2HMIA

Hiv-1 reverse transcriptase/fragment of fab 28/dna complex
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and functional implications of the polymerase active site region in a complex of HIV-1 RT with a double-stranded DNA template-primer and an antibody Fab fragment at 2.8 A resolution.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system/dna
molecule keywords DNA (5'-D(*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*GP*GP*G
total genus 135
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hmiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hmiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hmiA05
4AILC 1KLMB 1RCHA 3KOAA 4BE2A 2PY5A 4KHQA 1RT2B 3TWHA 4IH7A 3KLHA 3DM2A 1K1SA 4JV0A 3DOLB 5F8JA 4CGFA 1TKZB 4DTOA 5L1LA 1S1WB 3DI6B 3DLBA 3H5YA 2ILYA 5KFVA 1IKXB 2QE5A 5D3GB 4WYWA 4CEZA 1VSKA 2XY7A 4CE9A 1RDDA 4CHYA 2A1SA 4C8NA 3HPOA 4DL7A 3RB6A 5HBMB 5F8MA 1S0OA 3G10A 3T19A 3E01A 4O5BA 3KLFB 4JS5A 2QV6A 4TQSA 4ED3A 2IJNA 2ZE2A 4YR3A 3OYAA 1X9MA 3RRHA 4GC6A 4ZP8A 3JSMB 1S6PA 3PV8A 1C6VA 4NLOA 3WNFA 1S1UA 4WXOA 5KFLA 4O4GB 4NLQA 3FQLA 4DS4A 2JC0A 3QERA 3MR3A 2ALZA 2BANA 3NE6A 1TKTA 1LWEA 5EWGA 1RNHA 4KTWA 1RA7A 5KFEA 1N5YB 3KHHA 4I2QB 3HK2A 4B08A 3QO9A 3C6UB 2Z1GA 3RWUA 1BGXT 4ED0A 2O4IA 1MU2A 2V4QA 2YKMB 1RTHB 2F8TA 4EO8A 3VQDA 4F4WA 1LWCA 3PW4A 4TY9A 3H2LA 1HNVB 4J9QA 4ECWA 5HBMA 1TAUA 3NF8A 3OJSA 4CJ5A 3FFIA 5JUMA 4YR2A 5DGBA 3TQ1A 5KI6A 3KIOA 3Q8QB 2FBTA 2HAIA 3IRXA 4EP4A 3V9XA 1BI4A 3NAIA 2AGQA 1JXEA 1VSEA 2G8UA 3AO4A 1T05B 4JLHA 2YNIA 3H59A 3CJ4A 2I1RA 2D3ZA 4BWMA 2X6SA 1L5UA 4CJSA 4HUEA 3KD5E 3K5LA 3BGRA 3OL8A 4E7HA 2XRIA 1K6YA 4G3IA 4FZXC 1KLMA 4JS4A 2EX3A 1HMVB 2RF2B 3LZJA 2GC8A 5KFWA 2W7OA 4KTQA 4YQWA 1UA0A 1EETA 5K14B 2FJVA 4HVJA 1S0MA 1NKBA 2ZD1B 4F3OA 3V4IB 3ZSOA 1NOZA 4LH4A 3MR2A 1X9SA 4LH5A 1S1XB 4IFVB 3M8SA 4DQRA 2HNDA 3NCIA 4ZTJA 4QCLA 1XR6A 5J2NB 1QSYA 3QLHA 3HSTB 4MK7A 3M8QA 3QIPB 5F8GA 1DLOB 5FRMA 3MXIA 3SPZA 2E4LA 5KT4A 4XO0A 1S9FA 2R2UA 4O4RA 4DSIA 1HNIB 1WSHA 1SL2A 2VG6A 3SNNA 3BDPA 3LP1A 4H8KA 4O44B 3DRSB 1O1WA 1D0EA 1HYSA 1RDRA 1VSMA 4RW6B 4K4XA 2JEIA 2JLEA 4M3YA 4RW4B 1NOYA 4E7JA 1RT6A 2IC3A 5KG6A 1XR7A 2WRMA 3M8PB 1G15A 5DQHA 2XC9A 2Z1HA 4I2PB 3NGYA 2UVVA 2I5JB 1JLAA 4CCHA 3FRZA 3PJWA 4XIUA 4NCGA 4KRFA 1KVAA 3AO5A 3BJYA 5F9LA 4O3OA 3NF6A 4JRPA 1RBUA 3QLHB 2G8WA 1S97A 2YNGB 1HNVA 3C94A 3KLIB 2ATQA 3MFIA 5KFTA 1SH3A 3NH0A 5HLFB 2XI3A 3P5JA 1XR5A 4IFYA 4H4OA 5L1KA 5SZTA 3RR7A 2PYJA 5C25A 1FK9A 4K4TA 2XCPA 1EX4A 3H5SA 4ED2A 1BI4B 5DK5A 2BE2B 3HVAA 1MMLA 4TYBA 5T14A 4NLVA 1HYSB 4CEEA 4ECXA 2OA8A 4LQ9A 1ASUA 4Y3CA 1ZETA 2V4RA 1LAWA 5DGAA 4DSEA 2R8GA 3HM9A 1J53A 4FM1A 5C42B 2HHSA 4FJ8A 2AWZA 1U45A 1C0TA 4KE5A 2J6TA 3SQ4A 4JV2A 1TKZA 3S9HA 2RF2A 4YR0A 1TL1A 4CEDA 1TKXA 3NAEA 2R7YA 4EEYA 1TAQA 3EPGA 4M95A 2GV9A 4FK0A 1NJYA 4IDKA 3PZPA 1RT3B 1QTMA 1FKOB 4FJ9A 1Q9XA 1IKVB 3O3GA 2D0CA 4RW7B 3KK2B 4MKAA 3H40A 4K8XA 2BRKA 4CJTA 2HMIA 5KG5A 4N5SA 4CF2A 1HYZA 4IR1A 3BR9A 1GOCA 3DYAB 4H4OB 2Z1IA 4DFJA 3M8QB 3QIPA 4OKJA 5FRNA 3KK3B 4BWJA 3LZIA 5C25B 5KFXA 4CGIA 1IG9A 1S6PB 2IM1A 1QE1A 3LANA 2XGQA 1C1BA 4LSLA 2PZSA 4C8OA 3AVIA 3I0RB 5KFIA 2VG6B 2BANB 1RT4A 4QAGA 3AO2A 4GVMA 2W9CB 5KFKA 5DG9A 3SPYA 4KO0A 2HVIA 1J5OA 2DFFA 1JX4A 4TLRA 3NF7A 4O0JA 3LDSA 1QS4A 3KTQA 3C6UA 2R8HA 1TL1B 1RYRA 1JLFA 4ED1A 4CJVA 3EZ5A 4DU4A 4IG3A 4ELUA 3TVKA 1ASVA 1IM4A 4AH9A 3AVNA 4ICLB 4DU1A 4IH6A 3VA3A 3KKSA 2BGGA 3WNGA 1B9DA 1Q9YA 2HWIA 1N6QB 2DY4A 3ZSZA 2IAJB 1YT3A 3C6TB 1JLQA 4CEBA 3L2WA 3OYBA 4IKAA 3MXJA 3FFIB 1HRHA 2YNGA 3DRPB 2ASLA 4O3NA 1RTIA 3VQQA 1R0AB 1VSIA 2IM2A 3E01B 1J9AA 2ETJA 3AA5X 4KHNA 1NNDA 3OYCA 1Y97A 3SUPA 2YNHB 3VQAA 4CEFA 4FLVA 2YNIB 4M3WA 4TY8B 1K1QA 1X9WA 3DLKB 4KPYA 4CHZA 4KI4A 4KO0B 4OGEA 3SV4A 2FLNA 3QGHA 3TABA 1JLEB 4DFMA 5HROA 4KHUA 2FLPA 3Q8RB 3H08A 3LP3A 5FROA 1WSIA 1WSEA 3VQ9A 4W5QA 3O4QA 1RT7A 3SFGA 1S1XA 3D5MA 1Q8IA 3NHGA 2IJFA 3NBPA 3BSAA 4FZYA 2W7PA 3QNOA 4FLZA 3EY1A 3CDEA 4I7FA 1RTIB 4R8UA 4FJKA 1JLGB 1JKHB 4ZPCA 2OH2A 1S5JA 3V9SA 3T1AA 1NKCA 1W0HA 4ED8A 3K5MA 1HYVA 1TQLA 2FC0A 4M41A 4E19A 1TP7A 4E0DA 2X74A 2FBXA 1IKYA 1QAJA 2YV0X 4DSLA 2B6AA 3DLGB 4Q0BA 2AGPA 2BDPA 2IM3A 1XHZA 1VRUA 3IGVA 4LSLB 1DTQA 3DLEA 2XI2A 3ZT1A 3H4DA 1RT6B 5KT3A 3K57A 2HHXA 4CEQA 5KT6A 3HP6A 1RT2A 3E51A 4RNOA 1HQEA 3AVLA 1RTJB 3N6NA 5JXSA 4Y1CA 1HPZB 3LP0A 3RB0A 3DOKB 3KJVB 3M9MB 1BQMB 4ZMMA 3U3YA 2KZZA 1CXQA 4CHPA 4MQ3A 2ZD1A 4DLEA 3GIIA 3ZT4A 5D3GA 3A2FA 4K4YA 4MIBA 4KHSA 4IG0B 4FBUA 4C8LA 4CFDA 3DMJA 2DFHA 3KLIA 3L2UA 1U09A 3I0SB 1KVCA 5DMRA 4M3XA 1HARA 2D0AA 2VG5B 3QEWA 3OLBA 4YMEA 3VQ7A 3ASMA 4FYDA 2C28A 2DTUA 1DLOA 1FK9B 5HP1A 1WAJA 4Y1DA 2B5JB 2R8IA 4LSNA 4DU3A 4IQXA 5J1EA 4O55A 4CK1A 5I42B 1SV5B 3AA2A 4CJPA 2RN2A 2YKNB 3DRSA 4HKQA 1N5YA 2IA6A 3OLAA 3SJJA 1VSHA 1RTJA 3D0PA 4DSJA 1RT5B 4BDYA 3OL9A 3BQ1A 3DDKA 4RW9B 2XO7A 1A5WA 4WFYA 2D0BA 1UA1A 5DQIA 3MECA 1S1TA 3AVGA 3M8PA 4XPCA 2AX0A 4L8RB 1VSFA 3O3HA 4CGDA 4NLWA 4J9OA 5CYQB 4NYZA 1S1WA 4F4KA 5FDLA 3DMJB 4F2RA 3OJUA 3JYTB 3I0SA 3ULDA 3ZSVA 1C0UB 2B4JA 5CY4A 1A5VA 4DLGA 3ISNC 3PX6A 3MEGA 3CIZA 4ZVGA 2IBKA 4KB1A 4GW6A 4N56A 4AHRA 2B5JA 4KFBB 3OHBA 4EZ9A 1C1BB 4U7CA 4R0EA 3I0RA 5DG8A 4DQIA 3K5OA 4J2EA 2YKNA 2FVRA 4QW9A 4J9PA 4YNQA 3NL0A 3RMCA 3SYZA 5HRRA 4BE1A 1RT5A 4ZVHA 3TARA 5J2MA 2FVPA 1TVRB 4RNFA 1ZBFA 1NJXA 3VA0A 1JLCA 5KFMA 2AX1A 1JL2A 3QO9B 3HVRA 4X2BA 4IRDA 3MFHA 2KTQA 1NJZA 4ICLA 2FVCA 3DOKA 1Z25A 4KAZA 3K59A 4QWEA 4ECUA 4EBDA 1N4LA 3I8DA 2HHUA 1C1CA 3PO4A 1WSFA 2DPIA 4NCBA 3V9UA 5C5JA 3DRPA 5JS2A 3MEGB 4FS1A 3P83D 3AVFA 5J2PB 4CF8A 1DTTB 4RU9A 3OS1A 1NK5A 1OS5A 4TY8A 4MFBB 4EO6A 4CIFA 2R2SA 1L3TA 4CEOA 4OKEA 3OYNA 1FKPB 1S0NA 4DTPA 4BDPA 3CFOA 4AHVA 1VSJA 1FXXA 3AVAA 3N6MA 3ZT0A 2Y1IA 1TK0A 1TVRA 3V6DB 3AVHA 4O0IA 2ZQBA 4NLTA 5EU7A 4B9NA 1S10A 2OZMA 4TSXA 1D1UA 3CM5A 3GILA 3MECB 2IOCA 3OS0A 3P1GA 3B6PA 3I5CA 3ITHB 2HB5A 3M9OB 4ZTFA 3Q8PB 4QOZB 3OYGA 2GUIA 4I7FB 4CJRA 4R8UB 1N6QA 3N6LA 2IAJA 4Q43A 4CHQA 1SUQA 5KFNA 3G6VA 4M3UA 4W5NA 4FLXA 4DL4A 3EZUA 3ISND 2UVUA 2W9AA 4NYFA 5I3UA 1N56A 1WLJA 4PUOA 3MEDA 3WNHA 5KFPA 2GIQA 4DSKA 2ZKUA 3LAKA 3OL7A 2QKKA 2KQ2A 4DG1B 2FLLA 3VQEA 4FK2A 1D5AA 3V9WA 3VQBA 4IKFA 5DQGA 2XY8A 1C0TB 1L3SA 1EXQA 3U3GA 3OYIA 4QWAA 4ELTA 3CDUA 4MKBA 4OVLA 1JL1A 1MU2B 1SL0A 1TKDA 4FK4A 3QZ7A 4CJ4A 3LWMA 5DG7A 4QW8A 1ZYQA 4AHTA 3MAQA 4TQRA 5F8NA 3QESA 4N76A 1JLAB 1XHXA 4F3TA 3NH2A 4IG0A 1KHWA 3ZSQA 3OYKA 4HCBA 1WN7A 3KD1E 4RW8A 3QEXA 2OYQA 1QAIA 3O4NA 4E1NA 4CJEA 4JRQA 3QZ8A 4DTUA 4WZQA 2IGIA 4DTJA 4FXDA 1SH0A 4DQQA 4AHUA 1JKHA 4J9LA 1C0MA 4F4XA 3ICLA 2R2TA 1YTAA 1SKRA 4MH8A 3OHAA 4IRCA 5I42A 4HYKA 3VN5A 3QIOA 2ITGA 2HNYA 1U4BA 1S9GB 2HNZA 3PX4A 4ECQA 4M94A 1S1UB 2OPQB 5KFJA 2A1RA 3QEIA 4CEAA 4FM2A 2C22A 1WSJA 3RAQA 4B9UA 4FJXA 2KFZA 2IDOA 4F2SA 3V6JA 4Y34A 3GIMA 5KFGA 3LP2A 4PA1A 4FVMA 4EYHB 1T94A 3AV9A 4FCYA 3KJVA 2G8IA 1SL1A 3RBDA 5KFFA 5C24A 1RTHA 1EKEA 4RW8B 2FVQA 4CJUA 3OYDA 3ITHA 4FLYA 2Q3SA 1FKOA 1QSSA 4M3TA 4WE1A 3D28A 1JXLA 5F8IA 3V81A 3PR5B 3S3NA 4R5PB 1NK8A 5KT5A 1ZBHA 1GX5A 4IR9A 1L3VA 3V6HA 2VA3A 4Z0UA 3DLRA 4WYLA 5J2QB 3KK3A 2Y1JA 4TYAA 4PQUA 4FJJA 2O5DA 2HW3A 4KTZA 5I3UB 3K2PA 2GIRA 3SI6A 2O4GA 1VSDA 1UOCA 4QWBA 1BQNA 2OPQA 3T5KA 2HWHA 1GX6A 4NRTA 3NGDA 4K4VA 5KGWA 4B9TA 4ZVFA 5J2MB 1KVBA 2W9BB 4I9LA 3KHGA 1LW0B 3IG1A 4Y2AA 1LWFA 1BISA 4CFAA 3DOLA 3LALA 2EC0A 1CXUA 5EWEA 3ZSYA 4ECYA 2W42A 2JGUA 4KV8B 1IKXA 2R2RA 5HRNA 5K14A 3IS9B 5CYMA 4BDZA 3BREA 4ZP6A 5JS1A 2HHWA 4F8RA 3OYEA 4E7IA 2PYLA 4J9MA 5F8LA 2G8FA 4UQGA 4CERA 2P51A 1RBSA 4IH5A 2B43A 4NYNA 4O3PA 3SUOA 3PR4A 3UR0A 4EBEA 3HHKA 4B8CA 3QNNA 4ID1A 4ZPDA 4RNNA 4FJHA 3GQCA 4DSFA 3DLHA 4EYIB 4KHMA 2UVRA 4QPXA 2R8KA 2VWJA 4E89A 3WNEA 4CJWA 3TAMB 4LQ3A 1RDAA 3T5LA 1S6QA 2YNFA 4E3SA 2RDIA 2HNYB 3RBEA 4NLSA 1B92A 1VK0A 2BQRA 4O44A 1LWEB 1EP4B 2XWYA 3M9NB 4DFKA 2JEJA 4DQPA 2J6SA 5DLGA 1NJWA 5HROB 2AQ4A 3VQCA 4ZPAA 1TKXB 1RDBA 4CESA 5KTQA 1QUVA 4GMJB 4CF0A 2D7SA 3L3VA 3L3UA 3QETA 4URSA 2QXFA 5CYMB 4ED6A 5KRSA 4EP5A 1T03B 4PWDA 2E9RX 4I2PA 2OPPA 3BSOA 2UVWA 3S3MA 1IKVA 4F4ZA 2JC1A 1RTDA 2DPJA 3CM6A 1C1CB 1RBRA 2F96A 4B9VA 3HKWA 3MEEB 3GV8B 4CGHA 5KG4A 3UDLA 3V1OA 3KMQA 3MXMA 4WFXA 4R5PA 4F4YA 5KFRA 1HQUA 3CG7A 1JIHA 4RNMA 3B6OA 4KHRA 4LSNB 2ASDA 4CF9A 1SKSA 3AVJA 4ID5B 4Q8FA 1IKYB 3PW5A 2BRLA 4F50A 4Q0BB 4OKKA 1JLBB 1TL3B 1NK4A 4KI6A 4Z4CA 2F8SA 1FKPA 3BGRB 4RUCA 3T5JA 1Z4UA 3DLEB 4KHYA 3VQ5A 3KHLA 2JEFA 4KB0A 4EZ6A 2W9BA 2VG7B 5KG1A 1S1TB 5C42A 4KAIA 2ILZA 3U6FA 1EETB 2V9WA 4B9MA 3H98A 4PWDB 3CJ2A 1I3AA 1NHVA 1S9EB 1TK5A 4ECVA 4DL5A 1ZBUA 1WSGA 4IDKB 4JV1A 2QKBA 1RT3A 5KT7A 3G86A 3L2VA 1QQCA 1C0UA 3CFPA 3LPTA 3THVA 4CJFA 2E6LA 2XY5A 1HQUB 3MR5A 4CGJA 3QEVA 5KT2A 3IGNA 2AGOA 2G8HA 4KFBA 5F9NA 4M3RA 2P5GA 2YNHA 1KSPA 2W8KA 4FJ7A 1ASWA 5HP1B 3CFRA 2P5OA 1IO2A 4RZRA 1QE1B 2FVSA 1D8YA 3VQ4A 1T05A 1KRPA 1S1VA 2YNFB 3MTKA 4ECSA 4J9RA 3BQ2A 5KFQA 4AHSA 3QGIA 4PY5A 1NK7A 3L2QA 5KGXA 3SCXA 1WAFA 4DTXA 4MK8A 3AA3A 4NLYA 3DI6A 3G6YA 4URQU 4ELVA 1JLFB 3G6XA 5C24B 3NBPB 3SQ2A 4O3SA 2OPPB 3TAGA 4WE1B 3AVKA 2HHVA 4Q44A 2R8JA 1JLGA 3EYZA 2RDJA 1JLQB 4Z4FA 4ZHRA 3NAHA 1KHVA 3FDSA 4FJNA 1KFDA 2KW4A 4PQUB 1RAJA 3H4BA 4M42A 2B6AB 3DLGA 4CIGA 4FJLA 4G1QA 3CJ0A 1UAXA 3KLGA 4DF4A 2LSNA 1DTQB 3OSPA 3SZ2A 3TANA 4DTNA 4J9SA 1TL3A 1S9GA 2HNZB 1B9FA 1XWLA 3RB4A 2HHTA 3O3FA 3ZSWA 4KB7A 3MF5A 1RDCA 1ZBIA 3AVMA 3V6KA 3LP0B 4RG8A 4O3QA 3VQ8A 3DM2B 4KV8A 2RKIB 3DRRA 3VQPA 4CGGA 3HPHA 4N47A 3CQ8A 1KLNA 1BIZA 2QK9A 1S9EA 4H4MB 1Z26A 3OSNA 3KK1A 4FW2A 2C2EA 4O3RA 4NLPA 4CJQA 1C1AA 2VG5A 3HVTB 5CZ1A 3RR8A 1BL3A 1HJRA 4CIEA 1NK9A 2WONA 1N48A 3IRXB 1RYSA 1YTUA 1RT1B 4WFZA 1W25A 1SH2A 4OGCA 3TAMA 1ZBLA 1S6QB 1U47A 2FJXA 4MIAA 1U49A 3HO1A 3F9KA 4FLTA 4Z4IA 1S49A 2UUTA 4ZP7A 3HJFA 4DTMA 4W5OA 1J5OB 1BQNB 4FS2A 3QYYA 5EWFA 4FM0A 3FSIA 5KG3A 3PW7A 1KFSA 5HRSA 4ZP9A 1HMVA 1REVB 3HYFA 3V6DA 4C8MA 3IG1B 1HQEB 2OPSA 4Y2CA 4YFUA 2F8EX 3DRRB 3ZT3A 4IG3B 1T7PA 1NKEA 5KRTA 3QEPA 2XHBA 3SQ0A 3KK1B 4DWIA 5DLFA 3IS9A 2BR0A 2WK4A 4NLXA 3ALYA 3IN5A 1WNSA 3C6TA 1L3UA 4Z4EA 2OZSA 5KFYA 5HRPA 1LWCB 5J2NA 3TAQA 4RW7A 3KK2A 4HUGA 3K58A 3V1RA 3H5XA 2V0NA 4RNHA 3NGIA 2G8VA 4DFPA 3HT3A 1SUQB 3KHRA 2ASJA 2HHQA 1ZTTA 1U04A 1HNIA 3AO3A 4BACA 3LP1B 2D5RA 4IRKA 1JLBA 4Q8EA 2E9ZA 3QIDA 4OL8A 5KFOA 3KLGB 1IKWA 3GV7B 3TI0A 4B3OA 4K8ZA 1RT4B 4KKOB 1YVUA 2KZMA 2W9CA 3RRGA 1TV6A 2WOMA 1EP4A 4QWDA 1QHTA 3LP2B 2KFNA 1QSLA 2WCXA 3H5UA 3ZCMA 3PX0A 4C8KA 4CJKA 2I5JA 3KMSA 3RMDA 4J9KA 2IM0A 4W5TA 2RKIA 1RBTA 4FW1A 4OPJA 4CFCA 3PUFA 3SUNA 1CSJA 3V4IA 2AU0A 3NDKA 3PY8A 5CYQA 3GYNA 4FZZA 3PO5A 2CKWA 4WXWA 4K4UA 5KFUA 2FBVA 4CK3A 1T8EA 2G8KA 2HNDB 4LD0A 4CHOA 3MEEA 4WZMA 1DTTA 4H54A 1C2PA 3SFUA 4LY7A 5KFAA 3T5HA 2E9TA 3K5NA 4DS5A 1R0AA 2WONB 1D9FA 1KTQA 4NLUA 4IBNA 4DQSA 4J2BA 3I5BA 1WNEA 3CVKA 3KNAA 2J6UA 5L9XA 2WB4A 3CWJA 3OS2A 2FJWA 1TV6B 1RILA 1LWFB 1NK0A 4I2QA 4CHNA 4B8AB 3UQSA 3LAMA 5L1IA 1T3NA 3HPGA 3NFAA 1LAVA 2D41A 1S48A 1W9HA 4HTUA 4IOBA 4M45A 1JLCB 4TN2A 3I5AA 2BQUA 3SV3A 3IAYA 2EHGA 3V1QA 3RMBA 1X1PA 3BQ0A 1LW2B 3ZSXA 4CJ3A 5L1JA 4E7LA 3AVBA 1GOBA 4NCAA 2OPRB 1CLQA 1LV5A 3OYHA 1U48A 4QWCA 1KCFA 4OPKA 2WHOA 3VQ6A 3NGZA 3Q8SB 3SUQA 3DYAA 3ZSRA 4U6PA 4TXSA 2UUWA 4BE0A 2YHAA 5KFCA 5J2PA 4IFYB 1A5XA 3T3FA 2P1JA 4N41A 3MEDB 2E6MA 3KLEB 2AJQA 3TR8A 4OJRA 5F8HA 5SWMA 3MR6A 4XPEA 3PW0A 3JSMA 4FJGA 4DG1A 3QINA 3PHEA 4HUFA 4CECA 5KFBA 4JUZA 4J9NA 4KSEB 1S1VB 2JEGA 4MK9A 1VRTA 4KKOA 1BHLA 1ITGA 3GV5B 4CFBA 5KG7A 3RB3A 4YP3A 1LW0A 4ECZA 2WOMB 1YVFA 3OYFA 3PJXA 3RTVA 5KFHA 1T03A 3NMAA 3AVCA 3GIJA 5KG0A 1RA6A 4FLUA 4Q45A 4H4MA 1BQMA 4NLGA 2YKMA 3D45A 1XI1A 1NHUA 3CJ3A 2OPRA 4M3ZA 3OYLA 3JYTA 2XGPA 3AA4A 2X6NA 2FBYA 4OLAA 4DL2A 3HVTA 3F73A 2IMWP 1UWBA 4DMNA 3CDWA 5KFDA 3L2RA 2HMIB 3L8BA 3NKYA 4HCCA 3LPUA 2W8LA 4B9LA 2CJQA 2IS3A 4W5RA 1RT1A 3M8RA 2Z1JA 4OLBA 4NLRA 4ID5A 1TK8A 4DTRA 3DLKA 3BSNA 3LWLA 4ZVEA 2NUBA 1I39A 4PUOB 3KKRA 1SKWA 4NZ0A 4Z4GA 4ECTA 3G0ZA 1JLEA 1SV5A 4KREA 1REVA 3OYMA 3OYJA 3S3OA 1D9DA 3PVXA 4K50A 2X78A 4CJLA 3OL6A 1JXBA 2GBZA 4RW9A 3GIKA 1RT7B 4FJMA 1GOAA 3V9ZA 5KFSA 3SQ1A 4GC7A 4AHCA 3CJ5A 4Z4HA 3PW2A 4FJ5A 2VA2A 1LW2A 2XY6A 5FDLB 4IFVA 4E7KA 3NH1A 1RTDB 3V81B 1J54A 1XC9A 2C2RA 5HLFA 4DTSA 1I6JA 3CYMA 3OVNA 3CO9A 1CZ9A 4CK2A 5J2QA 2ZE2B 4DF8A 4ZPBA 3VQSA 2XCAA 4E1MA 3SI8A 5CZ2A 4NLDA 2BE2A 4KHWA 3HL8A 4ED7A 3KLEA 4B3OB 4K4WA 4KBIA 1RBVA 2BQ3A 4NRUA 1IH7A 2DFEA 5EUHA 1CZBA 3HXMA 3C95A 1TKTB 3RMAA 4FBTA 1BCOA 2WTFA 4RW6A 1BIUA 3NF9A 2C2DA 3QGGA 4RW4A 1VRTB 4CF1A 4ECRA 1TGOA 3UPFA 3ZT2A 1F21A 1HPZA 2IC3B 2RPIA 3EPIA 4FLWA 2VG7A 3KLHB 2OPSB 5EDWA 4J2AA 1S4FA 3BSCA 4NCGB 3TAFA 2D3UA 3AO1A 4EBCA 4DEZA 3TAEA 5E41A 4I9QA 4ZHRB 3UIQA 3FQKA 4B9SA 1NK6A 3HVWA 4K4SA 1UWBB 4Q5VA 4DL3A 3RAXA 5KFZA 4HHTA 4RUAA 3TAPA 4FJIA 3KLFA 4G1QB 1VSLA 2HVHA 5J1EB 3KLVA 3OY9A 4MFBA 1BCMA 3HP9A 4J2DA 4DL6A 4URGA 1ZTWA 1VRUB 2ATLA 5KG2A 2YHBA 4O4GA 1IKWB 2VWKA 4K4ZA 5T7BA
chains in the Genus database with same CATH superfamily
4OV6A 2HFVA 2OEKA 3U1LA 4B3SJ 4BE2A 1RT2B 4IH7A 1RKJA 4S0MA 4PG7A 3KLHA 3GJRB 4AQYF 1SAZA 2G0CA 2YWKA 3OTOK 2GW8A 1S1WB 2R7SA 3DI6B 3DLBA 4FF2A 3O8MA 3JTNA 1IBMJ 2QE5A 3RVCA 4ISFA 3HFVA 5A2QO 3MMAB 5JVGQ 4DU8A 5HVHA 4I1TA 2XY7A 4CE9A 2K8GA 1RAFB 3EGNA 2A1SA 3M05A 1S0OA 3DNCA 4ZVTB 1TYQA 1S72S 1MSWD 4TQSA 2RU3A 4ED3A 4F3QA 1NSKL 2ZE2A 4BC5A 4YR3A 3OYAA 3O1WA 2Y3YA 3P4UB 1X9MA 3RRHA 4ZP8A 4LF4K 3JSMB 4E8UA 1S6PA 1NB2A 2CQHA 4LSZB 3A8EA 4NLOA 5LT5A 4DV5K 1QD1A 3FQLA 3QERA 3C7NA 3JXOA 3FGVA 1WG5A 4BC2A 3GIRA 5EWGA 1RA7A 1LOTB 4I2QB 5DDRC 1TUYA 3L09A 3W65A 4DZ6A 4JNEA 4L3QA 1PGZA 3RWUA 4FP9A 2O4IA 1G7CB 2F8TA 3VQDA 2OAUA 1LCUA 3K0JA 1AYEA 1LWCA 2AJFE 3H2LA 1HNVB 4ECWA 4YHHK 5B0CA 2KM8C 3H3NO 1E6VA 1ZAXA 2ZGZA 2DRBA 3CULA 2X1GA 5DGBA 2MQOA 2OTLS 3MMBA 3R5CA 3KIOA 5C2GA 2BXJA 3OR2A 1B0PA 3PNIA 4HTJA 3IRXA 2H4YB 2POKA 1HHQA 3TW0A 1VSEA 3BV8A 4P2MA 3G6ES 2YNIA 2YH0A 2I1RA 2DNHA 4OQJA 3OFEA 1VQKS 1W97L 4HUEA 3BGRA 4PL7A 1AFIA 2XRIA 1K6YA 4KPCA 3VHQA 2EX3A 3MK6A 2DD8S 1NGHA 2RF2B 3PXGa 5KFWA 4B3SK 5D0HA 3M2VB 4X4PA 4KTQA 9ATCB 4YQWA 1FDNA 1EETA 1UA0A 4HVJA 4UOCA 1ZM2A 3MR2A 5AQWA 1S1XB 4IFVB 2YXLA 4DQRA 1UZHA 1IJEB 5LJ5Y 3THXB 4QCLA 5E3QA 5F0UA 1CQMA 3CCUS 1XQIA 3QLHA 2EK1A 3LO3A 3ENWA 3M8QA 2HVDA 2IA0A 3SPZA 2MMYA 4JN4A 3ILLA 1MNEA 3MN6A 4X4OA 1WSHA 3B8AX 2KXNB 2WAQD 1PBAA 3BDPA 3HOSA 1O1WA 2E5HA 1VSMA 2D1KA 3N28A 3ZZUA 2C2ZB 3TA1A 2JLEA 4M3YA 3OTBA 4B3SF 2OIHA 1W2IA 4MYTA 4DV5J 3ID6A 5IT0A 4A8SA 4AQYJ 5DQHA 5C7PA 4X62F 4I2PB 1EWRA 2UVVA 5D4PA 5A6WA 4DI6A 3DKDA 5F9LA 3NF6A 4BRFA 2OMOA 2YTCA 3QLHB 1TUWA 1NZAA 1VHXA 2RD5C 5HLFB 1HBOA 2W41A 4V19X 2XI3A 3AXKA 1XR5A 2A3JA 5SZTA 2Z2MA 2F9JA 3VVTA 4X4VA 4H5RA 1VQKN 1FK9A 3PDNA 5DK5A 5T14A 4WWSA 3CC4N 2KLAA 5DGAA 3FRYA 4NYOA 2Q0UA 2FSKA 4ILRA 3KWIA 4ED5A 4KE5A 2JVOA 3MM7B 1T9TA 3X3UA 1VQ7S 1TL1A 4OYXA 1TKXA 3M6GA 5FPMA 3IRWP 4PKIA 3CJ9A 4FK0A 3N5BA 2NXUA 4CD1A 3O3GA 4RW7B 2RVJA 3VGVA 2BRKA 2HMIA 4ETZA 4CF2A 4R0JA 3BR9A 4KGMA 3DYAB 1FI4A 4H4OB 2LU2A 4P9SA 4UW2A 5IC4B 1HNXJ 1NDLA 3EGWB 5JMNA 4DFJA 3QIPA 4GV3A 3LZIA 3EE3A 2EFPA 1IWAA 3KUHA 1QE1A 2YX6A 1S6OA 3M1VB 1BLUA 3AVIA 5ETQA 2GWJA 1FA0A 4CD3A 1RT4A 1XMOK 2LEBA 1WWHA 2M7SA 2RB7A 2ASOA 3LDSA 4OPAA 5JVHL 1GLEG 2N82B 2N7CA 4J9UE 2OKQA 4BS2A 4FYYB 4XEIA 1UEVA 4DU4A 1PC4A 3ZETA 5GADU 1ASVA 1SPBP 1N54B 1BU6O 2K1RA 5FPEA 4IH6A 4N8NA 4B17A 5LMNF 1B9DA 4O23A 3I56N 1YT3A 1JLQA 1OIAA 1QY7A 2RAQA 1M1KT 4M8LA 2CJKA 2UXDF 2JZ5A 5AXNA 1YJ7A 1CULA 3MXHP 1R0AB 1VQ5S 3E01B 3LTOA 3SQGB 1HBMA 1KQFB 2W40A 4CZJA 3DGPA 2GTDA 3EKSA 3PYFA 1MWZA 1YSJA 4ES1A 3SUPA 5ADXA 4CLFA 2YNIB 4V19J 4TY8B 4JK9A 3DLKB 2DEIA 4KPYA 2PEBA 4OGEA 2GVZB 1ATSA 2ZUAA 5HROA 3ZXWA 2MLYA 1MWQA 3Q8RB 3H08A 4JI6F 1EQ0A 2QL7B 2GX8A 4X62J 4A48A 3O4QA 4F0MA 1S1XA 1Q8IA 4OZ3A 1Z1ZA 4FZYA 4ZN3A 1RAEB 4G1IA 4I56A 3FMBA 5IS2A 4DL0C 5RUBA 4WP9A 4ERDA 5JICA 4R8UA 2F4VF 4ZPCA 2VOPA 1NKCA 1WC1A 3K5MA 1VAZA 3P49B 3MM6B 2XEXA 4E19A 1S79A 1G3OA 4E0DA 3MCPA 2PFUA 1D09B 5GAEU 1QAJA 4Q0BA 1V9OA 2KJWA 1VRUA 1OWXA 3DU6A 3DLEA 4B1ZA 3CCLN 3FBCA 2XI2A 4I67A 2PA3A 3H4DA 1RT6B 3K57A 3ZTSA 5G0RA 1CJKA 2P5VA 1RTJB 2DNKA 3BEGB 5CQGA 3M9MB 1BQMB 3U3YA 1YLXA 2KZZA 2IVMA 4XK8C 2ZD1A 2FJAB 3ZNJ1 5LSOA 3RRKA 2X1BA 4KHSA 4PR6A 2LYVA 3G2XA 4FBUA 5IC6B 4CFDA 3DMJA 2DFHA 2EFGA 1PIEA 3L2UA 3V2UC 4DV3F 3H6EA 1HARA 4WKYA 3QEWA 1HNXF 2IRYA 3QWUA 4Y65A 5H1SV 1YBUA 5H9FJ 2DTUA 4K5RA 1Y7PA 3CHWA 3TEGA 3FMWA 3C15B 4ILLA 4LSNA 2KHCA 4DR1K 4DU3A 2MZSA 4ILGB 2MJUA 3JAMU 4YOEA 2V34A 1TU0B 2QN6B 1YKWA 2RN2A 4HKQA 1QDUB 3NVMA 1FJGK 4NPOA 1VMBA 1HHTP 3SMSA 5KQ8A 1RT5B 4BDYA 3OL9A 1WG1A 1XUPO 4RW9B 1PCAA 2XO7A 1UA1A 4BBYA 1S1TA 4HH0A 4DR7K 4DR1J 4OYAA 3QJPA 4X4UA 1VSFA 2QTWA 4NLWA 4J9OA 2ACYA 4UY8T 4NYZA 3VALA 4A8MP 4YDUC 4RJVA 1WTBA 2BUPA 4BRCA 3OJUA 1KC8T 3FZFA 2B4JA 3C16B 4DLGA 3EE9A 2WBMA 2UXDJ 3PX6A 1DQAA 4ZPTR 4BLGA 2IBKA 4BC9A 2PEHA 4USHA 2B5JA 4HTIA 1T95A 3PCOB 2N4CA 1PC5A 4EZ9A 4TU8A 2KRRA 4IOAL 3I0RA 2OFGX 1NGGA 3C2PA 1SB6A 4J2EA 4L75A 3CC4S 4YNQA 2E5IA 4X64J 4IOAQ 2IVYA 4K5SA 4B3RF 3M32A 5J2MA 1TVRB 3UO0A 1RBLA 4P52A 4M63C 1U6ZA 2QL9B 4DR5J 2GELA 3E9OA 4UY85 4PG8A 3I87A 2FVCA 2YJFA 2EEYA 1U2FA 2HHUA 1N4LA 3I8DA 4NI2A 1WSFA 3U27A 2GVDA 3R5GA 4GVEA 2DHXA 3VV2B 3IKMA 3FEXB 4YOXA 3TJAA 4BRMA 2KHDA 3DRPA 2DY9A 2OI2A 5JS2A 1T11A 2F4VJ 1L3KA 1NLVA 1A6LA 5J2PB 1DTTB 3PKMA 3TTCA 1QUPA 4TY8A 4CIFA 1I94K 4C6AA 2MXYA 2IVPA 3OYNA 1S0NA 4CO5A 3I33A 3M5RA 1KQKA 3ZT0A 4FWPA 4DV6F 3D6RA 3O9QA 2PMWA 1V3ZA 4CJ7A 3PRDA 3MUVP 3M4XA 5EU7A 2NCKL 4WP3A 1B99A 1U0HB 3R27A 1S10A 3FZBA 2LFVA 3WXIA 4USJC 2IOCA 3B6PA 2HEKA 1NZ8A 4ZTFA 3JS9A 1XMOF 1X31C 1RAIB 3R2DJ 4QOZB 3OYGA 2HZAA 4UUXA 2GUIA 1N6QA 3CSKA 2HIQA 3A13A 4KGXB 3N6LA 4B3TK 2QZ8A 4CHQA 4WU3A 1G99A 2CPZA 4WJBA 4W5NA 3GJQB 1VQNN 2LMIA 4DHVA 4FLXA 4DL4A 3ISND 4OYZA 5I3UA 2FLOA 1B0TA 1N56A 3O6QA 3KJQB 2A2CA 2JFKA 2ZKUA 1HNZJ 2QKKA 3AQPA 4FK2A 2CQ4A 4QS8A 3FSXA 2ZBPA 1C0TB 4GKKK 1FVSA 4QWAA 1Y5IB 4MKBA 3Q89A 2AJ0A 1JL1A 4OVLA 4FPBA 4WF9L 1MU2B 1VQ6N 1TKDA 1O6XA 2XBPA 4DV2F 3LWMA 1I5OB 4QW8A 2RUGA 1YX2A 4WF9Q 4CZCA 3ZSQA 4WCEQ 1TUUA 5GAHP 2RJZA 2V8HA 3VF4A 4XH4A 3BYRA 4QIVA 1ZZNA 2UUBJ 3EVMA 4AXJA 3MN5A 1HBNB 4BG9A 1NWKA 1SH0A 4DQQA 4WQ4A 4USMA 1C0MA 1P1LA 3MAAA 1WOQA 3C15A 2HYIB 2R2TA 3T6BA 3W9JA 4GVLA 2ZZNA 1NDCA 4HYKA 4BRIA 2ITGA 2DK2A 2HNYA 1FX2A 4LFBF 3UD5A 3IMXA 2HBLA 2YI1A 4L3KA 2A5XA 4PQAA 3J81Y 1J6ZA 2RSQA 4BGAA 3OV7A 3RAQA 1M1GA 1KXPA 1VQ4N 2LXIA 4F2SA 2YKAA 4Y34A 5KFGA 1AXQA 4DR5F 4FVMA 4EYHB 2X51A 4CZKA 1T94A 3AV9A 4FCYA 2VODA 1H0HB 3EGZA 2G8IA 1SL1A 3GG1A 3ONQA 1EKEA 4RW8B 5ETNA 2I0XA 4LF9K 2OJ3A 3ITHA 5J1NA 3QWPA 2KJVA 4MTPA 1FKOA 2Z57B 1J27A 1QSSA 4M5MA 4OX8A 4RUBA 1TL4A 5KT5A 3VEVA 5B7WA 4ILHA 4LF2A 3BKUA 3QRQA 2EFQA 4IR9A 2OCEA 1BO5O 3CJBA 3R2CJ 4YOUA 4Z0UA 2Y1JA 4PQUA 4DR6F 4BC3A 4KTZA 2MSTA 1YVNA 4B3TJ 1Q78A 3O5BA 2ZHOA 2BOAA 3SI6A 2O4GA 2HWHA 1GX6A 2J9DA 8ATCB 4DR2F 4B9TA 1KVBA 3CC7N 5I4MA 1LW0B 3EM1A 3DOLA 3PFEA 2EC0A 1CXUA 3ZSYA 4ECYA 3GU0A 3AY9A 4JI3F 2IVNA 3IS9B 4BDZA 2IPOB 5JS1A 3THYA 4C3MA 2CVIA 2FC9A 4H4KA 3DXKA 3OTCA 4XTTA 3IDHA 3THXA 4OX7A 1FXRA 4O3PA 4EBEA 3HHKA 4B8CA 4ZPDA 4DSFA 4KHMA 2XMJA 4GO7X 4E89A 3WNEA 4A61A 3CCVS 1MA9B 4CJWA 3GFZA 1EKRA 3HD2A 1HPMA 3T5LA 1S6QA 2C3MA 2RDIA 2HNYB 3DHWC 1HNZF 2DR5A 1B92A 1U7LA 5M1KA 3BUZB 4P72A 3EUNA 3M9NB 1NJWA 2NLXA 2NPIA 1RDBA 4IJAA 2PD1A 5KTQA 1QUVA 1RCXB 2BA9A 3L3VA 3QETA 4EP5A 1T03B 2E9RX 1O51A 2OPPA 5I3PA 3G9CA 1OYEA 5DZ7A 4DX6A 2JC1A 1RTDA 2DPJA 2QEXS 1Q5VA 1JMTA 3HZ6A 3MX2A 5M2PA 2BKNA 2UUCF 4H0TB 4C2MA 4B9VA 2F96A 3VEOA 3J7YU 3UDLA 2UUBF 4DZDA 4KR0B 3BO4A 1KP6A 4DV7K 4R5PA 5THWA 1RP5A 1WHXA 5KFRA 1N36F 2GMHA 4AQYK 3G8QA 5BPMA 3CG7A 3VOVA 3EO3A 4KHRA 5B0AA 1H72C 5CZXA 4IUFA 4IO8A 2R4FA 4CO2A 2BVZA 4KHYA 1S77D 1JJ2R 2WZ1A 2HPUA 3CXCR 3KHLA 4EZ6A 2Q1NA 2V2ZA 1KKHA 4RO0A 1C4AA 2V9WA 1TTHB 3H8YA 1FE0A 1QZ6A 1VQ4S 3QFPA 2QKBA 2GO9A 1WC4A 3CFPA 1XBWA 2B9WA 5DRKA 1JJ4A 4LFBK 3UKUB 4JI0J 3THVA 3LPTA 1YZ6A 3DRYA 2DH7A 3FC9A 4ZS6A 2AYEA 1EX8A 2RRAA 4CGJA 4WQ5A 2AGOA 4KFBA 2PI5A 3VEWA 5IV4A 4DR6J 1ASWA 1IO2A 1QE1B 2J76E 3D0HE 2ZFHA 1D8YA 1KRPA 2RS8A 1Q4RA 3HKZD 2HSEB 5KFQA 4JEPA 3NRBA 2XNQA 3ZZPA 4PYDA 2DO0A 2XMKA 3ENQA 1OYDA 1RHRB 3AA3A 2EK6A 3ET6B 2HQIA 3G6YA 4JI3J 1WHWA 5C24B 2CJXB 4LVNP 4P10A 3NBPB 1QVFR 2DTJA 2BJ3A 2M5YA 2GVDB 3GMGA 2DO4A 4H5VA 3O9UA 4Q44A 3CPWR 1K8AT 2R8JA 2FZCB 1RHJB 4ZIVA 2GGPA 1LKZA 1NBWA 1PILA 3FDSA 4PQUB 3SLCA 4AD6A 2QC3A 4CQ1A 4BQLA 2H54B 4G1QA 4MLEA 3CJ0A 2YQ1A 3CJKA 1DTQB 3UN2A 3OSPA 1IWGA 1UVLA 4DTNA 3IR6B 4QS9A 2FGCA 1B9FA 2OMLA 1Z2ZA 3ATUA 3OTDA 1F3FA 3ISZA 1EJ7L 3EX7B 1GMWA 5EY4A 3V6KA 3I4HX 4O3QA 3DM2B 1N33J 2RKIB 3DRRA 3HPHA 1KLNA 1BIZA 2QK9A 3J81O 2FSJA 4F3MA 4FOEA 2PBDA 4DV3K 4O3RA 3DU5A 1U1KA 1IBMK 1OVYA 4JHDA 5AQUA 3K0SA 1YZ7A 1VK8A 2DGXA 2VG5A 3A5OC 1BL3A 3L9ZA 4CIEA 3E1YA 3TSUA 2KXHA 1YITS 2WONA 4G6VB 1DZ5A 1Q86O 1RYSA 4GMKA 3I4PA 3EE8A 3VWSA 1W25A 1SH2A 3IA0A 4P7VA 2M88A 3TAMA 1U1NA 2A6OA 4PRFA 1S6QB 3R7NB 2BJ1A 2V63A 1S49A 3BO2A 1HW8A 2DXEA 2P9PA 4L76A 3VEXA 1WF2A 1VQON 1RAGB 3R97A 3ZX2A 3PW7A 5E3CA 1HMVA 2DJWA 3V6DA 3THWA 4C8MA 3W9IA 1HQEB 4NZ7A 5AQJA 2F8EX 3LDNA 4M5DB 1NKEA 2XHBA 4AE5A 4ZPWR 3SQ0A 1NNEA 2BR0A 5D8HB 3CIPA 3GP9A 2YHYA 1L3UA 3CUNA 2PSZA 4I64A 5KFYA 1LWCB 4RW7A 3KK2A 2ZEJA 3K58A 2KL8A 4PHTX 3HSJA 4U8YA 2PIIA 4RNHA 2XM3A 1CEZA 3HM8A 1HNWK 2ASJA 4JK7A 2F40A 5M2UA 4JI5J 4OX9K 2AEJA 4DR6K 2D5RA 3LP1B 2LQ5A 3GYGA 4IRKA 4OL8A 5KFOA 4CZMA 2AT1B 3KLGB 1IKWA 3GV7B 5L39A 1U1PA 1BUPA 3DOMB 3QBCA 3RRGA 2XLJA 2IDEA 4RWTA 2WOMA 5AFUA 3LP2B 2KFNA 4FSVA 5B0BA 4FPAA 2GJ2A 3UD4P 2P9NB 2IM0A 2G1HA 3ZZZA 2AYBA 3D3BJ 3SUNA 4M5JA 3NDKA 3PY8A 4KHPK 3PO5A 2VPWB 3GCXP 1HKAA 4WXWA 1BWEA 2V8VA 1NHKL 4LRBA 1AUDA 1RWKB 4CK3A 2G8KA 2V69A 3CW2C 2HNDB 4LR9A 1UP1A 4OO1J 5E3AA 4CHOA 4WZMA 4HVZA 2XLKA 3CJSA 3QFWA 4XDDA 4DS5A 1BDGA 1KTQA 4QIWD 3NNCA 4FNIA 4NLUA 4J2BA 2ZZTA 2HQ3A 1VJWA 2J6UA 5L9XA 3UNYA 2NR0A 3CWJA 3PFOA 2M4MA 5CHCB 2FJWA 3ID8A 3QAEA 4OJ3A 3LAMA 1T3NA 3RU0A 3GR1A 1WDTA 3NFAA 1ICEB 3AGRA 4IOBA 2VPXB 1N33F 1JLCB 2F65A 3R5DA 2NXNA 4TN2A 4U7BA 2IHR1 1J2VA 4DUYJ 3VGTA 3ZSXA 4E7LA 3AVBA 5EOYA 1GOBA 1T02A 1LV5A 3NGZA 2GV1A 3ULHA 2WBRA 3ZSRA 2QW9A 4U6PA 2XYPB 2UUWA 3BEXA 3D6FB 3W8PA 1A5XA 4OMFG 3M1VA 5DO2A 2E6MA 4JI0K 3U8XA 2K3IA 3J7YP 1XMBA 4D3HA 3QINA 4MMOA 4W90B 4NX9A 3BBCA 4HUFA 3HT0A 5KFBA 3AARA 1YGYA 4J9NA 1GLJO 5HANA 1S57A 4MK9A 1ITGA 4CFBA 5KG7A 3RB3A 4YP3A 5T41A 2HLTA 3GFYA 4AL6A 1T03A 4ZCMA 3AVCA 2Q66A 2K1RB 2HFSA 1V3SA 3ZTQA 3D2WA 2RHKA 4CO0A 1BQMA 2VFTA 4NLGA 1XI1A 4JI8K 1URRA 4IFEA 2XGPA 3VMFB 2W4CA 2B9YA 3SCKE 4NLBA 1V4SA 3A4TA 3TWZA 1N5QA 2KT3A 1FXLA 1DQ8A 3CMES 2W8LA 3MAAB 2IS3A 2CQIA 4OLBA 1X3MA 4ID5A 5LJVA 3DLKA 2NUBA 5GAEI 2WFBA 3CJKB 1RHUB 1H7XA 4DPUA 5GAGI 3VZIA 1M90T 4XH5A 1I1GA 3OYMA 4X4RA 4ZLLA 4H03B 5GIPA 3K5PA 4G9ZA 4K50A 3SMZA 4CJLA 2PA8D 1NO8A 4C1NI 4KGKA 4FJMA 2MQPA 3SQ1A 3WQUA 2P9KA 3MWPA 3N0VA 1UWAA 2NSBA 1TUGB 3NNAA 3HHEA 2VH7A 3PW2A 4FJ5A 1LW2A 4IFVA 4A8WA 2WVFA 3F5TA 1F2GA 2QWMA 5TKYA 2RT3A 4HI2A 1ZAVA 1I6JA 1MROA 2HWTA 2QJ3A 3CYMA 1R0BG 2M70A 3CO9A 2B56A 3RSEB 2K3KA 2V8DA 3SI8A 4NLDA 2KT2A 4CZIA 3EVWA 1RBOB 3BZQA 3H90A 3M6XA 4DV4F 3W3SA 3D2EB 2GJFA 2BQ3A 1C0GA 1IBCB 5EUHA 4ALZA 3HXMA 1CZBA 2CH5A 4OYBA 4AF1A 4RW6A 3P5TL 3H25A 2C2DA 3LGHA 4ECRA 4CZFA 4CYUB 3C8YA 2IC3B 3EPIA 4QS7A 2QA4N 1VQ8S 4JKGB 2OPSB 4KJIA 5CCLA 1UVNA 4C3KA 3J81U 1QQNA 2D0OA 2E8AA 2XYHB 3HD1A 4ZVUB 3T1YF 1MDUB 4EAHD 4DX8H 2H3EB 1TUVA 3TAEA 3E9PA 4H5NA 1X4GA 3Q7BA 2WSCC 3MX5A 1YG0A 1NK6A 5IQ6A 5EX0A 2F7VA 3K7RA 1WUAA 4HHTA 4PEOA 5AQMA 2HVZA 4G1QB 3EGVA 5EHHA 2HVHA 3KLVA 1E6YB 2HBZB 1Y5NB 4LFAJ 4KT0C 4J2DA 2I6WA 3ZZTA 4DL6A 3E2EA 2OTJN 1ZTWA 2VWKA 4WQ4C 2MKKA 1KLMB 2RQKA 2PY5A 4KHQA 3TWHA 2R42A 4JV0A 3QMLA 3FLCO 1E4FT 4DTOA 3W7BA 5L1LA 2L9DA 3H5YA 3O44A 3GSDA 1ESVA 3ZEUA 3VF6A 4FWQA 1YRTA 1VSKA 3FE1A 2FTRA 1RDDA 2WTUA 1YJVA 4DR3F 4DL7A 1DQ9A 2QWPA 3VAGA 5F8MA 5DZ6A 3T19A 4G65A 4O5BA 4DX7A 4JS5A 4PZVA 1RTZA 1FRJA 4HDGA 5D6GA 2XTJP 2OFHX 4FF3A 1Q81T 3PYGA 4O4GB 3R5AA 4M5HA 4DS4A 2JC0A 3MR3A 1YI2S 3GCWP 4L73A 1RNHA 4OLOA 4KTWA 3KHHA 3IP0A 3HK2A 2M0GB 3CC2S 1Q79A 3C6UB 2MZTA 3K89A 3VCDA 3HBTA 4ED0A 5AT1B 2IDLA 4KYZA 4F4WA 4W98A 1H3DA 3QMQA 2C3YA 2Y1LB 1ZPVA 5C2FA 1C4CA 4A5AA 2NZTA 5HBMA 4JKDA 1Q86T 3F41A 3NY0A 3OJSA 2CQBA 3CJAA 1XN9A 3OW2R 4H0VB 2C2KB 2WSEC 1Q8KA 5JUMA 4YR2A 3TQ1A 1DARA 5KI6A 2GEMA 4RBUA 3Q8QB 4DV6K 2FBTA 5I9EB 5CA5A 4EP4A 3NAIA 2AGQA 1YWXA 4DV4J 1JXEA 1VFJA 1WI6A 4JLHA 3L7UA 2V5HG 3CD7A 2D3ZA 4LF6F 4BWMA 4USVA 3KD5E 3EMTA 2AP6A 3MCOA 1VQPN 2ZBQA 1KQSM 3OVSA 4FZXC 2ZH4A 2DHHA 1MMNA 5MAOA 5IXUA 4KHPJ 3DAWA 1X4BA 1CLFA 3GOIA 2YWGA 4KH6A 2ZHBA 2J0WA 3AAWB 2J7UA 1NKBA 2ZD1B 4F3OA 3ZSOA 1NOZA 2E2OA 4RU2A 2CAJA 3ZO7A 1E3MA 3IBCB 5LMNJ 3T1YJ 3IC1A 4WFNL 5BRHA 1FNOA 1FO1A 3NCIA 4OJ1A 3D4JA 3DXMB 1VQPS 1FRLA 3DHXA 3KWMA 5U47A 1QSYA 5F8GA 3K9JA 3B4DA 1YJUA 1SJRA 1M5OC 2DR6A 2E4LA 1K8AO 1AROP 2J7KA 3KUGA 4N8OA 1IQTA 4DSIA 2A6AA 1Q1KA 3SNNA 1OO0B 4LFAF 2XYGB 3LP1A 1VRQC 1K73T 1NDKA 3DRSB 3PG9A 3GONA 1HYSA 1RDRA 2RU9A 4CLZA 2B3TB 4RW4B 1SQKA 2NRWA 1NOYA 4FNHA 1UTAA 2DIUA 3FJ2A 4JI6J 4JD2B 2WRMA 4U96A 5D77A 3GZ7A 2XC9A 2PMHA 3NGYA 3ELHA 1QZ5A 1P9QC 1JLAA 1SC1B 4GKKF 2NRTA 2AJ1A 1QQOA 1KVAA 4ER8A 4J91A 3CC2N 3UNGC 4O3OA 5DM7Q 3D1HA 4JRPA 1UJ4A 1RBUA 2H5JB 3Q83A 3MEKA 2XZDB 2QTDA 2V2VA 2ATQA 2P9SB 4MLHA 2GHVC 2QGFB 1FEEA 3MPUB 3JTPA 1MROB 2QMXA 4IFYA 3UB5A 3QRRA 1V3RA 2P6SA 1E6YA 2R3VA 1EX4A 5F3TA 1NH7A 5K8PA 3HVAA 1XMQF 1MMLA 4TYBA 2YWHA 4CEEA 2DCUB 3R6LB 2HHHK 2OA8A 2MKCA 4LQ9A 4Y3CA 2V94A 1RDWX 3J8AA 1IN0A 1U2VA 4FM1A 5C42B 2HFUA 1UJ6A 2AWZA 2R7VA 4LIWA 1W7WA 4JV2A 2H3GX 4YR0A 1YF5L 2VUGA 3RBZA 1BA0A 4EEYA 2R7QA 4UZBA 4FJ9A 2D0CA 1R8HA 4MKAA 2Q36A 6FDRA 4CJTA 1K9MO 2ZNYA 1YTYA 4N5SA 4BR7A 2VF3A 2QWOA 4C8YA 3KHYA 3R1LA 5FRNA 2GS8A 2CPYA 1IR1A 3BN4A 5L38A 1IG9A 5EXWA 2AJ2A 1NMNA 2B9XA 3I0RB 4OYIA 2IIRA 4QAGA 4LF6J 3AO2A 2CWXA 2J8SA 1IBKK 2Q6BA 5DG9A 4A8FA 2HVIA 1J5OA 1JX4A 4P7TA 4YOYA 1EKSA 4TLRA 4CBXA 4OV1A 3KTQA 3C6UA 2R8HA 1ELOA 1F1BB 1TL1B 4DPYA 3HF5A 2OO4A 1RYRA 1HFEL 2FPHX 4CJVA 4DR1F 4ELUA 3TVKA 2K06A 3OXFA 2ZNZA 2AKWB 4DU1A 1T9YA 3G8TA 3VA3A 3KKSA 4WPAA 1Q9YA 2HWIA 2DY4A 3MMAA 2P9IB 3PEHA 2MEWA 2K7KA 3D7SB 3C6TB 3P96A 2FDNA 3J7YI 1HRHA 4CNYA 1DT9A 2YNGA 1RQ0A 2ASLA 1RTIA 1VSIA 3CCVN 1J9AA 2BACA 1NNDA 4BVPA 3W64A 1HLWA 5DETA 3D2EA 1Y97A 3BPSP 5BXIA 2YNHB 4B3RK 3O3LA 5GVQA 3WXLA 5AQIA 1K1QA 3IO1A 2GAHC 5IM0A 3T1HJ 3KWGA 1NG9A 4KO0B 2R7WA 3PKYA 5CZVA 2MQMA 4X64F 2FLNA 3QGHA 2O8DA 1VR6A 2YX4A 3TTDA 1GMVA 2JL9A 4EHTA 1U24A 4KHUA 2FLPA 4ZKAA 5FROA 1YRUA 3VQ9A 2VQEK 4QR1A 1YJ9S 4MYUA 2LXFA 2CG8A 1JJCB 2EPIA 2E29A 3CD6S 3D5MA 3NHGA 3FGUA 3CPWM 4U7UD 2IJFA 2L3MA 3NBPA 3BSAA 3WX8A 3QNOA 4FLZA 3SK3A 4DV1K 2B4PA 1NAQA 3CDEA 4I7FA 1RTIB 1JLGB 1QJHA 2YJEA 4ED8A 2GQCA 1HYVA 2P2CB 2GFFA 2X74A 4JYAK 4K0KK 4UTGA 3GJTB 1IKYA 3TR5A 2AGPA 2BDPA 4EWTA 1XMQJ 2IM3A 1V4TA 1RUSA 2CWKA 4C1NK 3A5NC 1NDPA 3CMEN 1S7HA 5IOLA 3ZT1A 5KT3A 4DV6J 4CEQA 5ELZA 4FYWB 4DPXA 3E51A 2DRDA 1HQEA 3H2UB 1GLLO 4DV0J 5JXSA 4JI2J 5A8KA 1U1RA 1KAXA 1N32K 3RB0A 3KJVB 3VAKA 4ZMMA 3CCRS 1CXQA 2QI2A 4CVNE 3AH6A 5B09A 4FF4A 1XMOJ 4KGVB 5CD4H 4C8LA 1VQMN 3M6VA 3KLIA 4IO9Q 1U09A 1PYTA 5K8MA 3Q8UA 2DNQA 4F67A 4WQ5C 3VQ7A 1HBNA 4QPTA 5LXRA 4I68A 3P3DA 5LMUK 3EDQB 3FZHA 2XMAA 1WAJA 4Y1DA 2B5JB 2AP1A 3QT6A 5HO4A 5J1EA 2EVZA 4CK1A 4CH0S 1WG4A 3P31A 2LVWA 1YQHA 4P74A 3T7ZA 1JQGA 3ADAC 4JKHA 1N5YA 4B02A 1EB0A 3OLAA 3SJJA 3QGPA 2FHJA 4DSJA 3BQ1A 2UXCK 4OZ1A 2CPDA 3PYDA 2D0BA 3I55S 4YDDB 4JD2A 3MECA 2W4PA 2LEAA 4XPCA 3AA9A 3OQ2A 4FVCA 5AQNA 4X66K 3O3HA 3MR7A 5CYQB 1FT8A 3QBXA 1PBUA 1S1WA 2F5GA 5EX5A 5FDLA 3VQTA 3CCQN 4PXCA 3CMAS 3OUYA 5D0EA 5L9NA 3MTJA 1C0UB 2I7PA 1LFPA 3MEGA 3CIZA 4ZVGA 4GW6A 2DGVA 1LXJA 3JAMO 1F6TA 1Y4ZB 2LDYA 4KFBB 4R0EA 5K5MA 4DQIA 7FD1A 5IFMA 3HFKA 4LFBJ 2YKNA 3CMAN 1A0OB 2FYXA 1KC8O 4A8KA 4DX5A 2HQDA 1M5PC 4ZVHA 3LPYA 3ZFVA 2FVPA 2O1PA 4RNFA 1B3TA 1NJXA 2JX2A 3VA0A 1JLCA 1WTFA 5KFMA 3TRGA 2BYCA 3B54A 1NJZA 4ICLA 1U1MA 2NXCA 3O1BA 2JLFA 2QA4G 3DDNA 3VF0B 3K59A 4DPTA 4NB4A 1HKCA 1C1CA 3PO4A 5AE1A 1RE1B 2VCPA 2Z4PA 2ASPA 1WACA 1FEHA 4PABA 2ZUGA 3D3CJ 2Q43A 3WXMB 3MEGB 1FNXH 3P83D 1OY6A 3AVFA 3M30B 2VWBA 4CF8A 1Q0NA 4RU9A 3OS1A 3WC2A 1NK5A 4JI1K 1OS5A 4WBFA 4EO6A 2QT7A 2HAFA 1DHMA 2IYGA 2L08A 4B3TF 4GO5X 1VQMS 1FKPB 1OSCA 1SI9A 1ZBSA 4BDPA 3SAHA 3CFOA 4AHVA 1VSJA 3D6TB 4OZ0A 4DR2J 3CT9A 1FXXA 3AVAA 3N6MA 5B0FA 2A10A 3MHYA 3GG0A 4OZNA 2KG1A 2U2FA 5ETOA 4H4KC 4IQMA 1ZM9A 2B0GA 3SEOA 1HQ2A 4J90A 4TSXA 1H2UX 1BY9A 2VGNA 3MECB 3K9KA 1Q8LA 3NS5A 4K42A 3NOCA 3P1GA 4F0HA 3AAPA 4W4MA 1JB0C 2ZDOA 3AY0A 3MMVA 4PL8A 4BRGA 4FWOA 1HA1A 4X4TA 4CJRA 2NRZA 1UETA 2MZ1A 2IAJA 4RLEA 2EXUA 2KYZA 4K43A 2IY5B 5HOOA 3G6EN 3EZUA 3GR0A 4CO4A 1S6UA 1YUWA 5K8NA 2FHJD 3GTYX 3IWXA 4X64K 2EC2A 4PUOA 2RHQB 3MEDA 3UR3C 3UDVA 3WNHA 2GIQA 4TVAB 1T6DA 2KQ2A 2HK2A 4ZIWA 1ZAWA 3VQBA 1HNWF 2MYFA 1EXQA 3OYIA 4LF5J 4I6MA 5GMEA 3W61A 3UW1A 2HGLA 2Q0RA 2G1DA 2P9KB 5AQQA 4CJ4A 3IBFB 3H20A 3I32A 1NGDA 3Q8YA 4F3TA 1RAOA 3US5A 5HQMA 4HCBA 5E3RA 3KD1E 2Z2YB 1S59A 2OYQA 2UUCJ 2QLJB 1Y9OA 4CJEA 4JRQA 3QZ8A 4DTUA 2IVFB 4ZVSB 1S3XA 2IGIA 1N36J 1GTEA 4OI6A 5LSRA 2H1YA 4MT1A 2VONA 4MH8A 3OHAA 2FQQB 4BGBA 2CJBA 3VN5A 4L6V3 4Z37A 3HSDA 4FWRA 2CQ1A 1S9GB 1EHWA 4ECQA 1S1UB 2VPYB 2OPQB 3GE9A 2D9PA 4LF9J 4LR8A 1KD1O 1QLNA 2A1RA 3QEIA 2C22A 4B9UA 3DXSX 2ZH7A 2IDOA 3GIMA 2F7TA 3U7JA 1BC6A 2HF4A 3OTEA 4OPHA 1F2HA 3J7Z5 5C24A 1RTHA 1M5VC 5DDQC 3R9PA 1X5PA 5AQXA 2K7JA 4WE1A 2E2NA 3D28A 4JI0F 5F8IA 3V81A 1JXLA 3S3NA 1YHQN 4MAKA 1OSDA 4NZ6A 4EFAC 3CETA 3DGPB 3TZXA 2BJ8A 4WYLA 5J2QB 1UW4A 4B1XB 1HUXA 1SJ3P 4C9DA 4WFBL 2HW3A 1FFSB 5I3UB 2Z30B 1FNMA 2UYTA 2AV5A 1CC7A 1UOCA 4QWBA 1BQNA 3T5KA 3NGDA 5KGWA 1ZOTA 1FJEB 2GWKA 1WOPA 3IBWA 4I9LA 3SBGA 1FFWB 3UWTA 2JJ4D 1OJ4A 4OX6A 2CNLB 1UVJA 5LMUF 2JGUA 4LF7F 2E66A 1IKXA 2BJ7A 2R2RA 4FPIA 1IVZA 2PYLA 1GQEA 4USKA 8RUCA 2L41A 5IT9O 1FRKA 4FPRA 2E44A 2B43A 4NYNA 3JSBA 4DKWA 3SUOA 2AW0A 3UR0A 3C14B 2FSNA 4FJHA 3DLHA 5ETSA 3VPZA 2CJAA 2BJ9A 1MWYA 2R8KA 3VENA 1MN9A 2L9WA 3ILOA 3Q86A 1RDAA 2ITMA 2YNFA 3BDEA 2PO4A 3MCNA 4NLSA 4O44A 1LWEB 2HZCA 4RWWA 2XWYA 1HNWJ 1Y11A 4CZEA 5K20B 2JDJA 1P9YA 5DLGA 2RIJA 3QT8A 1KNZA 2QEXN 1U0HA 3HHLB 4ZPAA 5KAKA 3ET6A 1B64A 2NS1B 1TKXB 1M90O 3DC2A 4URSA 2QXFA 3ZX0A 4I2PA 2ZH1A 1SBRA 1UPMB 2PGCA 4DR2K 2UVWA 3S3MA 4OI4A 1IKVA 4F4ZA 4OZ2A 4JAXA 2FJBB 3UCGA 3RBXA 3H1QA 5ETPA 2UXCJ 4YY3F 2KU7A 3V1OA 2GGPB 3KMQA 3MXMA 2VL1A 4WFXA 4NMXA 2HK3A 2Y8YA 1S22A 1JXVA 3M30A 2O8EB 4LSNB 4CF9A 3S7RA 1VJQA 2BRLA 4F50A 4Q0BB 4AM6A 1TL3B 4RUCA 3T5JA 1Z4UA 4M7YA 4CLPA 2YH1A 4LF9F 3VQ5A 3CQXA 4HACA 1FVQA 2JEFA 2C3UA 2DHAA 5IZHA 2J0XA 3FFKB 1S1TB 5C42A 3B8HA 2ILZA 2GUPA 1EETB 3U6FA 3DXBA 4B9MA 3Q7CA 4WIIA 3G25A 3CJ2A 2J9CA 1I3AA 1S9EB 1FE4A 4DL5A 4X62K 4IDKB 5F41A 1VQ7N 4EFHA 4NXNK 2CVEA 2XO6A 2KM8B 3VGLA 4JV5J 4CJFA 2XY5A 4ID8A 3THTA 3MR5A 1CJTA 5F9NA 2LECA 4M3RA 2P5GA 1RAHB 4JI5F 2UXDK 4DN9A 3QQCD 2E2PA 2BJDA 2G2OA 4RZRA 1CBKA 4BR4A 4V19S 5KOWA 1T05A 2HQGA 4J9RA 4AHSA 4QIFA 3DCAA 3PIOQ 5KGXA 3SCXA 2UP1A 3WT0A 1OH6A 4M1KA 1AUSL 5HVFA 4BR0A 3DI6A 4JI4K 3PHTA 2V8GA 4O3SA 2IIHA 4GVBA 3TZZA 2AEFA 2VGMA 3A8KA 2BBEA 1RHQB 2HHVA 4YOWA 1WBBA 1FRIA 4Z4FA 2MZRA 1REGX 2EFNA 4CIOA 1CJTB 1KHVA 4FJNA 4Y00A 3L0QA 1KFDA 1CULB 1FD2A 3H4BA 3MAHA 3JQMA 4FJLA 3SQGA 5CAAA 3OXLA 3WC0A 1UFLA 1JJ2M 4DF4A 2LSNA 3SZ2A 5A0YB 4J8FA 5L8RC 4A47A 2VASA 2HBJA 4J9SA 2H5IB 4IEEA 1S9GA 3PJ9A 1NGFA 3RB4A 2ZHAA 3HHLC 1OH5A 2YWWA 2BUNA 3MF5A 1RDCA 1ZBIA 2AEMA 4BR5A 1UMJA 3VQPA 4CGGA 4N47A 3CQ8A 1V5IB 4DUYF 3HRGA 4M5DA 1GLCG 1ZXOA 4LF1A 1QVGR 4A8YA 2MGZB 4WK1A 3OSNA 1NSQA 2C2EA 3O5TB 2UXCF 3UVJA 1K0TA 5HQLA 5E3PA 2KT5A 3QSIA 1I94F 5GADP 1HWJA 3RR8A 3J7A1 1JWWA 2P6TA 4ISGA 1HJRA 1NK9A 4LF6K 1N48A 1U8SA 4HI1A 4WFZA 4C11B 4YN3B 5ADXH 2RE1A 1Y3KA 2UUTA 3VVUA 3LGNA 1RKIA 2XSJA 2ASYA 1BWVA 4FS2A 5KG3A 1KFSA 1HD1A 1REVB 2DNNA 2FY8A 4DV0K 2OPSA 3DRRB 2GA7A 4NASA 5A8KB 4KQZA 4DPWA 1T7PA 2ZJPQ 5KRTA 4HH1A 3M6WA 3KK1B 4DWIA 4I69A 1U26A 2MHEA 2WK4A 4I6AA 3ALYA 1M5HA 1CC8A 5J2NA 1LFWA 1JK9B 4MJKA 3H5XA 1IR2A 5AQTA 4CZGA 3L6QA 2YKOA 1NEEA 3A3OB 2UV8G 3J7ZO 1NGJA 1HNIA 4L74A 3SJHA 1N52B 2HQCA 4BREA 2H9ZA 5E0OA 3SSQA 2ZZMA 4CZHA 1SXLA 3PYEA 5M1OA 2VZ9A 5AZIA 2D9OA 3MMCA 2XS2A 3TI0A 2FHMA 4ZCIA 4K7QA 3CCMS 3G71S 2W9CA 1KTVA 1WEZA 1EP4A 4QWDA 4NLCA 1OKJA 1QSLA 3FNNA 3HHLD 3RMDA 3DFEA 1WEXA 4X4NA 2RKIA 4OFZA 4BRLA 3NNHA 3BF4A 3PUFA 3V4IA 3KJNB 1Y0HA 3NOGA 4K4UA 2H4WB 1X5OA 4CNZA 4LD0A 1N8RO 1U0SA 3MEEA 3UI3A 1DTTA 4H54A 3CI5A 1C2PA 2CZVC 2P9LA 5AQYA 1RU2A 3NVKA 2UUAK 2WONB 4HT5A 2O8FA 4IOCQ 3E66A 2QLXA 4HT7A 4DQSA 1EARA 4TU7A 1AZSB 1PYSB 1WNEA 3KNAA 1VHIA 2WB4A 4P73A 5M1NA 1CQNA 3NCRA 4FOIA 4DR4K 3O8WA 1RILA 4CHNA 3NGKA 1NXIA 2A42A 3UQSA 5L1IA 2MJNA 3C46A 5CE3A 4M45A 2BQUA 3SV3A 2XZWA 2EHGA 2VJUA 3V1QA 3BQ0A 3C66A 5F0WA 1ZH5A 2NUHA 1VDHA 3CQYA 1CLQA 4PXDA 2DGTA 3OYHA 3P45B 3Q8SB 4U67Q 3GBTA 4E98A 3NWGA 4TXSA 5CYJA 4BE0A 2BW7A 5J2PA 4IFYB 3T3FA 3KLEB 1RWNB 5SWMA 1IV0A 3PW0A 3JSMA 4DN0A 3PHEA 4LVOP 2B8PA 3MMCB 2W6KA 2FY1A 3L95X 1S1VB 2CUYA 1VRTA 4I6MB 3M8ZA 3GV5B 2QIFA 4ECZA 4JKGA 4ETXA 4OLPA 2ZH6A 3NMAA 3SSSA 3GIJA 5KG0A 2P9NA 1SJFA 1XTZA 4FLUA 4Q45A 4H4MA 1X0FA 4JYAJ 4IDHA 3CJ3A 3MD1A 2WBNA 2OPRA 5MLCV 2XNRA 2X6NA 3CD5A 1XNQK 2RRBA 4OLAA 4DR3J 2IMWP 1UWBA 4DMNA 3CDWA 5KFDA 1LOUA 4P71A 4RUHA 4DV1J 4CLTA 3LPUA 2FJDB 4FKXA 2CJQA 4PKDB 2HFZA 3M8RA 1UKUA 4QOTA 2B4UA 4OHYA 3AOBA 3CB4A 2I7NA 4NLRA 5D78A 1TK8A 1X3NA 3BSNA 3LWLA 1LK7A 3TX8A 4JI4J 5AQRA 3HULA 3D2FA 3KKRA 5LJ3Y 1VLOA 4Z4GA 1JLEA 4AL7A 1SV5A 5GAHI 3OFHA 1REVA 2O67A 3G71N 3OYJA 3S3OA 1RJJA 3R7SB 5AQSA 4LUBA 2E5JA 4J7CA 1JXBA 1VK3A 1RT7B 5KFSA 2X3DA 5B08A 2HIYA 4YEAA 4AHCA 4C0HA 3DGVA 4JKEA 1U1LA 3ENAA 4E7KA 3G82B 2WVBA 1CZAN 1HKGA 2C2RA 2P9IA 4DTSA 4JHDB 2XB2D 3HI9A 1WC0A 3OVNA 4LF8K 1CZ9A 4JV5K 2KVIA 5LXYA 4DF8A 3VQSA 4PKGA 2LEPA 4X66F 1ZA2B 3CCWA 2ZOFA 2CQCA 4AM7A 4B3OB 4K4WA 4KBIA 1RBVA 3H2VE 4NRUA 1IH7A 2FD2A 2DFEA 2P9UA 1RLCL 1EWQA 1TKTB 3RMAA 1U1OA 1H7WA 2WTFA 1QQMA 1YJRA 2ZBRA 1D3WA 1BIUA 1G2EA 4RW4A 3C3LA 1VRTB 4CF1A 2DY1A 1TGOA 3UPFA 4KHPF 4FLWA 5KPZA 3KLHB 3V4MA 3QICA 1S4FA 3BSCA 4JI7J 4YOTA 3VZHA 2UUAF 2AJ4A 2V4JB 4NCGB 3BF3A 5DS7A 2D3UA 4BRAA 3U1MA 2QFIA 4EBCA 4ANEA 4I9QA 2CDRB 3FQKA 3UIQA 3IM8A 3AOCA 1DAXA 1UWBB 3TUIC 4Q5VA 3D0IE 3C19A 3C6AA 1H1VA 2LXUA 4FJIA 2PMZD 4BROA 5EN1A 1WJ9A 4GKJK 3TU5A 3UD3P 1HLUA 2VPZB 2ZOMA 2HMPA 5AZIB 2Y1RI 5T7BA 3I9V9 2JWNA 2A0FB 3KOAA 1YJTA 3HHLA 3FBFA 1Q7YO 3DM2A 1K1SA 2ZVIA 3IWNC 3DOLB 2HHHJ 4RBTA 1Z05A 3EKUA 4GKKJ 5KFVA 2ZKTA 5E7OB 2YX7A 3TVZA 1T9XA 3LOUA 5D3GB 4CEZA 2YKPA 1PG5B 4FWKA 3TYTA 4CHYA 3HPOA 3RB6A 2HRUA 2ACMA 5HBMB 3TUPA 2UXBJ 1DURA 3ZZRA 2IFXA 3TUZC 4Y2MA 5E84A 2UV8A 2QV6A 3LDOA 2IJNA 5B0EA 3JS6A 4WFNQ 5HN0A 1FW6A 2CNKB 3NGSA 4DR4F 3PV8A 4IJNA 4WXOA 2F3JA 1S76D 3MUMP 4HACB 1F0XA 5CD4A 5E5NA 1LWEA 3NS6A 1N5YB 1Z2LA 5JMVA 3X1LB 1N8RT 1R3NA 4M63A 3QO9A 5BN8A 1BGXT 2ZM6F 2Q6CA 1MU2A 3GG4A 3QNWB 5JJBA 1HJOA 4EO8A 4YB6A 4YB5A 4TY9A 1DJ0A 4J9QA 1TAUA 3TEHB 4DOZA 4M5KA 3HTVA 3WXKA 2BTFA 3D54A 2KYXA 2LCWA 2HAIA 3K2YA 3V9XA 1EQMA 3AO4A 3CCEN 3H59A 3CJ4A 4IXCA 4A2BA 3TPQA 1VIXA 5DDOC 2X6SA 1L5UA 4CJSA 4ITSA 4Y2KA 3K5LA 4J9VA 1FD8A 2EI5A 3BH6B 3AA8A 1TFWA 5ITHA 1M5KC 1KLMA 1HMVB 5BREA 2ZOGA 2GC8A 2ROPA 2FJVA 1S0MA 4CLLA 2AYGA 1XNQF 4NE9C 4CWBA 4LH5A 2OTJS 1GLAG 3M8SA 3AD7C 5FLXU 4FXVA 2VDHA 5J2NB 2NUUG 3HSTB 1BWFO 3QIPB 2BH1A 1D9AA 1DLOB 1YJWN 2V52B 2UUCK 4XO0A 2R2UA 4A57A 1TL7B 2HVEA 1XQSC 1SL2A 1RWUA 2B9EA 5A8WB 2FC8A 2NLWA 3T1HF 4O44B 1CVJA 1D0EA 1SJ4P 4RW6B 5F1XA 3R5BA 2CPJA 2JEIA 1CPZA 4E7JA 1VQ9N 2IC3A 3P6YC 3M8PB 1G15A 2HHHF 2XWXA 2Z1HA 2U1AA 3MI7X 4CCHA 2H48B 3PJWA 5C2DA 4KRFA 3A8IA 1FJGJ 3AO5A 1A9NB 4A5BA 2G8WA 2DH9A 1W2BR 1S97A 3D66A 3KLIB 2UXBF 3MFIA 5KFTA 3NH0A 2BOPA 3NP5A 3LH2S 2OHDA 1FCAA 5L1KA 3MUTP 4BRKA 3K17A 2PYJA 2CPFA 3BBBA 5HJXA 5C25A 4OX9J 2XCPA 1KVJA 2D4WA 5AR0A 4NLVA 1YXQA 2DHSA 3BO3A 4ECXA 3A5LC 4PWUA 1ASUA 2YPZA 1NGAA 1ZETA 4USTA 2V4RA 2H51B 3D0GE 3VERA 3HM9A 1Y3JA 2J8AA 4DV0F 1U45A 1C0TA 1IQZA 2J6TA 3FEYB 4JI2F 1VGYA 4F25A 1TKZA 2AF6A 2RF2A 2GX9A 2ZM6J 2R7YA 5F3ZA 3MM5A 3PRBA 4OYMA 3LGMA 4M95A 2GV9A 1NJYA 4I6WA 1NPRA 4BY9C 1RT3B 1QTMA 2FF6A 2E20A 5M2RA 3K8WA 3KK2B 1J5EK 3H40A 1SC4B 4K8XA 2Z1IA 1RWXB 3M8QB 4OKJA 3KK3B 4BWJA 1K73O 4CGIA 1S6PB 2CNNB 3CF5L 1RGVA 3T69A 1C1BA 4LSLA 4C8OA 3AFGA 3M8WA 4FWSA 3R3TA 5KFIA 2VG6B 2BANB 1FWLA 4NXMK 3HOTA 2VQEF 4XDCA 4NL5A 2W9CB 4C48A 1HR0K 5J1PA 3SPYA 3LDLA 4OHXA 4KO0A 3JTOA 3NF7A 4O0JA 1QM9A 3CCMN 3EN9A 5AQKA 2AA4A 5CR4A 1O0PA 3EXCX 3ENHA 2P8IA 4ED1A 5GADI 3EZ5A 4IG3A 3KVGA 4AH9A 5HJYA 2CRLA 4Z7YA 3KFWX 2BGGA 2E7VA 3UDEA 3ULEB 4F36A 3BR8A 1Q82T 4FF1A 4CEBA 2BE7D 4IKAA 3MXJA 4WP8A 4JI5K 2RDDA 2YWFA 2HURA 2WW4A 3DRPB 9RUBA 3VQQA 1VQSA 2ETJA 1BQXA 4U67L 3OYCA 4CEFA 2C42A 4IO9L 3W2VA 5HQ8A 1LK5A 3VGKA 4CHZA 3ZYYX 2EKYA 4KI4A 2FXUA 4M7XA 3SV4A 4LFAK 2AMCB 1JLEB 2ZH3A 3FKBA 1WOOA 2QG9B 2N3LA 1X7VA 2RMLA 2HGNA 1YRXA 1VI7A 1WSIA 3WEEA 2VQFF 2KN4A 1BOTO 3SFGA 3WX4A 3TOQA 2VU5A 4OZJA 1IJFB 1T3OA 3C16A 1PJ7A 3EY1A 1RWOB 3PM9A 1WHYA 4FJKA 2F4FA 2KDOA 4WFBQ 4LREA 1S5JA 3LW5C 4P2SA 3CCQS 1TQLA 2FC0A 2W25A 3JQKA 2FBXA 5HSPA 2RE2A 4DSLA 4DR5K 3LA0A 2B6AA 1TL5A 1RBAA 3UCUP 1XHZA 1U6BA 3TX0A 1OH7A 4LSLB 2XSJB 2A40A 2GJIA 2HHXA 5KT6A 3MMJA 1RT2A 1FJCA 3AVLA 3N6NA 5EVZA 3BGFA 2UXBK 5C2CA 1K44A 5GAGU 4CHPA 4FYVB 4MQ3A 4DLEA 5D3GA 2M9KA 3N4QA 2G0JA 4MIBA 1HI1A 2PI4A 4IG0B 3KDNA 3UKUA 3F0NA 3CCTA 2DCLA 3OT9A 2VBXA 2BW2A 2G9OA 5BPLA 2VG5B 5AFUH 3OLBA 4PPZA 2IBOA 2DYAA 2DGOA 1X4DA 3ASMA 2HBQB 4FYDA 4RBVA 1PJ6A 1FK9B 5HP1A 3MGJA 4LC9B 2GO8A 1CJVA 4AXIA 1PAEX 5GMKa 4IQXA 4O55A 4UOGA 5I42B 2LKZA 3SCIE 1YAGA 3W2VB 3AA2A 4CJPA 1Y10A 2VQEJ 4A8XA 2YKNB 2ZWHA 4PXBA 1X5SA 1RTJA 1EIYB 3KG1A 4LF5F 1HI0P 1F60B 2O8BA 4WFYA 1T9VA 2DISA 4CZLA 5ETMA 4L8RB 5AZJB 3VAHA 3T1HK 3MM9A 4CGDA 1FWPA 2YCHA 4LJMA 4F2RA 3G82A 4L72B 3OTOJ 3JYTB 2A6MA 3MPYA 4JI7K 4QQBA 2HF3A 3ZSVA 3C14A 2DRAA 1F5CA 5CY4A 2HBKA 1UFKA 2O66A 2V2QA 3ISNC 2EWSA 4DMZA 1YBTA 1VQNS 2Q1LA 4KB1A 5H1SQ 4DCOB 3A0IX 4UY8O 3OHBA 1C1BB 4U7CA 5DG8A 4H0PA 2KRBA 1DY3A 3R5JB 3K5OA 2NQPA 3MPVA 3DLJA 4QW9A 3NL0A 2HFNA 3SYZA 4BE1A 5FD1A 4K59A 2DNPA 1KONA 5F0XA 4IWVA 2M2BA 2E5LF 4FYXB 1ZBFA 2V2KA 5BJRA 4PKHA 2AX1A 1JL2A 2VQFJ 2EFVA 3HVRA 1TMMA 3IR7B 4X65K 4IRDA 3MFHA 3NGTA 3DOKA 2KHOA 1Z25A 4KAZA 2HBYB 2HRYA 3MPDA 4QWEA 4EBDA 1K47A 2DPIA 1P8ZA 3O9SA 4DUYK 1R7IA 4MO5A 1SJQA 4ZCKA 4FS1A 5JLHA 2PT0A 4EIAA 3CIMA 3AD8C 1PSDA 1M1KO 1Y5LB 4MFBB 1H2TZ 2R2SA 1GXTA 2YWEA 3HSZA 1L3TA 4CEOA 4DTPA 1ZPWX 5HMYA 2CQGA 1VOMA 2B4VA 2PFFB 3C6HA 5G4DA 1TK0A 1RISA 1TVRA 3V6DB 3THWB 4KH0B 2V6AA 1K9MT 4BRHA 2XULA 2ZQBA 2VFRA 4B9NA 1P27B 4DDFA 5LMUJ 1VCTA 3CM5A 4CI6A 4A8OA 4LF7J 1NU0A 4ZJLA 3H46O 2PC6A 3MD3A 1AB8A 2FGOA 4CO3A 3M9OB 4NXMF 3Q8PB 1AFJA 1QVGM 4EK2A 5AQZA 3ZTPA 2P9SA 3ZZYA 4Q43A 4FN5A 2H65B 5KFNA 3G6VA 2YHXA 5GMDA 2LQ8A 3EVOA 1U25A 4BRPA 4FVUA 3VAIA 5KFPA 3GE1A 3LAKA 4BG8A 3OL7A 4DG1B 1GMUA 3RG6A 1D5AA 1WDDA 3CJ1A 1VQLS 4IKFA 2XY8A 1KDNA 1L3SA 2PAVA 1MN7A 3UN3A 3AAQA 4ELTA 3CDUA 4Y28C 2FHOB 3CDAA 3R9LA 1SL0A 3H7HB 3E3XA 4FK4A 1KQSR 1FDBA 5DG7A 1ZYQA 3H3OB 3MAQA 3M2RB 4TQRA 1X4FA 3D6HB 5A2QY 4N76A 3QESA 2O8CA 1XHXA 1KR4A 4IG0A 1KHWA 3OYKA 3IXQA 3QEXA 1QAIA 2C2MB 4FWNA 1X9JA 2LP4A 1DKGD 3B78A 4E1NA 4YY3J 2ADBA 4WZQA 1B0VA 1OQ6A 4DTJA 3QT7A 3BP8A 2NPFA 4FXDA 4B9QA 3IUCA 1URNA 4AHUA 1JKHA 1N5SA 4J9LA 4F4XA 3ICLA 3MM6A 1YTAA 4IRCA 2QLWA 5I42A 2DGUA 5B0DA 3QIOA 1U4BA 3FR0A 4CO1A 3PX4A 4NMLA 1B70B 5HATA 5KFJA 3KG0A 3SCJE 1M1HA 2G4BA 2MQ8A 3A1YG 5E2QA 4FWMA 2B7BB 2KFZA 1IR0A 3V6JA 5KPTA 2XMVA 3LP2A 3ZETB 2YX1A 4LRDA 4QIGA 1MG7A 4CP5A 1TELA 4NEZA 3D7EO 4IOXA 1NM1A 3TQEA 2FVQA 4FLYA 2Q3SA 4ZA1A 4M3TA 4JV5F 1IBLK 2BEFA 3PR5B 4R5PB 3WDOA 4JB8B 1ZBHA 2PFDA 5AXLA 5IWAJ 1Y64A 1T44A 3POTB 3QDKA 2Z8QA 4FJJA 3J80O 2O5DA 4G1PA 2MKJA 3K2PA 4DJBA 1CJVB 1VSDA 3CCES 3MN9A 2OPQA 4QYRA 3O1LA 5A0YA 4O0NA 4K4VA 4ZVFA 5J2MB 4FKYA 3KHGA 4ZOSA 2GNKA 4QU6A 2G2YA 1OVQA 4Y2AA 1BISA 3TA0A 4CFAA 2VKZG 3LALA 4EMDA 5ETVA 3I82A 3CNQP 2ROGA 4DCHA 1QAYA 2CPXA 3RUBL 2C1EB 3W62A 5K14A 5CYMA 1HIYA 3R6GB 5ETTA 4ZP6A 2CYYA 2HHWA 3OYEA 2IRUA 1WC5A 1KOHA 1UPPA 2MLXA 5F8LA 2G8FA 4UQGA 4WIQA 4NA3A 2ZJPL 3N01A 4RNNA 2E1CA 2UUBK 1WOSA 5D4OA 3S6EA 3W1YC 4EYIB 2EW9A 4GKJF 4BQZA 2UVRA 3Q2SC 5FLXY 2R7UA 3VESA 3I56S 4CTAB 1X5TA 1NCLA 4LQ3A 4JOUA 2I2YA 5T7LB 3DOMA 2BQRA 1ZC6A 1EP4B 3R1XA 4DQPA 2JEJA 1UW9A 2J6SA 4H5TA 4MKVA 3FSYA 2ZH9A 4CF0A 4LFCJ 5CYMB 2DNYA 4JK8A