA 4ZTJA 3DOLA 5CH7B 4K4VA 2QWQA 5M1QA 5C2GA 1N34J 5DDOC 5K9FA 5KRSA 3ETOA 5TKWA 4J2AA 1K8KA 2OFGX 3O1WA 1IKVA 1N0VC 4MAKA 4ED0A 4I6MA 4DUYF 4BR9A 4USTA 4JS5A 1QAXA 4QS7A 1Y11A 2IDEA 3P3DA 3QIPB 4OLBA 1S7HA 1DRZA 3A1YG 3U8XA 3ZSYA 3CCLS 5IFMA 3I6PA 4X84A 1I94J 1JJ2M 2LQJA 1GTHA 1JLCA 2NZTA 3PIPL 3D4JA 4G9ZA 1D09B 3L4IA 1XNRK 2ZH7A 3L3UA 4RNOA 5D0RA 5KGXA 4ZCMA 4E8UA 4CLUA 1QQCA 4QOZB 4QZVB 1P8ZA 2GVDA 4OLAA 3C66A 2C2ZB 3NH0A 2E5LK 4DPOA 2ZH9A 2VG6A 2UUAF 1B7YB 4RW9A 4F02A 2ZWHA 2X6SA 1QD1A 3EE8A 1WELA 3KYLA 3QINA 3D45A 5E3PA 2CDRB 4JI3J 4NOHA 4QYZJ 3Q2TC 2PD1A 4KQZA 3I82A 3X3UA 4BRGA 3J7AP 2WOMA 1T44A 2ZF5O 4RX6A 3DOKA 3KTQA 3IAS9 2O8FA 5G4DA 3JQMA 4CHPA 4J2EA 4A8QA 2GMLA 1HQEB 2H3EB 3A8YA 4R5PB 3FDSA 4AXJA 3THYA 3CB4A 2HVZA 4ZP8A 5IT9U 3AGKA 3L2WA 5GAEU 4Z37A 4X65J 4BBYA 4BRIA 1ZZNA 2V7ZA 1KD1T 1O0PA 4CLZA 3MPYA 1SKRA 3HSTB 5JLHA 4W5TA 3QFUA 3V6KA 2ROGA 1YBUA 4CI0B 1BMQB 5DJBA 1WI6A 2M5YA 5HAOA 1BD6A 4L72B 3N4PA 4JK8A 4Z2XA 2W8LA 3TZYA 1OSDA 1WEXA 4WYLA 4OJHA 1T9XA 4IQMA 3CPWM 2YNHB 1FXXA 3DGPB 4NA2A 1U2VB 2E6LA 1A9NB 3CJ9A 3PM9A 3ATUA 4JV5F 2PSZA 2IM3A 3SQGB 4LRDA 4KKOA 2VFRA 4N41A 3JAMO 2NXUA 3LPTA 3TTDA 2OP5A 2HYIB 4GVEA 2HHHK 1NPPA 4AE5A 3CD7A 1OY6A 3PW5A 4EK2A 3LP0B 1QAYA 1K0VA 2GQ2A 4Y2CA 2E5IA 3OQ2A 3PACA 5EN1A 3MEGB 3H5SA 4NZ6A 2R8HA 3RAMA 2XY8A 1U02A 2RQ4A 3NAEA 3KOAA 4M5JA 2IA0A 2BR0A 3HHLD 2M2BA 1KVCA 3ISZA 3C94A 1TL1B 3GPAA 5J2MB 3W61A 3BKFA 3MPDA 3EN9A 4DV5K 1BWEA 4RCHA 4FWQA 2W2MP 1YI2N 4BRPA 4GRSA 2V2VA 1U1NA 3NEKA 4CEFA 5AE3A 3LPEA 5AZJB 2KLAA 1UFWA 2JFDA 1UWBB 1NO8A 2D1KA 4JKHA 1SAZA 3HOTA 1JLFA 2GGPB 2E6MA 2V34A 3DLKB 2EG2A 2NUHA 4M63A 4OI4A 2Z8QA 4DU3A 5A8RA 2ZE2B 3MUTP 1QSSA 2O67A 3EPIA 4B9VA 4K7QA 1C1BB 2RMLA 3WZ0A 4P10A 3SI6A 4Y6IA 3G8SA 5HQLA 1VIOA 4DSJA 2DGQA 4OZ3A 4TQSA 3A8JA 5LMUJ 1OS5A 1Y3KA 4NO7A 5IC4B 5KFHA 2CZVC 3HOSA 1WUUA 3O5TB 3CQ8A 4CZCA 2C3MA 3WXIA 1BQNA 2KW4A 4DQRA 3I31A 1JLGA 1X9WA 1W25A 1UVLA 3DFEA 1YQHA 1KHVA 4ZPCA 4C11B 4JS4A 5LMNF 3NP5A 1F5BA 2MZQA 3A4TA 3SAHA 4DPWA 4ZVTB 1KR4A 8RUCA 3GCXP 3VAKA 3SCJE 1TUGB 3CCQS 4N76A 3OYKA 4NLWA 2AGOA 5KG4A 3IC1A 4JI7J 3P4IA 4BC7A 5KTQA 4MIWA 4BLGA 3BGUA 4BWMA 4KHQA 1N5SA 2MQNA 4B3TJ 1Q86O 2IIHA 3MN5A 2J4RA 4HVZA 4USWA 3CPEA 1PBUA 4KB7A 1LK5A 4X66K 3PW2A 4ILLA 3JS6A 3MR5A 2PY5A 2SXLA 2OPRA 1S1WA 1KWMA 4UY8O 1SQEA 3UI3A 3ZX2A 3VQPA 1XK8A 1SXLA 3D2FB 4MQ3A 3UN5A 4RWTA 2MZ1A 3L2VA 1KAZA 1KQFB 1FWKA 2CQPA 1WG1A 5EWGA 5EX3A 4LQ3A 4F0MA 3D5MA 4OLOA 4MK7A 3N4WA 3LALA 4NXMK 1WHWA 1TFYA 3FFIA 2GTDA 4ILHA 1Z26A 2ZVSA 4NL5A 4TKTA 3MECB 4RW8A 4J8FA 4ED5A 1WSGA 4Y1CA 1SS6A 1KN6A 4H0YB 4YB5A 2F8SA 3MN9A 3SJHA 5EX0A 3TO8A 4RNHA 2P6SA 1UVMA 2NRRA 3RR7A 3W65A 2D0OA 1RE1B 3A2FA 3TU5A 2QV6A 1TAUA 1J6ZA 4WQ5C 4M3XA 4BR7A 4C3MA 1TL7A 4DR4K 1EQ0A 3VQ9A 1TKDA 1XMQK 4RBVA 2QTWA 2VBZA 2C1EB 1MROA 1TU0B 1RAJA 4RW7A 3LF0A 3OUYB 5L9XA 4PL8A 4B9UA 1MSWD 2DNHA 3UCUP 5GADP 4FZZA 2WK4A 1ZBTA 3CNQP 2JX2A 3JYTA 2GIQA 2XMVA 4U96A 3M9NB 2UUAJ 2X51A 2E88A 1X4HA 2L48A 4AHVA 5KQ8A 4HTJA 4JKBA 1FHTA 1MG7A 5KFSA 1G99A 1VQ5N 2RRAA 1VQ8S 2G0JA 5F41A 5KFCA 2FXUA 3SK3A 1JL2A 2F40A 1YI2S 1H1VA 3KMSA 1G4CA 5AQFA 3DHWC 3C7NB 2XI2A 4ZPVR 3VEOA 2D9PA 5K20B 1S7IA 1UA1A 5M1OA 5HMXA 3H6EA 2J9DA 2QW9A 4LF4J 1RAOA 1Q82O 3CMAN 1S1VB 4C4WA 1S4FA 2QMXA 4USVA 4ISEA 1VSMA 3M8YA 2BE2B 3ZETB 2IFXA 4NLPA 4FLVA 1BXNA 4D3GA 2B43A 2C2RA 2HWTA 1QS4A 3R7BB 4J9QA 3TAEA 1NG9A 1M5PC 5L8RC 1U6FA 3MWPA 1WC5A 4IG3B 3LTOA 4G1QA 2E1YA 4ZK7M 4JKCA 2FJAB 2R42A 3SI8A 4C1NI 1MU2A 2CNKB 4USJC 3M1VB 1ZM3A 4B9NA 3FZLA 5ELZA 4F4XA 1HHTP 3QIOA 3ILJA 2CQDA 1RHUB 4O3SA 4BREA 4MO5A 2MZSA 2HZAA 3AT1B 4JV5J 3R2DJ 3M2UB 3TAPA 3DKDA 2B7BB 2E9ZA 3CCJN 2E2QA 3CUNA 3Q86A 1AB8A 4JD2A 2Z30B 4NZ0A 4N7TA 1S9GB 2OPSA 1Q1KA 3L7OA 4EHTA 2ZITA 1NPRA 1IJEB 2IVNA 3PIOQ 2XCAA 2QWNA 1U0SA 4LF6J 3GJRB 5IZHA 3MR2A 2VOPA 1IR2A 4B3SF 2FHJD 1N5YA 2KZZA 2MKYA 1UL3A 4OQJA 4KGXB 1KNZA 5F1XA 3MM6A 4EBDA 1VRUA 1UW4A 1CJUA 3MFHA 3DMJA 1XR5A 4H5RA 3W64A 4UF4A 3A3NB 3BPDA 5LJ5Y 4CH7A 1ATNA 5C10A 2ADCA 1FNMA 3W9JA 2LMIA 3NOCA 3H5YA 1PIEA 3JXOA 1V6HA 2KTQA 4DS5A 3H7HB 1RT1A 3GE9A 3EGNA 5AQWA 2BJ1A 3QAUA 2YNFA 3HPOA 3UD5A 3T5LA 4CT8A 3P39A 5DQIA 2YHAA 1ZA1B 1FA0A 4NLBA 3L7UA 3CC7N 4UZBA 3SMSA 2BRLA 1U26A 1IBKF 3BB5A 2ASLA 3K58A 1RTDA 4NZ7A 3RB4A 4R8UA 4F4AA 4YUDA 3ZT3A 3MMCB 3TAFA 2IGIA 1SH3A 3P4UB 5LMNJ 4AL7A 4EO6A 3M6GA 5KG6A 4NEZA 3FBBA 5IT9O 4X62F 4BS2A 4FYXB 3DXSX 4IRDA 1Y3JA 3MPWA 3CJTA 4MFBB 2E5GA 1VQ9N 2AZ3A 4CGHA 1AW0A 4LSLA 1S1TB 1OSCA 3CCSS 1WSFA 4FLYA 4DV2K 4IO9L 1RCOB 4EUVA 2ETJA 2BE7D 1ASVA 5IM0A 3H1QA 5F3ZA 1OWXA 2GVZA 4L6V3 1TR0A 1J5OA 4ER8A 3K2PA 3ALYA 3R6GB 1RI7A 1GLAG 3MDQA 3DRYA 3NGKA 4A8FA 4LF8K 5KFBA 3GIJA 5AR0A 4H4KA 4TQRA 2KN4A 2UV8G 2EFOA 1T03B 4Y2AA 3UD4P 3EX7B 4GKKF 2J9DE 1REGX 3GL1A 2JEIA 1U8SA 5AQNA 2C3UA 1CULA 3NFAA 3CMAS 3J80U 1U09A 4DV1F 2VA3A 3A5MC 3EYZA 1S99A 4ID1A 1VISA 4A2BA 4PKDB 2VASA 2N4DA 4X64K 2XY7A 4MTPA 3J81U 4QU7A 5KI6A 2DGVA 3KKFA 3NNAA 2QRRA 4KT0C 4PXDA 5EDWA 2LA4A 3HVRA 1PAEX 1NDKA 1FI4A 3BJYA 1K9MO 1ZBLA 5CAAA 3BY5A 2VOOA 1PYTA 3SQ0A 3KHGA 3FQLA 2KT5A 2P9CA 5KPTA 2W4CA 1RBVA 1HW9A 4OHWA 5BJRA 5T7LA 2YQ0A 2UXCF 5BPNA 1AYEA 1UVIA 3KUGA 4AQYK 1BO5O 1XC9A 3AGRA 3KJFB 3OTEA 2IJRA 1KFDA 4YOUA 5K8MA 3OYAA 3E9LA 4WWSA 2DO4A 2RDIA 3MM9A 1YRXA 3WQPA 2ZH1A 5DDPC 1L3SA 1FFWB 2FZKB 4DU4A 3A3PB 2RILA 3PKYA 2V94A 1VHFA 2E1CA 1RWOB 2WW8A 2W8KA 2IDOA 3KWIA 3L4QA 3IGNA 4KB1A 1CJKB 4YDUC 5GMKa 2GAGC 4JI1K 1Q81O 1X9JA 1UJ4A 2MGZB 1FRJA 2BKNA 3LDOA 5ETVA 4OJ3A 4NXNF 3MXIA 2ALZA 3T7ZA 3EXCX 1R89A 4LR8A 4LFAF 1HQEA 4E7IA 3D0HE 2OD6A 1SJ4P 1UAWA 2N4CA 3G4SS 1FXRA 2X1FA 3GLJA 2KJVA 3AAQA 4CE9A 1QDUB 2BRKA 1KRPA 4HHHA 1KFSA 1GNKA 1YZ7A 5KFRA 1VBKA 3ZTOA 2DH8A 3BF3A 3NNHA 3IBFB 2EK6A 3THXB 1S3XA 2G8VA 5HVGA 2P1JA 4BACA 2RH3A 1P1LA 2W9BB 4XO0A 3A8IA 1QHAA 1KC8O 4K8ZA 4IRCA 3V6JA 4V19J 4H4OA 2YNHA 3TA2A 5A0YA 2GUIA 1E6VB 1ZM9A 3ZSRA 4FJLA 4PXBA 3VTIA 4LSZB 1RILA 1YTUA 3IM8A 4N77A 4O3OA 1CXUA 4KHSA 3J7YI 3UKRB 4LQ9A 3MMBA 4A57A 3VGSA 2BACA 4WFXA 4ZTFA 1ZC6A 2A3ZA 2E2NA 2X1BA 3LP3A 3CD6N 4DQIA 4C97A 4DU1A 4L3QA 4LVNP 2HPUA 1PC5A 3K8WA 4HUGA 1VRQC 2UXDK 2FLOA 1NKBA 1NCLA 2R9LA 4DV7F 1TL1A 3TR5A 1K73O 5J2MA 3FGUA 3R5BA 1XEZA 2OEJA 2QA4N 3CCTA 5KFAA 4C48A 1S1XA 3HKZD 3TR8A 1LW2B 4KY3A 4B3SJ 4WZQA 2C2KB 2OHDA 4P52A 3F56A 2IPOB 2ZUGA 2ROEA 3CMES 1FJCA 4GVMA 1DLOB 1UWBA 1KAYA 3DYAB 3POTB 1FCAA 2UU9F 3R9PA 3ZTSA 4C23A 2WFBA 3EZWA 4H0XB 4KPYA 2ZE2A 2MQ8A 3S3OA 3G6VA 3HHNB 4FZVA 2AMCB 4FJJA 4DTUA 1YBAA 2G8FA 4JHDB 3M8WA 2BANA 4CYUA 1PC4A 3QGHA 4OZ5A 4WF9Q 1QSLA 5J2PA 1WACA 4ECRA 2CJYB 3DI6B 1ZBUA 4BC5A 3KHHA 1BI4B 4JKGA 1U8WA 4HR2A 1U45A 2NRWA 5F8GA 3PR4A 4BC4A 1M90O 4PABA 4J91A 2CDQA 1IBKJ 3WC2A 3AVJA 3KLGA 1SJFA 4DV6F 1RT4A 3WNGA 1N32F 3PJWA 1E6YB 2K1RB 5H1SQ 1B9FA 4N8OA 4EO8A 1YJWS 1NMDA 1WBDA 4DDFA 4X62J 5BYQA 1YTYA 3OYGA 3NCQA 4FWRA 3OW2R 2C42A 1WKJA 2MHEA 3UDCA 3GFXA 2YKOA 2W42A 3HSJA 3NMUA 2ASYA 4C1NK 4PHTX 3J7YU 3W3SA 1I3AA 4ID5B 3EKSA 4CD3A 4LFBK 4C3KA 4XPEA 3ULEB 2HQ3A 3ET6B 2WC9A 3G6XA 2OTLN 3FK4A 1WSIA 2DR5A 2YWKA 5J1EA 1XERA 4K8RA 3RGIA 2EBGA 2XYHB 3TNVA 4NLCA 4GKJF 4LF5F 1KVKA 1ATSA 3TARA 5LT5A 4FS2A 3D2FA 1EKSA 4TY8A 4AD6A 3PW0A 2CJQA 2HW3A 4GKKJ 2AYMA 1FKOB 3UPFA 2HHQA 4AUKA 4K5SA 3TVKA 5C24B 4ZVEA 2VBXA 3CVKA 4DV1J 3H25A 4KR0B 3SIPB 1NJWA 4QU6A 4HCBA 3GG0A 4OLPA 1NK4A 2R2SA 2MYFA 1U6ZA 3SV4A 1S10A 1ZTTA 4NLRA 3R27A 4UW2A 3L6QA 3LAKA 2QLWA 2FBYA 3KXDA 5EWFA 3MWTA 5BRFA 2RKIA 4UOCA 4IR9A 3ISNC 2YVSA 4E1JA 3CQYA 3K2YA 2V4JB 5M2PA 4DU7A 3I32A 1WHVA 4JI8K 3NGIA 1DAXA 3QBXA 2KI2A 1NEEA 2HMIA 4CEAA 3TAGA 2WW4A 1OIAA 1YJTA 3DM2A 4LJMA 1C0MA 1HNWK 1XBWA 4P71A 1LOUA 2UXCJ 4PXEA 3U3YA 3BO4A 4RO0A 4E2FB 1RWKB 4PWUA 1J27A 2XO7A 4E19A 4NLGA 3EVOA 1VSDA 2X74A 3FQKA 3LPYA 4NASA 2XGPA 2YWFA 2EEYA 2O8CB 3VZIA 3IBCB 1HLWA 3NKYA 3QGGA 7FDRA 6AT1B 5DZ6A 1VQ6N 1JK9B 3R1XA 4B1WB 3SCLE 3K89A 2B0GA 4WCEL 3C7NA 3MGJA 1R0BG 3MEKA 1ZETA 1RT7A 2EFNA 4PR6A 4NXNJ 1LCUA 5KFVA 2IAJB 1Q7YT 4OPAA 4ZCIA 1XMOK 1S1VA 2DNRA 2LQ8A 3W2VA 4HDHA 3AVIA 3OFHA 1RTJB 1HNXF 2BE2A 3ZETA 1O51A 1HJOA 1G1XA 3PHTA 4NPOA 2EFVA 1GXLA 4L76A 3A13A 4YHHK 1IH7A 4B08A 4DV3K 2HFNA 3MTKA 2DHHA 2HZVA 4BC9A 1SV5A 5MLCV 3QYYA 4YY3K 3IR5B 5BYSA 2UUCK 3BSCA 2HFSA 2PO4A 3HSCA 4B3OA 4B3MF 3VPZA 3O80A 4A5BA 3C16B 5D15A 3O3FA 5ADXA 4E7JA 2A42A 3BEGB 5KFZA 2RQMA 2D69A 1EX8A 3GBTA 3CF5Q 4UOFA 3DRRB 1R3NA 4DR1F 1NB7A 3OVNA 5BPMA 4J2BA 1S9GA 4PWDA 2HBMA 3QT8A 4FLXA 4IQXA 1Q79A 3QBWA 3LGMA 1BLUA 2OJ3A 4EZ6A 2A3JA 3OL8A 4K0KF 2DXFA 3J81O 1EP4B 2V8HA 3GP9A 4DB3A 1QVGR 1R27B 1SCJB 5E33A 1QAJA 1Y7PA 1SPBP 2FVPA 2P9KA 4N5SA 2OGUA 4DV7J 4FVCA 5I3UA 2Y1IA 4DFKA 3CEDA 3N5BA 3O44A 1D9DA 2DGTA 1RYRA 5GMDA 5LXYA 5THWA 1RBSA 4Q2LA 2OTLS 3TAMB 4P2SA 3TUJC 1VC6A 3DRSA 4I64A 3K5OA 5KG7A 2BM0A 1V5VA 3PEJA 3H4DA 4Y2MA 3QATA 1MWMA 1GT8A 4G1PA 2CG4A 4K5RA 4CWBA 2PA8D 3M5RA 1VLOA 2MKCA 3C15A 5KQDA 3SSSA 2UU9J 4DV0F 4DTOA 1BWFO 5IOLA 2AJ1A 2Z2ZA 1CVJA 3FFKB 5D4NA 4MIAA 2VQEF 3BPSP 5GADI 2ZBCA 2AIRB 1TELA 1YITN 1KQSM 2B9XA 2JWLA 3GB0A 3CDEA 4LR7A 3T1YK 2QWPA 3L3VA 2VCPA 1IBMK 2P8IA 1URRA 2B8QA 1ICEB 4YOXA 1KAXA 3P38A 3NH2A 2RHSB 4M5IA 2ABYA 4J90A 3ZTRA 4RWXA 1Q16B 4W5QA 4F2RA 1NHVA 3OTBA 1WOQA 4DPXA 4HT5A 4FJGA 3S6EA 1VMBA 1LWEB 2VQFF 3CJQA 3MMCA 2V51B 2DHAA 1P27B 3RRHA 1SB6A 3NCIA 5A8KB 3BZCA 3SDEA 2QSFA 5H9FJ 1GLCG 3G10A 1N32J 4CJUA 1T3VA 4I7FB 3JSMB 2RUSA 5CYMB 2QO3A 2HRTA 3RB6A 1NXIA 1B70B 1M0SA 2UUBF 3T3FA 2NXNA 1JCEA 4Q2MA 3WIVA 3LA0A 4YFUA 2HBKA 4X4PA 4BR5A 1VI7A 3K9JA 1RT3B 3NWRA 3S1TA 2EWHA 2OH2A 2P9PA 4CI6A 1B64A 2AP6A 1TKTA 3G6EN 2FTRA 2DB1A 1OH7A 4CM2A 4G6VB 4E0DA 3E01B 2WB1D 1JX4A 5AE2A 4JAXA 2VJVA 1S9EB 4F7VA 2H5JB 2ZOFA 4CHOA 5A2QY 4OYWA 2FBTA 4RU2A 2FSKA 1HR0F 2ZJRQ 2YKNA 1T03A 1EAYC 2I0XA 3O4NA 4CF8A 3C6AA 3I55S 4GKJJ 1SL1A 2NZ4A 2VD3A 4LF5J 3KIOA 4A59A 3KUHA 3NL0A 3M8ZA 2R2UA 4BQZA 1QAIA 2W9CA 3PW4A 2C22A 3R5AA 2ZBQA 2IYIA 1YRUA 3SFGA 4EYIB 2XHCA 4KFBB 4JUZA 1HUXA 5JS2A 1YJUA 5I3QA 2P5GA 3ZZUA 4FWLA 4KIAA 1X9SA 2J6SA 1F60B 3HPGA 1UJ6A 3ISND 2QXLA 2YPYA 4QW9A 4CK2A 2ZM6F 5D4PA 4K2XA 2IRYA 2G13A 4Q8FA 4CT9A 2OEMA 4B3RK 4K42A 1WWHA 3HZ6A 1Q95G 4NLUA 4DX8H 4DTSA 5GADU 3V9XA 4EFAC 3UIQA 2AYGA 3RU0A 2ERRA 2XYGB 1WLJA 4EYHB 1VCTA 3RSEB 4HKQA 2JDJA 2VPWB 4Z4CA 3C95A 3NHGA 3OTOF 4LSNB 2G8HA 2L9NA 4L75A 2BBEA 3AD8C 5J2QB 1D5AA 3PW7A 3JTNA 3Q89A 3DLLL 4ZVQB 4JI6K 2WBRA 4PCQA 2DHGA 1O8BA 1T3OA 2H3GX 2ZWPA 4JKEA 3V5RA 1FTCA 1J2VA 3CGIA 4GV3A 1B7FA 4Y2IA 3T41A 2JVRA 2OO4A 4PYAA 5J1NA 1FKPA 4XAKA 2E7WA 1LW0B 2DIUA 4PG4A 1T11A 2OYQA 2HBRB 2HFOA 4CBWA 1RWXB 1I39A 3ENBA 2O8BA 2FYXA 2P9LA 3M30B 2O01C 2OIHA 3OL9A 3I87A 1KKHA 1W2BR 2B4VA 4Q44A 2OANA 2ASJA 4FSVA 1A6LA 4TLRA 2DNMA 3U1LA 5KOXA 3I8DA 4WFAQ 3GG1A 3VGMA 4KO0B 4HWIA 1XNRF 5AQHA 1Y5IB 2F4VJ 1VQLN 2MEWA 3H45C 4A61A 1T05A 1IG9A 1RT6A 1P9QC 1RWNB 3VVTA 1B0PA 2AEFA 4UQGA 2WBNA 1X5TA 2M4MA 2YTCA 5E2QA 1WTFA 2O8DB 1HNXJ 3M8QB 2Q6CA 4KRWA 4X4UA 4MYUA 1MNEA 3RAQA 2HHUA 3CCVS 3M6XA 1F2HA 4DL7A 4IO8A 3HMJG 3THXA 3C19A 2UXBF 3DDKA 1CPZA 1VJQA 4PRFA 2OUGA 1WNEA 2GUPA 3HJFA 1NSQA 2HBQB 3G0ZA 1S0NA 4DOZA 1WOPA 3H2UB 1QE1B 4P2FA 4YR0A 5J1PA 1BQMA 4YNQA 1BWVA 2F5GA 4B3MJ 3AVKA 3OHBA 4OKEA 4WZMA 2BX6A 4NLYA 4CEDA 1U7LA 2CJ9A 1TZ0A 2QX0A 2ZJQQ 5AE1A 3AB4B 3A5LC 3W1YC 4OVLA 3AY0A 1NM2A 3VEVA 2AA4A 4DR1J 4CJTA 5CQGA 2R7SA 2LP4A 3R5CA 4M5DA 1UPPA 1RHKB 1K1SA 2HHSA 2YHWA 2QG9B 3O3LA 3KZBA 4FJXA 1I51B 4RPFA 2J76E 1KVBA 4A5AA 1W26A 3I4PA 2AYEA 5JJBA 2BH1A 4BRKA 1NGDA 1Q86T 1N34K 4J9RA 1F0XA 4CLPA 2RS8A 4IKAA 2GMJA 1F6TA 4LF7J 2MKSA 1FNXH 2HVEA 4DCHA 5IQ6A 2OELA 1CZ9A 4O5FA 2QT7A 2KVQE 3TZXA 4Q43A 3DYAA 3POTA 1C0GA 2BJDA 5B0DA 2RT3A 1R0CB 3PTWA 3VA0A 2YNGB 2VKZG 3KLEB 2K7KA 2CPDA 1SI9A 1SIZA 5GIOA 3ZFVA 4M8LA 3HM9A 2DY1A 2HBYB 4KGKA 4Z4HA 4XTTA 3QT5A 2ZJPQ 1GFWB 4JHDA 3QESA 4PL7A 2VQEJ 2HIQA 3WNEA 2VPXB 1FWLA 2HURA 2KYXA 4UY85 2HK3A 5DZ7A 4FN5A 4QPTA 5AJ3J 1GMWA 1T9TA 1X3NA 3THWB 4K4WA 4I2QB 3O4QA 2YPZA 5LY3A 4RBTA 3L09A 3FCVA 3FMBA 2JVOA 2C3YA 5CYQB 2P9NB 1ZBFA 1AZSA 3KLFB 1ZAWA 4ZJLA 4O44B 2VQFJ 3NLCA 3I5CA 1U48A 5BRDA 4B17A 5B0AA 3OL6A 2FSNA 4QYZK 2HHPA 3U02A 2H54B 4DR3K 4W92B 1LWCB 1H38A 1N56A 3O1LA 1RAFB 1F9HA 4S0MA 3FSXA 3OYCA 4C7QA 3VGLA 3FEYB 2PT0A 2UUBJ 1YJNS 5KT4A 2QL5B 3VWSA 3HFZB 2O66A 4ID5A 1VQ7S 4X65K 3FLCO 1V3RA 5JUMA 1TYQB 3CCES 3BGRB 3G71S 3ET6A 2JNJA 1YDLA 2HWIA 4ZVRB 5I42A 5ETOA 3UKUB 3NF7A 3CWJA 1HLUA 1FWPA 2WVDA 3VR1A 3OXLA 3MCSA 1ZPVA 4TYBA 1FDDA 2KFYA 5E3QA 1EETA 2B9YA 4O55A 1N5TA 4WBFA 4M5KA 4DSLA 2O8EB 1HR0J 1Y4ZB 4DCJB 2FLNA 2DIVA 2GQQA 3LP2A 1LAWA 4IOBA 4CJ5A 2QZ8A 4EEYA 4LBPA 4L3KA 3UNYA 5JVHL 1REVB 1FXLA 4NYNA 3ATVA 3M4XA 5C24A 4OL8A 3VETA 4DPYA 2GJIA 2IVYA 4B9SA 1BU6O 3O1BA 1NDLA 5FLXY 1UEVA 1YBTA 2W2NP 2ZM6J 5GAGP 4DFPA 4FKXA 1Q18A 4X4VA 2P9IA 3ADAC 1W2IA 3D6RA 4ZP7A 4ICLB 2V4JA 1R7IA 3LGHA 2UVWA 1FESA 4V19X 1HWKA 5K5MA 1VBYA 2UZAA 1NMEB 2VYPA 4FK0A 1FJEB 4R79A 2RU3A 2BVZA 2VBWA 2JWNA 3WNFA 3H90A 3I0RB 3BZKA 3ENVA 3IDHA 4CQ1A 2DRAA 2YNIB 1RA7A 1BOTO 4FJ7A 2ZNZA 5DMRA 1BHNA 3KK3B 4GY2B 9RUBA 2E1PA 2DFEA 4M3TA 3CM6A 2RE2A 1NBEB 3NBPB 1TKXA 2FJDB 2LEAA 5SWMA 4Z94A 2NNWA 1WJ9A 3I0SA 3OFGA 3WIUA 1CQNA 3CCMN 3V9WA 3R8EA 3KNGA 4C8LA 2O8CA 1Q9XA 2PZSA 4CHZA 4DEZA 3GDQA 4KHYA 3KK2B 1T02A 2RSQA 4A46A 3RB0A 5EY4A 3MXHP 3HHLB 3TWZA 2VG5B 4B1UB 2DK2A 3KD1E 2HSTA 4U7UK 2OPQB 5D3GA 1XNRJ 4CF2A 5AFUA 1FF2A 4HCCA 2P5OA 3HPHA 4CJKA 4CJ4A 3D9BA 4X4OA 4FNIA 4A8MP 4IJAA 3KKRA 2DXDA 1Z05A 1MN7A 4FM0A 3U27A 1XNQK 1ZAVA 2VGMA 1ATRA 2UXBJ 4BWJA 3EM1A 2FJVA 1SUQA 2WZ1A 4NA3A 4MDBA 3RR8A 2R2RA 2BOAA 4FPRA 1HKAA 3PLAA 2ASDA 1GX5A 2PBDA 2XI3A 1IM6A 3W0LA 1N33F 1S72S 1JCFA 3QSIA 3S01A 1NK9A 3MM7A 4FM2A 5HBMB 2ZJQL 5LSLA 4K43A 2P9UB 3KWGA 3QEIA 2FGCA 3IWXA 5JVGL 1RXOB 3WQTA 4USHA 4P7TA 2VPYB 1BCOA 1RAEB 4DI6A 2CJXB 4DR7F 3CCUN 4ELUA 3EEQA 1CJTB 1MW7A 4NI2B 3D1QA 1C1AA 3WXKA 2CQ3A 4P7VA 2G8KA 2VFVA 4DL0C 1ZBHA 2PFFB 2P9GA 4DSEA 4CJQA 2HNYA 4YORA 3BUZB 3N5FA 3UDEA 3P6YC 3E3XA 4PKGA 1U47A 3K0SA 4RW4B 4FLWA 3NY0A 5KT6A 2CQ1A 3TAMA 2BJEA 5AQGA 3U3GA 1HNVB 2LVWA 3CJ4A 3ELHA 4WFBL 4QS8A 5IXUA 2QA2A 3BDEA 4DUYK 1LXJA 5AQYA 3N6NA 1T9VA 2EFPA 2HHHJ 4C8OA 2NSBA 3SQ4A 2BUNA 1R0AA 3H8YA 4J9PA 2X3GA 2UVVA 2V2ZA 3PO5A 2LLZA 4NLTA 4EGLA 3E1YA 4U67Q 4WTYA 5KFWA 1HBUB 3GJQB 3CFRA 4ECYA 3DWLA 5F8MA 4EZ9A 3CD5A 4BE2A 4OYAA 4DV5J 4IOAL 4EAHD 2ACMA 3GIIA 1HA1A 3ZT1A 1YIJS 3QNOA 4FS1A 3RMDA 4ZPDA 3CIPA 2E9TA 1RABB 3QICA 4WIQA 4CGGA 1XN9A 2UUAK 4IEIA 5A8KA 1K9MT 1PKUA 3SV3A 1NZAA 4ECUA 5AXKA 4ZLLA 5C2CA 1D4XA 2MMYA 2QK9A 3ONQA 4LT6A 1YJRA 2FHOB 4UUXA 1KONA 2DNOA 2DY4A 2DFFA 4LRFA 3FCHA 1DTTB 1KVIA 3U9DA 4GC6A 2W6KA 1MMDA 1V4TA 3KK1B 1RK8A 3GR1A 3QNWB 1K44A 1VFJA 4YN3B 1TMMA 1S9EA 1VBXA 1HBNB 3CJ8A 3SUPA 2VUGA 2ACYA 3CDUA 4WXWA 2CQGA 1OH8A 4W5OA 5GAHI 2YX7A 1Q81T 2FVCA 3JAMU 3LL3A 2F9DA 4RZRA 3MD3A 4L3NA 1UP1A 1TK8A 5F8LA 3P1GA 3PUFA 3AB2B 2MZJA 2QLJB 4HI2A 3NE6A 2VKRA 4H4MB 4DV2F 1EX4A 2Q79A 1WG4A 1HKGA 4PQUB 5CABA 1HYSB 2Z0GA 1RT2B 2D4WA 4K4TA 4OV1A 4HLBA 5CCLA 4YB6A 1C4CA 2MSSA 2CPYA 3ICLA 1P8GA 1UVKA 4CLKA 2XMUA 3ZTQA 2HNDA 3EY1A 1HNIB 3LGNA 3CQXA 1W7AA 3CDAA 2ATQA 2BE9B 1UA0A 5EX5A 4LFCF 1OYDA 2JL9A 1I94F 3IR6B 2FSJA 4ZDNA 2DNLA 1RBTA 3I5BA 2PC6A 3V81A 1C1CB 4O23A 2QWOA 4HHJA 2VPZB 3O9TA 1SJQA 2KXNB 3M2VB 1KC8T 3BKUA 1YJVA 2Z2MA 4OZJA 4K59A 4Y0FA 3RSEA 3ID6A 3ZSXA 1FX4A 3OFEA 3PX0A 1UZHA 3HVTA 2Q66A 2JOQA 4LSNA 3GQCA 3RJMB 5J2QA 2XG8A 1JLQB 3SYZA 1VGYA 3JQJA 3AH6A 4PYDA 2FF6A 4MDAA 3LPUA 4MH8A 1TV6B 2M0GB 4JI3F 4V19S 3DXMB 2C2OB 4C8YA 1NJIT 1PO6A 1PYSB 1JLEB 4CFAA 3PSIA 2BXJA 4JBCA 2DGUA 4ZCLA 3D3CJ 4DS4A 1NGJA 2KFZA 1OQ6A 1GXTA 2RRNA 1N8RO 3M30A 4CIEA 1ULRA 2F65A 3GILA 4EBEA 3UQSA 2D0BA 2E1ZA 1JLAA 3PCOB 5CZVA 2VGNA 3CO9A 2IVOA 1V3ZA 4DR4J 1J9AA 3C8YA 4RW6B 3FNNA 3ZYYX 2Z1JA 4OI3A 4AQYF 2LCWA 3ZEUB 2EC2A 3AO5A 3W62A 3NNCA 4ED6A 3DCAA 1VQKS 4ECSA 4FO0A 2V8VA 4CO5A 5FDLA 1FK9B 2NSCA 3EE9A 1NJYA 3OR1B 4NCGB 3CCLN 3AAPA 4Y2KA 3CDWA 2RS2A 3B6OA 1FRXA 3ASMA 1W97L 4HTIA 3MF5A 2A0FB 3AVLA 3AODA 4TU7A 2Q97A 5C15A 2PMWA 2KKHA 3ENWA 1URNA 1QE1A 1UOCA 3NS5A 5EUHA 3C14B 2DTJA 4BG9A 1U0HA 4URSA 3QAEA 2OZSA 3D3BJ 4CHYA 3QWPA 5C25A 1N33J 3SBGA 2YHXA 4OI2A 2W9AA 2CQ2A 5KAKA 2ZH3A 5HROA 1RISA 2Q2RA 2YKMA 2J7UA 5BR8F 1RACB 2ASPA 4DR7J 2F7TA 3ILOA 5AQIA 2HGLA 5KFLA 1WD6A 3G87A 2QKBA 3MOJB 3NRBA 2IC3A 1IBCB 2O3DA 3SBTA 2UV8A 3NGSA 3H20A 3HHLC 1X31C 4XK8C 3FR0A 4YDDB 3MURP 3IFRA 5BRHA 3HRGA 1SKUB 2P2CB 2MB0B 3TX8A 1R31A 2CQBA 4FXVA 4GV6A 2DRBA 3PXGa 4WPAA 2XMTA 5K14A 1XTZA 3HHDA 1XR6A 3M32A 2YNGA 2WVBA 4QWDA 3ZXWA 5KFKA 5HQMA 4B9QA 4USKA 4DFMA 2B7CB 1DHMA 3LDPA 4HACA 4OKJA 3D7SB 5LMUF 4LRCA 3NAIA 4NRTA 3BKTA 4CDIA 4YQWA 4B1VA 2EWSA 2YBVA 4UOHA 3AO1A 3Q8SB 2HBZB 5LJWA 4WIIA 3J81j 1TGOA 1LKZA 2D3O1 1NPKA 2DNPA 1ESVA 1BA0A 2V8DA 1SJRA 2MZTA 2DCUB 3FJ2A 2NRXA 2G8WA 4JOUA 5KT2A 3FZBA 2VA2A 4JI7F 4DR5F 1RQ0A 5B7WA 2DISA 2QJ3A 5KT5A 4PAAA 2KQ2A 3KNAA 5KFUA 2CYYA 5B0GA 4I6YA 4DR2K 1FRMA 5HMWA 2JC1A 3MK6A 3C6UA 3BH7B 3CJ7A 3G25A 1YVFA 3PYDA 1MA9B 1VSIA 1HMVA 2CQ4A 4I68A 1OO0B 4F8RA 2LDIA 4IZ9A 3WEEA 1UETA 4FPBA 1Q5VA 1FD2A 4H0VB 2J0SD 2WBMA 3GJSB 3KHYA 2A1BA 4B02A 2PEHA 4Q45A 4N56A 1RGVA 3V1RA 3SMZA 5BYRA 1E4GT 3L9ZA 4CZMA 4PKHA 2R7TA 3KK7A 5CHCB 2FPHX 2GX8A 3N79A 2FBXA 1RKJA 2O8EA 2K3IA 2AX0A 4WK1A 4ED4A 4X4RA 1QLNA 2XWYA 1BA1A 4P73A 4W4MA 3OJUA 3NGYA 4M5HA 1NLVA 3CIZA 2W7OA 3C0BA 3BZQA 4AHCA 5KFFA 3IWLA 4DV2J 4Y28C 1OY9A 3O08A 4DHVA 2COLA 2RJZA 1XMBA 1UWAA 2HAFA 3AA4A 1X4GA 3BN7A 1C0UB 2XCPA 2RAQA 3CE8A 3W60A 1EARA 4AILC 1VK8A 2OPPA 2E2OA 1PYOB 1SQGA 1AROP 1KOOA 3F41A 4KV8A 2J9EA 4KHPK 1YHQS 4LFCJ 4DKWA 1IBLF 2GO9A 3CCQN 3VQ5A 4U8VA 1ZS6A 4JK9A 3TJ8A 1J54A 3QB0A 5DM6L 3NMAA 5F9NA 3NVKA 4L74A 7FD1A 3OYNA 2VFTA 3EGZA 2WRMA 3NCPA 3H46O 2BZ2A 5KFNA 3R1LA 3IG1A 1N36F 4B3SK 3EWGA 3OT9A 5AQQA 1S22A 5M2RA 4WYBA 4Y0WA 4Q0BB 3VAJA 4EP4A 5KFMA 2R8GA 1IKWB 3LZJA 3K5MA 2GWJA 4QJVA 3QGIA 3NBPA 4OHZA 4FYWB 3KLVA 4WFZA 2B8PA 2GAHC 4OFZA 2MLXA 3HK2A 2XS5A 3VMFB 2ITMA 2B6AB 4D3HA 4BRMA 1WEZA 3LM2A 5AQLA 2YV0X 3NXZA 4CO3A 2C2DA 1XQIA 3KK2A 2LQ5A 4LF4F 3BQ1A 3LP1A 4Z4GA 2RHQB 1N88A 2ZOMA 4G3IA 3QFWA 1U1KA 3HZEA 2E4LA 2VG5A 4WQ4A 2HMPA 1XJWB 3NMRA 2MSTA 3FRYA 1IBKK 1N6QB 1R8PA 2FZGB 1BCMA 9ATCB 4AQYJ 4A48A 3JTPA 4BRLA 5LL6Z 1BC6A 5H9EJ 3M8RA 3IN5A 2E44A 2ITGA 1UPMB 1RTHA 1NDCA 2GEMA 4X62K 4E7LA 3M6WA 1YF5L 3EVMA 1ITPA 3K17A 4UT4A 4IOCL 1DBDA 4BC3A 4KTWA 4H0TB 2GO8A 2ATCB 4JI5K 3Q7CA 1Q8KA 3EUNA 2EG1A 3VOVA 4ECVA 3CCWA 4Y65A 4O3QA 2I7PA 3DC2A 4MK8A 2W2QP 2OZMA 2HB5A 1YLXA 4ZOSA 5L46A 2N7CA 5HBMA 2YJFA 1FW6A 3T1HF 1N52B 4K8XA 1CJVB 1RWUA 3L95X 1U4BA 1ZZFA 5AZIB 1FO1A 1PG5B 2DO0A 4KGMA 4DLEA 5DM7L 1NHUA 3OW2M 1NOZA 4LF6F 3SMPA 4QR0A 2EPIA 3VCDA 1CJTA 1VQ8N 4DV3F 3KD5E 5BR8J 1UTAA 3DDIA 3QO9B 2VB6A 1YG0A 2KXHA 5GAGI 4X4SA 1WC1A 4O3PA 3NH1A 2F96A 1EO1A 3R7NB 1S1UB 4DX7A 5FPNA 5IWAF 1QZ5A 3ULHA 4CLWA 1TUWA 1T9WA 3KLIA 1NK5A 4DV1K 2X1GA 5MLCQ 3EZUA 3ZCMA 4Z7YA 4OI0A 3EICA 2BDPA 3UE2A 2IYGA 2UUTA 3GFYA 1HNVA 3MAAB 3RWUA 4GVBA 3BO2A 1NUEA 2BW2A 2B3TB 2HG4A 2RQCA 1HKBA 3K57A 2I2YA 4AL5A 1O1WA 1WDDA 4RR5A 3QLHA 2B9WA 2W01A 2Z1GA 2KVIA 4ZS6A 5T14A 5HL7Q 2YX6A 3AQPA 1VSHA 1GMWD 4CBUA 2DH9A 2IRXA 2YH1A 1XUPO 3PZPA 3OHAA 5K8NA 2WTFA 5E7OB 3TX0A 3VQQA 3UVJA 4O3NA 4CESA 4LF9F 3DOLB 4NX9A 3CFOA 1S0OA 3AQOA 2QE5A 4NLXA 3CJ1A 1X0PA 5ETRA 1LWFA 4HDGA 1K8KB 1IKVB 4M3UA 4FWMA 1RLDA 1ZM4A 4J9LA 4IOXA 3QBCA 4DR5J 4CJPA 2D74B 1N0UA 2HIYA 2FLPA 3WNHA 3S3MA 4KGVB 3PO4A 1NH7A 2E8AA 4CBXA 4O3RA 1EQMA 4FVMA 3BDPA 4KH1B 1DTTA 1Z2LA 3IBWA 5AXNA 4HEA9 5AQJA 5EU7A 4OZNA 1YK9A 3MUVP 4NXNK 1TUUA 3OYIA 3NF9A 3ULDA 4LFAK 4CF9A 2V68A 1YZ6A 2C2NA 4FPAA 3PR5B 3ZSQA 4JLHA 3PKMA 3HM8A 2XS2A 3OLBA 2GVDB 3JXUA 3T1AA 4F26A 5CYJA 2LXFA 3L2RA 3T19A 3SCXA 1TK5A 4CEOA 2HS0A 4PUOA 2PYJA 3GYXB 4KH0B 2HFZA 3IRXB 4ZJQA 4M45A 3R6MA 5AFUH 4JN4A 5GAGU 4DTJA 1IKXB 3JS9A 4YB7A 2LU1A 1HHQA 3AXKA 1PBAA 1T9UA 2QLBB 3TWHA 4QS9A 1GEHA 4NCBA 5L1KA 4H4MA 3W5ZA 1YGYA 3KVGA 2WOMB 4YOTA 4B9MA 3HVWA 1B0VA 4PQUA 4DTMA 3DOMB 4WFNQ 1KXPA 3UD3P 5DDRC 4ECZA 2NRTA 2QKKA 4CP5A 3THYB 3D7EO 4J9KA 2ALYB 3TQ1A 3HFVA 3H59A 1U6BA 3T5HA 2KM8B 4CTAB 1FRHA 3OVAA 2F8MA 1PJ6A 3Q22A 1G3OA 1C1CA 1VQYA 2M9KA 4OX7A 2FC8A 5CR4A 3U9ZA 4FJKA 3TJAA 2K7JA 1IBLJ 2RF2B 4KI4A 1WSJA 5HOOA 5KFTA 4DV7K 4WP3A 1RADB 2LFVA 3VALA 3CCSN 4OI6A 5A8WA 1NGGA 1EWRA 4FJ8A 1VAZA 1R8BA 5A76A 1N36J 4JYAF 1L5UA 5E3AA 3LDLA 4PEOA 4URGA 3R5JB 2GCFA 1JLQA 1GMVA 2D3ZA 3IMXA 4BRQA 5DLFA 1BE4A 1H2UX 3DXBA 4KKOB 4E3SA 3NDKA 1HPZB 4OKKA 4M3WA 2KH9A 3HT0A 1TV6A 3GFHA 3OS0A 4CJ7A 3HP6A 4UZCA 2UU9K 3DXMA 1S6PB 4B3RF 2KHOA 5L38A 1QVGM 1JLEA 3IXQA 3PG9A 3FMWA 2JGUA 4DMNA 2G8IA 2CNNB 4DX6A 2RDJA 1HL6A 3Q8YA 4YR2A 4QYRA 2BW7A 2XEXA 2E1AA 2HQFA 3AA3A 2DTUA 1C0TB 4Z4IA 4ZVPB 3MFIA 2IMOA 3CC2S 4YR3A 2FB0A 2HS4A 5ETQA 6FDRA 1HJRA 5H1SV 2BM1A 1HPMA 1HNWJ 1AFIA 2K06A 2CGJA 2J7WA 2FHJA 5CE3A 1NZ8A 2QLFB 4DV6K 2H4WB 5D0GA 1N32K 4JKAA 1MWQA 2MDAA 4Y00A 2ROPA 2WB4A 4CZGA 2PDAA 4FF1A 1WKLA 2AJ2A 4AXIA 5A8RB 5KFYA 2ZNYA 5F0XA 1NK0A 1FJ7A 3C6HA 3SLCA 1V3SA 2MPUA 4C98A 1IO2A 1M1HA 2FVSA 4DTPA 1LFWA 4ECTA 3C14A 3H2LA 4CJ3A 4X4QA 3KJVA 4QWBA 1DTQA 1BQNB 3RYLA 5HP1A 1HYVA 1KLMA 3MD1A 4IUFA 1JLGB 4NCAA 3FBCA 1XWLA 2NREA 4NLOA 3X1LB 3T1HJ 2YQ3A 1GOCA 5FPEA 1XC3A 4BY9C 4OJGA 2ZH2A 3OPKA 5FJ4A 1IJJA 1M1KO 4LF5K 2DYAA 2YXLA 2IJFA 1WHYA 3ZNUA 4DV3J 1CZAN 3D28A 3G86A 3C2PA 4WU2A 4BR4A 5AQOA 3M3ZA 3QT6A 1HNZF 2CPXA 1VJWA 4LR9A 2GNKA 5IWAJ 2JLEA 1RU1A 3MEEA 1F3FA 3AVFA 3CULA 3G4SN 4DZ6A 1NGCA 5KFPA 5ETSA 3OSPA 2CXEA 4UUWA 4ATNA 2WVCA 1HI0P 4NA1A 4R0EA 1YJ9N 5C7PA 2FHMA 2JHEA 2G0IA 2VC0A 6FD1A 3VAMA 2C2MB 1LV5A 3THVA 1FFSB 1HBMA 1BDGA 3MWBA 3BQ0A 1TAQA 4J9NA 4OYXA 3AJ1A 4OGEA 1H2VZ 3K5PA 4LRAA 5DS7A 1NGIA 1Q9YA 4CECA 3MM8B 4F4KA 2QWLA 4K50A 1KS2A 4UQTA 3ZSWA 2ZH8A 1D9AA 2A2DA 2POKA 1K47A 4LF9J 1HYZA 2AT1B 2MJUA 1N5QA 3RW7A 1NGHA 2JZ5A 3ZSOA 2L9DA 2R7UA 2HQCA 3E51A 1S5JA 1VSLA 1P90A 1TKZA 2P9EA 2N3LA 2OTJS 3CDBA 3H3OB 2IVMA 4WQ5A 4ZPWR 4ZKAA 2VG7A 1V5IB 4KRFA 4DUZF 3MMVA 5F3TA 3PIPQ 1TL7B 1NU4A 2H48B 1DZ5A 4FYYB 3BSNA 2D0AA 4CK3A 2D9OA 4TSXA 3O8WA 4CNYA 4BE0A 2HLUA 4PG5A 4DZDA 2FJXA 2WHOA 3KJNB 1F1BB 3GU0A 3A5OC 4RW7B 3CMEN 3IS9B 2IS3A 2NLWA 4O5BA 2APOA 2JEJA 4LF1A 3NS6A 1RCHA 4BRAA 3D6FB 3R5GA 3JYTB 3CO0P 2LYVA 3FZ2A 1WAFA 2AJFE 4IO1A 1X1PA 1W2BM 1NMNA 4KHMA 1HARA 2Q1LA 4JI4F 2VFSA 3PRVA 2A1SA 4IYQA 1B3TA 4DL5A 1WDTA 1S59A 3V9SA 4B3MK 3TSPA 3HI9A 2V4RA 3QFPA 2GC8A 4BDZA 2FD2A 3RW6A 4FWSA 1U2CA 1UFLA 2FHKA 4ZPTR 4M3YA 2HRYA 2E1MC 4JK7A 2DPNA 4EBCA 3QIPA 5IT0A 1KVJA 4DR1K 1KHWA 1PILA 1NK7A 1W7WA 2F8TA 4FJ5A 3TA1A 5MAOA 1YJWN 5HQ8A 4A62A 2FUG9 1QM9A 4K0KK 2GIFA 3HDSA 1JNZB 3BBCA 4F25A 4KH6A 2HS3A 4G1QB 3RRKA 3RMBA 3GSDA 5HK4A 4H03B 2XZTB 1MU2B 2XQCA 4JI0K 4DR6K 3AXMA 2V69A 5LJVA 1H6KX 4ELTA 3U1MA 4JYAJ 5JICA 3WUHA 5ETTA 4J9MA 1NJXA 4P6QA 3OJSA 2PGCA 1R59O 4H8KA 1S4EA 1JJCB 1WNSA 3RBXA 4OYPA 4I0WA 4A8YA 4DV0K 4B9LA 1WI8A 2OPSB 4B3RJ 2X3DA 2VQEK 2E29A 4DV4F 2B6AA 5KFQA 4FJHA 3NF6A 2EVZA 3NVMA 4JKFA 2LU2A 4JV1A 1SH2A 1J53A 2A5XA 4EU0A 3OYEA 5C2DA 3FZHA 1P6TA 4R5PA 3ENHA 1FKAF 5FIIA 5ETMA 2QEXS 2EI5A 4CK1A 2QFJA 1NGEA 1N5YB 1QUVA 4OJ1A 2O5DA 1B99A 4CZHA 1VRUB 3WDOA 1RAHB 4WQ4C 2FQQB 2VQFK 2E7VA 1YJ9S 4MJKA 2KM8C 1YVUA 1DQ9A 1MWYA 2OEKA 4NLQA 3WX8A 4DCOB 3PV8A 2D7SA 1WSVA 4KHUA 3ZZZA 2B56A 5GVQA 5EVZA 2J8AA 2V9KA 3VF2A 3NF8A 4FJ9A 3VTHA 4PG8A 3DLJA 3JQKA 4KJIA 4OMFG 4J9UE 3TUIC 3CXCM 1V9OA 5LSRA 4I9LA 4OI1A 1TVRB 1VQ4S 3AVAA 2MKIA 3DGPA 1U2VA 4OX8A 2HGNA 4GO7X 2GW8A 2YNFB 3SQGA 5D4OA 5HN0A 3F2KA 3C3LA 1RT5B 4EHUA 4ED8A 2WTUA 1VBZA 3OR2B 2JFKA 2LEBA 3HKWA 3GIKA 3ITHB 1QZ6A 2JRSA 2LECA 3HHKA 3JSBA 4QIVA 3FEXB 4ED7A 1CJVA 1RTDB 3EGWB 3LP0A 4J2DA 4R8UB 4CGFA 2FY8A 5HVHA 4LH4A 3MEGA 3V2UC 2NYIA 2EXUA 4OYZA 3DGVA 1NJIO 3ZZ0A 1LWXA 3AV9A 3VEWA 1S48A 1CEZA 3PIOL 3CJ2A 2CAJA 5A6PA 1KVAA 2AZ1A 1L3VA 3W9HA 3QSYB 1YTAA 3CJ3A 2D3UA 4LSLB 3CJRA 4FP9A 3PY8A 1S1UA 1RBOB 2NPIA 1TQLA 3EKUA 3CJCA 1KTQA 5A2QU 5AXMA 3G96A 1RAGB 3W5YA 5AZJA 4M94A 3LAMA 5KFJA 4DL3A 1HNZJ 1ACMB 1NSKL 2GVZB 3AO2A 2GGPA 2ZM6K 1J5OB 1VOMA 3BM7A 3O9SA 4C3LA 3DLKA 1IR0A 5K8PA 4DN0A 4CJEA 4A8OA 3RBEA 3FEZA 3MEDB 4RJVA 2ZHAA 1C1BA 4M63C 2VC1A 1TMJA 4DUTA 3MMAB 4QQBA 2CPIA 4ALZA 3C6TB 4ZVGA 1ZYQA 2H4YB 5C12A 3OL7A 3EPGA 3BO3A 3MCAB 3OTOK 4L73A 2ZDOA 2CZ9A 1CULB 2HSEB 3D1HA 3GFZA 4C11A 5FPMA 2I38A 8ATCB 3OTDA 1YJ7A 3KMQA 1CLQA 1UZDA 3AA5X 4BE1A 3J7ZO 2I9SA 3SEOA 1HI1A 5E41A 2F9JA 3PX4A 3HSZA 4Z4FA 4CJVA 3HULA 2ZHBA 5KGWA 5JXSA 1PCAA 2EFGA 3TW0A 4KB0A 3Q83A 3ZSZA 2F3JA 3FUYA 4YDXA 1VQMS 3R3TA 2QMUB 2HVIA 3QT7A 1GQEA 1QUPA 2PN6A 4FK2A 3TSUA 1HWJA 3AHPA 3DLBA 2HWHA 2KT3A 4NMXA 4DUZJ 3HSGA 5T7LB 2XMAA 4QOTA 1K8AT 1WORA 1NH8A 2W40A 1H7XA 4UOGA 3BREA 3MTJA 2G2ZA 1WG5A 3F5TA 5KPZA 2HVDA 1FEEA 4IJNA 2XMMA 3P8BB 3N6LA 3T9NA 3CJBA 3MM9B 4E89A 2JJ4D 2NUUG 5KFXA 2FBVA 3Q8UA 3MCOA 4KBOA 2LEPA 2HHWA 3VEXA 1JXVA 2H5EA 1N8RT 3IRXA 3KHLA 4YDUA 2IVFB 2UXBK 2HKEA 1IKXA 2FY1A 3I8BA 4U9RA 5DG9A 4C8NA 4DR3J 4JI4J 2FJBB 4W90B 1E4FT 3E8OA